F495240

General Info

Members Datasets Scaffolds Average Seq Length
1659 477 1659 37

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0532054|Ga0501031_0532054_389_526
Length 45
Sequence VSNGEEATVKVRPSVKKMCEKCKVIRRHGRVMVICENPRHKQRQG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
69 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
70 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300023563 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
170 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
193 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
194 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
195 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
231 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
232 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
235 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
236 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
237 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
248 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
249 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
250 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
251 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
252 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
253 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
254 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
255 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
256 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
260 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
266 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
267 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
277 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
282 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
291 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
296 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
300 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
301 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
309 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
310 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
311 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
312 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
316 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
321 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
344 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
345 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
346 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
400 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
409 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
410 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
411 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
416 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
417 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
418 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
419 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
420 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
421 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
422 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
423 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
424 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
425 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
426 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
427 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
428 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
429 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
430 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
431 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
432 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
433 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
434 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
435 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
436 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
437 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
438 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
439 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
440 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
441 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
442 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
443 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.37
Metatranscriptomes 6.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 9.1
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10088500 3300001979 Bacteria 801
2 JGI24739J22299_10031467 3300001989 Bacteria 1834
3 JGI24743J22301_10003930 3300001991 Bacteria 2382
4 JGI24034J26672_10111582 3300002239 Bacteria 523
5 JGI24742J22300_10084749 3300002244 Bacteria 602
6 Ga0070672_100077749 3300005543 Bacteria 2654
7 Ga0070672_100285086 3300005543 Bacteria 1397
8 Ga0070672_101719617 3300005543 Bacteria 563
9 Ga0070665_100413394 3300005548 Bacteria 1357
10 Ga0070665_100846569 3300005548 Bacteria 928
11 Ga0070665_101737175 3300005548 Bacteria 631
12 Ga0070665_101976051 3300005548 Bacteria 589
13 Ga0068855_100076941 3300005563 Bacteria 3871
14 Ga0068855_100506750 3300005563 Bacteria 1311
15 Ga0070664_100454133 3300005564 Bacteria 1177
16 Ga0070664_101174041 3300005564 Bacteria 724
17 Ga0070664_102355143 3300005564 Bacteria 505
18 Ga0068857_100784790 3300005577 Bacteria 909
19 Ga0068857_101640012 3300005577 Bacteria 628
20 Ga0068857_101896030 3300005577 Bacteria 584
21 Ga0068854_101100243 3300005578 Bacteria 708
22 Ga0068856_100013028 3300005614 Bacteria 8052
23 Ga0068856_100316577 3300005614 Bacteria 1578
24 Ga0068856_100799382 3300005614 Bacteria 963
25 Ga0068852_100532843 3300005616 Bacteria 1173
26 Ga0068852_100557502 3300005616 Bacteria 1147
27 Ga0068852_101304543 3300005616 Bacteria 748
28 Ga0068852_101935721 3300005616 Bacteria 612
29 Ga0068859_100265412 3300005617 Bacteria 1809
30 Ga0068859_100281232 3300005617 Bacteria 1757
31 Ga0068859_101144341 3300005617 Bacteria 856
32 Ga0068864_102225948 3300005618 Bacteria 555
33 Ga0068866_10181190 3300005718 Bacteria 1244
34 Ga0068866_11047144 3300005718 Bacteria 582
35 Ga0068861_100029137 3300005719 Bacteria 4035
36 Ga0068861_100095522 3300005719 Bacteria 2354
37 Ga0068861_101112896 3300005719 Bacteria 760
38 Ga0068861_102158249 3300005719 Bacteria 557
39 Ga0068851_10919395 3300005834 Bacteria 549
40 Ga0068870_10438218 3300005840 Bacteria 859
41 Ga0068863_100280593 3300005841 Bacteria 1614
42 Ga0068863_100520763 3300005841 Bacteria 1172
43 Ga0068858_100115807 3300005842 Bacteria 2505
44 Ga0068858_100163432 3300005842 Bacteria 2097
45 Ga0068858_100508925 3300005842 Bacteria 1164
46 Ga0068860_100302134 3300005843 Bacteria 1568
47 Ga0068860_101005631 3300005843 Bacteria 852
48 Ga0068860_102183039 3300005843 Bacteria 575
49 Ga0068862_101511440 3300005844 Bacteria 677
50 Ga0068862_102021608 3300005844 Bacteria 587
51 Ga0081455_10001246 3300005937 Bacteria 31840
52 Ga0081455_10002789 3300005937 Bacteria 20567
53 Ga0081455_10010819 3300005937 Bacteria 9218
54 Ga0081455_10034606 3300005937 Bacteria 4524
55 Ga0081455_10091499 3300005937 Bacteria 2463
56 Ga0081455_10109721 3300005937 Bacteria 2195
57 Ga0081455_10166672 3300005937 Bacteria 1682
58 Ga0081455_10186765 3300005937 Bacteria 1565
59 Ga0081455_10353276 3300005937 Bacteria 1036
60 Ga0081455_10395919 3300005937 Bacteria 960
61 Ga0081455_10420127 3300005937 Bacteria 922
62 Ga0081538_10013338 3300005981 Bacteria 6513
63 Ga0081538_10020236 3300005981 Bacteria 4911
64 Ga0081538_10022376 3300005981 Bacteria 4580
65 Ga0081538_10284407 3300005981 Bacteria 613
66 Ga0081538_10380426 3300005981 Bacteria 509
67 Ga0081540_1010298 3300005983 Bacteria 6343
68 Ga0081540_1026069 3300005983 Bacteria 3347
69 Ga0081539_10005544 3300005985 Bacteria 12794
70 Ga0081539_10019869 3300005985 Bacteria 4574
71 Ga0081539_10167367 3300005985 Bacteria 1042
72 Ga0070717_10045783 3300006028 Bacteria 3577
73 Ga0070717_10071813 3300006028 Bacteria 2889
74 Ga0075365_10009834 3300006038 Bacteria 5531
75 Ga0075365_10099254 3300006038 Bacteria 1992
76 Ga0075365_10689443 3300006038 Bacteria 722
77 Ga0075365_10850673 3300006038 Bacteria 643
78 Ga0075363_100037884 3300006048 Bacteria 2533
79 Ga0075363_100062659 3300006048 Bacteria 2006
80 Ga0075363_100070977 3300006048 Bacteria 1892
81 Ga0075364_10140568 3300006051 Bacteria 1624
82 Ga0075364_10308562 3300006051 Bacteria 1077
83 Ga0075364_10348061 3300006051 Bacteria 1010
84 Ga0075364_10439350 3300006051 Bacteria 891
85 Ga0075364_10457672 3300006051 Bacteria 872
86 Ga0075364_10605252 3300006051 Bacteria 749
87 Ga0075364_10716238 3300006051 Bacteria 683
88 Ga0075364_10809075 3300006051 Bacteria 639
89 Ga0070715_10391394 3300006163 Bacteria 770
90 Ga0070716_100008236 3300006173 Bacteria 5166
91 Ga0070716_100608593 3300006173 Bacteria 823
92 Ga0070716_101201297 3300006173 Bacteria 609
93 Ga0070712_101126663 3300006175 Bacteria 681
94 Ga0070712_101753041 3300006175 Bacteria 544
95 Ga0075362_10017162 3300006177 Bacteria 2978
96 Ga0075362_10652031 3300006177 Bacteria 547
97 Ga0075362_10699387 3300006177 Bacteria 529
98 Ga0075362_10730319 3300006177 Bacteria 518
99 Ga0075367_10043865 3300006178 Bacteria 2619
100 Ga0075369_10160324 3300006186 Bacteria 1031
101 Ga0075366_10737784 3300006195 Bacteria 612
102 Ga0097621_100434981 3300006237 Bacteria 1180
103 Ga0097621_101543602 3300006237 Bacteria 631
104 Ga0097621_101758789 3300006237 Bacteria 591
105 Ga0075370_10155106 3300006353 Bacteria 1342
106 Ga0075370_10235499 3300006353 Bacteria 1084
107 Ga0075370_10618420 3300006353 Bacteria 657
108 Ga0075370_10620402 3300006353 Bacteria 656
109 Ga0068871_100033556 3300006358 Bacteria 4066
110 Ga0068871_101024643 3300006358 Bacteria 769
111 Ga0068871_101406169 3300006358 Bacteria 658
112 Ga0068871_101792492 3300006358 Bacteria 583
113 Ga0068871_102233006 3300006358 Bacteria 522
114 Ga0075428_100007971 3300006844 Bacteria 11750
115 Ga0075428_100299180 3300006844 Bacteria 1730
116 Ga0075428_100348046 3300006844 Bacteria 1591
117 Ga0075428_100418077 3300006844 Bacteria 1436
118 Ga0075428_100585101 3300006844 Bacteria 1192
119 Ga0075428_101219956 3300006844 Bacteria 792
120 Ga0075428_101251041 3300006844 Bacteria 781
121 Ga0075428_101734366 3300006844 Bacteria 651
122 Ga0075430_100004496 3300006846 Bacteria 11750
123 Ga0075430_100007366 3300006846 Bacteria 9295
124 Ga0075430_100032919 3300006846 Bacteria 4400
125 Ga0075430_100068857 3300006846 Bacteria 2969
126 Ga0075430_100484609 3300006846 Bacteria 1020
127 Ga0075430_100501729 3300006846 Bacteria 1001
128 Ga0075430_100557959 3300006846 Bacteria 945
129 Ga0075430_100802196 3300006846 Bacteria 776
130 Ga0075430_101562441 3300006846 Bacteria 542
131 Ga0075431_100014487 3300006847 Bacteria 7977
132 Ga0075431_100020636 3300006847 Bacteria 6733
133 Ga0075431_100078548 3300006847 Bacteria 3406
134 Ga0075431_100106185 3300006847 Bacteria 2897
135 Ga0075431_100120241 3300006847 Bacteria 2710
136 Ga0075431_100170754 3300006847 Bacteria 2234
137 Ga0075431_101155274 3300006847 Bacteria 738
138 Ga0075431_101258460 3300006847 Bacteria 701
139 Ga0075431_101705543 3300006847 Bacteria 587
140 Ga0075433_10002059 3300006852 Bacteria 15203
141 Ga0075434_100023641 3300006871 Bacteria 5993
142 Ga0075434_100043618 3300006871 Bacteria 4448
143 Ga0075434_100211572 3300006871 Bacteria 1959
144 Ga0075429_100001166 3300006880 Bacteria 21212
145 Ga0075429_100004700 3300006880 Bacteria 11750
146 Ga0075429_100044520 3300006880 Bacteria 3860
147 Ga0075429_100060587 3300006880 Bacteria 3296
148 Ga0075429_100110304 3300006880 Bacteria 2405
149 Ga0075429_100473292 3300006880 Bacteria 1098
150 Ga0068865_100035387 3300006881 Bacteria 3357
151 Ga0075436_101009698 3300006914 Bacteria 625
152 Ga0097620_100281232 3300006931 Bacteria 1757
153 Ga0097620_101144284 3300006931 Bacteria 856
154 Ga0075435_100005458 3300007076 Bacteria 8883
155 Ga0075435_100039831 3300007076 Bacteria 3751
156 Ga0075435_100049942 3300007076 Bacteria 3365
157 Ga0075435_100609975 3300007076 Bacteria 947
158 Ga0075435_101022430 3300007076 Bacteria 722
159 Ga0099794_10799147 3300007265 Bacteria 505
160 Ga0099795_10052413 3300007788 Bacteria 1490
161 Ga0105240_10007000 3300009093 Bacteria 16465
162 Ga0105240_10993896 3300009093 Bacteria 898
163 Ga0105240_11583436 3300009093 Bacteria 686
164 Ga0111539_10093408 3300009094 Bacteria 3534
165 Ga0111539_10195175 3300009094 Bacteria 2361
166 Ga0111539_10226930 3300009094 Bacteria 2175
167 Ga0111539_10231016 3300009094 Bacteria 2154
168 Ga0111539_10430352 3300009094 Bacteria 1537
169 Ga0111539_10619321 3300009094 Bacteria 1260
170 Ga0111539_11571081 3300009094 Bacteria 763
171 Ga0111539_12236980 3300009094 Bacteria 634
172 Ga0111539_12460724 3300009094 Bacteria 604
173 Ga0111539_13121769 3300009094 Bacteria 534
174 Ga0105245_10082473 3300009098 Bacteria 2941
175 Ga0105245_10150945 3300009098 Bacteria 2197
176 Ga0105245_10310475 3300009098 Bacteria 1550
177 Ga0105245_10634456 3300009098 Bacteria 1097
178 Ga0105245_11131502 3300009098 Bacteria 830
179 Ga0105245_12731064 3300009098 Bacteria 547
180 Ga0105247_10048269 3300009101 Bacteria 2615
181 Ga0105247_11526677 3300009101 Bacteria 546
182 Ga0114129_10006513 3300009147 Bacteria 16568
183 Ga0114129_10013234 3300009147 Bacteria 11750
184 Ga0114129_10025778 3300009147 Bacteria 8327
185 Ga0114129_10082965 3300009147 Bacteria 4453
186 Ga0114129_10099332 3300009147 Bacteria 4029
187 Ga0114129_10223211 3300009147 Bacteria 2541
188 Ga0114129_10271883 3300009147 Bacteria 2267
189 Ga0114129_10513014 3300009147 Bacteria 1564
190 Ga0114129_12002090 3300009147 Bacteria 700
191 Ga0114129_12244772 3300009147 Bacteria 656
192 Ga0105243_10062864 3300009148 Bacteria 2973
193 Ga0105243_10249739 3300009148 Bacteria 1583
194 Ga0105243_10342869 3300009148 Bacteria 1369
195 Ga0105243_10607862 3300009148 Bacteria 1054
196 Ga0105243_10817676 3300009148 Bacteria 920
197 Ga0105243_11149645 3300009148 Bacteria 787
198 Ga0105243_11687061 3300009148 Bacteria 662
199 Ga0105243_12172790 3300009148 Bacteria 591
200 Ga0105243_12222467 3300009148 Bacteria 585
201 Ga0105243_12437966 3300009148 Bacteria 562
202 Ga0105241_10371461 3300009174 Bacteria 1247
203 Ga0105241_10415780 3300009174 Bacteria 1182
204 Ga0105242_10012654 3300009176 Bacteria 6497
205 Ga0105242_10574368 3300009176 Bacteria 1085
206 Ga0105242_10777121 3300009176 Bacteria 945
207 Ga0105242_10780773 3300009176 Bacteria 943
208 Ga0105242_12039619 3300009176 Bacteria 616
209 Ga0105248_10053697 3300009177 Bacteria 4520
210 Ga0105248_10416602 3300009177 Bacteria 1513
211 Ga0105248_10863729 3300009177 Bacteria 1021
212 Ga0105248_11632957 3300009177 Bacteria 730
213 Ga0105238_11275836 3300009551 Bacteria 760
214 Ga0105249_10345397 3300009553 Bacteria 1506
215 Ga0105249_10411099 3300009553 Bacteria 1385
216 Ga0105249_11439393 3300009553 Bacteria 761
217 Ga0105249_12202232 3300009553 Bacteria 624
218 Ga0105249_12605481 3300009553 Bacteria 578
219 Ga0105033_109861 3300009986 Bacteria 838
220 Ga0105239_10013170 3300010375 Bacteria 9189
221 Ga0105239_10368183 3300010375 Bacteria 1624
222 Ga0105239_11198401 3300010375 Bacteria 875
223 Ga0105239_11495136 3300010375 Bacteria 780
224 Ga0105239_11744039 3300010375 Bacteria 721
225 Ga0105239_12247135 3300010375 Bacteria 634
226 Ga0105246_10314827 3300011119 Bacteria 1269
227 Ga0105246_12198978 3300011119 Bacteria 537
228 Ga0157321_1040388 3300012487 Bacteria 511
229 Ga0157345_1053613 3300012498 Bacteria 519
230 Ga0157342_1032142 3300012507 Bacteria 666
231 Ga0157373_10972599 3300013100 Bacteria 632
232 Ga0157370_11230718 3300013104 Bacteria 675
233 Ga0157369_10483634 3300013105 Bacteria 1281
234 Ga0157374_10019227 3300013296 Bacteria 6044
235 Ga0157374_11240886 3300013296 Bacteria 767
236 Ga0157374_12107769 3300013296 Bacteria 591
237 Ga0157378_10440646 3300013297 Bacteria 1291
238 Ga0163162_10037304 3300013306 Bacteria 4850
239 Ga0163162_10339309 3300013306 Bacteria 1635
240 Ga0163162_11549487 3300013306 Bacteria 755
241 Ga0163162_11645319 3300013306 Bacteria 733
242 Ga0163162_11873619 3300013306 Bacteria 686
243 Ga0163162_12848947 3300013306 Bacteria 557
244 Ga0163162_13121806 3300013306 Bacteria 532
245 Ga0157372_10130298 3300013307 Bacteria 2893
246 Ga0157372_10190207 3300013307 Bacteria 2377
247 Ga0157372_11354252 3300013307 Bacteria 821
248 Ga0157375_10105922 3300013308 Bacteria 2903
249 Ga0157375_10619490 3300013308 Bacteria 1240
250 Ga0157375_10840701 3300013308 Bacteria 1065
251 Ga0157375_11264445 3300013308 Bacteria 867
252 Ga0163163_10057795 3300014325 Bacteria 3836
253 Ga0163163_10110359 3300014325 Bacteria 2779
254 Ga0163163_10953490 3300014325 Bacteria 921
255 Ga0163163_11024680 3300014325 Bacteria 889
256 Ga0163163_11147473 3300014325 Bacteria 840
257 Ga0157380_10212948 3300014326 Bacteria 1723
258 Ga0157380_10748408 3300014326 Bacteria 988
259 Ga0157380_11298625 3300014326 Bacteria 775
260 Ga0157380_11733596 3300014326 Bacteria 683
261 Ga0157380_12096932 3300014326 Bacteria 628
262 Ga0157377_10520683 3300014745 Bacteria 835
263 Ga0157377_10901522 3300014745 Bacteria 661
264 Ga0157379_10032947 3300014968 Bacteria 4620
265 Ga0157379_10294062 3300014968 Bacteria 1479
266 Ga0157376_10666059 3300014969 Bacteria 1043
267 Ga0157376_11026965 3300014969 Unclassified 848
268 Ga0157376_11219620 3300014969 Bacteria 781
269 Ga0157376_12398880 3300014969 Bacteria 567
270 Ga0163161_10373585 3300017792 Bacteria 1138
271 Ga0163161_12092319 3300017792 Bacteria 503
272 Ga0197907_10258355 3300020069 Bacteria 3502
273 Ga0197907_10620110 3300020069 Bacteria 1696
274 Ga0197907_11085200 3300020069 Bacteria 649
275 Ga0197907_11115412 3300020069 Bacteria 941
276 Ga0206356_10270551 3300020070 Bacteria 1114
277 Ga0206356_11234993 3300020070 Bacteria 1338
278 Ga0206356_11556085 3300020070 Bacteria 1053
279 Ga0206356_11743183 3300020070 Bacteria 551
280 Ga0206349_1666946 3300020075 Bacteria 1584
281 Ga0206355_1218665 3300020076 Bacteria 843
282 Ga0206355_1249527 3300020076 Bacteria 508
283 Ga0206355_1555461 3300020076 Bacteria 687
284 Ga0206355_1569372 3300020076 Bacteria 519
285 Ga0206351_10470750 3300020077 Bacteria 630
286 Ga0206352_10027235 3300020078 Bacteria 552
287 Ga0206352_10918135 3300020078 Bacteria 1203
288 Ga0206352_11023359 3300020078 Bacteria 560
289 Ga0206350_10805923 3300020080 Bacteria 916
290 Ga0206350_11515923 3300020080 Bacteria 559
291 Ga0206354_10307830 3300020081 Bacteria 502
292 Ga0206354_11486946 3300020081 Bacteria 578
293 Ga0206353_11237824 3300020082 Bacteria 719
294 Ga0206353_11793639 3300020082 Bacteria 754
295 Ga0206353_11882423 3300020082 Bacteria 781
296 Ga0154015_1210807 3300020610 Bacteria 902
297 Ga0213873_10066290 3300021358 Bacteria 987
298 Ga0213874_10087910 3300021377 Bacteria 1017
299 Ga0213874_10135052 3300021377 Bacteria 850
300 Ga0213874_10205100 3300021377 Bacteria 711
301 Ga0213876_10034422 3300021384 Bacteria 2671
302 Ga0213876_10083012 3300021384 Bacteria 1695
303 Ga0213876_10102352 3300021384 Bacteria 1518
304 Ga0213876_10421279 3300021384 Bacteria 710
305 Ga0213876_10596061 3300021384 Bacteria 588
306 Ga0213876_10729183 3300021384 Bacteria 527
307 Ga0213871_10017971 3300021441 Bacteria 1724
308 Ga0224712_10019428 3300022467 Bacteria 2291
309 Ga0224712_10625034 3300022467 Bacteria 527
310 Ga0224712_10653806 3300022467 Bacteria 515
311 Ga0247530_115070 3300023563 Bacteria 569
312 Ga0207642_10002029 3300025899 Bacteria 6246
313 Ga0207710_10362921 3300025900 Bacteria 739
314 Ga0207688_10181428 3300025901 Bacteria 1255
315 Ga0207688_10576728 3300025901 Bacteria 708
316 Ga0207685_10209073 3300025905 Bacteria 921
317 Ga0207699_10044166 3300025906 Bacteria 2593
318 Ga0207645_10350571 3300025907 Bacteria 988
319 Ga0207643_10224329 3300025908 Bacteria 1151
320 Ga0207705_10009427 3300025909 Bacteria 7100
321 Ga0207684_10070149 3300025910 Bacteria 2978
322 Ga0207684_10185008 3300025910 Bacteria 1796
323 Ga0207684_10342453 3300025910 Bacteria 1287
324 Ga0207684_10726960 3300025910 Bacteria 842
325 Ga0207654_10247971 3300025911 Bacteria 1192
326 Ga0207707_10135393 3300025912 Bacteria 2154
327 Ga0207707_11070003 3300025912 Bacteria 659
328 Ga0207695_10034632 3300025913 Bacteria 5488
329 Ga0207693_10017254 3300025915 Bacteria 5757
330 Ga0207693_10371873 3300025915 Bacteria 1118
331 Ga0207663_10002584 3300025916 Bacteria 8710
332 Ga0207663_10027394 3300025916 Bacteria 3321
333 Ga0207663_11081200 3300025916 Bacteria 644
334 Ga0207660_10660205 3300025917 Bacteria 853
335 Ga0207662_10015067 3300025918 Bacteria 4345
336 Ga0207662_10125506 3300025918 Bacteria 1614
337 Ga0207662_10740294 3300025918 Bacteria 691
338 Ga0207662_10812670 3300025918 Unclassified 659
339 Ga0207649_10491792 3300025920 Bacteria 932
340 Ga0207652_10221802 3300025921 Bacteria 1704
341 Ga0207646_10011554 3300025922 Bacteria 8539
342 Ga0207646_10093958 3300025922 Bacteria 2686
343 Ga0207646_10228538 3300025922 Bacteria 1681
344 Ga0207646_10264694 3300025922 Bacteria 1554
345 Ga0207646_11018016 3300025922 Bacteria 731
346 Ga0207681_10033390 3300025923 Bacteria 3374
347 Ga0207659_10790057 3300025926 Bacteria 815
348 Ga0207659_11350763 3300025926 Bacteria 611
349 Ga0207687_10136748 3300025927 Bacteria 1854
350 Ga0207687_10356844 3300025927 Bacteria 1192
351 Ga0207687_10901415 3300025927 Bacteria 757
352 Ga0207700_10041454 3300025928 Bacteria 3368
353 Ga0207700_10074224 3300025928 Bacteria 2630
354 Ga0207700_10671889 3300025928 Bacteria 924
355 Ga0207700_10850108 3300025928 Bacteria 816
356 Ga0207664_10026076 3300025929 Bacteria 4413
357 Ga0207664_10047208 3300025929 Bacteria 3382
358 Ga0207664_10365484 3300025929 Bacteria 1279
359 Ga0207664_10858743 3300025929 Bacteria 816
360 Ga0207690_10889131 3300025932 Bacteria 738
361 Ga0207706_10040831 3300025933 Bacteria 4113
362 Ga0207706_10258344 3300025933 Bacteria 1521
363 Ga0207706_10460204 3300025933 Bacteria 1100
364 Ga0207706_10971320 3300025933 Bacteria 715
365 Ga0207706_11108725 3300025933 Bacteria 661
366 Ga0207706_11308674 3300025933 Bacteria 599
367 Ga0207686_10011426 3300025934 Bacteria 4862
368 Ga0207686_10044161 3300025934 Bacteria 2735
369 Ga0207686_10424916 3300025934 Bacteria 1017
370 Ga0207686_10489881 3300025934 Bacteria 952
371 Ga0207686_10759341 3300025934 Bacteria 775
372 Ga0207709_10063111 3300025935 Bacteria 2321
373 Ga0207709_10639696 3300025935 Bacteria 846
374 Ga0207709_10882745 3300025935 Bacteria 726
375 Ga0207709_10999538 3300025935 Bacteria 684
376 Ga0207709_11611611 3300025935 Bacteria 539
377 Ga0207709_11668052 3300025935 Bacteria 530
378 Ga0207670_11228146 3300025936 Bacteria 635
379 Ga0207670_11299459 3300025936 Bacteria 617
380 Ga0207669_10057949 3300025937 Bacteria 2361
381 Ga0207669_10197025 3300025937 Bacteria 1459
382 Ga0207669_10210501 3300025937 Bacteria 1419
383 Ga0207669_11759566 3300025937 Bacteria 529
384 Ga0207704_11190189 3300025938 Bacteria 649
385 Ga0207665_10015265 3300025939 Bacteria 5044
386 Ga0207665_10929373 3300025939 Bacteria 691
387 Ga0207691_10100228 3300025940 Bacteria 2585
388 Ga0207691_10121532 3300025940 Bacteria 2314
389 Ga0207691_10313760 3300025940 Bacteria 1345
390 Ga0207691_10578467 3300025940 Bacteria 951
391 Ga0207691_11137882 3300025940 Bacteria 648
392 Ga0207711_10388235 3300025941 Bacteria 1296
393 Ga0207689_10193029 3300025942 Bacteria 1680
394 Ga0207689_10267765 3300025942 Bacteria 1414
395 Ga0207689_10489762 3300025942 Bacteria 1030
396 Ga0207661_11087398 3300025944 Bacteria 736
397 Ga0207661_12017330 3300025944 Bacteria 523
398 Ga0207679_10113478 3300025945 Bacteria 2144
399 Ga0207679_11333049 3300025945 Bacteria 659
400 Ga0207667_10187688 3300025949 Bacteria 2122
401 Ga0207651_11105192 3300025960 Bacteria 711
402 Ga0207651_11885429 3300025960 Bacteria 538
403 Ga0207712_10111301 3300025961 Bacteria 2054
404 Ga0207712_11324168 3300025961 Bacteria 644
405 Ga0207712_11548078 3300025961 Bacteria 594
406 Ga0207668_10980043 3300025972 Bacteria 755
407 Ga0207668_11348190 3300025972 Bacteria 643
408 Ga0207640_10254812 3300025981 Bacteria 1364
409 Ga0207640_10991987 3300025981 Bacteria 738
410 Ga0207658_10564923 3300025986 Bacteria 1019
411 Ga0207658_10632092 3300025986 Bacteria 964
412 Ga0207658_11372343 3300025986 Bacteria 646
413 Ga0207677_10054605 3300026023 Bacteria 2727
414 Ga0207677_10585281 3300026023 Bacteria 977
415 Ga0207677_10669944 3300026023 Bacteria 917
416 Ga0207703_10063898 3300026035 Bacteria 3019
417 Ga0207703_10127047 3300026035 Bacteria 2197
418 Ga0207703_10327840 3300026035 Bacteria 1404
419 Ga0207703_11025894 3300026035 Bacteria 792
420 Ga0207703_11187853 3300026035 Bacteria 733
421 Ga0207703_11768936 3300026035 Bacteria 594
422 Ga0207678_10134622 3300026067 Bacteria 2109
423 Ga0207708_10037086 3300026075 Bacteria 3713
424 Ga0207708_10081745 3300026075 Bacteria 2483
425 Ga0207708_10324981 3300026075 Bacteria 1256
426 Ga0207708_10481674 3300026075 Bacteria 1037
427 Ga0207702_10006558 3300026078 Bacteria 10014
428 Ga0207702_10408250 3300026078 Bacteria 1311
429 Ga0207702_10503454 3300026078 Bacteria 1181
430 Ga0207641_10766978 3300026088 Bacteria 953
431 Ga0207641_10900046 3300026088 Bacteria 879
432 Ga0207648_10651786 3300026089 Bacteria 973
433 Ga0207648_11005978 3300026089 Bacteria 781
434 Ga0207676_10756755 3300026095 Bacteria 945
435 Ga0207676_11479899 3300026095 Bacteria 676
436 Ga0207674_10641893 3300026116 Bacteria 1025
437 Ga0207675_100032376 3300026118 Bacteria 4870
438 Ga0207675_102693386 3300026118 Bacteria 506
439 Ga0207683_10002428 3300026121 Bacteria 16263
440 Ga0207683_10046790 3300026121 Bacteria 3787
441 Ga0207683_10058103 3300026121 Bacteria 3396
442 Ga0207683_10155563 3300026121 Bacteria 2065
443 Ga0207683_10559281 3300026121 Bacteria 1058
444 Ga0207683_11298364 3300026121 Bacteria 674
445 Ga0207683_11371799 3300026121 Bacteria 654
446 Ga0207698_12129983 3300026142 Bacteria 574
447 Ga0209179_1148793 3300027512 Bacteria 523
448 Ga0209588_1260670 3300027671 Bacteria 528
449 Ga0209998_10024310 3300027717 Bacteria 1314
450 Ga0207428_10003880 3300027907 Bacteria 14334
451 Ga0207428_10004795 3300027907 Bacteria 12776
452 Ga0207428_10236957 3300027907 Bacteria 1364
453 Ga0207428_11033522 3300027907 Bacteria 576
454 Ga0207428_11115952 3300027907 Bacteria 551
455 Ga0207428_11255483 3300027907 Bacteria 514
456 Ga0268266_10444982 3300028379 Bacteria 1231
457 Ga0268265_11835305 3300028380 Bacteria 613
458 Ga0268264_10907384 3300028381 Bacteria 884
459 Ga0268264_10925479 3300028381 Bacteria 876
460 Ga0265326_10052191 3300028558 Bacteria 1158
461 Ga0265319_1134171 3300028563 Bacteria 769
462 Ga0265334_10041588 3300028573 Bacteria 1796
463 Ga0265336_10160758 3300028666 Bacteria 668
464 Ga0265336_10233716 3300028666 Bacteria 546
465 Ga0265338_10001469 3300028800 Bacteria 38157
466 Ga0265338_10029477 3300028800 Bacteria 5439
467 Ga0265338_10030307 3300028800 Bacteria 5333
468 Ga0265338_10118712 3300028800 Bacteria 2113
469 Ga0265338_10172860 3300028800 Bacteria 1655
470 Ga0265324_10006460 3300029957 Bacteria 4886
471 Ga0314311_1085012 3300030733 Bacteria 758
472 Ga0316183_1159347 3300030742 Bacteria 784
473 Ga0316182_1077039 3300030745 Bacteria 6818
474 Ga0265320_10002674 3300031240 Bacteria 12328
475 Ga0265325_10009375 3300031241 Bacteria 5718
476 Ga0265329_10003710 3300031242 Bacteria 6583
477 Ga0265339_10030245 3300031249 Bacteria 3067
478 Ga0265339_10074487 3300031249 Bacteria 1803
479 Ga0265327_10002304 3300031251 Bacteria 20409
480 Ga0265327_10024946 3300031251 Bacteria 3497
481 Ga0265327_10030079 3300031251 Bacteria 3076
482 Ga0265327_10062804 3300031251 Bacteria 1889
483 Ga0265316_10059571 3300031344 Bacteria 2969
484 Ga0307408_100649122 3300031548 Bacteria 943
485 Ga0316579_10299121 3300031691 Bacteria 778
486 Ga0316579_10665151 3300031691 Bacteria 504
487 Ga0265342_10102357 3300031712 Bacteria 1630
488 Ga0316576_10002775 3300031727 Bacteria 10061
489 Ga0316576_10011929 3300031727 Bacteria 5718
490 Ga0316576_10109103 3300031727 Bacteria 2074
491 Ga0316578_10049797 3300031728 Bacteria 2449
492 Ga0316578_10064645 3300031728 Bacteria 2159
493 Ga0307405_11707035 3300031731 Bacteria 558
494 Ga0316577_10058560 3300031733 Bacteria 2151
495 Ga0316577_10061403 3300031733 Bacteria 2097
496 Ga0316577_10170344 3300031733 Bacteria 1229
497 Ga0307413_10746419 3300031824 Bacteria 818
498 Ga0307413_10980814 3300031824 Bacteria 723
499 Ga0307413_11367017 3300031824 Bacteria 622
500 Ga0307413_12140130 3300031824 Unclassified 506
501 Ga0307413_12174952 3300031824 Bacteria 503
502 Ga0307410_11761364 3300031852 Bacteria 550
503 Ga0307407_10575870 3300031903 Bacteria 835
504 Ga0307409_100018566 3300031995 Bacteria 4681
505 Ga0307409_100082399 3300031995 Bacteria 2604
506 Ga0307409_102779131 3300031995 Bacteria 517
507 Ga0307416_100437756 3300032002 Bacteria 1356
508 Ga0307416_100829733 3300032002 Bacteria 1022
509 Ga0307416_103869188 3300032002 Bacteria 501
510 Ga0307411_10715681 3300032005 Bacteria 874
511 Ga0307411_11030165 3300032005 Bacteria 738
512 Ga0307411_11365116 3300032005 Bacteria 648
513 Ga0307415_100023176 3300032126 Bacteria 3849
514 Ga0307415_100067206 3300032126 Bacteria 2504
515 Ga0316583_10239032 3300032133 Bacteria 629
516 Ga0316585_10017603 3300032137 Bacteria 2162
517 Ga0316580_10010964 3300032139 Bacteria 2747
518 Ga0316593_10105141 3300032168 Bacteria 1004
519 Ga0316588_1005594 3300033528 Bacteria 2459
520 Ga0316596_1054680 3300033541 Bacteria 1059
521 Ga0373944_0006098 3300035089 Bacteria 3193
522 Ga0373951_0003481 3300035091 Bacteria 3806
523 Ga0373951_0184421 3300035091 Bacteria 601
524 Ga0373951_0200926 3300035091 Bacteria 581
525 Ga0373952_0281538 3300035092 Bacteria 513
526 Ga0373932_0224886 3300035112 Bacteria 676
527 Ga0373936_0280733 3300035113 Bacteria 748
528 Ga0373936_0502737 3300035113 Bacteria 564
529 Ga0373936_0592901 3300035113 Bacteria 520
530 Ga0373939_0305077 3300035114 Bacteria 636
531 Ga0373939_0414179 3300035114 Bacteria 561
532 Ga0373941_0088105 3300035115 Bacteria 1060
533 Ga0373941_0129882 3300035115 Bacteria 907
534 Ga0373945_0010376 3300035116 Bacteria 3067
535 Ga0373960_0005204 3300035121 Bacteria 3004
536 Ga0373943_0015500 3300035170 Bacteria 3463
537 Ga0373943_0062916 3300035170 Bacteria 1859
538 Ga0373943_0142890 3300035170 Bacteria 1291
539 Ga0373946_0361526 3300035171 Bacteria 727
540 Ga0373962_0243334 3300035242 Bacteria 622
541 Ga0316574_0004169 3300035398 Bacteria 7533
542 Ga0316574_0146215 3300035398 Bacteria 1523
543 Ga0373931_0042228 3300035691 Bacteria 2397
544 Ga0373935_0217831 3300035692 Bacteria 1325
545 Ga0373935_0307940 3300035692 Bacteria 1121
546 Ga0373927_0388800 3300035695 Bacteria 920
547 Ga0373927_0921639 3300035695 Bacteria 577
548 Ga0373933_0940945 3300035724 Bacteria 569
549 Ga0373947_0020846 3300035725 Bacteria 3788
550 Ga0373947_0078612 3300035725 Bacteria 2037
551 Ga0373947_0131617 3300035725 Bacteria 1597
552 Ga0373947_0245579 3300035725 Bacteria 1182
553 Ga0373937_0008344 3300036401 Bacteria 8995
554 Ga0316582_0033791 3300036647 Bacteria 3144
555 Ga0316582_0081939 3300036647 Bacteria 2109
556 Ga0316582_0112039 3300036647 Bacteria 1817
557 Ga0316584_0040686 3300036712 Bacteria 3463
558 Ga0316584_0180208 3300036712 Bacteria 1564
559 Ga0316584_0182070 3300036712 Bacteria 1555
560 Ga0373925_0050349 3300037068 Bacteria 3106
561 Ga0373925_0273137 3300037068 Bacteria 1360
562 Ga0373925_0474265 3300037068 Bacteria 1026
563 Ga0373925_0776016 3300037068 Bacteria 790
564 Ga0373925_1794760 3300037068 Bacteria 500
565 Ga0395899_0004680 3300037312 Bacteria 10679
566 Ga0395899_0005677 3300037312 Bacteria 9689
567 Ga0395899_0023473 3300037312 Bacteria 4670
568 Ga0395899_0412777 3300037312 Bacteria 891
569 Ga0395900_0000743 3300037418 Bacteria 43323
570 Ga0395900_0006166 3300037418 Bacteria 12518
571 Ga0395900_0013025 3300037418 Bacteria 8497
572 Ga0395900_0072926 3300037418 Bacteria 3529
573 Ga0395900_0160339 3300037418 Bacteria 2294
574 Ga0395900_0286161 3300037418 Bacteria 1638
575 Ga0395900_0298875 3300037418 Bacteria 1597
576 Ga0395900_0308758 3300037418 Bacteria 1565
577 Ga0395900_0312877 3300037418 Bacteria 1553
578 Ga0395900_0385254 3300037418 Bacteria 1369
579 Ga0395900_0455995 3300037418 Bacteria 1234
580 Ga0395900_0514218 3300037418 Bacteria 1146
581 Ga0395900_0702937 3300037418 Bacteria 944
582 Ga0395900_1241036 3300037418 Bacteria 660
583 Ga0395900_1351163 3300037418 Bacteria 626
584 Ga0395900_1368868 3300037418 Bacteria 621
585 Ga0395898_0004731 3300037466 Bacteria 14815
586 Ga0395898_0013971 3300037466 Bacteria 8251
587 Ga0395898_0043063 3300037466 Bacteria 4449
588 Ga0395898_0316427 3300037466 Bacteria 1489
589 Ga0395898_0426786 3300037466 Bacteria 1263
590 Ga0395898_0513325 3300037466 Bacteria 1140
591 Ga0395898_1953112 3300037466 Bacteria 506
592 Ga0395905_0001396 3300037471 Bacteria 29255
593 Ga0395905_0002827 3300037471 Bacteria 19021
594 Ga0395905_0038325 3300037471 Bacteria 4497
595 Ga0395905_0044492 3300037471 Bacteria 4167
596 Ga0395905_0087327 3300037471 Bacteria 2924
597 Ga0395905_0102377 3300037471 Bacteria 2688
598 Ga0395905_0103220 3300037471 Bacteria 2677
599 Ga0395905_0874881 3300037471 Bacteria 802
600 Ga0395905_1004334 3300037471 Bacteria 737
601 Ga0316581_0031946 3300037588 Bacteria 1587
602 Ga0436364_0536177 3300037853 Bacteria 531
603 Ga0436364_0561570 3300037853 Bacteria 693
604 Ga0436364_0900074 3300037853 Bacteria 1871
605 Ga0436364_0952678 3300037853 Bacteria 2686
606 Ga0436364_1457480 3300037853 Bacteria 664
607 Ga0395901_0000608 3300038443 Bacteria 41717
608 Ga0395901_0001625 3300038443 Bacteria 23242
609 Ga0395901_0020069 3300038443 Bacteria 6838
610 Ga0395901_0020104 3300038443 Bacteria 6832
611 Ga0395901_0042627 3300038443 Bacteria 4705
612 Ga0395901_0043546 3300038443 Bacteria 4656
613 Ga0395901_0077724 3300038443 Bacteria 3464
614 Ga0395901_0118129 3300038443 Bacteria 2786
615 Ga0395901_0247269 3300038443 Bacteria 1859
616 Ga0395901_0345921 3300038443 Bacteria 1535
617 Ga0395901_0492767 3300038443 Bacteria 1248
618 Ga0395901_0711481 3300038443 Bacteria 1001
619 Ga0395901_1002826 3300038443 Bacteria 811
620 Ga0395901_1518717 3300038443 Bacteria 625
621 Ga0395901_1762724 3300038443 Bacteria 569
622 Ga0395901_2119039 3300038443 Bacteria 507
623 Ga0242420_071778 3300038996 Bacteria 705
624 Ga0436365_0197615 3300039437 Bacteria 502
625 Ga0436365_0229577 3300039437 Bacteria 710
626 Ga0436365_0340703 3300039437 Bacteria 1430
627 Ga0436365_0744423 3300039437 Bacteria 986
628 Ga0436365_0828602 3300039437 Bacteria 2020
629 Ga0436365_1123200 3300039437 Bacteria 3671
630 Ga0436365_1317203 3300039437 Bacteria 739
631 Ga0436365_1340450 3300039437 Bacteria 3215
632 Ga0436365_1353011 3300039437 Bacteria 695
633 Ga0436365_1701879 3300039437 Bacteria 1073
634 Ga0436365_1808656 3300039437 Bacteria 3808
635 Ga0436363_0020748 3300039450 Bacteria 1009
636 Ga0436363_0311018 3300039450 Bacteria 544
637 Ga0436363_0859085 3300039450 Bacteria 1260
638 Ga0436363_1231148 3300039450 Bacteria 1301
639 Ga0436363_1680183 3300039450 Bacteria 554
640 Ga0436362_0090517 3300039453 Bacteria 3307
641 Ga0436362_0151148 3300039453 Bacteria 8035
642 Ga0436362_0209718 3300039453 Bacteria 2519
643 Ga0436362_0241064 3300039453 Bacteria 572
644 Ga0439438_010111 3300041405 Bacteria 3007
645 Ga0439461_0122296 3300041410 Bacteria 652
646 Ga0439465_0175579 3300041413 Bacteria 773
647 Ga0439465_0203493 3300041413 Bacteria 722
648 Ga0439465_0221005 3300041413 Bacteria 694
649 Ga0451787_009211 3300041441 Bacteria 1032
650 Ga0451789_0175977 3300041443 Bacteria 531
651 Ga0451789_1195439 3300041443 Bacteria 823
652 Ga0451790_05211 3300041444 Bacteria 626
653 Ga0451790_37377 3300041444 Unclassified 644
654 Ga0451794_49486 3300041446 Bacteria 565
655 Ga0451791_0088197 3300041451 Bacteria 510
656 Ga0451791_0136570 3300041451 Bacteria 945
657 Ga0451791_0508058 3300041451 Bacteria 1164
658 Ga0451793_0014665 3300041452 Bacteria 1019
659 Ga0451798_0513130 3300041458 Bacteria 1834
660 Ga0451800_0303440 3300041459 Bacteria 760
661 Ga0451800_0413162 3300041459 Bacteria 1455
662 Ga0451802_0302952 3300041460 Bacteria 2069
663 Ga0451805_100082 3300041461 Unclassified 521
664 Ga0451804_0008972 3300041463 Bacteria 768
665 Ga0451804_0437360 3300041463 Bacteria 685
666 Ga0451804_0494228 3300041463 Bacteria 992
667 Ga0451808_35197 3300041464 Bacteria 562
668 Ga0451807_0941007 3300041486 Bacteria 3019
669 Ga0451807_1407961 3300041486 Bacteria 703
670 Ga0451807_1415391 3300041486 Bacteria 536
671 Ga0451833_1121621 3300041491 Bacteria 1273
672 Ga0451835_0008708 3300041492 Bacteria 3718
673 Ga0451837_0685982 3300041494 Bacteria 3092
674 Ga0451837_1484235 3300041494 Bacteria 1174
675 Ga0451839_0891048 3300041496 Bacteria 1836
676 Ga0451839_1293502 3300041496 Bacteria 2999
677 Ga0451841_0277217 3300041498 Bacteria 887
678 Ga0451841_0665373 3300041498 Bacteria 874
679 Ga0451845_0158583 3300041501 Bacteria 3194
680 Ga0451845_0359913 3300041501 Bacteria 551
681 Ga0451847_0500621 3300041503 Bacteria 840
682 Ga0451851_0275059 3300041507 Bacteria 825
683 Ga0451851_1282943 3300041507 Bacteria 815
684 Ga0451843_0264872 3300041509 Bacteria 638
685 Ga0451843_1399751 3300041509 Bacteria 686
686 Ga0451855_0735930 3300041511 Bacteria 505
687 Ga0451853_1647682 3300041512 Bacteria 1021
688 Ga0451853_3012778 3300041512 Bacteria 2854
689 Ga0439431_0021178 3300041997 Bacteria 1559
690 Ga0439443_017393 3300042003 Bacteria 1106
691 Ga0439445_0030319 3300042004 Bacteria 1401
692 Ga0439448_0000738 3300042005 Bacteria 7903
693 Ga0439448_0013866 3300042005 Bacteria 2426
694 Ga0439432_035312 3300042006 Bacteria 1602
695 Ga0439432_115337 3300042006 Bacteria 797
696 Ga0439449_0153350 3300042007 Bacteria 859
697 Ga0439450_001793 3300042008 Bacteria 3228
698 Ga0439451_017287 3300042009 Bacteria 1453
699 Ga0439452_029613 3300042010 Bacteria 1357
700 Ga0439452_101174 3300042010 Bacteria 619
701 Ga0439454_000646 3300042011 Bacteria 2921
702 Ga0439455_0004924 3300042012 Bacteria 2680
703 Ga0439456_026694 3300042013 Bacteria 1229
704 Ga0439456_045856 3300042013 Bacteria 952
705 Ga0439456_125549 3300042013 Bacteria 590
706 Ga0439463_001082 3300042016 Bacteria 7352
707 Ga0450888_001730 3300042126 Bacteria 2106
708 Ga0450888_062332 3300042126 Bacteria 549
709 Ga0450902_052021 3300042137 Bacteria 704
710 Ga0439446_0001975 3300042156 Bacteria 4845
711 Ga0439446_0163149 3300042156 Bacteria 738
712 Ga0439446_0377694 3300042156 Bacteria 509
713 Ga0439458_0202180 3300042157 Bacteria 544
714 Ga0439458_0208571 3300042157 Bacteria 536
715 Ga0439434_0004207 3300042435 Bacteria 4203
716 Ga0439434_0049167 3300042435 Bacteria 1305
717 Ga0439434_0081233 3300042435 Bacteria 1029
718 Ga0439444_0036505 3300042437 Bacteria 947
719 Ga0439459_0064919 3300042438 Bacteria 833
720 Ga0439464_0002672 3300042439 Bacteria 4418
721 Ga0439464_0105571 3300042439 Bacteria 859
722 Ga0439460_0003483 3300042461 Bacteria 3805
723 Ga0439460_0098232 3300042461 Bacteria 938
724 Ga0451577_0422092 3300042876 Bacteria 1211
725 Ga0439440_0008555 3300042993 Bacteria 2103
726 Ga0453683_0039498 3300044673 Bacteria 2966
727 Ga0453683_0133999 3300044673 Bacteria 1562
728 Ga0466965_0558722 3300044683 Bacteria 647
729 Ga0466965_0588331 3300044683 Bacteria 631
730 Ga0466966_0357651 3300044684 Bacteria 877
731 Ga0466966_0657196 3300044684 Bacteria 631
732 Ga0466963_0211351 3300044694 Bacteria 1358
733 Ga0466963_0351221 3300044694 Bacteria 1039
734 Ga0466963_0435099 3300044694 Bacteria 925
735 Ga0466963_0699566 3300044694 Bacteria 715
736 Ga0466964_0012030 3300044706 Bacteria 3273
737 Ga0466964_0016789 3300044706 Bacteria 2797
738 Ga0466964_0279706 3300044706 Bacteria 834
739 Ga0453684_0397698 3300044712 Bacteria 1544
740 Ga0453684_0456657 3300044712 Bacteria 1421
741 Ga0466968_0381720 3300044735 Bacteria 688
742 Ga0466970_0349513 3300044765 Bacteria 839
743 Ga0466957_0259519 3300044842 Bacteria 1158
744 Ga0466957_0530152 3300044842 Bacteria 819
745 Ga0466960_0006520 3300044901 Bacteria 4684
746 Ga0466960_0068730 3300044901 Bacteria 1758
747 Ga0466960_0340934 3300044901 Bacteria 853
748 Ga0451576_0119948 3300045051 Bacteria 2738
749 Ga0451576_0430696 3300045051 Bacteria 1384
750 Ga0451576_0962207 3300045051 Bacteria 895
751 Ga0466967_0003690 3300045976 Bacteria 10078
752 Ga0466967_0005405 3300045976 Bacteria 8847
753 Ga0466967_0040641 3300045976 Bacteria 4005
754 Ga0466967_0203713 3300045976 Bacteria 1875
755 Ga0466967_0561642 3300045976 Bacteria 1124
756 Ga0466967_0903807 3300045976 Bacteria 878
757 Ga0466967_1122218 3300045976 Bacteria 783
758 Ga0495592_0036627 3300046454 Bacteria 3694
759 Ga0495592_0082665 3300046454 Bacteria 2320
760 Ga0495592_0175635 3300046454 Bacteria 1463
761 Ga0495592_0342809 3300046454 Bacteria 960
762 Ga0495603_0000168 3300046455 Bacteria 33188
763 Ga0495603_0157712 3300046455 Bacteria 1317
764 Ga0495603_0310310 3300046455 Bacteria 906
765 Ga0495590_0435443 3300046457 Bacteria 506
766 Ga0495629_0004184 3300046459 Bacteria 10834
767 Ga0495629_0240986 3300046459 Bacteria 1245
768 Ga0495629_0300861 3300046459 Bacteria 1099
769 Ga0495629_0426464 3300046459 Bacteria 900
770 Ga0495638_0105562 3300046460 Bacteria 1679
771 Ga0495641_0003448 3300046461 Bacteria 11823
772 Ga0495641_0229710 3300046461 Bacteria 833
773 Ga0495651_0004813 3300046462 Bacteria 10332
774 Ga0495651_0070491 3300046462 Bacteria 2660
775 Ga0495651_0187486 3300046462 Bacteria 1458
776 Ga0495651_0498577 3300046462 Bacteria 780
777 Ga0495653_0010728 3300046463 Bacteria 7503
778 Ga0495653_0052427 3300046463 Bacteria 3126
779 Ga0495653_0219114 3300046463 Bacteria 1280
780 Ga0495653_0325959 3300046463 Bacteria 994
781 Ga0495580_0446771 3300046472 Bacteria 868
782 Ga0495580_0499832 3300046472 Bacteria 812
783 Ga0495582_0226927 3300046473 Bacteria 1069
784 Ga0495582_0583651 3300046473 Bacteria 647
785 Ga0495582_0693322 3300046473 Bacteria 589
786 Ga0495582_0879198 3300046473 Bacteria 518
787 Ga0495639_0063525 3300046475 Bacteria 1695
788 Ga0495639_0134542 3300046475 Bacteria 1185
789 Ga0495639_0688600 3300046475 Bacteria 528
790 Ga0495662_0364693 3300046476 Bacteria 710
791 Ga0495664_0019053 3300046477 Bacteria 3941
792 Ga0495584_0262552 3300046491 Bacteria 878
793 Ga0495594_0001050 3300046499 Bacteria 14363
794 Ga0495594_0365510 3300046499 Bacteria 821
795 Ga0495594_0448553 3300046499 Bacteria 733
796 Ga0495596_0058481 3300046500 Bacteria 1503
797 Ga0495596_0148383 3300046500 Bacteria 911
798 Ga0495608_0072159 3300046511 Bacteria 2252
799 Ga0495608_0156577 3300046511 Bacteria 1450
800 Ga0495608_0277858 3300046511 Bacteria 1040
801 Ga0495618_0033552 3300046514 Bacteria 3219
802 Ga0495618_0309800 3300046514 Bacteria 980
803 Ga0495618_0325436 3300046514 Bacteria 951
804 Ga0495620_0375255 3300046515 Bacteria 539
805 Ga0495628_0003174 3300046516 Bacteria 14733
806 Ga0495628_0049859 3300046516 Bacteria 3313
807 Ga0495630_0010468 3300046517 Bacteria 6698
808 Ga0495630_0033447 3300046517 Bacteria 3835
809 Ga0495630_0102507 3300046517 Bacteria 2165
810 Ga0495630_0163659 3300046517 Bacteria 1693
811 Ga0495630_0350345 3300046517 Bacteria 1130
812 Ga0495630_0420574 3300046517 Bacteria 1024
813 Ga0495630_0703841 3300046517 Bacteria 773
814 Ga0495630_0703897 3300046517 Bacteria 773
815 Ga0495630_1121075 3300046517 Bacteria 596
816 Ga0495631_0117506 3300046518 Bacteria 1144
817 Ga0495644_0096638 3300046523 Bacteria 1116
818 Ga0495644_0269861 3300046523 Bacteria 663
819 Ga0495666_0016962 3300046526 Bacteria 3625
820 Ga0495666_0094738 3300046526 Bacteria 1408
821 Ga0495666_0168852 3300046526 Bacteria 1012
822 Ga0495652_0116165 3300046529 Bacteria 2143
823 Ga0495654_0314944 3300046530 Bacteria 636
824 Ga0495665_0178857 3300046531 Bacteria 1103
825 Ga0495640_0122993 3300046533 Bacteria 1685
826 Ga0495640_0429583 3300046533 Bacteria 809
827 Ga0495640_0677507 3300046533 Bacteria 619
828 Ga0495587_0041055 3300046536 Bacteria 2761
829 Ga0495621_0423664 3300046539 Bacteria 567
830 Ga0495645_0204215 3300046543 Bacteria 1338
831 Ga0495645_0294996 3300046543 Bacteria 1061
832 Ga0495622_0391027 3300046557 Bacteria 600
833 Ga0495667_0002578 3300046559 Bacteria 12112
834 Ga0495667_0059128 3300046559 Bacteria 2516
835 Ga0495667_0624142 3300046559 Bacteria 671
836 Ga0495656_0127090 3300046615 Bacteria 1210
837 Ga0495668_0441331 3300046616 Bacteria 716
838 Ga0495668_0483032 3300046616 Bacteria 682
839 Ga0495668_0550432 3300046616 Bacteria 637
840 Ga0495634_0019308 3300046642 Bacteria 4844
841 Ga0495634_0165733 3300046642 Bacteria 1391
842 Ga0495634_0259888 3300046642 Bacteria 1060
843 Ga0495634_0806890 3300046642 Bacteria 535
844 Ga0495635_0016528 3300046663 Bacteria 5156
845 Ga0495635_0400670 3300046663 Bacteria 912
846 Ga0495635_0531815 3300046663 Bacteria 772
847 Ga0495588_0000956 3300046674 Bacteria 12598
848 Ga0495657_0001765 3300046675 Bacteria 18492
849 Ga0495657_0036107 3300046675 Bacteria 3418
850 Ga0495657_0202178 3300046675 Bacteria 1210
851 Ga0495657_0391188 3300046675 Bacteria 819
852 Ga0495599_0336105 3300046678 Bacteria 907
853 Ga0495599_0817417 3300046678 Bacteria 532
854 Ga0495623_0027040 3300046679 Bacteria 3690
855 Ga0495623_0454524 3300046679 Bacteria 681
856 Ga0495623_0658305 3300046679 Bacteria 539
857 Ga0495646_0156763 3300046680 Bacteria 1263
858 Ga0495646_0288877 3300046680 Bacteria 870
859 Ga0495647_0006984 3300046681 Bacteria 3763
860 Ga0495647_0201665 3300046681 Bacteria 872
861 Ga0495647_0637962 3300046681 Bacteria 501
862 Ga0495658_0384595 3300046683 Bacteria 894
863 Ga0495658_0444656 3300046683 Bacteria 828
864 Ga0495658_0462977 3300046683 Bacteria 810
865 Ga0495658_0690989 3300046683 Bacteria 654
866 Ga0495658_0784023 3300046683 Bacteria 610
867 Ga0495613_0005603 3300046689 Bacteria 9426
868 Ga0495613_0079445 3300046689 Bacteria 2385
869 Ga0495613_0745507 3300046689 Bacteria 642
870 Ga0495624_0100202 3300046690 Bacteria 1784
871 Ga0495624_0299010 3300046690 Bacteria 971
872 Ga0495624_0885134 3300046690 Bacteria 526
873 Ga0495649_0358017 3300046694 Bacteria 737
874 Ga0495589_0218593 3300046794 Bacteria 896
875 Ga0495600_0016031 3300046809 Bacteria 4751
876 Ga0495600_0513385 3300046809 Bacteria 735
877 Ga0495600_0726280 3300046809 Bacteria 596
878 Ga0495581_0031097 3300047315 Bacteria 3093
879 Ga0495581_0145677 3300047315 Bacteria 1382
880 Ga0495581_0154866 3300047315 Bacteria 1339
881 Ga0495581_0567788 3300047315 Bacteria 658
882 Ga0495604_0195072 3300047317 Bacteria 1408
883 Ga0495604_0347456 3300047317 Bacteria 986
884 Ga0495604_0968997 3300047317 Bacteria 528
885 Ga0495674_0167812 3300047319 Bacteria 1833
886 Ga0495674_0201212 3300047319 Bacteria 1652
887 Ga0495674_0403444 3300047319 Bacteria 1103
888 Ga0495674_1373299 3300047319 Bacteria 527
889 Ga0495672_0159988 3300047320 Bacteria 1159
890 Ga0495672_0495372 3300047320 Bacteria 544
891 Ga0495676_0084655 3300047321 Bacteria 2392
892 Ga0495676_0104992 3300047321 Bacteria 2083
893 Ga0495676_0515466 3300047321 Bacteria 784
894 Ga0495676_0608608 3300047321 Bacteria 711
895 Ga0495676_1053132 3300047321 Bacteria 518
896 Ga0495680_0004189 3300047322 Bacteria 13854
897 Ga0495680_0012097 3300047322 Bacteria 7614
898 Ga0495680_0611095 3300047322 Bacteria 728
899 Ga0495683_0385139 3300047323 Bacteria 586
900 Ga0495675_0068857 3300047444 Bacteria 2235
901 Ga0495675_0277372 3300047444 Bacteria 1000
902 Ga0495679_126689 3300047446 Bacteria 695
903 Ga0495684_0022720 3300047471 Bacteria 4824
904 Ga0495684_0080311 3300047471 Bacteria 2476
905 Ga0495684_0811219 3300047471 Bacteria 610
906 Ga0495602_0076237 3300048088 Bacteria 2842
907 Ga0495602_0387786 3300048088 Bacteria 999
908 Ga0495614_0128859 3300048089 Bacteria 1119
909 Ga0495614_0270257 3300048089 Bacteria 781
910 Ga0496100_0008037 3300048903 Bacteria 5863
911 Ga0496100_0022211 3300048903 Bacteria 3836
912 Ga0496100_0061790 3300048903 Bacteria 2469
913 Ga0496100_0106448 3300048903 Bacteria 1941
914 Ga0496100_0354564 3300048903 Bacteria 1109
915 Ga0496100_0485158 3300048903 Bacteria 951
916 Ga0496100_1630522 3300048903 Bacteria 510
917 Ga0496101_0009815 3300048904 Bacteria 6305
918 Ga0496101_0038241 3300048904 Bacteria 3407
919 Ga0496101_0057739 3300048904 Bacteria 2808
920 Ga0496101_0200038 3300048904 Bacteria 1544
921 Ga0496101_0236637 3300048904 Bacteria 1420
922 Ga0496101_0448192 3300048904 Bacteria 1018
923 Ga0496101_0612196 3300048904 Bacteria 861
924 Ga0496102_0002726 3300048905 Bacteria 15048
925 Ga0496102_0007769 3300048905 Bacteria 9168
926 Ga0496102_0030776 3300048905 Bacteria 4806
927 Ga0496102_0099129 3300048905 Bacteria 2704
928 Ga0496102_0247766 3300048905 Bacteria 1680
929 Ga0496102_0366913 3300048905 Bacteria 1355
930 Ga0496102_0405867 3300048905 Bacteria 1281
931 Ga0496102_0612487 3300048905 Bacteria 1012
932 Ga0496102_0670352 3300048905 Bacteria 960
933 Ga0496102_0868273 3300048905 Bacteria 824
934 Ga0496102_0871661 3300048905 Bacteria 822
935 Ga0496102_0915431 3300048905 Bacteria 798
936 Ga0496102_0983837 3300048905 Bacteria 764
937 Ga0496102_1680900 3300048905 Bacteria 553
938 Ga0496103_0004577 3300048906 Bacteria 8379
939 Ga0496103_0056708 3300048906 Bacteria 2432
940 Ga0496103_0086610 3300048906 Bacteria 1975
941 Ga0496103_0273699 3300048906 Bacteria 1086
942 Ga0496103_0482780 3300048906 Bacteria 794
943 Ga0496103_0570135 3300048906 Bacteria 722
944 Ga0496103_0783089 3300048906 Bacteria 602
945 Ga0496103_0927436 3300048906 Bacteria 545
946 Ga0496104_0002622 3300048907 Bacteria 15487
947 Ga0496104_0074547 3300048907 Bacteria 3230
948 Ga0496104_0080130 3300048907 Bacteria 3113
949 Ga0496104_0080543 3300048907 Bacteria 3105
950 Ga0496104_0535460 3300048907 Bacteria 1082
951 Ga0496104_0638832 3300048907 Bacteria 973
952 Ga0496104_0681200 3300048907 Bacteria 936
953 Ga0496105_0013979 3300048908 Bacteria 6384
954 Ga0496105_0016649 3300048908 Bacteria 5870
955 Ga0496105_0035543 3300048908 Bacteria 4100
956 Ga0496105_0111871 3300048908 Bacteria 2253
957 Ga0496105_0127286 3300048908 Bacteria 2100
958 Ga0496105_0137682 3300048908 Bacteria 2010
959 Ga0496105_0320831 3300048908 Bacteria 1242
960 Ga0496105_0340505 3300048908 Bacteria 1199
961 Ga0496105_0578070 3300048908 Bacteria 874
962 Ga0496106_0005196 3300048909 Bacteria 9639
963 Ga0496106_0028397 3300048909 Bacteria 4167
964 Ga0496106_0066209 3300048909 Bacteria 2751
965 Ga0496106_0112787 3300048909 Bacteria 2118
966 Ga0496106_0378734 3300048909 Bacteria 1137
967 Ga0496106_1424211 3300048909 Bacteria 535
968 Ga0496106_1467204 3300048909 Bacteria 526
969 Ga0496107_0021521 3300048910 Bacteria 4557
970 Ga0496107_0042781 3300048910 Bacteria 3253
971 Ga0496107_0062203 3300048910 Bacteria 2704
972 Ga0496107_0133619 3300048910 Bacteria 1833
973 Ga0496107_0140213 3300048910 Bacteria 1787
974 Ga0496107_0935766 3300048910 Bacteria 631
975 Ga0496108_0002353 3300048911 Bacteria 15135
976 Ga0496108_0034475 3300048911 Bacteria 4206
977 Ga0496108_0236554 3300048911 Bacteria 1589
978 Ga0496108_0463970 3300048911 Bacteria 1106
979 Ga0496108_0644839 3300048911 Bacteria 921
980 Ga0496109_0004037 3300048912 Bacteria 12259
981 Ga0496109_0004660 3300048912 Bacteria 11447
982 Ga0496109_0004743 3300048912 Bacteria 11365
983 Ga0496109_0042955 3300048912 Bacteria 4097
984 Ga0496109_0059427 3300048912 Bacteria 3492
985 Ga0496109_0247577 3300048912 Bacteria 1678
986 Ga0496109_0409977 3300048912 Bacteria 1280
987 Ga0496109_0588602 3300048912 Bacteria 1048
988 Ga0496109_0667317 3300048912 Bacteria 977
989 Ga0496109_1554458 3300048912 Bacteria 596
990 Ga0496110_0000526 3300048913 Bacteria 26000
991 Ga0496110_0004643 3300048913 Bacteria 10677
992 Ga0496110_0011428 3300048913 Bacteria 7267
993 Ga0496110_0042026 3300048913 Bacteria 3990
994 Ga0496110_0156538 3300048913 Bacteria 2064
995 Ga0496110_0170208 3300048913 Bacteria 1976
996 Ga0496110_0173664 3300048913 Bacteria 1956
997 Ga0496110_0473091 3300048913 Bacteria 1141
998 Ga0496110_0569043 3300048913 Bacteria 1029
999 Ga0496110_0651824 3300048913 Bacteria 953
1000 Ga0496111_0010628 3300048914 Bacteria 6186
1001 Ga0496111_0016068 3300048914 Bacteria 5152
1002 Ga0496111_0025168 3300048914 Bacteria 4198
1003 Ga0496111_0031524 3300048914 Bacteria 3777
1004 Ga0496111_0045995 3300048914 Bacteria 3141
1005 Ga0496111_0286304 3300048914 Bacteria 1222
1006 Ga0496111_0600342 3300048914 Bacteria 806
1007 Ga0496111_0801191 3300048914 Bacteria 682
1008 Ga0496111_1350285 3300048914 Bacteria 501
1009 Ga0496112_0044987 3300048915 Bacteria 4326
1010 Ga0496112_0063461 3300048915 Bacteria 3644
1011 Ga0496112_0082500 3300048915 Bacteria 3179
1012 Ga0496112_0291808 3300048915 Bacteria 1577
1013 Ga0496112_0691442 3300048915 Bacteria 948
1014 Ga0496112_1441950 3300048915 Bacteria 603
1015 Ga0496113_0004175 3300048916 Bacteria 8823
1016 Ga0496113_0018575 3300048916 Bacteria 4845
1017 Ga0496113_0559377 3300048916 Bacteria 917
1018 Ga0496113_0716239 3300048916 Bacteria 798
1019 Ga0496113_1529240 3300048916 Bacteria 515
1020 Ga0496114_0004194 3300048917 Bacteria 11164
1021 Ga0496114_0005056 3300048917 Bacteria 10281
1022 Ga0496114_0017734 3300048917 Bacteria 5752
1023 Ga0496114_0024410 3300048917 Bacteria 4935
1024 Ga0496114_0053427 3300048917 Bacteria 3368
1025 Ga0496114_0069183 3300048917 Bacteria 2964
1026 Ga0496114_0080151 3300048917 Bacteria 2757
1027 Ga0496114_0280482 3300048917 Bacteria 1469
1028 Ga0496114_0431158 3300048917 Bacteria 1168
1029 Ga0496114_0461627 3300048917 Bacteria 1124
1030 Ga0496114_0556571 3300048917 Bacteria 1013
1031 Ga0496114_0970135 3300048917 Bacteria 733
1032 Ga0496114_1201885 3300048917 Bacteria 644
1033 Ga0496114_1347259 3300048917 Bacteria 601
1034 Ga0496115_0001699 3300048918 Bacteria 15776
1035 Ga0496115_0047476 3300048918 Bacteria 3434
1036 Ga0496115_0408568 3300048918 Bacteria 1101
1037 Ga0496115_0891202 3300048918 Bacteria 686
1038 Ga0496115_1247961 3300048918 Bacteria 556
1039 Ga0496124_0901048 3300048927 Bacteria 537
1040 Ga0501308_038193 3300049128 Bacteria 668
1041 Ga0501308_076384 3300049128 Bacteria 527
1042 Ga0501310_016817 3300049130 Bacteria 880
1043 Ga0501310_051521 3300049130 Bacteria 596
1044 Ga0501310_079179 3300049130 Bacteria 513
1045 Ga0501305_049406 3300049161 Bacteria 703
1046 Ga0501307_033510 3300049162 Bacteria 722
1047 Ga0501314_031489 3300049530 Bacteria 591
1048 Ga0501316_071956 3300049532 Bacteria 525
1049 Ga0501316_073504 3300049532 Bacteria 521
1050 Ga0501317_006514 3300049533 Bacteria 1288
1051 Ga0501317_033367 3300049533 Bacteria 757
1052 Ga0501318_001880 3300049534 Bacteria 1738
1053 Ga0501318_033283 3300049534 Bacteria 710
1054 Ga0501325_039407 3300049541 Bacteria 570
1055 Ga0501330_021793 3300049546 Bacteria 519
1056 Ga0501333_001410 3300049549 Bacteria 1293
1057 Ga0501031_0001922 3300049568 Bacteria 13097
1058 Ga0501031_0005180 3300049568 Bacteria 8498
1059 Ga0501031_0005531 3300049568 Bacteria 8225
1060 Ga0501031_0017300 3300049568 Bacteria 4683
1061 Ga0501031_0018753 3300049568 Bacteria 4504
1062 Ga0501031_0036857 3300049568 Bacteria 3191
1063 Ga0501031_0068792 3300049568 Bacteria 2306
1064 Ga0501031_0470692 3300049568 Bacteria 811
1065 Ga0501031_0532054 3300049568 Bacteria 757
1066 Ga0501031_0758377 3300049568 Bacteria 622
1067 Ga0501032_0018739 3300049569 Bacteria 4844
1068 Ga0501032_0031380 3300049569 Bacteria 3643
1069 Ga0501032_0038425 3300049569 Bacteria 3260
1070 Ga0501032_0137352 3300049569 Bacteria 1611
1071 Ga0501032_0241633 3300049569 Bacteria 1173
1072 Ga0501032_0587712 3300049569 Bacteria 709
1073 Ga0501032_0608714 3300049569 Bacteria 695
1074 Ga0501032_0611688 3300049569 Bacteria 693
1075 Ga0501032_0778266 3300049569 Bacteria 605
1076 Ga0501033_0010145 3300049570 Bacteria 7230
1077 Ga0501033_0032916 3300049570 Bacteria 3892
1078 Ga0501033_0090106 3300049570 Bacteria 2244
1079 Ga0501033_0205609 3300049570 Bacteria 1405
1080 Ga0501033_0248029 3300049570 Bacteria 1263
1081 Ga0501033_1085943 3300049570 Bacteria 533
1082 Ga0501034_0011227 3300049571 Bacteria 9301
1083 Ga0501034_0031799 3300049571 Bacteria 5360
1084 Ga0501034_0051052 3300049571 Bacteria 4171
1085 Ga0501034_0540189 3300049571 Bacteria 1076
1086 Ga0501034_1294494 3300049571 Bacteria 606
1087 Ga0501034_1334904 3300049571 Bacteria 593
1088 Ga0501036_0009133 3300049572 Bacteria 8152
1089 Ga0501036_0019870 3300049572 Bacteria 5640
1090 Ga0501036_0028832 3300049572 Bacteria 4691
1091 Ga0501036_0045518 3300049572 Bacteria 3717
1092 Ga0501036_0045609 3300049572 Bacteria 3713
1093 Ga0501036_0057478 3300049572 Bacteria 3295
1094 Ga0501036_0191702 3300049572 Bacteria 1719
1095 Ga0501036_0196255 3300049572 Bacteria 1698
1096 Ga0501036_0235531 3300049572 Bacteria 1536
1097 Ga0501036_0270587 3300049572 Bacteria 1422
1098 Ga0501036_0354379 3300049572 Bacteria 1225
1099 Ga0501036_0359236 3300049572 Bacteria 1216
1100 Ga0501036_0530272 3300049572 Bacteria 979
1101 Ga0501036_0735090 3300049572 Bacteria 814
1102 Ga0501036_1207507 3300049572 Bacteria 616
1103 Ga0501036_1209692 3300049572 Bacteria 616
1104 Ga0501037_0005752 3300049573 Bacteria 9054
1105 Ga0501037_0061198 3300049573 Bacteria 2745
1106 Ga0501037_0135506 3300049573 Bacteria 1763
1107 Ga0501037_0169853 3300049573 Bacteria 1551
1108 Ga0501037_0189589 3300049573 Bacteria 1456
1109 Ga0501037_0325989 3300049573 Bacteria 1063
1110 Ga0501037_0426832 3300049573 Bacteria 907
1111 Ga0501038_0003673 3300049574 Bacteria 14294
1112 Ga0501038_0041519 3300049574 Bacteria 4011
1113 Ga0501038_0061441 3300049574 Bacteria 3213
1114 Ga0501038_0076183 3300049574 Bacteria 2834
1115 Ga0501038_0086310 3300049574 Bacteria 2637
1116 Ga0501038_0096734 3300049574 Bacteria 2464
1117 Ga0501038_0105410 3300049574 Bacteria 2342
1118 Ga0501038_0117524 3300049574 Bacteria 2196
1119 Ga0501038_0191520 3300049574 Bacteria 1645
1120 Ga0501038_0508122 3300049574 Bacteria 921
1121 Ga0501038_1176100 3300049574 Bacteria 558
1122 Ga0501039_0001765 3300049575 Bacteria 15962
1123 Ga0501039_0007712 3300049575 Bacteria 8216
1124 Ga0501039_0009669 3300049575 Bacteria 7350
1125 Ga0501039_0012688 3300049575 Bacteria 6441
1126 Ga0501039_0030743 3300049575 Bacteria 4140
1127 Ga0501039_0082192 3300049575 Bacteria 2508
1128 Ga0501039_0109363 3300049575 Bacteria 2161
1129 Ga0501039_0114246 3300049575 Bacteria 2112
1130 Ga0501039_0155205 3300049575 Bacteria 1798
1131 Ga0501039_0241469 3300049575 Bacteria 1420
1132 Ga0501039_0333440 3300049575 Bacteria 1192
1133 Ga0501039_0651711 3300049575 Bacteria 824
1134 Ga0501039_0662169 3300049575 Bacteria 817
1135 Ga0501039_0700222 3300049575 Bacteria 792
1136 Ga0501040_0001336 3300049576 Bacteria 15604
1137 Ga0501040_0002053 3300049576 Bacteria 12978
1138 Ga0501040_0010042 3300049576 Bacteria 6183
1139 Ga0501040_0013186 3300049576 Bacteria 5437
1140 Ga0501040_0025963 3300049576 Bacteria 3941
1141 Ga0501040_0031959 3300049576 Bacteria 3559
1142 Ga0501040_0041569 3300049576 Bacteria 3131
1143 Ga0501040_0064208 3300049576 Bacteria 2527
1144 Ga0501040_0132251 3300049576 Bacteria 1755
1145 Ga0501040_0209624 3300049576 Bacteria 1385
1146 Ga0501040_0318432 3300049576 Bacteria 1112
1147 Ga0501040_0489003 3300049576 Bacteria 887
1148 Ga0501041_0001150 3300049577 Bacteria 14480
1149 Ga0501041_0001929 3300049577 Bacteria 11642
1150 Ga0501041_0008706 3300049577 Bacteria 5974
1151 Ga0501041_0032148 3300049577 Bacteria 3171
1152 Ga0501041_0039470 3300049577 Bacteria 2865
1153 Ga0501041_0057116 3300049577 Bacteria 2386
1154 Ga0501041_0087585 3300049577 Bacteria 1922
1155 Ga0501041_0105501 3300049577 Bacteria 1746
1156 Ga0501041_0123385 3300049577 Bacteria 1611
1157 Ga0501041_0153497 3300049577 Bacteria 1438
1158 Ga0501041_0222709 3300049577 Bacteria 1184
1159 Ga0501041_0239420 3300049577 Bacteria 1140
1160 Ga0501041_0466048 3300049577 Bacteria 802
1161 Ga0501041_0762979 3300049577 Bacteria 620
1162 Ga0501042_0001278 3300049578 Bacteria 14653
1163 Ga0501042_0006496 3300049578 Bacteria 7592
1164 Ga0501042_0019089 3300049578 Bacteria 4757
1165 Ga0501042_0023659 3300049578 Bacteria 4300
1166 Ga0501042_0026481 3300049578 Bacteria 4074
1167 Ga0501042_0039322 3300049578 Bacteria 3361
1168 Ga0501042_0043308 3300049578 Bacteria 3205
1169 Ga0501042_0050736 3300049578 Bacteria 2959
1170 Ga0501042_0109331 3300049578 Bacteria 1990
1171 Ga0501042_0196908 3300049578 Bacteria 1453
1172 Ga0501042_0213777 3300049578 Bacteria 1391
1173 Ga0501042_0370059 3300049578 Bacteria 1037
1174 Ga0501042_0811100 3300049578 Bacteria 681
1175 Ga0501042_0989784 3300049578 Bacteria 613
1176 Ga0501042_1062663 3300049578 Bacteria 590
1177 Ga0501042_1322135 3300049578 Bacteria 526
1178 Ga0501043_0112135 3300049579 Bacteria 2141
1179 Ga0501043_0202752 3300049579 Bacteria 1539
1180 Ga0501043_0292645 3300049579 Bacteria 1246
1181 Ga0501043_0435476 3300049579 Bacteria 987
1182 Ga0501043_0536165 3300049579 Bacteria 871
1183 Ga0501043_0545066 3300049579 Bacteria 862
1184 Ga0501043_0606383 3300049579 Bacteria 808
1185 Ga0501046_0004632 3300049580 Bacteria 12422
1186 Ga0501046_0008923 3300049580 Bacteria 8705
1187 Ga0501046_0013607 3300049580 Bacteria 6882
1188 Ga0501046_0026901 3300049580 Bacteria 4698
1189 Ga0501046_0033739 3300049580 Bacteria 4133
1190 Ga0501046_0034655 3300049580 Bacteria 4072
1191 Ga0501046_0432016 3300049580 Bacteria 948
1192 Ga0501046_0446928 3300049580 Bacteria 930
1193 Ga0501046_0820294 3300049580 Bacteria 651
1194 Ga0501046_0943605 3300049580 Bacteria 600
1195 Ga0501046_0989564 3300049580 Bacteria 584
1196 Ga0501046_1032240 3300049580 Bacteria 570
1197 Ga0501046_1237311 3300049580 Bacteria 512
1198 Ga0501047_0017447 3300049581 Bacteria 6875
1199 Ga0501047_0043981 3300049581 Bacteria 4313
1200 Ga0501047_0390651 3300049581 Bacteria 1225
1201 Ga0501047_0583711 3300049581 Bacteria 940
1202 Ga0501048_0001716 3300049582 Bacteria 16710
1203 Ga0501048_0015076 3300049582 Bacteria 5713
1204 Ga0501048_0019856 3300049582 Bacteria 4927
1205 Ga0501048_0020579 3300049582 Bacteria 4835
1206 Ga0501048_0024858 3300049582 Bacteria 4369
1207 Ga0501048_0045206 3300049582 Bacteria 3146
1208 Ga0501048_0073497 3300049582 Bacteria 2413
1209 Ga0501048_0092616 3300049582 Bacteria 2131
1210 Ga0501048_0141404 3300049582 Bacteria 1702
1211 Ga0501048_0202701 3300049582 Bacteria 1406
1212 Ga0501048_0220627 3300049582 Bacteria 1345
1213 Ga0501048_0364179 3300049582 Bacteria 1032
1214 Ga0501048_0804538 3300049582 Bacteria 675
1215 Ga0501048_0999487 3300049582 Bacteria 602
1216 Ga0501067_0002828 3300049583 Bacteria 9552
1217 Ga0501067_0021994 3300049583 Bacteria 3528
1218 Ga0501067_0122573 3300049583 Bacteria 1447
1219 Ga0501067_0514857 3300049583 Bacteria 669
1220 Ga0501068_0001266 3300049584 Bacteria 13415
1221 Ga0501068_0008513 3300049584 Bacteria 5711
1222 Ga0501068_0027136 3300049584 Bacteria 3379
1223 Ga0501068_0046288 3300049584 Bacteria 2623
1224 Ga0501068_0058938 3300049584 Bacteria 2330
1225 Ga0501068_0123849 3300049584 Bacteria 1613
1226 Ga0501068_0135071 3300049584 Bacteria 1544
1227 Ga0501068_0202466 3300049584 Bacteria 1259
1228 Ga0501068_0207537 3300049584 Bacteria 1243
1229 Ga0501068_0382240 3300049584 Bacteria 907
1230 Ga0501068_0479048 3300049584 Bacteria 806
1231 Ga0501068_0921916 3300049584 Bacteria 575
1232 Ga0501069_0001652 3300049585 Bacteria 11081
1233 Ga0501069_0002252 3300049585 Bacteria 9730
1234 Ga0501069_0020551 3300049585 Bacteria 3578
1235 Ga0501069_0083221 3300049585 Bacteria 1804
1236 Ga0501069_0122959 3300049585 Bacteria 1483
1237 Ga0501069_0136891 3300049585 Bacteria 1404
1238 Ga0501069_0140177 3300049585 Bacteria 1387
1239 Ga0501069_0141407 3300049585 Bacteria 1381
1240 Ga0501069_0263115 3300049585 Bacteria 1007
1241 Ga0501070_0008949 3300049586 Bacteria 8466
1242 Ga0501070_0026809 3300049586 Bacteria 4833
1243 Ga0501070_0028334 3300049586 Bacteria 4697
1244 Ga0501070_0078845 3300049586 Bacteria 2725
1245 Ga0501070_0341638 3300049586 Bacteria 1216
1246 Ga0501070_0399097 3300049586 Bacteria 1112
1247 Ga0501070_0710054 3300049586 Bacteria 795
1248 Ga0501070_0760276 3300049586 Bacteria 763
1249 Ga0501070_0816938 3300049586 Bacteria 731
1250 Ga0501070_0851061 3300049586 Bacteria 714
1251 Ga0501070_0890853 3300049586 Bacteria 695
1252 Ga0501070_0971692 3300049586 Bacteria 660
1253 Ga0501070_0989426 3300049586 Bacteria 653
1254 Ga0501071_0002499 3300049587 Bacteria 11181
1255 Ga0501071_0003097 3300049587 Bacteria 10317
1256 Ga0501071_0007263 3300049587 Bacteria 7253
1257 Ga0501071_0011341 3300049587 Bacteria 6003
1258 Ga0501071_0012256 3300049587 Bacteria 5807
1259 Ga0501071_0018159 3300049587 Bacteria 4864
1260 Ga0501071_0030948 3300049587 Bacteria 3789
1261 Ga0501071_0059917 3300049587 Bacteria 2755
1262 Ga0501071_0083826 3300049587 Bacteria 2335
1263 Ga0501071_0112914 3300049587 Bacteria 2009
1264 Ga0501071_0116472 3300049587 Bacteria 1978
1265 Ga0501071_0118230 3300049587 Bacteria 1963
1266 Ga0501071_0203057 3300049587 Bacteria 1489
1267 Ga0501071_0277032 3300049587 Bacteria 1269
1268 Ga0501071_0302532 3300049587 Bacteria 1213
1269 Ga0501071_0410296 3300049587 Bacteria 1035
1270 Ga0501071_1044187 3300049587 Bacteria 631
1271 Ga0501072_0000404 3300049588 Bacteria 30870
1272 Ga0501072_0000570 3300049588 Bacteria 26541
1273 Ga0501072_0001268 3300049588 Bacteria 18858
1274 Ga0501072_0005957 3300049588 Bacteria 9289
1275 Ga0501072_0026725 3300049588 Bacteria 4501
1276 Ga0501072_0051978 3300049588 Bacteria 3226
1277 Ga0501072_0071764 3300049588 Bacteria 2736
1278 Ga0501072_0086154 3300049588 Bacteria 2493
1279 Ga0501072_0100709 3300049588 Bacteria 2296
1280 Ga0501072_0122808 3300049588 Bacteria 2069
1281 Ga0501072_0175598 3300049588 Bacteria 1709
1282 Ga0501072_0328692 3300049588 Bacteria 1215
1283 Ga0501072_0380593 3300049588 Bacteria 1120
1284 Ga0501072_0446155 3300049588 Bacteria 1025
1285 Ga0501072_0473170 3300049588 Bacteria 992
1286 Ga0501072_0541254 3300049588 Bacteria 920
1287 Ga0501072_1138048 3300049588 Bacteria 607
1288 Ga0501072_1140883 3300049588 Bacteria 606
1289 Ga0501072_1230187 3300049588 Bacteria 581
1290 Ga0501073_0001011 3300049589 Bacteria 20308
1291 Ga0501073_0132458 3300049589 Bacteria 1728
1292 Ga0501073_0146739 3300049589 Bacteria 1635
1293 Ga0501073_0280245 3300049589 Bacteria 1150
1294 Ga0501073_0691982 3300049589 Bacteria 703
1295 Ga0501073_0839389 3300049589 Bacteria 633
1296 Ga0501073_1285362 3300049589 Bacteria 502
1297 Ga0501074_0020761 3300049590 Bacteria 4772
1298 Ga0501074_0031371 3300049590 Bacteria 3850
1299 Ga0501074_0043426 3300049590 Bacteria 3253
1300 Ga0501074_0058625 3300049590 Bacteria 2774
1301 Ga0501074_0068008 3300049590 Bacteria 2561
1302 Ga0501074_0079553 3300049590 Bacteria 2352
1303 Ga0501074_0253034 3300049590 Bacteria 1253
1304 Ga0501074_0406683 3300049590 Bacteria 965
1305 Ga0501074_0537814 3300049590 Bacteria 827
1306 Ga0501074_0563905 3300049590 Bacteria 806
1307 Ga0501074_1078444 3300049590 Bacteria 564
1308 Ga0501074_1096455 3300049590 Bacteria 559
1309 Ga0501074_1117878 3300049590 Bacteria 553
1310 Ga0501075_0002651 3300049591 Bacteria 11960
1311 Ga0501075_0003123 3300049591 Bacteria 11073
1312 Ga0501075_0017192 3300049591 Bacteria 5221
1313 Ga0501075_0049791 3300049591 Bacteria 3149
1314 Ga0501075_0056549 3300049591 Bacteria 2953
1315 Ga0501075_0073190 3300049591 Bacteria 2591
1316 Ga0501075_0081749 3300049591 Bacteria 2446
1317 Ga0501075_0097724 3300049591 Bacteria 2228
1318 Ga0501075_0132932 3300049591 Bacteria 1895
1319 Ga0501075_0224245 3300049591 Bacteria 1434
1320 Ga0501075_0320493 3300049591 Bacteria 1181
1321 Ga0501075_0328392 3300049591 Bacteria 1166
1322 Ga0501075_0480857 3300049591 Bacteria 947
1323 Ga0501075_0559045 3300049591 Bacteria 873
1324 Ga0501075_0655819 3300049591 Bacteria 800
1325 Ga0501075_0876328 3300049591 Bacteria 683
1326 Ga0501075_1230844 3300049591 Bacteria 568
1327 Ga0501075_1346411 3300049591 Bacteria 541
1328 Ga0501076_0001626 3300049592 Bacteria 15152
1329 Ga0501076_0009171 3300049592 Bacteria 7291
1330 Ga0501076_0014532 3300049592 Bacteria 5932
1331 Ga0501076_0027314 3300049592 Bacteria 4425
1332 Ga0501076_0032179 3300049592 Bacteria 4093
1333 Ga0501076_0051590 3300049592 Bacteria 3256
1334 Ga0501076_0075450 3300049592 Bacteria 2702
1335 Ga0501076_0117064 3300049592 Bacteria 2157
1336 Ga0501076_0149728 3300049592 Bacteria 1898
1337 Ga0501076_0164123 3300049592 Bacteria 1810
1338 Ga0501076_0172123 3300049592 Bacteria 1765
1339 Ga0501076_0271774 3300049592 Bacteria 1388
1340 Ga0501076_0327589 3300049592 Bacteria 1256
1341 Ga0501076_0444788 3300049592 Bacteria 1067
1342 Ga0501076_0645002 3300049592 Bacteria 874
1343 Ga0501076_0659653 3300049592 Bacteria 863
1344 Ga0501076_0949860 3300049592 Bacteria 708
1345 Ga0501076_1228768 3300049592 Bacteria 617
1346 Ga0501077_0002661 3300049593 Bacteria 10707
1347 Ga0501077_0007349 3300049593 Bacteria 6792
1348 Ga0501077_0011401 3300049593 Bacteria 5552
1349 Ga0501077_0034661 3300049593 Bacteria 3212
1350 Ga0501077_0036232 3300049593 Bacteria 3142
1351 Ga0501077_0125598 3300049593 Bacteria 1626
1352 Ga0501077_0147539 3300049593 Bacteria 1492
1353 Ga0501077_0245790 3300049593 Bacteria 1137
1354 Ga0501077_1089313 3300049593 Bacteria 514
1355 Ga0501079_0011424 3300049741 Bacteria 6777
1356 Ga0501079_0016443 3300049741 Bacteria 5648
1357 Ga0501079_0017122 3300049741 Bacteria 5534
1358 Ga0501079_0027551 3300049741 Bacteria 4358
1359 Ga0501079_0046685 3300049741 Bacteria 3342
1360 Ga0501079_0078560 3300049741 Bacteria 2552
1361 Ga0501079_0082592 3300049741 Bacteria 2485
1362 Ga0501079_0122350 3300049741 Bacteria 2023
1363 Ga0501079_0147395 3300049741 Bacteria 1834
1364 Ga0501079_0702566 3300049741 Bacteria 796
1365 Ga0501079_0911202 3300049741 Bacteria 692
1366 Ga0501079_1408137 3300049741 Bacteria 549
1367 Ga0501080_0020334 3300049742 Bacteria 6143
1368 Ga0501080_0034333 3300049742 Bacteria 4734
1369 Ga0501080_0045856 3300049742 Bacteria 4070
1370 Ga0501080_0062854 3300049742 Bacteria 3455
1371 Ga0501080_0170659 3300049742 Bacteria 2006
1372 Ga0501080_0174978 3300049742 Bacteria 1978
1373 Ga0501080_0247334 3300049742 Bacteria 1626
1374 Ga0501080_0338523 3300049742 Bacteria 1360
1375 Ga0501080_0362296 3300049742 Bacteria 1308
1376 Ga0501080_0386989 3300049742 Bacteria 1259
1377 Ga0501080_0495585 3300049742 Bacteria 1092
1378 Ga0501080_0499308 3300049742 Bacteria 1087
1379 Ga0501080_0744299 3300049742 Bacteria 862
1380 Ga0501080_1168156 3300049742 Bacteria 663
1381 Ga0501080_1170134 3300049742 Bacteria 662
1382 Ga0501080_1200423 3300049742 Bacteria 652
1383 Ga0501081_0005768 3300049743 Bacteria 8018
1384 Ga0501081_0009102 3300049743 Bacteria 6460
1385 Ga0501081_0018885 3300049743 Bacteria 4581
1386 Ga0501081_0029885 3300049743 Bacteria 3684
1387 Ga0501081_0030368 3300049743 Bacteria 3658
1388 Ga0501081_0044490 3300049743 Bacteria 3047
1389 Ga0501081_0073713 3300049743 Bacteria 2381
1390 Ga0501081_0115350 3300049743 Bacteria 1909
1391 Ga0501081_0198496 3300049743 Bacteria 1455
1392 Ga0501081_0206163 3300049743 Bacteria 1427
1393 Ga0501081_0322995 3300049743 Bacteria 1135
1394 Ga0501081_0354573 3300049743 Bacteria 1081
1395 Ga0501081_0411999 3300049743 Bacteria 1001
1396 Ga0501081_0421046 3300049743 Bacteria 990
1397 Ga0501081_0716622 3300049743 Bacteria 751
1398 Ga0501081_1071046 3300049743 Bacteria 610
1399 Ga0501083_0005072 3300049744 Bacteria 9327
1400 Ga0501083_0030813 3300049744 Bacteria 3682
1401 Ga0501083_0088522 3300049744 Bacteria 2047
1402 Ga0501083_0129782 3300049744 Bacteria 1652
1403 Ga0501083_0232418 3300049744 Bacteria 1201
1404 Ga0501083_0399067 3300049744 Bacteria 895
1405 Ga0501083_0500449 3300049744 Bacteria 791
1406 Ga0501083_0811563 3300049744 Bacteria 609
1407 Ga0501083_1067226 3300049744 Bacteria 526
1408 Ga0501035_0003302 3300049822 Bacteria 15457
1409 Ga0501035_0148016 3300049822 Bacteria 2039
1410 Ga0501035_0150437 3300049822 Bacteria 2020
1411 Ga0501035_0278346 3300049822 Bacteria 1415
1412 Ga0501035_0694706 3300049822 Bacteria 821
1413 Ga0501035_0770821 3300049822 Bacteria 770
1414 Ga0501035_0788911 3300049822 Bacteria 760
1415 Ga0501044_0006082 3300049823 Bacteria 13321
1416 Ga0501044_0065231 3300049823 Bacteria 3714
1417 Ga0501044_0090769 3300049823 Bacteria 3082
1418 Ga0501044_0106428 3300049823 Bacteria 2817
1419 Ga0501044_0120027 3300049823 Bacteria 2631
1420 Ga0501044_0346893 3300049823 Bacteria 1405
1421 Ga0501044_0353329 3300049823 Bacteria 1389
1422 Ga0501044_0431551 3300049823 Bacteria 1227
1423 Ga0501044_0554429 3300049823 Bacteria 1046
1424 Ga0501045_0000769 3300049824 Bacteria 20594
1425 Ga0501045_0009487 3300049824 Bacteria 6811
1426 Ga0501045_0016096 3300049824 Bacteria 5306
1427 Ga0501045_0020878 3300049824 Bacteria 4682
1428 Ga0501045_0024490 3300049824 Bacteria 4334
1429 Ga0501045_0033121 3300049824 Bacteria 3747
1430 Ga0501045_0041454 3300049824 Bacteria 3350
1431 Ga0501045_0066886 3300049824 Bacteria 2638
1432 Ga0501045_0097534 3300049824 Bacteria 2174
1433 Ga0501045_0129414 3300049824 Bacteria 1876
1434 Ga0501045_0168924 3300049824 Bacteria 1629
1435 Ga0501045_0179778 3300049824 Bacteria 1576
1436 Ga0501045_0281489 3300049824 Bacteria 1238
1437 Ga0501045_1316153 3300049824 Bacteria 526
1438 nmdc:mga03683_23138_c1 3300050489 Bacteria 2417
1439 nmdc:mga03683_69434_c1 3300050489 Bacteria 1503
1440 nmdc:mga03n38_146827_c1 3300050490 Bacteria 1183
1441 nmdc:mga03n38_30805_c1 3300050490 Bacteria 2259
1442 nmdc:mga03n38_93759_c1 3300050490 Bacteria 1435
1443 nmdc:mga00v17_206099_c1 3300050491 Bacteria 1272
1444 nmdc:mga00v17_256671_c1 3300050491 Bacteria 1134
1445 nmdc:mga00v17_355651_c1 3300050491 Bacteria 952
1446 nmdc:mga00v17_369197_c1 3300050491 Bacteria 933
1447 nmdc:mga00v17_576065_c1 3300050491 Bacteria 727
1448 nmdc:mga00v17_659508_c1 3300050491 Bacteria 672
1449 nmdc:mga00v17_7911_c1 3300050491 Bacteria 5700
1450 nmdc:mga00v17_955168_c1 3300050491 Bacteria 541
1451 nmdc:mga0yw44_190443_c1 3300050492 Bacteria 1353
1452 nmdc:mga0yw44_610942_c1 3300050492 Bacteria 741
1453 nmdc:mga0yw44_91294_c1 3300050492 Bacteria 1925
1454 nmdc:mga0k408_310205_c1 3300050493 Bacteria 942
1455 nmdc:mga06z11_528407_c1 3300050494 Bacteria 715
1456 nmdc:mga06z11_537187_c1 3300050494 Bacteria 709
1457 nmdc:mga06z11_726504_c1 3300050494 Bacteria 605
1458 nmdc:mga06z11_728890_c1 3300050494 Bacteria 604
1459 nmdc:mga07m45_100310_c1 3300050496 Bacteria 1662
1460 nmdc:mga07m45_311165_c1 3300050496 Bacteria 916
1461 nmdc:mga07m45_333577_c1 3300050496 Bacteria 881
1462 nmdc:mga07m45_353354_c1 3300050496 Bacteria 854
1463 nmdc:mga05p37_112203_c1 3300050507 Bacteria 3353
1464 nmdc:mga05p37_152314_c1 3300050507 Bacteria 1130
1465 nmdc:mga05p37_154934_c1 3300050507 Bacteria 2801
1466 nmdc:mga05p37_171_c1 3300050507 Bacteria 63303
1467 nmdc:mga05p37_17560_c2 3300050507 Bacteria 7255
1468 nmdc:mga05p37_330960_c1 3300050507 Bacteria 1799
1469 nmdc:mga05p37_433211_c1 3300050507 Bacteria 1527
1470 nmdc:mga05p37_47968_c1 3300050507 Bacteria 5253
1471 nmdc:mga05p37_548581_c1 3300050507 Bacteria 1316
1472 nmdc:mga09592_127336_c1 3300050508 Bacteria 2190
1473 nmdc:mga09592_183_c1 3300050508 Bacteria 44709
1474 nmdc:mga09592_208171_c1 3300050508 Bacteria 1694
1475 nmdc:mga09592_38268_c1 3300050508 Bacteria 4026
1476 nmdc:mga09592_565_c1 3300050508 Bacteria 28059
1477 nmdc:mga09592_605768_c1 3300050508 Bacteria 938
1478 nmdc:mga09592_78078_c1 3300050508 Bacteria 2817
1479 nmdc:mga09592_84949_c1 3300050508 Bacteria 2700
1480 nmdc:mga0qj67_14906_c1 3300050509 Bacteria 5879
1481 nmdc:mga0qj67_159848_c1 3300050509 Bacteria 1829
1482 nmdc:mga0qj67_17002_c1 3300050509 Bacteria 5526
1483 nmdc:mga0qj67_243482_c1 3300050509 Bacteria 1459
1484 nmdc:mga0qj67_267021_c1 3300050509 Bacteria 1388
1485 nmdc:mga0qj67_361195_c1 3300050509 Bacteria 1173
1486 nmdc:mga0qj67_40316_c1 3300050509 Bacteria 3670
1487 nmdc:mga0qj67_538_c1 3300050509 Bacteria 25772
1488 nmdc:mga0qj67_580222_c1 3300050509 Bacteria 898
1489 nmdc:mga0qj67_743619_c1 3300050509 Bacteria 778
1490 nmdc:mga06r32_10511_c1 3300050510 Bacteria 8348
1491 nmdc:mga06r32_1189971_c1 3300050510 Bacteria 709
1492 nmdc:mga06r32_120500_c1 3300050510 Bacteria 2587
1493 nmdc:mga06r32_1244331_c1 3300050510 Bacteria 690
1494 nmdc:mga06r32_1538832_c1 3300050510 Bacteria 605
1495 nmdc:mga06r32_1646800_c1 3300050510 Bacteria 580
1496 nmdc:mga06r32_1752820_c1 3300050510 Bacteria 557
1497 nmdc:mga06r32_22307_c1 3300050510 Bacteria 5852
1498 nmdc:mga06r32_342_c1 3300050510 Bacteria 38838
1499 nmdc:mga06r32_737899_c1 3300050510 Bacteria 949
1500 nmdc:mga08y16_138470_c1 3300050511 Bacteria 2530
1501 nmdc:mga08y16_1802431_c1 3300050511 Bacteria 565
1502 nmdc:mga08y16_189594_c1 3300050511 Bacteria 2133
1503 nmdc:mga08y16_1913539_c1 3300050511 Bacteria 544
1504 nmdc:mga08y16_21805_c1 3300050511 Bacteria 6758
1505 nmdc:mga08y16_225415_c1 3300050511 Bacteria 1940
1506 nmdc:mga08y16_439827_c1 3300050511 Bacteria 1331
1507 nmdc:mga08y16_731829_c1 3300050511 Bacteria 986
1508 nmdc:mga08y16_75914_c1 3300050511 Bacteria 3503
1509 nmdc:mga08y16_974337_c1 3300050511 Bacteria 830
1510 nmdc:mga0n895_1200691_c1 3300050512 Bacteria 732
1511 nmdc:mga0n895_153218_c1 3300050512 Bacteria 2336
1512 nmdc:mga0n895_195030_c2 3300050512 Bacteria 1554
1513 nmdc:mga0n895_218437_c1 3300050512 Bacteria 1935
1514 nmdc:mga0n895_57615_c1 3300050512 Bacteria 3830
1515 nmdc:mga0rr50_1599208_c1 3300050513 Bacteria 550
1516 nmdc:mga0rr50_1745_c1 3300050513 Bacteria 11991
1517 nmdc:mga0rr50_1802255_c1 3300050513 Bacteria 515
1518 nmdc:mga0rr50_223587_c1 3300050513 Bacteria 1555
1519 nmdc:mga0rr50_55828_c1 3300050513 Bacteria 2948
1520 nmdc:mga0rr50_58237_c1 3300050513 Bacteria 2895
1521 nmdc:mga08x19_15822_c1 3300050514 Bacteria 4594
1522 nmdc:mga08x19_982664_c1 3300050514 Bacteria 600
1523 nmdc:mga0a205_1221074_c1 3300050515 Bacteria 599
1524 nmdc:mga0a205_15462_c1 3300050515 Bacteria 7135
1525 nmdc:mga0a205_460_c1 3300050515 Bacteria 31634
1526 nmdc:mga0sz30_173542_c1 3300050516 Bacteria 956
1527 nmdc:mga0sz30_198196_c1 3300050516 Bacteria 891
1528 Ga0495601_0004388 3300053077 Bacteria 8151
1529 Ga0495601_0161174 3300053077 Bacteria 1466
1530 Ga0495601_0170148 3300053077 Bacteria 1424
1531 Ga0495612_0143806 3300053078 Bacteria 1035
1532 Ga0495612_0299138 3300053078 Bacteria 721
1533 Ga0495595_0005271 3300053084 Bacteria 5227
1534 Ga0495595_0018372 3300053084 Bacteria 3021
1535 Ga0495595_0026950 3300053084 Bacteria 2557
1536 Ga0495595_0049086 3300053084 Bacteria 1951
1537 Ga0495595_0148363 3300053084 Bacteria 1153
1538 Ga0495619_0005469 3300053085 Bacteria 8052
1539 Ga0495619_0057521 3300053085 Bacteria 2580
1540 Ga0495619_0120735 3300053085 Bacteria 1797
1541 Ga0495619_0610250 3300053085 Bacteria 746
1542 Ga0495619_0638626 3300053085 Bacteria 727
1543 Ga0500566_0510460 3300053094 Bacteria 516
1544 Ga0500650_0303702 3300053098 Bacteria 706
1545 Ga0500650_0334421 3300053098 Bacteria 665
1546 Ga0500628_207511 3300053129 Bacteria 567
1547 Ga0500568_0028420 3300053139 Bacteria 2331
1548 Ga0500616_0000361 3300053153 Bacteria 64415
1549 Ga0500616_0000816 3300053153 Bacteria 35390
1550 Ga0501084_0007455 3300054114 Bacteria 9018
1551 Ga0501084_0017951 3300054114 Bacteria 5892
1552 Ga0501084_0022306 3300054114 Bacteria 5284
1553 Ga0501084_0031121 3300054114 Bacteria 4463
1554 Ga0501084_0045054 3300054114 Bacteria 3694
1555 Ga0501084_0100661 3300054114 Bacteria 2426
1556 Ga0501084_0109556 3300054114 Bacteria 2320
1557 Ga0501084_0343225 3300054114 Bacteria 1261
1558 Ga0501084_0368250 3300054114 Bacteria 1214
1559 Ga0501084_0374621 3300054114 Bacteria 1203
1560 Ga0501084_0610701 3300054114 Bacteria 921
1561 Ga0501084_0918450 3300054114 Bacteria 736
1562 Ga0501084_1048356 3300054114 Bacteria 685
1563 Ga0501084_1383447 3300054114 Bacteria 589
1564 Ga0501084_1523805 3300054114 Bacteria 559
1565 Ga0501084_1835301 3300054114 Bacteria 506
1566 Ga0587084_150229 3300059477 Bacteria 512
1567 Ga0587066_108750 3300059490 Bacteria 640
1568 Ga0587066_213575 3300059490 Bacteria 514
1569 Ga0587070_117591 3300059491 Bacteria 632
1570 Ga0587070_137665 3300059491 Bacteria 600
1571 Ga0587070_156549 3300059491 Bacteria 575
1572 Ga0587073_0221845 3300059492 Bacteria 578
1573 Ga0587077_246322 3300059493 Bacteria 515
1574 Ga0587082_120842 3300059504 Bacteria 592
1575 Ga0587082_145203 3300059504 Bacteria 557
1576 Ga0587083_0022054 3300059505 Bacteria 1189
1577 Ga0587083_0051723 3300059505 Bacteria 898
1578 Ga0587083_0215026 3300059505 Bacteria 556
1579 Ga0587085_040029 3300059506 Bacteria 812
1580 Ga0587085_159900 3300059506 Bacteria 526
1581 Ga0587086_093632 3300059507 Bacteria 545
1582 Ga0587088_056893 3300059508 Bacteria 782
1583 Ga0587091_019178 3300059511 Bacteria 1172
1584 Ga0587091_233257 3300059511 Bacteria 509
1585 Ga0587092_071063 3300059512 Bacteria 670
1586 Ga0587094_037029 3300059513 Bacteria 780
1587 Ga0587094_094244 3300059513 Bacteria 570
1588 Ga0587098_071333 3300059604 Bacteria 563
1589 Ga0587106_049143 3300059605 Bacteria 742
1590 Ga0587106_158080 3300059605 Bacteria 509
1591 Ga0587113_037196 3300059625 Bacteria 572
1592 Ga0587115_024490 3300059626 Bacteria 862
1593 Ga0587122_022736 3300059628 Bacteria 693
1594 Ga0587122_042692 3300059628 Bacteria 568
1595 Ga0587128_045618 3300059630 Bacteria 783
1596 Ga0587128_132866 3300059630 Bacteria 552
1597 Ga0587067_041105 3300059640 Bacteria 899
1598 Ga0587067_050188 3300059640 Bacteria 841
1599 Ga0587068_085230 3300059641 Bacteria 644
1600 Ga0587068_095386 3300059641 Bacteria 618
1601 Ga0587068_131506 3300059641 Bacteria 552
1602 Ga0587069_099636 3300059642 Bacteria 592
1603 Ga0587072_090424 3300059643 Bacteria 674
1604 Ga0587072_198065 3300059643 Bacteria 509
1605 Ga0587076_182945 3300059645 Bacteria 529
1606 Ga0587078_056666 3300059646 Bacteria 585
1607 Ga0587078_064639 3300059646 Bacteria 561
1608 Ga0587078_079749 3300059646 Bacteria 523
1609 Ga0587079_046204 3300059647 Bacteria 898
1610 Ga0587079_114616 3300059647 Bacteria 659
1611 Ga0587079_136658 3300059647 Bacteria 621
1612 Ga0587102_054742 3300059649 Bacteria 545
1613 Ga0587105_026106 3300059651 Bacteria 537
1614 Ga0587107_035137 3300059652 Bacteria 783
1615 Ga0587110_007484 3300059654 Bacteria 1034
1616 Ga0587110_019641 3300059654 Bacteria 755
1617 Ga0587114_021661 3300059655 Bacteria 913
1618 Ga0587124_031029 3300059660 Bacteria 591
1619 Ga0587071_061998 3300060344 Bacteria 797
1620 Ga0587071_162477 3300060344 Bacteria 563
1621 Ga0587071_182486 3300060344 Bacteria 540
1622 Ga0501082_0005568 3300060353 Bacteria 10936
1623 Ga0501082_0012938 3300060353 Bacteria 7173
1624 Ga0501082_0013609 3300060353 Bacteria 6991
1625 Ga0501082_0024808 3300060353 Bacteria 5168
1626 Ga0501082_0062677 3300060353 Bacteria 3201
1627 Ga0501082_0084870 3300060353 Bacteria 2731
1628 Ga0501082_0095374 3300060353 Bacteria 2571
1629 Ga0501082_0125341 3300060353 Bacteria 2228
1630 Ga0501082_0137403 3300060353 Bacteria 2121
1631 Ga0501082_0140077 3300060353 Bacteria 2099
1632 Ga0501082_0286587 3300060353 Bacteria 1434
1633 Ga0501082_0326846 3300060353 Bacteria 1336
1634 Ga0501082_0330973 3300060353 Bacteria 1327
1635 Ga0501082_0377492 3300060353 Bacteria 1237
1636 Ga0501082_0405009 3300060353 Bacteria 1191
1637 Ga0501082_0449213 3300060353 Bacteria 1126
1638 Ga0501082_0884438 3300060353 Bacteria 781
1639 Ga0501082_1796379 3300060353 Bacteria 535
1640 Ga0501082_1870277 3300060353 Bacteria 523
1641 Ga0530510_0000429 3300061734 Bacteria 27096
1642 Ga0530510_0007861 3300061734 Bacteria 7438
1643 Ga0530510_0010040 3300061734 Bacteria 6641
1644 Ga0530510_0020154 3300061734 Bacteria 4741
1645 Ga0530510_0023058 3300061734 Bacteria 4435
1646 Ga0530510_0024142 3300061734 Bacteria 4337
1647 Ga0530510_0031838 3300061734 Bacteria 3792
1648 Ga0530510_0033114 3300061734 Bacteria 3720
1649 Ga0530510_0041048 3300061734 Bacteria 3340
1650 Ga0530510_0051239 3300061734 Bacteria 2982
1651 Ga0530510_0107332 3300061734 Bacteria 2043
1652 Ga0530510_0194403 3300061734 Bacteria 1506
1653 Ga0530510_0324699 3300061734 Bacteria 1154
1654 Ga0530510_0442498 3300061734 Bacteria 982
1655 Ga0530510_0571992 3300061734 Bacteria 859
1656 Ga0530510_0611653 3300061734 Bacteria 829
1657 Ga0530510_0712561 3300061734 Bacteria 765
1658 Ga0530510_0935269 3300061734 Bacteria 663
1659 Ga0530510_1078602 3300061734 Bacteria 615

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001979 JGI24740J21852_10088500 JGI24740J21852_100885003 37
2 3300001989 JGI24739J22299_10031467 JGI24739J22299_100314673 37
3 3300001991 JGI24743J22301_10003930 JGI24743J22301_100039302 37
4 3300002239 JGI24034J26672_10111582 JGI24034J26672_101115822 37
5 3300002244 JGI24742J22300_10084749 JGI24742J22300_100847491 37
6 3300005543 Ga0070672_100077749 Ga0070672_1000777495 37
7 3300005543 Ga0070672_100285086 Ga0070672_1002850862 37
8 3300005543 Ga0070672_101719617 Ga0070672_1017196172 37
9 3300005548 Ga0070665_100413394 Ga0070665_1004133942 37
10 3300005548 Ga0070665_100846569 Ga0070665_1008465692 37
11 3300005548 Ga0070665_101737175 Ga0070665_1017371751 37
12 3300005548 Ga0070665_101976051 Ga0070665_1019760512 37
13 3300005563 Ga0068855_100076941 Ga0068855_1000769413 37
14 3300005563 Ga0068855_100506750 Ga0068855_1005067502 37
15 3300005564 Ga0070664_100454133 Ga0070664_1004541333 37
16 3300005564 Ga0070664_101174041 Ga0070664_1011740412 37
17 3300005564 Ga0070664_102355143 Ga0070664_1023551432 37
18 3300005577 Ga0068857_100784790 Ga0068857_1007847902 37
19 3300005577 Ga0068857_101640012 Ga0068857_1016400122 37
20 3300005577 Ga0068857_101896030 Ga0068857_1018960302 37
21 3300005578 Ga0068854_101100243 Ga0068854_1011002432 37
22 3300005614 Ga0068856_100013028 Ga0068856_10001302810 37
23 3300005614 Ga0068856_100316577 Ga0068856_1003165774 37
24 3300005614 Ga0068856_100799382 Ga0068856_1007993821 37
25 3300005616 Ga0068852_100532843 Ga0068852_1005328433 37
26 3300005616 Ga0068852_100557502 Ga0068852_1005575022 37
27 3300005616 Ga0068852_101304543 Ga0068852_1013045433 37
28 3300005616 Ga0068852_101935721 Ga0068852_1019357212 37
29 3300005617 Ga0068859_100265412 Ga0068859_1002654124 37
30 3300005617 Ga0068859_100281232 Ga0068859_1002812325 37
31 3300005617 Ga0068859_101144341 Ga0068859_1011443412 37
32 3300005618 Ga0068864_102225948 Ga0068864_1022259482 37
33 3300005718 Ga0068866_10181190 Ga0068866_101811902 37
34 3300005718 Ga0068866_11047144 Ga0068866_110471442 37
35 3300005719 Ga0068861_100029137 Ga0068861_1000291373 37
36 3300005719 Ga0068861_100095522 Ga0068861_1000955222 37
37 3300005719 Ga0068861_101112896 Ga0068861_1011128962 37
38 3300005719 Ga0068861_102158249 Ga0068861_1021582492 37
39 3300005834 Ga0068851_10919395 Ga0068851_109193952 37
40 3300005840 Ga0068870_10438218 Ga0068870_104382182 37
41 3300005841 Ga0068863_100280593 Ga0068863_1002805932 37
42 3300005841 Ga0068863_100520763 Ga0068863_1005207632 37
43 3300005842 Ga0068858_100115807 Ga0068858_1001158073 37
44 3300005842 Ga0068858_100163432 Ga0068858_1001634323 37
45 3300005842 Ga0068858_100508925 Ga0068858_1005089252 37
46 3300005843 Ga0068860_100302134 Ga0068860_1003021344 37
47 3300005843 Ga0068860_101005631 Ga0068860_1010056312 37
48 3300005843 Ga0068860_102183039 Ga0068860_1021830392 37
49 3300005844 Ga0068862_101511440 Ga0068862_1015114401 37
50 3300005844 Ga0068862_102021608 Ga0068862_1020216082 37
51 3300005937 Ga0081455_10001246 Ga0081455_1000124624 37
52 3300005937 Ga0081455_10002789 Ga0081455_100027895 37
53 3300005937 Ga0081455_10010819 Ga0081455_100108198 37
54 3300005937 Ga0081455_10034606 Ga0081455_100346065 37
55 3300005937 Ga0081455_10091499 Ga0081455_100914994 37
56 3300005937 Ga0081455_10109721 Ga0081455_101097213 37
57 3300005937 Ga0081455_10166672 Ga0081455_101666724 37
58 3300005937 Ga0081455_10186765 Ga0081455_101867651 37
59 3300005937 Ga0081455_10353276 Ga0081455_103532762 37
60 3300005937 Ga0081455_10395919 Ga0081455_103959193 37
61 3300005937 Ga0081455_10420127 Ga0081455_104201272 37
62 3300005981 Ga0081538_10013338 Ga0081538_100133382 37
63 3300005981 Ga0081538_10020236 Ga0081538_100202366 37
64 3300005981 Ga0081538_10022376 Ga0081538_100223766 37
65 3300005981 Ga0081538_10284407 Ga0081538_102844072 37
66 3300005981 Ga0081538_10380426 Ga0081538_103804262 37
67 3300005983 Ga0081540_1010298 Ga0081540_10102984 37
68 3300005983 Ga0081540_1026069 Ga0081540_10260694 37
69 3300005985 Ga0081539_10005544 Ga0081539_1000554413 37
70 3300005985 Ga0081539_10019869 Ga0081539_100198694 37
71 3300005985 Ga0081539_10167367 Ga0081539_101673672 37
72 3300006028 Ga0070717_10045783 Ga0070717_100457834 37
73 3300006028 Ga0070717_10071813 Ga0070717_100718133 37
74 3300006038 Ga0075365_10009834 Ga0075365_100098343 37
75 3300006038 Ga0075365_10099254 Ga0075365_100992543 37
76 3300006038 Ga0075365_10689443 Ga0075365_106894432 37
77 3300006038 Ga0075365_10850673 Ga0075365_108506732 37
78 3300006048 Ga0075363_100037884 Ga0075363_1000378843 37
79 3300006048 Ga0075363_100062659 Ga0075363_1000626592 37
80 3300006048 Ga0075363_100070977 Ga0075363_1000709774 37
81 3300006051 Ga0075364_10140568 Ga0075364_101405683 37
82 3300006051 Ga0075364_10308562 Ga0075364_103085622 37
83 3300006051 Ga0075364_10348061 Ga0075364_103480612 37
84 3300006051 Ga0075364_10439350 Ga0075364_104393502 37
85 3300006051 Ga0075364_10457672 Ga0075364_104576721 37
86 3300006051 Ga0075364_10605252 Ga0075364_106052522 37
87 3300006051 Ga0075364_10716238 Ga0075364_107162382 37
88 3300006051 Ga0075364_10809075 Ga0075364_108090752 37
89 3300006163 Ga0070715_10391394 Ga0070715_103913942 37
90 3300006173 Ga0070716_100008236 Ga0070716_1000082363 37
91 3300006173 Ga0070716_100608593 Ga0070716_1006085931 37
92 3300006173 Ga0070716_101201297 Ga0070716_1012012972 37
93 3300006175 Ga0070712_101126663 Ga0070712_1011266632 37
94 3300006175 Ga0070712_101753041 Ga0070712_1017530412 37
95 3300006177 Ga0075362_10017162 Ga0075362_100171625 37
96 3300006177 Ga0075362_10652031 Ga0075362_106520312 37
97 3300006177 Ga0075362_10699387 Ga0075362_106993872 37
98 3300006177 Ga0075362_10730319 Ga0075362_107303192 37
99 3300006178 Ga0075367_10043865 Ga0075367_100438653 37
100 3300006186 Ga0075369_10160324 Ga0075369_101603243 37
101 3300006195 Ga0075366_10737784 Ga0075366_107377841 37
102 3300006237 Ga0097621_100434981 Ga0097621_1004349813 37
103 3300006237 Ga0097621_101543602 Ga0097621_1015436022 37
104 3300006237 Ga0097621_101758789 Ga0097621_1017587892 37
105 3300006353 Ga0075370_10155106 Ga0075370_101551064 37
106 3300006353 Ga0075370_10235499 Ga0075370_102354993 37
107 3300006353 Ga0075370_10618420 Ga0075370_106184202 37
108 3300006353 Ga0075370_10620402 Ga0075370_106204022 37
109 3300006358 Ga0068871_100033556 Ga0068871_1000335563 37
110 3300006358 Ga0068871_101024643 Ga0068871_1010246433 37
111 3300006358 Ga0068871_101406169 Ga0068871_1014061692 37
112 3300006358 Ga0068871_101792492 Ga0068871_1017924921 37
113 3300006358 Ga0068871_102233006 Ga0068871_1022330062 37
114 3300006844 Ga0075428_100007971 Ga0075428_1000079712 37
115 3300006844 Ga0075428_100299180 Ga0075428_1002991803 37
116 3300006844 Ga0075428_100348046 Ga0075428_1003480463 37
117 3300006844 Ga0075428_100418077 Ga0075428_1004180772 37
118 3300006844 Ga0075428_100585101 Ga0075428_1005851012 37
119 3300006844 Ga0075428_101219956 Ga0075428_1012199562 37
120 3300006844 Ga0075428_101251041 Ga0075428_1012510412 37
121 3300006844 Ga0075428_101734366 Ga0075428_1017343662 37
122 3300006846 Ga0075430_100004496 Ga0075430_1000044962 37
123 3300006846 Ga0075430_100007366 Ga0075430_10000736613 37
124 3300006846 Ga0075430_100032919 Ga0075430_1000329193 37
125 3300006846 Ga0075430_100068857 Ga0075430_1000688574 37
126 3300006846 Ga0075430_100484609 Ga0075430_1004846092 37
127 3300006846 Ga0075430_100501729 Ga0075430_1005017292 37
128 3300006846 Ga0075430_100557959 Ga0075430_1005579593 37
129 3300006846 Ga0075430_100802196 Ga0075430_1008021962 37
130 3300006846 Ga0075430_101562441 Ga0075430_1015624412 37
131 3300006847 Ga0075431_100014487 Ga0075431_1000144877 37
132 3300006847 Ga0075431_100020636 Ga0075431_1000206369 37
133 3300006847 Ga0075431_100078548 Ga0075431_1000785486 37
134 3300006847 Ga0075431_100106185 Ga0075431_1001061853 37
135 3300006847 Ga0075431_100120241 Ga0075431_1001202412 37
136 3300006847 Ga0075431_100170754 Ga0075431_1001707544 37
137 3300006847 Ga0075431_101155274 Ga0075431_1011552742 37
138 3300006847 Ga0075431_101258460 Ga0075431_1012584602 37
139 3300006847 Ga0075431_101705543 Ga0075431_1017055431 37
140 3300006852 Ga0075433_10002059 Ga0075433_100020599 37
141 3300006871 Ga0075434_100023641 Ga0075434_10002364110 37
142 3300006871 Ga0075434_100043618 Ga0075434_1000436185 37
143 3300006871 Ga0075434_100211572 Ga0075434_1002115722 37
144 3300006880 Ga0075429_100001166 Ga0075429_10000116629 37
145 3300006880 Ga0075429_100004700 Ga0075429_1000047002 37
146 3300006880 Ga0075429_100044520 Ga0075429_1000445202 37
147 3300006880 Ga0075429_100060587 Ga0075429_1000605875 37
148 3300006880 Ga0075429_100110304 Ga0075429_1001103045 37
149 3300006880 Ga0075429_100473292 Ga0075429_1004732922 37
150 3300006881 Ga0068865_100035387 Ga0068865_1000353873 37
151 3300006914 Ga0075436_101009698 Ga0075436_1010096982 37
152 3300006931 Ga0097620_100281232 Ga0097620_1002812325 37
153 3300006931 Ga0097620_101144284 Ga0097620_1011442842 37
154 3300007076 Ga0075435_100005458 Ga0075435_10000545811 37
155 3300007076 Ga0075435_100039831 Ga0075435_1000398314 37
156 3300007076 Ga0075435_100049942 Ga0075435_1000499423 37
157 3300007076 Ga0075435_100609975 Ga0075435_1006099752 37
158 3300007076 Ga0075435_101022430 Ga0075435_1010224302 37
159 3300007265 Ga0099794_10799147 Ga0099794_107991472 37
160 3300007788 Ga0099795_10052413 Ga0099795_100524133 37
161 3300009093 Ga0105240_10007000 Ga0105240_1000700018 37
162 3300009093 Ga0105240_10993896 Ga0105240_109938962 37
163 3300009093 Ga0105240_11583436 Ga0105240_115834362 37
164 3300009094 Ga0111539_10093408 Ga0111539_100934087 37
165 3300009094 Ga0111539_10195175 Ga0111539_101951754 37
166 3300009094 Ga0111539_10226930 Ga0111539_102269303 37
167 3300009094 Ga0111539_10231016 Ga0111539_102310165 37
168 3300009094 Ga0111539_10430352 Ga0111539_104303523 37
169 3300009094 Ga0111539_10619321 Ga0111539_106193213 37
170 3300009094 Ga0111539_11571081 Ga0111539_115710813 37
171 3300009094 Ga0111539_12236980 Ga0111539_122369802 37
172 3300009094 Ga0111539_12460724 Ga0111539_124607242 37
173 3300009094 Ga0111539_13121769 Ga0111539_131217692 37
174 3300009098 Ga0105245_10082473 Ga0105245_100824733 37
175 3300009098 Ga0105245_10150945 Ga0105245_101509454 37
176 3300009098 Ga0105245_10310475 Ga0105245_103104752 37
177 3300009098 Ga0105245_10634456 Ga0105245_106344563 37
178 3300009098 Ga0105245_11131502 Ga0105245_111315022 37
179 3300009098 Ga0105245_12731064 Ga0105245_127310642 37
180 3300009101 Ga0105247_10048269 Ga0105247_100482692 37
181 3300009101 Ga0105247_11526677 Ga0105247_115266772 37
182 3300009147 Ga0114129_10006513 Ga0114129_1000651316 37
183 3300009147 Ga0114129_10013234 Ga0114129_1001323419 37
184 3300009147 Ga0114129_10025778 Ga0114129_100257782 37
185 3300009147 Ga0114129_10082965 Ga0114129_100829654 37
186 3300009147 Ga0114129_10099332 Ga0114129_100993325 37
187 3300009147 Ga0114129_10223211 Ga0114129_102232114 37
188 3300009147 Ga0114129_10271883 Ga0114129_102718832 37
189 3300009147 Ga0114129_10513014 Ga0114129_105130143 37
190 3300009147 Ga0114129_12002090 Ga0114129_120020901 37
191 3300009147 Ga0114129_12244772 Ga0114129_122447722 37
192 3300009148 Ga0105243_10062864 Ga0105243_100628643 37
193 3300009148 Ga0105243_10249739 Ga0105243_102497392 37
194 3300009148 Ga0105243_10342869 Ga0105243_103428693 37
195 3300009148 Ga0105243_10607862 Ga0105243_106078622 37
196 3300009148 Ga0105243_10817676 Ga0105243_108176762 37
197 3300009148 Ga0105243_11149645 Ga0105243_111496452 37
198 3300009148 Ga0105243_11687061 Ga0105243_116870613 37
199 3300009148 Ga0105243_12172790 Ga0105243_121727901 37
200 3300009148 Ga0105243_12222467 Ga0105243_122224672 37
201 3300009148 Ga0105243_12437966 Ga0105243_124379662 37
202 3300009174 Ga0105241_10371461 Ga0105241_103714612 37
203 3300009174 Ga0105241_10415780 Ga0105241_104157802 37
204 3300009176 Ga0105242_10012654 Ga0105242_100126545 37
205 3300009176 Ga0105242_10574368 Ga0105242_105743682 37
206 3300009176 Ga0105242_10777121 Ga0105242_107771211 37
207 3300009176 Ga0105242_10780773 Ga0105242_107807732 37
208 3300009176 Ga0105242_12039619 Ga0105242_120396192 37
209 3300009177 Ga0105248_10053697 Ga0105248_100536972 37
210 3300009177 Ga0105248_10416602 Ga0105248_104166022 37
211 3300009177 Ga0105248_10863729 Ga0105248_108637293 37
212 3300009177 Ga0105248_11632957 Ga0105248_116329572 37
213 3300009551 Ga0105238_11275836 Ga0105238_112758362 37
214 3300009553 Ga0105249_10345397 Ga0105249_103453973 37
215 3300009553 Ga0105249_10411099 Ga0105249_104110993 37
216 3300009553 Ga0105249_11439393 Ga0105249_114393933 37
217 3300009553 Ga0105249_12202232 Ga0105249_122022322 37
218 3300009553 Ga0105249_12605481 Ga0105249_126054812 37
219 3300009986 Ga0105033_109861 Ga0105033_1098612 37
220 3300010375 Ga0105239_10013170 Ga0105239_100131707 37
221 3300010375 Ga0105239_10368183 Ga0105239_103681833 37
222 3300010375 Ga0105239_11198401 Ga0105239_111984012 37
223 3300010375 Ga0105239_11495136 Ga0105239_114951361 37
224 3300010375 Ga0105239_11744039 Ga0105239_117440392 37
225 3300010375 Ga0105239_12247135 Ga0105239_122471352 37
226 3300011119 Ga0105246_10314827 Ga0105246_103148272 37
227 3300011119 Ga0105246_12198978 Ga0105246_121989782 37
228 3300012487 Ga0157321_1040388 Ga0157321_10403882 37
229 3300012498 Ga0157345_1053613 Ga0157345_10536132 37
230 3300012507 Ga0157342_1032142 Ga0157342_10321422 37
231 3300013100 Ga0157373_10972599 Ga0157373_109725991 37
232 3300013104 Ga0157370_11230718 Ga0157370_112307181 37
233 3300013105 Ga0157369_10483634 Ga0157369_104836343 37
234 3300013296 Ga0157374_10019227 Ga0157374_100192277 37
235 3300013296 Ga0157374_11240886 Ga0157374_112408862 37
236 3300013296 Ga0157374_12107769 Ga0157374_121077691 37
237 3300013297 Ga0157378_10440646 Ga0157378_104406462 37
238 3300013306 Ga0163162_10037304 Ga0163162_100373044 37
239 3300013306 Ga0163162_10339309 Ga0163162_103393092 37
240 3300013306 Ga0163162_11549487 Ga0163162_115494872 37
241 3300013306 Ga0163162_11645319 Ga0163162_116453192 37
242 3300013306 Ga0163162_11873619 Ga0163162_118736191 37
243 3300013306 Ga0163162_12848947 Ga0163162_128489471 37
244 3300013306 Ga0163162_13121806 Ga0163162_131218062 37
245 3300013307 Ga0157372_10130298 Ga0157372_101302985 37
246 3300013307 Ga0157372_10190207 Ga0157372_101902075 37
247 3300013307 Ga0157372_11354252 Ga0157372_113542523 37
248 3300013308 Ga0157375_10105922 Ga0157375_101059223 37
249 3300013308 Ga0157375_10619490 Ga0157375_106194903 37
250 3300013308 Ga0157375_10840701 Ga0157375_108407013 37
251 3300013308 Ga0157375_11264445 Ga0157375_112644452 37
252 3300014325 Ga0163163_10057795 Ga0163163_100577952 37
253 3300014325 Ga0163163_10110359 Ga0163163_101103592 37
254 3300014325 Ga0163163_10953490 Ga0163163_109534903 37
255 3300014325 Ga0163163_11024680 Ga0163163_110246802 37
256 3300014325 Ga0163163_11147473 Ga0163163_111474733 37
257 3300014326 Ga0157380_10212948 Ga0157380_102129483 37
258 3300014326 Ga0157380_10748408 Ga0157380_107484082 37
259 3300014326 Ga0157380_11298625 Ga0157380_112986252 37
260 3300014326 Ga0157380_11733596 Ga0157380_117335961 37
261 3300014326 Ga0157380_12096932 Ga0157380_120969322 37
262 3300014745 Ga0157377_10520683 Ga0157377_105206832 37
263 3300014745 Ga0157377_10901522 Ga0157377_109015222 37
264 3300014968 Ga0157379_10032947 Ga0157379_100329473 37
265 3300014968 Ga0157379_10294062 Ga0157379_102940622 37
266 3300014969 Ga0157376_10666059 Ga0157376_106660592 37
267 3300014969 Ga0157376_11026965 Ga0157376_110269651 37
268 3300014969 Ga0157376_11219620 Ga0157376_112196203 37
269 3300014969 Ga0157376_12398880 Ga0157376_123988802 37
270 3300017792 Ga0163161_10373585 Ga0163161_103735852 37
271 3300017792 Ga0163161_12092319 Ga0163161_120923192 37
272 3300020069 Ga0197907_10258355 Ga0197907_102583554 37
273 3300020069 Ga0197907_10620110 Ga0197907_106201102 37
274 3300020069 Ga0197907_11085200 Ga0197907_110852001 37
275 3300020069 Ga0197907_11115412 Ga0197907_111154123 37
276 3300020070 Ga0206356_10270551 Ga0206356_102705513 37
277 3300020070 Ga0206356_11234993 Ga0206356_112349934 37
278 3300020070 Ga0206356_11556085 Ga0206356_115560852 37
279 3300020070 Ga0206356_11743183 Ga0206356_117431832 37
280 3300020075 Ga0206349_1666946 Ga0206349_16669464 37
281 3300020076 Ga0206355_1218665 Ga0206355_12186653 37
282 3300020076 Ga0206355_1249527 Ga0206355_12495272 37
283 3300020076 Ga0206355_1555461 Ga0206355_15554612 37
284 3300020076 Ga0206355_1569372 Ga0206355_15693722 37
285 3300020077 Ga0206351_10470750 Ga0206351_104707502 37
286 3300020078 Ga0206352_10027235 Ga0206352_100272352 37
287 3300020078 Ga0206352_10918135 Ga0206352_109181353 37
288 3300020078 Ga0206352_11023359 Ga0206352_110233592 37
289 3300020080 Ga0206350_10805923 Ga0206350_108059232 37
290 3300020080 Ga0206350_11515923 Ga0206350_115159232 37
291 3300020081 Ga0206354_10307830 Ga0206354_103078301 37
292 3300020081 Ga0206354_11486946 Ga0206354_114869462 37
293 3300020082 Ga0206353_11237824 Ga0206353_112378242 37
294 3300020082 Ga0206353_11793639 Ga0206353_117936392 37
295 3300020082 Ga0206353_11882423 Ga0206353_118824233 37
296 3300020610 Ga0154015_1210807 Ga0154015_12108073 37
297 3300021358 Ga0213873_10066290 Ga0213873_100662901 37
298 3300021377 Ga0213874_10087910 Ga0213874_100879102 37
299 3300021377 Ga0213874_10135052 Ga0213874_101350522 37
300 3300021377 Ga0213874_10205100 Ga0213874_102051002 37
301 3300021384 Ga0213876_10034422 Ga0213876_100344223 37
302 3300021384 Ga0213876_10083012 Ga0213876_100830122 37
303 3300021384 Ga0213876_10102352 Ga0213876_101023522 37
304 3300021384 Ga0213876_10421279 Ga0213876_104212792 37
305 3300021384 Ga0213876_10596061 Ga0213876_105960612 37
306 3300021384 Ga0213876_10729183 Ga0213876_107291832 37
307 3300021441 Ga0213871_10017971 Ga0213871_100179714 37
308 3300022467 Ga0224712_10019428 Ga0224712_100194285 37
309 3300022467 Ga0224712_10625034 Ga0224712_106250342 37
310 3300022467 Ga0224712_10653806 Ga0224712_106538062 37
311 3300023563 Ga0247530_115070 Ga0247530_1150701 37
312 3300025899 Ga0207642_10002029 Ga0207642_100020294 37
313 3300025900 Ga0207710_10362921 Ga0207710_103629212 37
314 3300025901 Ga0207688_10181428 Ga0207688_101814282 37
315 3300025901 Ga0207688_10576728 Ga0207688_105767282 37
316 3300025905 Ga0207685_10209073 Ga0207685_102090733 37
317 3300025906 Ga0207699_10044166 Ga0207699_100441664 37
318 3300025907 Ga0207645_10350571 Ga0207645_103505713 37
319 3300025908 Ga0207643_10224329 Ga0207643_102243293 37
320 3300025909 Ga0207705_10009427 Ga0207705_100094274 37
321 3300025910 Ga0207684_10070149 Ga0207684_100701494 37
322 3300025910 Ga0207684_10185008 Ga0207684_101850083 37
323 3300025910 Ga0207684_10342453 Ga0207684_103424533 37
324 3300025910 Ga0207684_10726960 Ga0207684_107269602 37
325 3300025911 Ga0207654_10247971 Ga0207654_102479712 37
326 3300025912 Ga0207707_10135393 Ga0207707_101353935 37
327 3300025912 Ga0207707_11070003 Ga0207707_110700033 37
328 3300025913 Ga0207695_10034632 Ga0207695_100346324 37
329 3300025915 Ga0207693_10017254 Ga0207693_1001725410 37
330 3300025915 Ga0207693_10371873 Ga0207693_103718733 37
331 3300025916 Ga0207663_10002584 Ga0207663_1000258416 37
332 3300025916 Ga0207663_10027394 Ga0207663_100273945 37
333 3300025916 Ga0207663_11081200 Ga0207663_110812002 37
334 3300025917 Ga0207660_10660205 Ga0207660_106602052 37
335 3300025918 Ga0207662_10015067 Ga0207662_100150674 37
336 3300025918 Ga0207662_10125506 Ga0207662_101255063 37
337 3300025918 Ga0207662_10740294 Ga0207662_107402943 37
338 3300025918 Ga0207662_10812670 Ga0207662_108126701 37
339 3300025920 Ga0207649_10491792 Ga0207649_104917923 37
340 3300025921 Ga0207652_10221802 Ga0207652_102218023 37
341 3300025922 Ga0207646_10011554 Ga0207646_1001155411 37
342 3300025922 Ga0207646_10093958 Ga0207646_100939585 37
343 3300025922 Ga0207646_10228538 Ga0207646_102285382 37
344 3300025922 Ga0207646_10264694 Ga0207646_102646943 37
345 3300025922 Ga0207646_11018016 Ga0207646_110180163 37
346 3300025923 Ga0207681_10033390 Ga0207681_100333904 37
347 3300025926 Ga0207659_10790057 Ga0207659_107900571 37
348 3300025926 Ga0207659_11350763 Ga0207659_113507632 37
349 3300025927 Ga0207687_10136748 Ga0207687_101367484 37
350 3300025927 Ga0207687_10356844 Ga0207687_103568443 37
351 3300025927 Ga0207687_10901415 Ga0207687_109014152 37
352 3300025928 Ga0207700_10041454 Ga0207700_100414543 37
353 3300025928 Ga0207700_10074224 Ga0207700_100742244 37
354 3300025928 Ga0207700_10671889 Ga0207700_106718892 37
355 3300025928 Ga0207700_10850108 Ga0207700_108501083 37
356 3300025929 Ga0207664_10026076 Ga0207664_100260764 37
357 3300025929 Ga0207664_10047208 Ga0207664_100472086 37
358 3300025929 Ga0207664_10365484 Ga0207664_103654842 37
359 3300025929 Ga0207664_10858743 Ga0207664_108587431 37
360 3300025932 Ga0207690_10889131 Ga0207690_108891313 37
361 3300025933 Ga0207706_10040831 Ga0207706_100408316 37
362 3300025933 Ga0207706_10258344 Ga0207706_102583442 37
363 3300025933 Ga0207706_10460204 Ga0207706_104602041 37
364 3300025933 Ga0207706_10971320 Ga0207706_109713202 37
365 3300025933 Ga0207706_11108725 Ga0207706_111087252 37
366 3300025933 Ga0207706_11308674 Ga0207706_113086742 37
367 3300025934 Ga0207686_10011426 Ga0207686_100114266 37
368 3300025934 Ga0207686_10044161 Ga0207686_100441613 37
369 3300025934 Ga0207686_10424916 Ga0207686_104249162 37
370 3300025934 Ga0207686_10489881 Ga0207686_104898813 37
371 3300025934 Ga0207686_10759341 Ga0207686_107593412 37
372 3300025935 Ga0207709_10063111 Ga0207709_100631112 37
373 3300025935 Ga0207709_10639696 Ga0207709_106396963 37
374 3300025935 Ga0207709_10882745 Ga0207709_108827452 37
375 3300025935 Ga0207709_10999538 Ga0207709_109995382 37
376 3300025935 Ga0207709_11611611 Ga0207709_116116112 37
377 3300025935 Ga0207709_11668052 Ga0207709_116680522 37
378 3300025936 Ga0207670_11228146 Ga0207670_112281461 37
379 3300025936 Ga0207670_11299459 Ga0207670_112994592 37
380 3300025937 Ga0207669_10057949 Ga0207669_100579495 37
381 3300025937 Ga0207669_10197025 Ga0207669_101970254 37
382 3300025937 Ga0207669_10210501 Ga0207669_102105012 37
383 3300025937 Ga0207669_11759566 Ga0207669_117595662 37
384 3300025938 Ga0207704_11190189 Ga0207704_111901892 37
385 3300025939 Ga0207665_10015265 Ga0207665_100152656 37
386 3300025939 Ga0207665_10929373 Ga0207665_109293732 37
387 3300025940 Ga0207691_10100228 Ga0207691_101002285 37
388 3300025940 Ga0207691_10121532 Ga0207691_101215325 37
389 3300025940 Ga0207691_10313760 Ga0207691_103137603 37
390 3300025940 Ga0207691_10578467 Ga0207691_105784673 37
391 3300025940 Ga0207691_11137882 Ga0207691_111378822 37
392 3300025941 Ga0207711_10388235 Ga0207711_103882352 37
393 3300025942 Ga0207689_10193029 Ga0207689_101930294 37
394 3300025942 Ga0207689_10267765 Ga0207689_102677652 37
395 3300025942 Ga0207689_10489762 Ga0207689_104897621 37
396 3300025944 Ga0207661_11087398 Ga0207661_110873983 37
397 3300025944 Ga0207661_12017330 Ga0207661_120173301 37
398 3300025945 Ga0207679_10113478 Ga0207679_101134784 37
399 3300025945 Ga0207679_11333049 Ga0207679_113330492 37
400 3300025949 Ga0207667_10187688 Ga0207667_101876883 37
401 3300025960 Ga0207651_11105192 Ga0207651_111051923 37
402 3300025960 Ga0207651_11885429 Ga0207651_118854292 37
403 3300025961 Ga0207712_10111301 Ga0207712_101113013 37
404 3300025961 Ga0207712_11324168 Ga0207712_113241682 37
405 3300025961 Ga0207712_11548078 Ga0207712_115480782 37
406 3300025972 Ga0207668_10980043 Ga0207668_109800432 37
407 3300025972 Ga0207668_11348190 Ga0207668_113481902 37
408 3300025981 Ga0207640_10254812 Ga0207640_102548123 37
409 3300025981 Ga0207640_10991987 Ga0207640_109919872 37
410 3300025986 Ga0207658_10564923 Ga0207658_105649232 37
411 3300025986 Ga0207658_10632092 Ga0207658_106320923 37
412 3300025986 Ga0207658_11372343 Ga0207658_113723432 37
413 3300026023 Ga0207677_10054605 Ga0207677_100546055 37
414 3300026023 Ga0207677_10585281 Ga0207677_105852813 37
415 3300026023 Ga0207677_10669944 Ga0207677_106699443 37
416 3300026035 Ga0207703_10063898 Ga0207703_100638983 37
417 3300026035 Ga0207703_10127047 Ga0207703_101270472 37
418 3300026035 Ga0207703_10327840 Ga0207703_103278402 37
419 3300026035 Ga0207703_11025894 Ga0207703_110258942 37
420 3300026035 Ga0207703_11187853 Ga0207703_111878532 37
421 3300026035 Ga0207703_11768936 Ga0207703_117689362 37
422 3300026067 Ga0207678_10134622 Ga0207678_101346222 37
423 3300026075 Ga0207708_10037086 Ga0207708_100370866 37
424 3300026075 Ga0207708_10081745 Ga0207708_100817454 37
425 3300026075 Ga0207708_10324981 Ga0207708_103249813 37
426 3300026075 Ga0207708_10481674 Ga0207708_104816743 37
427 3300026078 Ga0207702_10006558 Ga0207702_100065589 37
428 3300026078 Ga0207702_10408250 Ga0207702_104082504 37
429 3300026078 Ga0207702_10503454 Ga0207702_105034543 37
430 3300026088 Ga0207641_10766978 Ga0207641_107669783 37
431 3300026088 Ga0207641_10900046 Ga0207641_109000462 37
432 3300026089 Ga0207648_10651786 Ga0207648_106517863 37
433 3300026089 Ga0207648_11005978 Ga0207648_110059781 37
434 3300026095 Ga0207676_10756755 Ga0207676_107567552 37
435 3300026095 Ga0207676_11479899 Ga0207676_114798992 37
436 3300026116 Ga0207674_10641893 Ga0207674_106418932 37
437 3300026118 Ga0207675_100032376 Ga0207675_1000323766 37
438 3300026118 Ga0207675_102693386 Ga0207675_1026933862 37
439 3300026121 Ga0207683_10002428 Ga0207683_1000242811 37
440 3300026121 Ga0207683_10046790 Ga0207683_100467905 37
441 3300026121 Ga0207683_10058103 Ga0207683_100581034 37
442 3300026121 Ga0207683_10155563 Ga0207683_101555632 37
443 3300026121 Ga0207683_10559281 Ga0207683_105592813 37
444 3300026121 Ga0207683_11298364 Ga0207683_112983642 37
445 3300026121 Ga0207683_11371799 Ga0207683_113717992 37
446 3300026142 Ga0207698_12129983 Ga0207698_121299832 37
447 3300027512 Ga0209179_1148793 Ga0209179_11487932 37
448 3300027671 Ga0209588_1260670 Ga0209588_12606702 37
449 3300027717 Ga0209998_10024310 Ga0209998_100243103 37
450 3300027907 Ga0207428_10003880 Ga0207428_1000388017 37
451 3300027907 Ga0207428_10004795 Ga0207428_100047955 37
452 3300027907 Ga0207428_10236957 Ga0207428_102369573 37
453 3300027907 Ga0207428_11033522 Ga0207428_110335222 37
454 3300027907 Ga0207428_11115952 Ga0207428_111159522 37
455 3300027907 Ga0207428_11255483 Ga0207428_112554832 37
456 3300028379 Ga0268266_10444982 Ga0268266_104449822 37
457 3300028380 Ga0268265_11835305 Ga0268265_118353051 37
458 3300028381 Ga0268264_10907384 Ga0268264_109073842 37
459 3300028381 Ga0268264_10925479 Ga0268264_109254792 37
460 3300028558 Ga0265326_10052191 Ga0265326_100521912 37
461 3300028563 Ga0265319_1134171 Ga0265319_11341712 37
462 3300028573 Ga0265334_10041588 Ga0265334_100415884 37
463 3300028666 Ga0265336_10160758 Ga0265336_101607582 37
464 3300028666 Ga0265336_10233716 Ga0265336_102337162 37
465 3300028800 Ga0265338_10001469 Ga0265338_1000146931 37
466 3300028800 Ga0265338_10029477 Ga0265338_100294774 37
467 3300028800 Ga0265338_10030307 Ga0265338_100303075 37
468 3300028800 Ga0265338_10118712 Ga0265338_101187122 37
469 3300028800 Ga0265338_10172860 Ga0265338_101728602 37
470 3300029957 Ga0265324_10006460 Ga0265324_100064604 37
471 3300030733 Ga0314311_1085012 Ga0314311_10850122 37
472 3300030742 Ga0316183_1159347 Ga0316183_11593472 37
473 3300030745 Ga0316182_1077039 Ga0316182_10770394 37
474 3300031240 Ga0265320_10002674 Ga0265320_100026746 37
475 3300031241 Ga0265325_10009375 Ga0265325_1000937510 37
476 3300031242 Ga0265329_10003710 Ga0265329_100037103 37
477 3300031249 Ga0265339_10030245 Ga0265339_100302454 37
478 3300031249 Ga0265339_10074487 Ga0265339_100744874 37
479 3300031251 Ga0265327_10002304 Ga0265327_1000230414 37
480 3300031251 Ga0265327_10024946 Ga0265327_100249467 37
481 3300031251 Ga0265327_10030079 Ga0265327_100300793 37
482 3300031251 Ga0265327_10062804 Ga0265327_100628042 37
483 3300031344 Ga0265316_10059571 Ga0265316_100595713 37
484 3300031548 Ga0307408_100649122 Ga0307408_1006491222 37
485 3300031691 Ga0316579_10299121 Ga0316579_102991212 37
486 3300031691 Ga0316579_10665151 Ga0316579_106651512 37
487 3300031712 Ga0265342_10102357 Ga0265342_101023572 37
488 3300031727 Ga0316576_10002775 Ga0316576_1000277515 37
489 3300031727 Ga0316576_10011929 Ga0316576_100119293 37
490 3300031727 Ga0316576_10109103 Ga0316576_101091035 37
491 3300031728 Ga0316578_10049797 Ga0316578_100497975 37
492 3300031728 Ga0316578_10064645 Ga0316578_100646454 37
493 3300031731 Ga0307405_11707035 Ga0307405_117070351 37
494 3300031733 Ga0316577_10058560 Ga0316577_100585602 37
495 3300031733 Ga0316577_10061403 Ga0316577_100614033 37
496 3300031733 Ga0316577_10170344 Ga0316577_101703443 37
497 3300031824 Ga0307413_10746419 Ga0307413_107464192 37
498 3300031824 Ga0307413_10980814 Ga0307413_109808142 37
499 3300031824 Ga0307413_11367017 Ga0307413_113670172 37
500 3300031824 Ga0307413_12140130 Ga0307413_121401301 37
501 3300031824 Ga0307413_12174952 Ga0307413_121749522 37
502 3300031852 Ga0307410_11761364 Ga0307410_117613642 37
503 3300031903 Ga0307407_10575870 Ga0307407_105758703 37
504 3300031995 Ga0307409_100018566 Ga0307409_1000185669 37
505 3300031995 Ga0307409_100082399 Ga0307409_1000823994 37
506 3300031995 Ga0307409_102779131 Ga0307409_1027791311 37
507 3300032002 Ga0307416_100437756 Ga0307416_1004377563 37
508 3300032002 Ga0307416_100829733 Ga0307416_1008297332 37
509 3300032002 Ga0307416_103869188 Ga0307416_1038691882 37
510 3300032005 Ga0307411_10715681 Ga0307411_107156812 37
511 3300032005 Ga0307411_11030165 Ga0307411_110301652 37
512 3300032005 Ga0307411_11365116 Ga0307411_113651162 37
513 3300032126 Ga0307415_100023176 Ga0307415_1000231765 37
514 3300032126 Ga0307415_100067206 Ga0307415_1000672065 37
515 3300032133 Ga0316583_10239032 Ga0316583_102390322 37
516 3300032137 Ga0316585_10017603 Ga0316585_100176033 37
517 3300032139 Ga0316580_10010964 Ga0316580_100109644 37
518 3300032168 Ga0316593_10105141 Ga0316593_101051412 37
519 3300033528 Ga0316588_1005594 Ga0316588_10055945 37
520 3300033541 Ga0316596_1054680 Ga0316596_10546802 37
521 3300035089 Ga0373944_0006098 Ga0373944_0006098_810_923 37
522 3300035091 Ga0373951_0003481 Ga0373951_0003481_248_361 37
523 3300035091 Ga0373951_0184421 Ga0373951_0184421_404_517 37
524 3300035091 Ga0373951_0200926 Ga0373951_0200926_288_401 37
525 3300035092 Ga0373952_0281538 Ga0373952_0281538_298_411 37
526 3300035112 Ga0373932_0224886 Ga0373932_0224886_198_311 37
527 3300035113 Ga0373936_0280733 Ga0373936_0280733_124_237 37
528 3300035113 Ga0373936_0502737 Ga0373936_0502737_65_178 37
529 3300035113 Ga0373936_0592901 Ga0373936_0592901_180_293 37
530 3300035114 Ga0373939_0305077 Ga0373939_0305077_508_621 37
531 3300035114 Ga0373939_0414179 Ga0373939_0414179_214_327 37
532 3300035115 Ga0373941_0088105 Ga0373941_0088105_318_431 37
533 3300035115 Ga0373941_0129882 Ga0373941_0129882_325_438 37
534 3300035116 Ga0373945_0010376 Ga0373945_0010376_2397_2510 37
535 3300035121 Ga0373960_0005204 Ga0373960_0005204_2288_2401 37
536 3300035170 Ga0373943_0015500 Ga0373943_0015500_882_995 37
537 3300035170 Ga0373943_0062916 Ga0373943_0062916_375_488 37
538 3300035170 Ga0373943_0142890 Ga0373943_0142890_226_339 37
539 3300035171 Ga0373946_0361526 Ga0373946_0361526_152_265 37
540 3300035242 Ga0373962_0243334 Ga0373962_0243334_124_237 37
541 3300035398 Ga0316574_0004169 Ga0316574_0004169_6347_6460 37
542 3300035398 Ga0316574_0146215 Ga0316574_0146215_848_961 37
543 3300035691 Ga0373931_0042228 Ga0373931_0042228_28_141 37
544 3300035692 Ga0373935_0217831 Ga0373935_0217831_434_547 37
545 3300035692 Ga0373935_0307940 Ga0373935_0307940_306_419 37
546 3300035695 Ga0373927_0388800 Ga0373927_0388800_626_739 37
547 3300035695 Ga0373927_0921639 Ga0373927_0921639_427_540 37
548 3300035724 Ga0373933_0940945 Ga0373933_0940945_138_251 37
549 3300035725 Ga0373947_0020846 Ga0373947_0020846_2591_2704 37
550 3300035725 Ga0373947_0078612 Ga0373947_0078612_1546_1659 37
551 3300035725 Ga0373947_0131617 Ga0373947_0131617_873_986 37
552 3300035725 Ga0373947_0245579 Ga0373947_0245579_634_747 37
553 3300036401 Ga0373937_0008344 Ga0373937_0008344_8339_8452 37
554 3300036647 Ga0316582_0033791 Ga0316582_0033791_702_815 37
555 3300036647 Ga0316582_0081939 Ga0316582_0081939_1961_2074 37
556 3300036647 Ga0316582_0112039 Ga0316582_0112039_1032_1145 37
557 3300036712 Ga0316584_0040686 Ga0316584_0040686_2385_2498 37
558 3300036712 Ga0316584_0180208 Ga0316584_0180208_430_543 37
559 3300036712 Ga0316584_0182070 Ga0316584_0182070_1157_1270 37
560 3300037068 Ga0373925_0050349 Ga0373925_0050349_1685_1798 37
561 3300037068 Ga0373925_0273137 Ga0373925_0273137_154_267 37
562 3300037068 Ga0373925_0474265 Ga0373925_0474265_378_491 37
563 3300037068 Ga0373925_0776016 Ga0373925_0776016_197_310 37
564 3300037068 Ga0373925_1794760 Ga0373925_1794760_282_395 37
565 3300037312 Ga0395899_0004680 Ga0395899_0004680_2215_2328 37
566 3300037312 Ga0395899_0005677 Ga0395899_0005677_7770_7883 37
567 3300037312 Ga0395899_0023473 Ga0395899_0023473_3969_4082 37
568 3300037312 Ga0395899_0412777 Ga0395899_0412777_223_336 37
569 3300037418 Ga0395900_0000743 Ga0395900_0000743_18412_18525 37
570 3300037418 Ga0395900_0006166 Ga0395900_0006166_6988_7101 37
571 3300037418 Ga0395900_0013025 Ga0395900_0013025_5791_5904 37
572 3300037418 Ga0395900_0072926 Ga0395900_0072926_524_637 37
573 3300037418 Ga0395900_0160339 Ga0395900_0160339_2017_2130 37
574 3300037418 Ga0395900_0286161 Ga0395900_0286161_914_1027 37
575 3300037418 Ga0395900_0298875 Ga0395900_0298875_643_756 37
576 3300037418 Ga0395900_0308758 Ga0395900_0308758_1438_1551 37
577 3300037418 Ga0395900_0312877 Ga0395900_0312877_1391_1504 37
578 3300037418 Ga0395900_0385254 Ga0395900_0385254_549_662 37
579 3300037418 Ga0395900_0455995 Ga0395900_0455995_402_515 37
580 3300037418 Ga0395900_0514218 Ga0395900_0514218_581_694 37
581 3300037418 Ga0395900_0702937 Ga0395900_0702937_676_789 37
582 3300037418 Ga0395900_1241036 Ga0395900_1241036_127_240 37
583 3300037418 Ga0395900_1351163 Ga0395900_1351163_472_585 37
584 3300037418 Ga0395900_1368868 Ga0395900_1368868_422_535 37
585 3300037466 Ga0395898_0004731 Ga0395898_0004731_9056_9169 37
586 3300037466 Ga0395898_0013971 Ga0395898_0013971_1176_1289 37
587 3300037466 Ga0395898_0043063 Ga0395898_0043063_526_639 37
588 3300037466 Ga0395898_0316427 Ga0395898_0316427_992_1105 37
589 3300037466 Ga0395898_0426786 Ga0395898_0426786_462_575 37
590 3300037466 Ga0395898_0513325 Ga0395898_0513325_413_526 37
591 3300037466 Ga0395898_1953112 Ga0395898_1953112_225_338 37
592 3300037471 Ga0395905_0001396 Ga0395905_0001396_7621_7734 37
593 3300037471 Ga0395905_0002827 Ga0395905_0002827_16932_17045 37
594 3300037471 Ga0395905_0038325 Ga0395905_0038325_913_1026 37
595 3300037471 Ga0395905_0044492 Ga0395905_0044492_3885_3998 37
596 3300037471 Ga0395905_0087327 Ga0395905_0087327_2244_2357 37
597 3300037471 Ga0395905_0102377 Ga0395905_0102377_1608_1721 37
598 3300037471 Ga0395905_0103220 Ga0395905_0103220_1004_1117 37
599 3300037471 Ga0395905_0874881 Ga0395905_0874881_267_380 37
600 3300037471 Ga0395905_1004334 Ga0395905_1004334_510_623 37
601 3300037588 Ga0316581_0031946 Ga0316581_0031946_801_914 37
602 3300037853 Ga0436364_0536177 Ga0436364_0536177_279_392 37
603 3300037853 Ga0436364_0561570 Ga0436364_0561570_361_474 37
604 3300037853 Ga0436364_0900074 Ga0436364_0900074_1149_1262 37
605 3300037853 Ga0436364_0952678 Ga0436364_0952678_352_468 37
606 3300037853 Ga0436364_1457480 Ga0436364_1457480_376_489 37
607 3300038443 Ga0395901_0000608 Ga0395901_0000608_15540_15653 37
608 3300038443 Ga0395901_0001625 Ga0395901_0001625_1456_1569 37
609 3300038443 Ga0395901_0020069 Ga0395901_0020069_2600_2713 37
610 3300038443 Ga0395901_0020104 Ga0395901_0020104_1615_1728 37
611 3300038443 Ga0395901_0042627 Ga0395901_0042627_4097_4210 37
612 3300038443 Ga0395901_0043546 Ga0395901_0043546_296_409 37
613 3300038443 Ga0395901_0077724 Ga0395901_0077724_1217_1330 37
614 3300038443 Ga0395901_0118129 Ga0395901_0118129_1069_1182 37
615 3300038443 Ga0395901_0247269 Ga0395901_0247269_552_665 37
616 3300038443 Ga0395901_0345921 Ga0395901_0345921_1088_1201 37
617 3300038443 Ga0395901_0492767 Ga0395901_0492767_134_247 37
618 3300038443 Ga0395901_0711481 Ga0395901_0711481_238_351 37
619 3300038443 Ga0395901_1002826 Ga0395901_1002826_430_543 37
620 3300038443 Ga0395901_1518717 Ga0395901_1518717_497_610 37
621 3300038443 Ga0395901_1762724 Ga0395901_1762724_221_334 37
622 3300038443 Ga0395901_2119039 Ga0395901_2119039_84_197 37
623 3300038996 Ga0242420_071778 Ga0242420_071778_253_366 37
624 3300039437 Ga0436365_0197615 Ga0436365_0197615_40_153 37
625 3300039437 Ga0436365_0229577 Ga0436365_0229577_444_557 37
626 3300039437 Ga0436365_0340703 Ga0436365_0340703_864_977 37
627 3300039437 Ga0436365_0744423 Ga0436365_0744423_380_493 37
628 3300039437 Ga0436365_0828602 Ga0436365_0828602_594_707 37
629 3300039437 Ga0436365_1123200 Ga0436365_1123200_3074_3187 37
630 3300039437 Ga0436365_1317203 Ga0436365_1317203_104_217 37
631 3300039437 Ga0436365_1340450 Ga0436365_1340450_1339_1452 37
632 3300039437 Ga0436365_1353011 Ga0436365_1353011_379_492 37
633 3300039437 Ga0436365_1701879 Ga0436365_1701879_65_178 37
634 3300039437 Ga0436365_1808656 Ga0436365_1808656_3650_3763 37
635 3300039450 Ga0436363_0020748 Ga0436363_0020748_511_624 37
636 3300039450 Ga0436363_0311018 Ga0436363_0311018_148_261 37
637 3300039450 Ga0436363_0859085 Ga0436363_0859085_741_854 37
638 3300039450 Ga0436363_1231148 Ga0436363_1231148_721_834 37
639 3300039450 Ga0436363_1680183 Ga0436363_1680183_52_165 37
640 3300039453 Ga0436362_0090517 Ga0436362_0090517_1452_1565 37
641 3300039453 Ga0436362_0151148 Ga0436362_0151148_7590_7703 37
642 3300039453 Ga0436362_0209718 Ga0436362_0209718_1128_1241 37
643 3300039453 Ga0436362_0241064 Ga0436362_0241064_23_136 37
644 3300041405 Ga0439438_010111 Ga0439438_010111_713_826 37
645 3300041410 Ga0439461_0122296 Ga0439461_0122296_237_350 37
646 3300041413 Ga0439465_0175579 Ga0439465_0175579_539_652 37
647 3300041413 Ga0439465_0203493 Ga0439465_0203493_503_616 37
648 3300041413 Ga0439465_0221005 Ga0439465_0221005_446_559 37
649 3300041441 Ga0451787_009211 Ga0451787_009211_669_782 37
650 3300041443 Ga0451789_0175977 Ga0451789_0175977_319_432 37
651 3300041443 Ga0451789_1195439 Ga0451789_1195439_155_268 37
652 3300041444 Ga0451790_05211 Ga0451790_05211_135_248 37
653 3300041444 Ga0451790_37377 Ga0451790_37377_247_360 37
654 3300041446 Ga0451794_49486 Ga0451794_49486_106_219 37
655 3300041451 Ga0451791_0088197 Ga0451791_0088197_131_244 37
656 3300041451 Ga0451791_0136570 Ga0451791_0136570_583_696 37
657 3300041451 Ga0451791_0508058 Ga0451791_0508058_74_187 37
658 3300041452 Ga0451793_0014665 Ga0451793_0014665_231_344 37
659 3300041458 Ga0451798_0513130 Ga0451798_0513130_750_863 37
660 3300041459 Ga0451800_0303440 Ga0451800_0303440_223_336 37
661 3300041459 Ga0451800_0413162 Ga0451800_0413162_499_612 37
662 3300041460 Ga0451802_0302952 Ga0451802_0302952_534_647 37
663 3300041461 Ga0451805_100082 Ga0451805_100082_134_247 37
664 3300041463 Ga0451804_0008972 Ga0451804_0008972_419_532 37
665 3300041463 Ga0451804_0437360 Ga0451804_0437360_476_589 37
666 3300041463 Ga0451804_0494228 Ga0451804_0494228_274_387 37
667 3300041464 Ga0451808_35197 Ga0451808_35197_299_412 37
668 3300041486 Ga0451807_0941007 Ga0451807_0941007_1038_1151 37
669 3300041486 Ga0451807_1407961 Ga0451807_1407961_136_249 37
670 3300041486 Ga0451807_1415391 Ga0451807_1415391_267_380 37
671 3300041491 Ga0451833_1121621 Ga0451833_1121621_832_945 37
672 3300041492 Ga0451835_0008708 Ga0451835_0008708_3510_3623 37
673 3300041494 Ga0451837_0685982 Ga0451837_0685982_1554_1667 37
674 3300041494 Ga0451837_1484235 Ga0451837_1484235_536_649 37
675 3300041496 Ga0451839_0891048 Ga0451839_0891048_1524_1637 37
676 3300041496 Ga0451839_1293502 Ga0451839_1293502_1777_1890 37
677 3300041498 Ga0451841_0277217 Ga0451841_0277217_511_624 37
678 3300041498 Ga0451841_0665373 Ga0451841_0665373_135_248 37
679 3300041501 Ga0451845_0158583 Ga0451845_0158583_2171_2284 37
680 3300041501 Ga0451845_0359913 Ga0451845_0359913_113_226 37
681 3300041503 Ga0451847_0500621 Ga0451847_0500621_40_153 37
682 3300041507 Ga0451851_0275059 Ga0451851_0275059_156_269 37
683 3300041507 Ga0451851_1282943 Ga0451851_1282943_495_608 37
684 3300041509 Ga0451843_0264872 Ga0451843_0264872_224_337 37
685 3300041509 Ga0451843_1399751 Ga0451843_1399751_239_352 37
686 3300041511 Ga0451855_0735930 Ga0451855_0735930_81_194 37
687 3300041512 Ga0451853_1647682 Ga0451853_1647682_245_358 37
688 3300041512 Ga0451853_3012778 Ga0451853_3012778_1995_2108 37
689 3300041997 Ga0439431_0021178 Ga0439431_0021178_457_570 37
690 3300042003 Ga0439443_017393 Ga0439443_017393_821_934 37
691 3300042004 Ga0439445_0030319 Ga0439445_0030319_519_632 37
692 3300042005 Ga0439448_0000738 Ga0439448_0000738_7408_7521 37
693 3300042005 Ga0439448_0013866 Ga0439448_0013866_2163_2276 37
694 3300042006 Ga0439432_035312 Ga0439432_035312_453_566 37
695 3300042006 Ga0439432_115337 Ga0439432_115337_285_398 37
696 3300042007 Ga0439449_0153350 Ga0439449_0153350_487_600 37
697 3300042008 Ga0439450_001793 Ga0439450_001793_647_760 37
698 3300042009 Ga0439451_017287 Ga0439451_017287_465_578 37
699 3300042010 Ga0439452_029613 Ga0439452_029613_717_830 37
700 3300042010 Ga0439452_101174 Ga0439452_101174_472_585 37
701 3300042011 Ga0439454_000646 Ga0439454_000646_2179_2292 37
702 3300042012 Ga0439455_0004924 Ga0439455_0004924_1118_1231 37
703 3300042013 Ga0439456_026694 Ga0439456_026694_449_562 37
704 3300042013 Ga0439456_045856 Ga0439456_045856_157_270 37
705 3300042013 Ga0439456_125549 Ga0439456_125549_367_480 37
706 3300042016 Ga0439463_001082 Ga0439463_001082_5087_5200 37
707 3300042126 Ga0450888_001730 Ga0450888_001730_458_571 37
708 3300042126 Ga0450888_062332 Ga0450888_062332_86_199 37
709 3300042137 Ga0450902_052021 Ga0450902_052021_130_243 37
710 3300042156 Ga0439446_0001975 Ga0439446_0001975_1247_1360 37
711 3300042156 Ga0439446_0163149 Ga0439446_0163149_12_125 37
712 3300042156 Ga0439446_0377694 Ga0439446_0377694_109_222 37
713 3300042157 Ga0439458_0202180 Ga0439458_0202180_92_205 37
714 3300042157 Ga0439458_0208571 Ga0439458_0208571_387_500 37
715 3300042435 Ga0439434_0004207 Ga0439434_0004207_2422_2535 37
716 3300042435 Ga0439434_0049167 Ga0439434_0049167_1131_1244 37
717 3300042435 Ga0439434_0081233 Ga0439434_0081233_176_289 37
718 3300042437 Ga0439444_0036505 Ga0439444_0036505_93_206 37
719 3300042438 Ga0439459_0064919 Ga0439459_0064919_262_375 37
720 3300042439 Ga0439464_0002672 Ga0439464_0002672_235_348 37
721 3300042439 Ga0439464_0105571 Ga0439464_0105571_171_284 37
722 3300042461 Ga0439460_0003483 Ga0439460_0003483_3199_3312 37
723 3300042461 Ga0439460_0098232 Ga0439460_0098232_659_772 37
724 3300042876 Ga0451577_0422092 Ga0451577_0422092_337_450 37
725 3300042993 Ga0439440_0008555 Ga0439440_0008555_558_671 37
726 3300044673 Ga0453683_0039498 Ga0453683_0039498_212_325 37
727 3300044673 Ga0453683_0133999 Ga0453683_0133999_1334_1447 37
728 3300044683 Ga0466965_0558722 Ga0466965_0558722_59_172 37
729 3300044683 Ga0466965_0588331 Ga0466965_0588331_136_249 37
730 3300044684 Ga0466966_0357651 Ga0466966_0357651_584_697 37
731 3300044684 Ga0466966_0657196 Ga0466966_0657196_333_446 37
732 3300044694 Ga0466963_0211351 Ga0466963_0211351_238_351 37
733 3300044694 Ga0466963_0351221 Ga0466963_0351221_715_828 37
734 3300044694 Ga0466963_0435099 Ga0466963_0435099_379_492 37
735 3300044694 Ga0466963_0699566 Ga0466963_0699566_325_438 37
736 3300044706 Ga0466964_0012030 Ga0466964_0012030_835_948 37
737 3300044706 Ga0466964_0016789 Ga0466964_0016789_1916_2029 37
738 3300044706 Ga0466964_0279706 Ga0466964_0279706_461_580 37
739 3300044712 Ga0453684_0397698 Ga0453684_0397698_286_399 37
740 3300044712 Ga0453684_0456657 Ga0453684_0456657_808_921 37
741 3300044735 Ga0466968_0381720 Ga0466968_0381720_551_664 37
742 3300044765 Ga0466970_0349513 Ga0466970_0349513_610_723 37
743 3300044842 Ga0466957_0259519 Ga0466957_0259519_353_466 37
744 3300044842 Ga0466957_0530152 Ga0466957_0530152_29_142 37
745 3300044901 Ga0466960_0006520 Ga0466960_0006520_1957_2070 37
746 3300044901 Ga0466960_0068730 Ga0466960_0068730_1470_1583 37
747 3300044901 Ga0466960_0340934 Ga0466960_0340934_99_212 37
748 3300045051 Ga0451576_0119948 Ga0451576_0119948_2593_2706 37
749 3300045051 Ga0451576_0430696 Ga0451576_0430696_902_1015 37
750 3300045051 Ga0451576_0962207 Ga0451576_0962207_348_461 37
751 3300045976 Ga0466967_0003690 Ga0466967_0003690_835_948 37
752 3300045976 Ga0466967_0005405 Ga0466967_0005405_6631_6744 37
753 3300045976 Ga0466967_0040641 Ga0466967_0040641_31_144 37
754 3300045976 Ga0466967_0203713 Ga0466967_0203713_787_900 37
755 3300045976 Ga0466967_0561642 Ga0466967_0561642_704_817 37
756 3300045976 Ga0466967_0903807 Ga0466967_0903807_715_828 37
757 3300045976 Ga0466967_1122218 Ga0466967_1122218_381_494 37
758 3300046454 Ga0495592_0036627 Ga0495592_0036627_2132_2245 37
759 3300046454 Ga0495592_0082665 Ga0495592_0082665_558_671 37
760 3300046454 Ga0495592_0175635 Ga0495592_0175635_956_1069 37
761 3300046454 Ga0495592_0342809 Ga0495592_0342809_263_376 37
762 3300046455 Ga0495603_0000168 Ga0495603_0000168_10553_10666 37
763 3300046455 Ga0495603_0157712 Ga0495603_0157712_295_408 37
764 3300046455 Ga0495603_0310310 Ga0495603_0310310_365_478 37
765 3300046457 Ga0495590_0435443 Ga0495590_0435443_254_367 37
766 3300046459 Ga0495629_0004184 Ga0495629_0004184_9845_9958 37
767 3300046459 Ga0495629_0240986 Ga0495629_0240986_79_192 37
768 3300046459 Ga0495629_0300861 Ga0495629_0300861_934_1047 37
769 3300046459 Ga0495629_0426464 Ga0495629_0426464_67_180 37
770 3300046460 Ga0495638_0105562 Ga0495638_0105562_1497_1610 37
771 3300046461 Ga0495641_0003448 Ga0495641_0003448_7017_7130 37
772 3300046461 Ga0495641_0229710 Ga0495641_0229710_514_627 37
773 3300046462 Ga0495651_0004813 Ga0495651_0004813_8239_8352 37
774 3300046462 Ga0495651_0070491 Ga0495651_0070491_1951_2064 37
775 3300046462 Ga0495651_0187486 Ga0495651_0187486_445_558 37
776 3300046462 Ga0495651_0498577 Ga0495651_0498577_581_694 37
777 3300046463 Ga0495653_0010728 Ga0495653_0010728_3712_3825 37
778 3300046463 Ga0495653_0052427 Ga0495653_0052427_562_675 37
779 3300046463 Ga0495653_0219114 Ga0495653_0219114_204_317 37
780 3300046463 Ga0495653_0325959 Ga0495653_0325959_364_477 37
781 3300046472 Ga0495580_0446771 Ga0495580_0446771_207_320 37
782 3300046472 Ga0495580_0499832 Ga0495580_0499832_126_239 37
783 3300046473 Ga0495582_0226927 Ga0495582_0226927_684_797 37
784 3300046473 Ga0495582_0583651 Ga0495582_0583651_271_384 37
785 3300046473 Ga0495582_0693322 Ga0495582_0693322_349_462 37
786 3300046473 Ga0495582_0879198 Ga0495582_0879198_316_429 37
787 3300046475 Ga0495639_0063525 Ga0495639_0063525_218_331 37
788 3300046475 Ga0495639_0134542 Ga0495639_0134542_532_645 37
789 3300046475 Ga0495639_0688600 Ga0495639_0688600_96_209 37
790 3300046476 Ga0495662_0364693 Ga0495662_0364693_405_518 37
791 3300046477 Ga0495664_0019053 Ga0495664_0019053_292_405 37
792 3300046491 Ga0495584_0262552 Ga0495584_0262552_717_830 37
793 3300046499 Ga0495594_0001050 Ga0495594_0001050_4772_4885 37
794 3300046499 Ga0495594_0365510 Ga0495594_0365510_677_790 37
795 3300046499 Ga0495594_0448553 Ga0495594_0448553_101_214 37
796 3300046500 Ga0495596_0058481 Ga0495596_0058481_28_141 37
797 3300046500 Ga0495596_0148383 Ga0495596_0148383_193_306 37
798 3300046511 Ga0495608_0072159 Ga0495608_0072159_1482_1595 37
799 3300046511 Ga0495608_0156577 Ga0495608_0156577_690_803 37
800 3300046511 Ga0495608_0277858 Ga0495608_0277858_617_730 37
801 3300046514 Ga0495618_0033552 Ga0495618_0033552_2717_2830 37
802 3300046514 Ga0495618_0309800 Ga0495618_0309800_367_480 37
803 3300046514 Ga0495618_0325436 Ga0495618_0325436_718_831 37
804 3300046515 Ga0495620_0375255 Ga0495620_0375255_347_460 37
805 3300046516 Ga0495628_0003174 Ga0495628_0003174_3339_3452 37
806 3300046516 Ga0495628_0049859 Ga0495628_0049859_649_762 37
807 3300046517 Ga0495630_0010468 Ga0495630_0010468_1611_1724 37
808 3300046517 Ga0495630_0033447 Ga0495630_0033447_279_392 37
809 3300046517 Ga0495630_0102507 Ga0495630_0102507_590_703 37
810 3300046517 Ga0495630_0163659 Ga0495630_0163659_12_125 37
811 3300046517 Ga0495630_0350345 Ga0495630_0350345_923_1036 37
812 3300046517 Ga0495630_0420574 Ga0495630_0420574_825_941 37
813 3300046517 Ga0495630_0703841 Ga0495630_0703841_301_414 37
814 3300046517 Ga0495630_0703897 Ga0495630_0703897_529_642 37
815 3300046517 Ga0495630_1121075 Ga0495630_1121075_408_521 37
816 3300046518 Ga0495631_0117506 Ga0495631_0117506_773_886 37
817 3300046523 Ga0495644_0096638 Ga0495644_0096638_407_520 37
818 3300046523 Ga0495644_0269861 Ga0495644_0269861_399_512 37
819 3300046526 Ga0495666_0016962 Ga0495666_0016962_274_387 37
820 3300046526 Ga0495666_0094738 Ga0495666_0094738_397_510 37
821 3300046526 Ga0495666_0168852 Ga0495666_0168852_42_155 37
822 3300046529 Ga0495652_0116165 Ga0495652_0116165_723_836 37
823 3300046530 Ga0495654_0314944 Ga0495654_0314944_195_308 37
824 3300046531 Ga0495665_0178857 Ga0495665_0178857_656_769 37
825 3300046533 Ga0495640_0122993 Ga0495640_0122993_93_206 37
826 3300046533 Ga0495640_0429583 Ga0495640_0429583_355_468 37
827 3300046533 Ga0495640_0677507 Ga0495640_0677507_438_551 37
828 3300046536 Ga0495587_0041055 Ga0495587_0041055_1398_1511 37
829 3300046539 Ga0495621_0423664 Ga0495621_0423664_116_229 37
830 3300046543 Ga0495645_0204215 Ga0495645_0204215_83_196 37
831 3300046543 Ga0495645_0294996 Ga0495645_0294996_758_871 37
832 3300046557 Ga0495622_0391027 Ga0495622_0391027_310_423 37
833 3300046559 Ga0495667_0002578 Ga0495667_0002578_8583_8696 37
834 3300046559 Ga0495667_0059128 Ga0495667_0059128_1424_1537 37
835 3300046559 Ga0495667_0624142 Ga0495667_0624142_413_526 37
836 3300046615 Ga0495656_0127090 Ga0495656_0127090_947_1060 37
837 3300046616 Ga0495668_0441331 Ga0495668_0441331_450_563 37
838 3300046616 Ga0495668_0483032 Ga0495668_0483032_518_631 37
839 3300046616 Ga0495668_0550432 Ga0495668_0550432_391_504 37
840 3300046642 Ga0495634_0019308 Ga0495634_0019308_4089_4202 37
841 3300046642 Ga0495634_0165733 Ga0495634_0165733_85_198 37
842 3300046642 Ga0495634_0259888 Ga0495634_0259888_657_770 37
843 3300046642 Ga0495634_0806890 Ga0495634_0806890_145_258 37
844 3300046663 Ga0495635_0016528 Ga0495635_0016528_658_771 37
845 3300046663 Ga0495635_0400670 Ga0495635_0400670_163_276 37
846 3300046663 Ga0495635_0531815 Ga0495635_0531815_383_496 37
847 3300046674 Ga0495588_0000956 Ga0495588_0000956_11267_11380 37
848 3300046675 Ga0495657_0001765 Ga0495657_0001765_6184_6297 37
849 3300046675 Ga0495657_0036107 Ga0495657_0036107_2854_2967 37
850 3300046675 Ga0495657_0202178 Ga0495657_0202178_749_862 37
851 3300046675 Ga0495657_0391188 Ga0495657_0391188_276_389 37
852 3300046678 Ga0495599_0336105 Ga0495599_0336105_598_711 37
853 3300046678 Ga0495599_0817417 Ga0495599_0817417_212_325 37
854 3300046679 Ga0495623_0027040 Ga0495623_0027040_3113_3226 37
855 3300046679 Ga0495623_0454524 Ga0495623_0454524_254_367 37
856 3300046679 Ga0495623_0658305 Ga0495623_0658305_190_303 37
857 3300046680 Ga0495646_0156763 Ga0495646_0156763_488_601 37
858 3300046680 Ga0495646_0288877 Ga0495646_0288877_485_598 37
859 3300046681 Ga0495647_0006984 Ga0495647_0006984_1045_1158 37
860 3300046681 Ga0495647_0201665 Ga0495647_0201665_34_147 37
861 3300046681 Ga0495647_0637962 Ga0495647_0637962_109_222 37
862 3300046683 Ga0495658_0384595 Ga0495658_0384595_632_745 37
863 3300046683 Ga0495658_0444656 Ga0495658_0444656_646_759 37
864 3300046683 Ga0495658_0462977 Ga0495658_0462977_614_727 37
865 3300046683 Ga0495658_0690989 Ga0495658_0690989_333_446 37
866 3300046683 Ga0495658_0784023 Ga0495658_0784023_471_584 37
867 3300046689 Ga0495613_0005603 Ga0495613_0005603_151_264 37
868 3300046689 Ga0495613_0079445 Ga0495613_0079445_2120_2233 37
869 3300046689 Ga0495613_0745507 Ga0495613_0745507_109_222 37
870 3300046690 Ga0495624_0100202 Ga0495624_0100202_1276_1389 37
871 3300046690 Ga0495624_0299010 Ga0495624_0299010_381_494 37
872 3300046690 Ga0495624_0885134 Ga0495624_0885134_312_425 37
873 3300046694 Ga0495649_0358017 Ga0495649_0358017_208_321 37
874 3300046794 Ga0495589_0218593 Ga0495589_0218593_333_446 37
875 3300046809 Ga0495600_0016031 Ga0495600_0016031_1379_1492 37
876 3300046809 Ga0495600_0513385 Ga0495600_0513385_416_529 37
877 3300046809 Ga0495600_0726280 Ga0495600_0726280_394_507 37
878 3300047315 Ga0495581_0031097 Ga0495581_0031097_2763_2876 37
879 3300047315 Ga0495581_0145677 Ga0495581_0145677_440_553 37
880 3300047315 Ga0495581_0154866 Ga0495581_0154866_79_192 37
881 3300047315 Ga0495581_0567788 Ga0495581_0567788_238_351 37
882 3300047317 Ga0495604_0195072 Ga0495604_0195072_647_760 37
883 3300047317 Ga0495604_0347456 Ga0495604_0347456_128_241 37
884 3300047317 Ga0495604_0968997 Ga0495604_0968997_220_333 37
885 3300047319 Ga0495674_0167812 Ga0495674_0167812_1491_1604 37
886 3300047319 Ga0495674_0201212 Ga0495674_0201212_976_1089 37
887 3300047319 Ga0495674_0403444 Ga0495674_0403444_196_309 37
888 3300047319 Ga0495674_1373299 Ga0495674_1373299_110_223 37
889 3300047320 Ga0495672_0159988 Ga0495672_0159988_240_353 37
890 3300047320 Ga0495672_0495372 Ga0495672_0495372_264_377 37
891 3300047321 Ga0495676_0084655 Ga0495676_0084655_2074_2187 37
892 3300047321 Ga0495676_0104992 Ga0495676_0104992_1017_1130 37
893 3300047321 Ga0495676_0515466 Ga0495676_0515466_190_303 37
894 3300047321 Ga0495676_0608608 Ga0495676_0608608_163_276 37
895 3300047321 Ga0495676_1053132 Ga0495676_1053132_56_169 37
896 3300047322 Ga0495680_0004189 Ga0495680_0004189_8764_8877 37
897 3300047322 Ga0495680_0012097 Ga0495680_0012097_4797_4910 37
898 3300047322 Ga0495680_0611095 Ga0495680_0611095_121_234 37
899 3300047323 Ga0495683_0385139 Ga0495683_0385139_128_241 37
900 3300047444 Ga0495675_0068857 Ga0495675_0068857_397_510 37
901 3300047444 Ga0495675_0277372 Ga0495675_0277372_199_312 37
902 3300047446 Ga0495679_126689 Ga0495679_126689_551_664 37
903 3300047471 Ga0495684_0022720 Ga0495684_0022720_1338_1451 37
904 3300047471 Ga0495684_0080311 Ga0495684_0080311_2167_2280 37
905 3300047471 Ga0495684_0811219 Ga0495684_0811219_286_399 37
906 3300048088 Ga0495602_0076237 Ga0495602_0076237_1071_1184 37
907 3300048088 Ga0495602_0387786 Ga0495602_0387786_603_716 37
908 3300048089 Ga0495614_0128859 Ga0495614_0128859_258_371 37
909 3300048089 Ga0495614_0270257 Ga0495614_0270257_24_137 37
910 3300048903 Ga0496100_0008037 Ga0496100_0008037_947_1060 37
911 3300048903 Ga0496100_0022211 Ga0496100_0022211_1648_1761 37
912 3300048903 Ga0496100_0061790 Ga0496100_0061790_1678_1791 37
913 3300048903 Ga0496100_0106448 Ga0496100_0106448_1694_1807 37
914 3300048903 Ga0496100_0354564 Ga0496100_0354564_105_218 37
915 3300048903 Ga0496100_0485158 Ga0496100_0485158_278_391 37
916 3300048903 Ga0496100_1630522 Ga0496100_1630522_363_476 37
917 3300048904 Ga0496101_0009815 Ga0496101_0009815_1119_1232 37
918 3300048904 Ga0496101_0038241 Ga0496101_0038241_520_633 37
919 3300048904 Ga0496101_0057739 Ga0496101_0057739_1762_1875 37
920 3300048904 Ga0496101_0200038 Ga0496101_0200038_851_964 37
921 3300048904 Ga0496101_0236637 Ga0496101_0236637_709_822 37
922 3300048904 Ga0496101_0448192 Ga0496101_0448192_675_788 37
923 3300048904 Ga0496101_0612196 Ga0496101_0612196_620_733 37
924 3300048905 Ga0496102_0002726 Ga0496102_0002726_14376_14489 37
925 3300048905 Ga0496102_0007769 Ga0496102_0007769_6551_6664 37
926 3300048905 Ga0496102_0030776 Ga0496102_0030776_3621_3734 37
927 3300048905 Ga0496102_0099129 Ga0496102_0099129_854_967 37
928 3300048905 Ga0496102_0247766 Ga0496102_0247766_1104_1217 37
929 3300048905 Ga0496102_0366913 Ga0496102_0366913_1190_1303 37
930 3300048905 Ga0496102_0405867 Ga0496102_0405867_231_344 37
931 3300048905 Ga0496102_0612487 Ga0496102_0612487_734_847 37
932 3300048905 Ga0496102_0670352 Ga0496102_0670352_311_424 37
933 3300048905 Ga0496102_0868273 Ga0496102_0868273_501_614 37
934 3300048905 Ga0496102_0871661 Ga0496102_0871661_284_397 37
935 3300048905 Ga0496102_0915431 Ga0496102_0915431_259_372 37
936 3300048905 Ga0496102_0983837 Ga0496102_0983837_148_261 37
937 3300048905 Ga0496102_1680900 Ga0496102_1680900_46_159 37
938 3300048906 Ga0496103_0004577 Ga0496103_0004577_7043_7156 37
939 3300048906 Ga0496103_0056708 Ga0496103_0056708_288_401 37
940 3300048906 Ga0496103_0086610 Ga0496103_0086610_464_577 37
941 3300048906 Ga0496103_0273699 Ga0496103_0273699_526_639 37
942 3300048906 Ga0496103_0482780 Ga0496103_0482780_363_476 37
943 3300048906 Ga0496103_0570135 Ga0496103_0570135_150_263 37
944 3300048906 Ga0496103_0783089 Ga0496103_0783089_17_130 37
945 3300048906 Ga0496103_0927436 Ga0496103_0927436_304_417 37
946 3300048907 Ga0496104_0002622 Ga0496104_0002622_3255_3368 37
947 3300048907 Ga0496104_0074547 Ga0496104_0074547_2099_2212 37
948 3300048907 Ga0496104_0080130 Ga0496104_0080130_863_976 37
949 3300048907 Ga0496104_0080543 Ga0496104_0080543_2256_2369 37
950 3300048907 Ga0496104_0535460 Ga0496104_0535460_614_727 37
951 3300048907 Ga0496104_0638832 Ga0496104_0638832_207_320 37
952 3300048907 Ga0496104_0681200 Ga0496104_0681200_723_836 37
953 3300048908 Ga0496105_0013979 Ga0496105_0013979_1297_1410 37
954 3300048908 Ga0496105_0016649 Ga0496105_0016649_1093_1206 37
955 3300048908 Ga0496105_0035543 Ga0496105_0035543_498_611 37
956 3300048908 Ga0496105_0111871 Ga0496105_0111871_761_874 37
957 3300048908 Ga0496105_0127286 Ga0496105_0127286_901_1014 37
958 3300048908 Ga0496105_0137682 Ga0496105_0137682_905_1018 37
959 3300048908 Ga0496105_0320831 Ga0496105_0320831_924_1037 37
960 3300048908 Ga0496105_0340505 Ga0496105_0340505_520_633 37
961 3300048908 Ga0496105_0578070 Ga0496105_0578070_641_754 37
962 3300048909 Ga0496106_0005196 Ga0496106_0005196_7569_7682 37
963 3300048909 Ga0496106_0028397 Ga0496106_0028397_1382_1495 37
964 3300048909 Ga0496106_0066209 Ga0496106_0066209_1887_2000 37
965 3300048909 Ga0496106_0112787 Ga0496106_0112787_319_432 37
966 3300048909 Ga0496106_0378734 Ga0496106_0378734_341_454 37
967 3300048909 Ga0496106_1424211 Ga0496106_1424211_234_347 37
968 3300048909 Ga0496106_1467204 Ga0496106_1467204_310_423 37
969 3300048910 Ga0496107_0021521 Ga0496107_0021521_3426_3539 37
970 3300048910 Ga0496107_0042781 Ga0496107_0042781_1757_1870 37
971 3300048910 Ga0496107_0062203 Ga0496107_0062203_887_1000 37
972 3300048910 Ga0496107_0133619 Ga0496107_0133619_859_972 37
973 3300048910 Ga0496107_0140213 Ga0496107_0140213_443_556 37
974 3300048910 Ga0496107_0935766 Ga0496107_0935766_285_398 37
975 3300048911 Ga0496108_0002353 Ga0496108_0002353_3709_3822 37
976 3300048911 Ga0496108_0034475 Ga0496108_0034475_3610_3723 37
977 3300048911 Ga0496108_0236554 Ga0496108_0236554_670_783 37
978 3300048911 Ga0496108_0463970 Ga0496108_0463970_664_777 37
979 3300048911 Ga0496108_0644839 Ga0496108_0644839_288_401 37
980 3300048912 Ga0496109_0004037 Ga0496109_0004037_6044_6157 37
981 3300048912 Ga0496109_0004660 Ga0496109_0004660_7609_7722 37
982 3300048912 Ga0496109_0004743 Ga0496109_0004743_578_691 37
983 3300048912 Ga0496109_0042955 Ga0496109_0042955_2386_2499 37
984 3300048912 Ga0496109_0059427 Ga0496109_0059427_2833_2946 37
985 3300048912 Ga0496109_0247577 Ga0496109_0247577_1151_1264 37
986 3300048912 Ga0496109_0409977 Ga0496109_0409977_865_978 37
987 3300048912 Ga0496109_0588602 Ga0496109_0588602_903_1016 37
988 3300048912 Ga0496109_0667317 Ga0496109_0667317_555_668 37
989 3300048912 Ga0496109_1554458 Ga0496109_1554458_39_152 37
990 3300048913 Ga0496110_0000526 Ga0496110_0000526_19785_19898 37
991 3300048913 Ga0496110_0004643 Ga0496110_0004643_3650_3763 37
992 3300048913 Ga0496110_0011428 Ga0496110_0011428_2351_2464 37
993 3300048913 Ga0496110_0042026 Ga0496110_0042026_3154_3267 37
994 3300048913 Ga0496110_0156538 Ga0496110_0156538_1784_1897 37
995 3300048913 Ga0496110_0170208 Ga0496110_0170208_495_608 37
996 3300048913 Ga0496110_0173664 Ga0496110_0173664_734_847 37
997 3300048913 Ga0496110_0473091 Ga0496110_0473091_928_1041 37
998 3300048913 Ga0496110_0569043 Ga0496110_0569043_505_618 37
999 3300048913 Ga0496110_0651824 Ga0496110_0651824_346_462 37
1000 3300048914 Ga0496111_0010628 Ga0496111_0010628_2904_3017 37
1001 3300048914 Ga0496111_0016068 Ga0496111_0016068_1304_1417 37
1002 3300048914 Ga0496111_0025168 Ga0496111_0025168_2816_2929 37
1003 3300048914 Ga0496111_0031524 Ga0496111_0031524_131_244 37
1004 3300048914 Ga0496111_0045995 Ga0496111_0045995_530_643 37
1005 3300048914 Ga0496111_0286304 Ga0496111_0286304_444_557 37
1006 3300048914 Ga0496111_0600342 Ga0496111_0600342_363_476 37
1007 3300048914 Ga0496111_0801191 Ga0496111_0801191_341_454 37
1008 3300048914 Ga0496111_1350285 Ga0496111_1350285_271_384 37
1009 3300048915 Ga0496112_0044987 Ga0496112_0044987_2764_2877 37
1010 3300048915 Ga0496112_0063461 Ga0496112_0063461_2377_2490 37
1011 3300048915 Ga0496112_0082500 Ga0496112_0082500_756_869 37
1012 3300048915 Ga0496112_0291808 Ga0496112_0291808_1256_1369 37
1013 3300048915 Ga0496112_0691442 Ga0496112_0691442_77_190 37
1014 3300048915 Ga0496112_1441950 Ga0496112_1441950_102_215 37
1015 3300048916 Ga0496113_0004175 Ga0496113_0004175_517_630 37
1016 3300048916 Ga0496113_0018575 Ga0496113_0018575_2157_2270 37
1017 3300048916 Ga0496113_0559377 Ga0496113_0559377_354_467 37
1018 3300048916 Ga0496113_0716239 Ga0496113_0716239_25_138 37
1019 3300048916 Ga0496113_1529240 Ga0496113_1529240_179_292 37
1020 3300048917 Ga0496114_0004194 Ga0496114_0004194_9166_9279 37
1021 3300048917 Ga0496114_0005056 Ga0496114_0005056_2654_2767 37
1022 3300048917 Ga0496114_0017734 Ga0496114_0017734_1046_1159 37
1023 3300048917 Ga0496114_0024410 Ga0496114_0024410_3333_3446 37
1024 3300048917 Ga0496114_0053427 Ga0496114_0053427_21_134 37
1025 3300048917 Ga0496114_0069183 Ga0496114_0069183_2467_2580 37
1026 3300048917 Ga0496114_0080151 Ga0496114_0080151_1021_1134 37
1027 3300048917 Ga0496114_0280482 Ga0496114_0280482_572_685 37
1028 3300048917 Ga0496114_0431158 Ga0496114_0431158_998_1111 37
1029 3300048917 Ga0496114_0461627 Ga0496114_0461627_420_533 37
1030 3300048917 Ga0496114_0556571 Ga0496114_0556571_554_667 37
1031 3300048917 Ga0496114_0970135 Ga0496114_0970135_303_416 37
1032 3300048917 Ga0496114_1201885 Ga0496114_1201885_232_345 37
1033 3300048917 Ga0496114_1347259 Ga0496114_1347259_163_276 37
1034 3300048918 Ga0496115_0001699 Ga0496115_0001699_15414_15527 37
1035 3300048918 Ga0496115_0047476 Ga0496115_0047476_291_404 37
1036 3300048918 Ga0496115_0408568 Ga0496115_0408568_539_652 37
1037 3300048918 Ga0496115_0891202 Ga0496115_0891202_468_581 37
1038 3300048918 Ga0496115_1247961 Ga0496115_1247961_247_360 37
1039 3300048927 Ga0496124_0901048 Ga0496124_0901048_172_285 37
1040 3300049128 Ga0501308_038193 Ga0501308_038193_299_412 37
1041 3300049128 Ga0501308_076384 Ga0501308_076384_218_331 37
1042 3300049130 Ga0501310_016817 Ga0501310_016817_557_670 37
1043 3300049130 Ga0501310_051521 Ga0501310_051521_229_342 37
1044 3300049130 Ga0501310_079179 Ga0501310_079179_81_194 37
1045 3300049161 Ga0501305_049406 Ga0501305_049406_507_620 37
1046 3300049162 Ga0501307_033510 Ga0501307_033510_322_435 37
1047 3300049530 Ga0501314_031489 Ga0501314_031489_379_492 37
1048 3300049532 Ga0501316_071956 Ga0501316_071956_79_192 37
1049 3300049532 Ga0501316_073504 Ga0501316_073504_182_295 37
1050 3300049533 Ga0501317_006514 Ga0501317_006514_763_876 37
1051 3300049533 Ga0501317_033367 Ga0501317_033367_133_246 37
1052 3300049534 Ga0501318_001880 Ga0501318_001880_102_215 37
1053 3300049534 Ga0501318_033283 Ga0501318_033283_338_451 37
1054 3300049541 Ga0501325_039407 Ga0501325_039407_124_237 37
1055 3300049546 Ga0501330_021793 Ga0501330_021793_194_307 37
1056 3300049549 Ga0501333_001410 Ga0501333_001410_867_980 37
1057 3300049568 Ga0501031_0001922 Ga0501031_0001922_9285_9398 37
1058 3300049568 Ga0501031_0005180 Ga0501031_0005180_2150_2263 37
1059 3300049568 Ga0501031_0005531 Ga0501031_0005531_6114_6227 37
1060 3300049568 Ga0501031_0017300 Ga0501031_0017300_1383_1496 37
1061 3300049568 Ga0501031_0018753 Ga0501031_0018753_2838_2951 37
1062 3300049568 Ga0501031_0036857 Ga0501031_0036857_47_160 37
1063 3300049568 Ga0501031_0068792 Ga0501031_0068792_1658_1771 37
1064 3300049568 Ga0501031_0470692 Ga0501031_0470692_62_175 37
1065 3300049568 Ga0501031_0532054 Ga0501031_0532054_389_526 37
1066 3300049568 Ga0501031_0758377 Ga0501031_0758377_201_314 37
1067 3300049569 Ga0501032_0018739 Ga0501032_0018739_989_1102 37
1068 3300049569 Ga0501032_0031380 Ga0501032_0031380_2221_2334 37
1069 3300049569 Ga0501032_0038425 Ga0501032_0038425_443_556 37
1070 3300049569 Ga0501032_0137352 Ga0501032_0137352_1205_1318 37
1071 3300049569 Ga0501032_0241633 Ga0501032_0241633_582_695 37
1072 3300049569 Ga0501032_0587712 Ga0501032_0587712_94_207 37
1073 3300049569 Ga0501032_0608714 Ga0501032_0608714_328_441 37
1074 3300049569 Ga0501032_0611688 Ga0501032_0611688_74_187 37
1075 3300049569 Ga0501032_0778266 Ga0501032_0778266_202_315 37
1076 3300049570 Ga0501033_0010145 Ga0501033_0010145_4337_4450 37
1077 3300049570 Ga0501033_0032916 Ga0501033_0032916_2539_2652 37
1078 3300049570 Ga0501033_0090106 Ga0501033_0090106_1794_1907 37
1079 3300049570 Ga0501033_0205609 Ga0501033_0205609_842_955 37
1080 3300049570 Ga0501033_0248029 Ga0501033_0248029_749_862 37
1081 3300049570 Ga0501033_1085943 Ga0501033_1085943_328_441 37
1082 3300049571 Ga0501034_0011227 Ga0501034_0011227_6271_6384 37
1083 3300049571 Ga0501034_0031799 Ga0501034_0031799_3692_3805 37
1084 3300049571 Ga0501034_0051052 Ga0501034_0051052_73_186 37
1085 3300049571 Ga0501034_0540189 Ga0501034_0540189_644_757 37
1086 3300049571 Ga0501034_1294494 Ga0501034_1294494_172_285 37
1087 3300049571 Ga0501034_1334904 Ga0501034_1334904_302_415 37
1088 3300049572 Ga0501036_0009133 Ga0501036_0009133_6229_6342 37
1089 3300049572 Ga0501036_0019870 Ga0501036_0019870_4963_5076 37
1090 3300049572 Ga0501036_0028832 Ga0501036_0028832_524_637 37
1091 3300049572 Ga0501036_0045518 Ga0501036_0045518_2799_2912 37
1092 3300049572 Ga0501036_0045609 Ga0501036_0045609_2091_2228 37
1093 3300049572 Ga0501036_0057478 Ga0501036_0057478_1725_1838 37
1094 3300049572 Ga0501036_0191702 Ga0501036_0191702_1063_1176 37
1095 3300049572 Ga0501036_0196255 Ga0501036_0196255_979_1092 37
1096 3300049572 Ga0501036_0235531 Ga0501036_0235531_927_1040 37
1097 3300049572 Ga0501036_0270587 Ga0501036_0270587_182_295 37
1098 3300049572 Ga0501036_0354379 Ga0501036_0354379_374_487 37
1099 3300049572 Ga0501036_0359236 Ga0501036_0359236_268_381 37
1100 3300049572 Ga0501036_0530272 Ga0501036_0530272_35_148 37
1101 3300049572 Ga0501036_0735090 Ga0501036_0735090_328_441 37
1102 3300049572 Ga0501036_1207507 Ga0501036_1207507_51_164 37
1103 3300049572 Ga0501036_1209692 Ga0501036_1209692_163_276 37
1104 3300049573 Ga0501037_0005752 Ga0501037_0005752_7734_7847 37
1105 3300049573 Ga0501037_0061198 Ga0501037_0061198_1883_1996 37
1106 3300049573 Ga0501037_0135506 Ga0501037_0135506_757_870 37
1107 3300049573 Ga0501037_0169853 Ga0501037_0169853_123_236 37
1108 3300049573 Ga0501037_0189589 Ga0501037_0189589_1081_1194 37
1109 3300049573 Ga0501037_0325989 Ga0501037_0325989_532_645 37
1110 3300049573 Ga0501037_0426832 Ga0501037_0426832_152_289 37
1111 3300049574 Ga0501038_0003673 Ga0501038_0003673_12659_12772 37
1112 3300049574 Ga0501038_0041519 Ga0501038_0041519_3032_3145 37
1113 3300049574 Ga0501038_0061441 Ga0501038_0061441_263_376 37
1114 3300049574 Ga0501038_0076183 Ga0501038_0076183_1879_1992 37
1115 3300049574 Ga0501038_0086310 Ga0501038_0086310_1962_2075 37
1116 3300049574 Ga0501038_0096734 Ga0501038_0096734_106_219 37
1117 3300049574 Ga0501038_0105410 Ga0501038_0105410_514_651 37
1118 3300049574 Ga0501038_0117524 Ga0501038_0117524_999_1112 37
1119 3300049574 Ga0501038_0191520 Ga0501038_0191520_1054_1167 37
1120 3300049574 Ga0501038_0508122 Ga0501038_0508122_718_831 37
1121 3300049574 Ga0501038_1176100 Ga0501038_1176100_216_329 37
1122 3300049575 Ga0501039_0001765 Ga0501039_0001765_15068_15181 37
1123 3300049575 Ga0501039_0007712 Ga0501039_0007712_4880_4993 37
1124 3300049575 Ga0501039_0009669 Ga0501039_0009669_3507_3620 37
1125 3300049575 Ga0501039_0012688 Ga0501039_0012688_4388_4501 37
1126 3300049575 Ga0501039_0030743 Ga0501039_0030743_2714_2827 37
1127 3300049575 Ga0501039_0082192 Ga0501039_0082192_333_446 37
1128 3300049575 Ga0501039_0109363 Ga0501039_0109363_1614_1727 37
1129 3300049575 Ga0501039_0114246 Ga0501039_0114246_1611_1748 37
1130 3300049575 Ga0501039_0155205 Ga0501039_0155205_973_1086 37
1131 3300049575 Ga0501039_0241469 Ga0501039_0241469_41_154 37
1132 3300049575 Ga0501039_0333440 Ga0501039_0333440_930_1043 37
1133 3300049575 Ga0501039_0651711 Ga0501039_0651711_154_267 37
1134 3300049575 Ga0501039_0662169 Ga0501039_0662169_76_189 37
1135 3300049575 Ga0501039_0700222 Ga0501039_0700222_623_736 37
1136 3300049576 Ga0501040_0001336 Ga0501040_0001336_13728_13841 37
1137 3300049576 Ga0501040_0002053 Ga0501040_0002053_3522_3635 37
1138 3300049576 Ga0501040_0010042 Ga0501040_0010042_2173_2286 37
1139 3300049576 Ga0501040_0013186 Ga0501040_0013186_2666_2803 37
1140 3300049576 Ga0501040_0025963 Ga0501040_0025963_2917_3030 37
1141 3300049576 Ga0501040_0031959 Ga0501040_0031959_2452_2565 37
1142 3300049576 Ga0501040_0041569 Ga0501040_0041569_2764_2877 37
1143 3300049576 Ga0501040_0064208 Ga0501040_0064208_1449_1562 37
1144 3300049576 Ga0501040_0132251 Ga0501040_0132251_1288_1401 37
1145 3300049576 Ga0501040_0209624 Ga0501040_0209624_685_798 37
1146 3300049576 Ga0501040_0318432 Ga0501040_0318432_554_667 37
1147 3300049576 Ga0501040_0489003 Ga0501040_0489003_43_156 37
1148 3300049577 Ga0501041_0001150 Ga0501041_0001150_4335_4448 37
1149 3300049577 Ga0501041_0001929 Ga0501041_0001929_7760_7873 37
1150 3300049577 Ga0501041_0008706 Ga0501041_0008706_4941_5054 37
1151 3300049577 Ga0501041_0032148 Ga0501041_0032148_2483_2596 37
1152 3300049577 Ga0501041_0039470 Ga0501041_0039470_1491_1628 37
1153 3300049577 Ga0501041_0057116 Ga0501041_0057116_1099_1212 37
1154 3300049577 Ga0501041_0087585 Ga0501041_0087585_32_145 37
1155 3300049577 Ga0501041_0105501 Ga0501041_0105501_550_663 37
1156 3300049577 Ga0501041_0123385 Ga0501041_0123385_990_1103 37
1157 3300049577 Ga0501041_0153497 Ga0501041_0153497_842_955 37
1158 3300049577 Ga0501041_0222709 Ga0501041_0222709_420_533 37
1159 3300049577 Ga0501041_0239420 Ga0501041_0239420_945_1058 37
1160 3300049577 Ga0501041_0466048 Ga0501041_0466048_218_331 37
1161 3300049577 Ga0501041_0762979 Ga0501041_0762979_426_539 37
1162 3300049578 Ga0501042_0001278 Ga0501042_0001278_813_926 37
1163 3300049578 Ga0501042_0006496 Ga0501042_0006496_7386_7499 37
1164 3300049578 Ga0501042_0019089 Ga0501042_0019089_2696_2809 37
1165 3300049578 Ga0501042_0023659 Ga0501042_0023659_3792_3905 37
1166 3300049578 Ga0501042_0026481 Ga0501042_0026481_860_973 37
1167 3300049578 Ga0501042_0039322 Ga0501042_0039322_977_1090 37
1168 3300049578 Ga0501042_0043308 Ga0501042_0043308_2368_2481 37
1169 3300049578 Ga0501042_0050736 Ga0501042_0050736_1424_1537 37
1170 3300049578 Ga0501042_0109331 Ga0501042_0109331_1242_1355 37
1171 3300049578 Ga0501042_0196908 Ga0501042_0196908_446_559 37
1172 3300049578 Ga0501042_0213777 Ga0501042_0213777_1048_1161 37
1173 3300049578 Ga0501042_0370059 Ga0501042_0370059_508_621 37
1174 3300049578 Ga0501042_0811100 Ga0501042_0811100_55_168 37
1175 3300049578 Ga0501042_0989784 Ga0501042_0989784_260_373 37
1176 3300049578 Ga0501042_1062663 Ga0501042_1062663_167_280 37
1177 3300049578 Ga0501042_1322135 Ga0501042_1322135_330_443 37
1178 3300049579 Ga0501043_0112135 Ga0501043_0112135_1162_1275 37
1179 3300049579 Ga0501043_0202752 Ga0501043_0202752_1053_1166 37
1180 3300049579 Ga0501043_0292645 Ga0501043_0292645_422_535 37
1181 3300049579 Ga0501043_0435476 Ga0501043_0435476_36_149 37
1182 3300049579 Ga0501043_0536165 Ga0501043_0536165_509_622 37
1183 3300049579 Ga0501043_0545066 Ga0501043_0545066_258_371 37
1184 3300049579 Ga0501043_0606383 Ga0501043_0606383_122_235 37
1185 3300049580 Ga0501046_0004632 Ga0501046_0004632_2502_2615 37
1186 3300049580 Ga0501046_0008923 Ga0501046_0008923_835_948 37
1187 3300049580 Ga0501046_0013607 Ga0501046_0013607_6125_6238 37
1188 3300049580 Ga0501046_0026901 Ga0501046_0026901_2738_2851 37
1189 3300049580 Ga0501046_0033739 Ga0501046_0033739_2824_2937 37
1190 3300049580 Ga0501046_0034655 Ga0501046_0034655_973_1086 37
1191 3300049580 Ga0501046_0432016 Ga0501046_0432016_56_169 37
1192 3300049580 Ga0501046_0446928 Ga0501046_0446928_795_908 37
1193 3300049580 Ga0501046_0820294 Ga0501046_0820294_21_134 37
1194 3300049580 Ga0501046_0943605 Ga0501046_0943605_399_512 37
1195 3300049580 Ga0501046_0989564 Ga0501046_0989564_75_188 37
1196 3300049580 Ga0501046_1032240 Ga0501046_1032240_174_287 37
1197 3300049580 Ga0501046_1237311 Ga0501046_1237311_88_201 37
1198 3300049581 Ga0501047_0017447 Ga0501047_0017447_6285_6398 37
1199 3300049581 Ga0501047_0043981 Ga0501047_0043981_957_1070 37
1200 3300049581 Ga0501047_0390651 Ga0501047_0390651_48_161 37
1201 3300049581 Ga0501047_0583711 Ga0501047_0583711_239_352 37
1202 3300049582 Ga0501048_0001716 Ga0501048_0001716_13190_13303 37
1203 3300049582 Ga0501048_0015076 Ga0501048_0015076_1210_1323 37
1204 3300049582 Ga0501048_0019856 Ga0501048_0019856_777_890 37
1205 3300049582 Ga0501048_0020579 Ga0501048_0020579_3731_3844 37
1206 3300049582 Ga0501048_0024858 Ga0501048_0024858_4150_4287 37
1207 3300049582 Ga0501048_0045206 Ga0501048_0045206_2630_2743 37
1208 3300049582 Ga0501048_0073497 Ga0501048_0073497_861_974 37
1209 3300049582 Ga0501048_0092616 Ga0501048_0092616_1450_1563 37
1210 3300049582 Ga0501048_0141404 Ga0501048_0141404_325_438 37
1211 3300049582 Ga0501048_0202701 Ga0501048_0202701_845_958 37
1212 3300049582 Ga0501048_0220627 Ga0501048_0220627_911_1024 37
1213 3300049582 Ga0501048_0364179 Ga0501048_0364179_59_172 37
1214 3300049582 Ga0501048_0804538 Ga0501048_0804538_324_437 37
1215 3300049582 Ga0501048_0999487 Ga0501048_0999487_331_444 37
1216 3300049583 Ga0501067_0002828 Ga0501067_0002828_7114_7227 37
1217 3300049583 Ga0501067_0021994 Ga0501067_0021994_163_276 37
1218 3300049583 Ga0501067_0122573 Ga0501067_0122573_801_914 37
1219 3300049583 Ga0501067_0514857 Ga0501067_0514857_526_639 37
1220 3300049584 Ga0501068_0001266 Ga0501068_0001266_9092_9205 37
1221 3300049584 Ga0501068_0008513 Ga0501068_0008513_4263_4376 37
1222 3300049584 Ga0501068_0027136 Ga0501068_0027136_2861_2974 37
1223 3300049584 Ga0501068_0046288 Ga0501068_0046288_824_937 37
1224 3300049584 Ga0501068_0058938 Ga0501068_0058938_103_216 37
1225 3300049584 Ga0501068_0123849 Ga0501068_0123849_961_1074 37
1226 3300049584 Ga0501068_0135071 Ga0501068_0135071_149_262 37
1227 3300049584 Ga0501068_0202466 Ga0501068_0202466_887_1000 37
1228 3300049584 Ga0501068_0207537 Ga0501068_0207537_165_278 37
1229 3300049584 Ga0501068_0382240 Ga0501068_0382240_128_241 37
1230 3300049584 Ga0501068_0479048 Ga0501068_0479048_458_571 37
1231 3300049584 Ga0501068_0921916 Ga0501068_0921916_206_319 37
1232 3300049585 Ga0501069_0001652 Ga0501069_0001652_1579_1692 37
1233 3300049585 Ga0501069_0002252 Ga0501069_0002252_1615_1728 37
1234 3300049585 Ga0501069_0020551 Ga0501069_0020551_3263_3376 37
1235 3300049585 Ga0501069_0083221 Ga0501069_0083221_1529_1642 37
1236 3300049585 Ga0501069_0122959 Ga0501069_0122959_835_948 37
1237 3300049585 Ga0501069_0136891 Ga0501069_0136891_245_358 37
1238 3300049585 Ga0501069_0140177 Ga0501069_0140177_65_178 37
1239 3300049585 Ga0501069_0141407 Ga0501069_0141407_1052_1165 37
1240 3300049585 Ga0501069_0263115 Ga0501069_0263115_716_829 37
1241 3300049586 Ga0501070_0008949 Ga0501070_0008949_4880_4993 37
1242 3300049586 Ga0501070_0026809 Ga0501070_0026809_3846_3959 37
1243 3300049586 Ga0501070_0028334 Ga0501070_0028334_670_783 37
1244 3300049586 Ga0501070_0078845 Ga0501070_0078845_1359_1472 37
1245 3300049586 Ga0501070_0341638 Ga0501070_0341638_958_1071 37
1246 3300049586 Ga0501070_0399097 Ga0501070_0399097_715_828 37
1247 3300049586 Ga0501070_0710054 Ga0501070_0710054_40_159 37
1248 3300049586 Ga0501070_0760276 Ga0501070_0760276_96_209 37
1249 3300049586 Ga0501070_0816938 Ga0501070_0816938_300_413 37
1250 3300049586 Ga0501070_0851061 Ga0501070_0851061_323_436 37
1251 3300049586 Ga0501070_0890853 Ga0501070_0890853_530_643 37
1252 3300049586 Ga0501070_0971692 Ga0501070_0971692_280_393 37
1253 3300049586 Ga0501070_0989426 Ga0501070_0989426_442_555 37
1254 3300049587 Ga0501071_0002499 Ga0501071_0002499_10340_10453 37
1255 3300049587 Ga0501071_0003097 Ga0501071_0003097_9237_9350 37
1256 3300049587 Ga0501071_0007263 Ga0501071_0007263_5675_5788 37
1257 3300049587 Ga0501071_0011341 Ga0501071_0011341_5044_5157 37
1258 3300049587 Ga0501071_0012256 Ga0501071_0012256_1626_1739 37
1259 3300049587 Ga0501071_0018159 Ga0501071_0018159_3885_3998 37
1260 3300049587 Ga0501071_0030948 Ga0501071_0030948_657_794 37
1261 3300049587 Ga0501071_0059917 Ga0501071_0059917_844_957 37
1262 3300049587 Ga0501071_0083826 Ga0501071_0083826_1591_1704 37
1263 3300049587 Ga0501071_0112914 Ga0501071_0112914_1451_1564 37
1264 3300049587 Ga0501071_0116472 Ga0501071_0116472_1043_1156 37
1265 3300049587 Ga0501071_0118230 Ga0501071_0118230_1834_1947 37
1266 3300049587 Ga0501071_0203057 Ga0501071_0203057_339_452 37
1267 3300049587 Ga0501071_0277032 Ga0501071_0277032_1008_1121 37
1268 3300049587 Ga0501071_0302532 Ga0501071_0302532_570_683 37
1269 3300049587 Ga0501071_0410296 Ga0501071_0410296_262_375 37
1270 3300049587 Ga0501071_1044187 Ga0501071_1044187_42_155 37
1271 3300049588 Ga0501072_0000404 Ga0501072_0000404_15063_15176 37
1272 3300049588 Ga0501072_0000570 Ga0501072_0000570_13270_13383 37
1273 3300049588 Ga0501072_0001268 Ga0501072_0001268_3032_3145 37
1274 3300049588 Ga0501072_0005957 Ga0501072_0005957_6371_6484 37
1275 3300049588 Ga0501072_0026725 Ga0501072_0026725_1879_1992 37
1276 3300049588 Ga0501072_0051978 Ga0501072_0051978_484_621 37
1277 3300049588 Ga0501072_0071764 Ga0501072_0071764_744_857 37
1278 3300049588 Ga0501072_0086154 Ga0501072_0086154_974_1087 37
1279 3300049588 Ga0501072_0100709 Ga0501072_0100709_1088_1201 37
1280 3300049588 Ga0501072_0122808 Ga0501072_0122808_1816_1929 37
1281 3300049588 Ga0501072_0175598 Ga0501072_0175598_657_770 37
1282 3300049588 Ga0501072_0328692 Ga0501072_0328692_1010_1123 37
1283 3300049588 Ga0501072_0380593 Ga0501072_0380593_518_631 37
1284 3300049588 Ga0501072_0446155 Ga0501072_0446155_446_559 37
1285 3300049588 Ga0501072_0473170 Ga0501072_0473170_69_182 37
1286 3300049588 Ga0501072_0541254 Ga0501072_0541254_43_156 37
1287 3300049588 Ga0501072_1138048 Ga0501072_1138048_32_145 37
1288 3300049588 Ga0501072_1140883 Ga0501072_1140883_406_519 37
1289 3300049588 Ga0501072_1230187 Ga0501072_1230187_22_135 37
1290 3300049589 Ga0501073_0001011 Ga0501073_0001011_524_637 37
1291 3300049589 Ga0501073_0132458 Ga0501073_0132458_1067_1180 37
1292 3300049589 Ga0501073_0146739 Ga0501073_0146739_235_348 37
1293 3300049589 Ga0501073_0280245 Ga0501073_0280245_206_319 37
1294 3300049589 Ga0501073_0691982 Ga0501073_0691982_434_547 37
1295 3300049589 Ga0501073_0839389 Ga0501073_0839389_73_186 37
1296 3300049589 Ga0501073_1285362 Ga0501073_1285362_266_379 37
1297 3300049590 Ga0501074_0020761 Ga0501074_0020761_601_714 37
1298 3300049590 Ga0501074_0031371 Ga0501074_0031371_354_467 37
1299 3300049590 Ga0501074_0043426 Ga0501074_0043426_2457_2570 37
1300 3300049590 Ga0501074_0058625 Ga0501074_0058625_965_1078 37
1301 3300049590 Ga0501074_0068008 Ga0501074_0068008_918_1031 37
1302 3300049590 Ga0501074_0079553 Ga0501074_0079553_1207_1320 37
1303 3300049590 Ga0501074_0253034 Ga0501074_0253034_720_833 37
1304 3300049590 Ga0501074_0406683 Ga0501074_0406683_566_679 37
1305 3300049590 Ga0501074_0537814 Ga0501074_0537814_92_205 37
1306 3300049590 Ga0501074_0563905 Ga0501074_0563905_602_715 37
1307 3300049590 Ga0501074_1078444 Ga0501074_1078444_327_440 37
1308 3300049590 Ga0501074_1096455 Ga0501074_1096455_327_440 37
1309 3300049590 Ga0501074_1117878 Ga0501074_1117878_178_291 37
1310 3300049591 Ga0501075_0002651 Ga0501075_0002651_1063_1176 37
1311 3300049591 Ga0501075_0003123 Ga0501075_0003123_480_593 37
1312 3300049591 Ga0501075_0017192 Ga0501075_0017192_959_1072 37
1313 3300049591 Ga0501075_0049791 Ga0501075_0049791_2590_2703 37
1314 3300049591 Ga0501075_0056549 Ga0501075_0056549_622_735 37
1315 3300049591 Ga0501075_0073190 Ga0501075_0073190_1622_1759 37
1316 3300049591 Ga0501075_0081749 Ga0501075_0081749_594_707 37
1317 3300049591 Ga0501075_0097724 Ga0501075_0097724_1478_1591 37
1318 3300049591 Ga0501075_0132932 Ga0501075_0132932_788_901 37
1319 3300049591 Ga0501075_0224245 Ga0501075_0224245_655_768 37
1320 3300049591 Ga0501075_0320493 Ga0501075_0320493_539_652 37
1321 3300049591 Ga0501075_0328392 Ga0501075_0328392_581_694 37
1322 3300049591 Ga0501075_0480857 Ga0501075_0480857_377_490 37
1323 3300049591 Ga0501075_0559045 Ga0501075_0559045_455_568 37
1324 3300049591 Ga0501075_0655819 Ga0501075_0655819_394_507 37
1325 3300049591 Ga0501075_0876328 Ga0501075_0876328_409_522 37
1326 3300049591 Ga0501075_1230844 Ga0501075_1230844_263_376 37
1327 3300049591 Ga0501075_1346411 Ga0501075_1346411_11_124 37
1328 3300049592 Ga0501076_0001626 Ga0501076_0001626_6719_6832 37
1329 3300049592 Ga0501076_0009171 Ga0501076_0009171_1585_1698 37
1330 3300049592 Ga0501076_0014532 Ga0501076_0014532_5239_5352 37
1331 3300049592 Ga0501076_0027314 Ga0501076_0027314_938_1051 37
1332 3300049592 Ga0501076_0032179 Ga0501076_0032179_788_901 37
1333 3300049592 Ga0501076_0051590 Ga0501076_0051590_2828_2941 37
1334 3300049592 Ga0501076_0075450 Ga0501076_0075450_1621_1734 37
1335 3300049592 Ga0501076_0117064 Ga0501076_0117064_1779_1892 37
1336 3300049592 Ga0501076_0149728 Ga0501076_0149728_692_805 37
1337 3300049592 Ga0501076_0164123 Ga0501076_0164123_545_658 37
1338 3300049592 Ga0501076_0172123 Ga0501076_0172123_206_319 37
1339 3300049592 Ga0501076_0271774 Ga0501076_0271774_28_141 37
1340 3300049592 Ga0501076_0327589 Ga0501076_0327589_955_1068 37
1341 3300049592 Ga0501076_0444788 Ga0501076_0444788_886_999 37
1342 3300049592 Ga0501076_0645002 Ga0501076_0645002_600_713 37
1343 3300049592 Ga0501076_0659653 Ga0501076_0659653_98_211 37
1344 3300049592 Ga0501076_0949860 Ga0501076_0949860_243_356 37
1345 3300049592 Ga0501076_1228768 Ga0501076_1228768_304_417 37
1346 3300049593 Ga0501077_0002661 Ga0501077_0002661_2288_2401 37
1347 3300049593 Ga0501077_0007349 Ga0501077_0007349_2784_2897 37
1348 3300049593 Ga0501077_0011401 Ga0501077_0011401_968_1081 37
1349 3300049593 Ga0501077_0034661 Ga0501077_0034661_213_326 37
1350 3300049593 Ga0501077_0036232 Ga0501077_0036232_1694_1807 37
1351 3300049593 Ga0501077_0125598 Ga0501077_0125598_323_436 37
1352 3300049593 Ga0501077_0147539 Ga0501077_0147539_138_251 37
1353 3300049593 Ga0501077_0245790 Ga0501077_0245790_802_915 37
1354 3300049593 Ga0501077_1089313 Ga0501077_1089313_136_249 37
1355 3300049741 Ga0501079_0011424 Ga0501079_0011424_1727_1840 37
1356 3300049741 Ga0501079_0016443 Ga0501079_0016443_4359_4472 37
1357 3300049741 Ga0501079_0017122 Ga0501079_0017122_518_631 37
1358 3300049741 Ga0501079_0027551 Ga0501079_0027551_1514_1651 37
1359 3300049741 Ga0501079_0046685 Ga0501079_0046685_1102_1215 37
1360 3300049741 Ga0501079_0078560 Ga0501079_0078560_154_267 37
1361 3300049741 Ga0501079_0082592 Ga0501079_0082592_510_623 37
1362 3300049741 Ga0501079_0122350 Ga0501079_0122350_995_1108 37
1363 3300049741 Ga0501079_0147395 Ga0501079_0147395_1708_1821 37
1364 3300049741 Ga0501079_0702566 Ga0501079_0702566_288_401 37
1365 3300049741 Ga0501079_0911202 Ga0501079_0911202_295_408 37
1366 3300049741 Ga0501079_1408137 Ga0501079_1408137_231_344 37
1367 3300049742 Ga0501080_0020334 Ga0501080_0020334_2186_2299 37
1368 3300049742 Ga0501080_0034333 Ga0501080_0034333_4118_4231 37
1369 3300049742 Ga0501080_0045856 Ga0501080_0045856_1529_1642 37
1370 3300049742 Ga0501080_0062854 Ga0501080_0062854_554_667 37
1371 3300049742 Ga0501080_0170659 Ga0501080_0170659_107_220 37
1372 3300049742 Ga0501080_0174978 Ga0501080_0174978_237_350 37
1373 3300049742 Ga0501080_0247334 Ga0501080_0247334_1401_1514 37
1374 3300049742 Ga0501080_0338523 Ga0501080_0338523_139_252 37
1375 3300049742 Ga0501080_0362296 Ga0501080_0362296_426_539 37
1376 3300049742 Ga0501080_0386989 Ga0501080_0386989_291_404 37
1377 3300049742 Ga0501080_0495585 Ga0501080_0495585_918_1031 37
1378 3300049742 Ga0501080_0499308 Ga0501080_0499308_201_314 37
1379 3300049742 Ga0501080_0744299 Ga0501080_0744299_640_753 37
1380 3300049742 Ga0501080_1168156 Ga0501080_1168156_90_203 37
1381 3300049742 Ga0501080_1170134 Ga0501080_1170134_203_316 37
1382 3300049742 Ga0501080_1200423 Ga0501080_1200423_257_370 37
1383 3300049743 Ga0501081_0005768 Ga0501081_0005768_7455_7568 37
1384 3300049743 Ga0501081_0009102 Ga0501081_0009102_5393_5506 37
1385 3300049743 Ga0501081_0018885 Ga0501081_0018885_1718_1855 37
1386 3300049743 Ga0501081_0029885 Ga0501081_0029885_2521_2634 37
1387 3300049743 Ga0501081_0030368 Ga0501081_0030368_399_512 37
1388 3300049743 Ga0501081_0044490 Ga0501081_0044490_2539_2652 37
1389 3300049743 Ga0501081_0073713 Ga0501081_0073713_1529_1642 37
1390 3300049743 Ga0501081_0115350 Ga0501081_0115350_608_721 37
1391 3300049743 Ga0501081_0198496 Ga0501081_0198496_272_385 37
1392 3300049743 Ga0501081_0206163 Ga0501081_0206163_91_204 37
1393 3300049743 Ga0501081_0322995 Ga0501081_0322995_377_490 37
1394 3300049743 Ga0501081_0354573 Ga0501081_0354573_805_918 37
1395 3300049743 Ga0501081_0411999 Ga0501081_0411999_477_590 37
1396 3300049743 Ga0501081_0421046 Ga0501081_0421046_506_619 37
1397 3300049743 Ga0501081_0716622 Ga0501081_0716622_368_481 37
1398 3300049743 Ga0501081_1071046 Ga0501081_1071046_382_495 37
1399 3300049744 Ga0501083_0005072 Ga0501083_0005072_992_1105 37
1400 3300049744 Ga0501083_0030813 Ga0501083_0030813_956_1069 37
1401 3300049744 Ga0501083_0088522 Ga0501083_0088522_573_686 37
1402 3300049744 Ga0501083_0129782 Ga0501083_0129782_760_873 37
1403 3300049744 Ga0501083_0232418 Ga0501083_0232418_992_1105 37
1404 3300049744 Ga0501083_0399067 Ga0501083_0399067_270_383 37
1405 3300049744 Ga0501083_0500449 Ga0501083_0500449_391_504 37
1406 3300049744 Ga0501083_0811563 Ga0501083_0811563_88_201 37
1407 3300049744 Ga0501083_1067226 Ga0501083_1067226_74_187 37
1408 3300049822 Ga0501035_0003302 Ga0501035_0003302_8786_8899 37
1409 3300049822 Ga0501035_0148016 Ga0501035_0148016_749_862 37
1410 3300049822 Ga0501035_0150437 Ga0501035_0150437_938_1051 37
1411 3300049822 Ga0501035_0278346 Ga0501035_0278346_422_535 37
1412 3300049822 Ga0501035_0694706 Ga0501035_0694706_355_468 37
1413 3300049822 Ga0501035_0770821 Ga0501035_0770821_413_526 37
1414 3300049822 Ga0501035_0788911 Ga0501035_0788911_288_401 37
1415 3300049823 Ga0501044_0006082 Ga0501044_0006082_3980_4093 37
1416 3300049823 Ga0501044_0065231 Ga0501044_0065231_128_241 37
1417 3300049823 Ga0501044_0090769 Ga0501044_0090769_2121_2234 37
1418 3300049823 Ga0501044_0106428 Ga0501044_0106428_35_148 37
1419 3300049823 Ga0501044_0120027 Ga0501044_0120027_472_585 37
1420 3300049823 Ga0501044_0346893 Ga0501044_0346893_701_814 37
1421 3300049823 Ga0501044_0353329 Ga0501044_0353329_574_687 37
1422 3300049823 Ga0501044_0431551 Ga0501044_0431551_722_835 37
1423 3300049823 Ga0501044_0554429 Ga0501044_0554429_153_266 37
1424 3300049824 Ga0501045_0000769 Ga0501045_0000769_5069_5182 37
1425 3300049824 Ga0501045_0009487 Ga0501045_0009487_3676_3789 37
1426 3300049824 Ga0501045_0016096 Ga0501045_0016096_3573_3686 37
1427 3300049824 Ga0501045_0020878 Ga0501045_0020878_1589_1726 37
1428 3300049824 Ga0501045_0024490 Ga0501045_0024490_2419_2532 37
1429 3300049824 Ga0501045_0033121 Ga0501045_0033121_2793_2906 37
1430 3300049824 Ga0501045_0041454 Ga0501045_0041454_1028_1141 37
1431 3300049824 Ga0501045_0066886 Ga0501045_0066886_1377_1490 37
1432 3300049824 Ga0501045_0097534 Ga0501045_0097534_1078_1191 37
1433 3300049824 Ga0501045_0129414 Ga0501045_0129414_1084_1197 37
1434 3300049824 Ga0501045_0168924 Ga0501045_0168924_1455_1568 37
1435 3300049824 Ga0501045_0179778 Ga0501045_0179778_1069_1182 37
1436 3300049824 Ga0501045_0281489 Ga0501045_0281489_520_633 37
1437 3300049824 Ga0501045_1316153 Ga0501045_1316153_307_420 37
1438 3300050489 nmdc:mga03683_23138_c1 nmdc:mga03683_23138_c1_2008_2121 37
1439 3300050489 nmdc:mga03683_69434_c1 nmdc:mga03683_69434_c1_535_648 37
1440 3300050490 nmdc:mga03n38_146827_c1 nmdc:mga03n38_146827_c1_825_938 37
1441 3300050490 nmdc:mga03n38_30805_c1 nmdc:mga03n38_30805_c1_1930_2043 37
1442 3300050490 nmdc:mga03n38_93759_c1 nmdc:mga03n38_93759_c1_1238_1351 37
1443 3300050491 nmdc:mga00v17_206099_c1 nmdc:mga00v17_206099_c1_834_947 37
1444 3300050491 nmdc:mga00v17_256671_c1 nmdc:mga00v17_256671_c1_461_574 37
1445 3300050491 nmdc:mga00v17_355651_c1 nmdc:mga00v17_355651_c1_681_794 37
1446 3300050491 nmdc:mga00v17_369197_c1 nmdc:mga00v17_369197_c1_281_394 37
1447 3300050491 nmdc:mga00v17_576065_c1 nmdc:mga00v17_576065_c1_233_346 37
1448 3300050491 nmdc:mga00v17_659508_c1 nmdc:mga00v17_659508_c1_364_477 37
1449 3300050491 nmdc:mga00v17_7911_c1 nmdc:mga00v17_7911_c1_2226_2339 37
1450 3300050491 nmdc:mga00v17_955168_c1 nmdc:mga00v17_955168_c1_39_152 37
1451 3300050492 nmdc:mga0yw44_190443_c1 nmdc:mga0yw44_190443_c1_1045_1158 37
1452 3300050492 nmdc:mga0yw44_610942_c1 nmdc:mga0yw44_610942_c1_568_681 37
1453 3300050492 nmdc:mga0yw44_91294_c1 nmdc:mga0yw44_91294_c1_350_463 37
1454 3300050493 nmdc:mga0k408_310205_c1 nmdc:mga0k408_310205_c1_640_753 37
1455 3300050494 nmdc:mga06z11_528407_c1 nmdc:mga06z11_528407_c1_334_447 37
1456 3300050494 nmdc:mga06z11_537187_c1 nmdc:mga06z11_537187_c1_354_467 37
1457 3300050494 nmdc:mga06z11_726504_c1 nmdc:mga06z11_726504_c1_319_432 37
1458 3300050494 nmdc:mga06z11_728890_c1 nmdc:mga06z11_728890_c1_118_231 37
1459 3300050496 nmdc:mga07m45_100310_c1 nmdc:mga07m45_100310_c1_972_1085 37
1460 3300050496 nmdc:mga07m45_311165_c1 nmdc:mga07m45_311165_c1_693_806 37
1461 3300050496 nmdc:mga07m45_333577_c1 nmdc:mga07m45_333577_c1_602_715 37
1462 3300050496 nmdc:mga07m45_353354_c1 nmdc:mga07m45_353354_c1_140_253 37
1463 3300050507 nmdc:mga05p37_112203_c1 nmdc:mga05p37_112203_c1_2536_2649 37
1464 3300050507 nmdc:mga05p37_152314_c1 nmdc:mga05p37_152314_c1_543_656 37
1465 3300050507 nmdc:mga05p37_154934_c1 nmdc:mga05p37_154934_c1_713_826 37
1466 3300050507 nmdc:mga05p37_171_c1 nmdc:mga05p37_171_c1_38448_38561 37
1467 3300050507 nmdc:mga05p37_17560_c2 nmdc:mga05p37_17560_c2_5445_5558 37
1468 3300050507 nmdc:mga05p37_330960_c1 nmdc:mga05p37_330960_c1_880_993 37
1469 3300050507 nmdc:mga05p37_433211_c1 nmdc:mga05p37_433211_c1_277_390 37
1470 3300050507 nmdc:mga05p37_47968_c1 nmdc:mga05p37_47968_c1_3677_3790 37
1471 3300050507 nmdc:mga05p37_548581_c1 nmdc:mga05p37_548581_c1_592_714 37
1472 3300050508 nmdc:mga09592_127336_c1 nmdc:mga09592_127336_c1_621_734 37
1473 3300050508 nmdc:mga09592_183_c1 nmdc:mga09592_183_c1_16478_16591 37
1474 3300050508 nmdc:mga09592_208171_c1 nmdc:mga09592_208171_c1_1363_1476 37
1475 3300050508 nmdc:mga09592_38268_c1 nmdc:mga09592_38268_c1_2739_2852 37
1476 3300050508 nmdc:mga09592_565_c1 nmdc:mga09592_565_c1_23243_23356 37
1477 3300050508 nmdc:mga09592_605768_c1 nmdc:mga09592_605768_c1_189_302 37
1478 3300050508 nmdc:mga09592_78078_c1 nmdc:mga09592_78078_c1_2285_2398 37
1479 3300050508 nmdc:mga09592_84949_c1 nmdc:mga09592_84949_c1_898_1011 37
1480 3300050509 nmdc:mga0qj67_14906_c1 nmdc:mga0qj67_14906_c1_3532_3645 37
1481 3300050509 nmdc:mga0qj67_159848_c1 nmdc:mga0qj67_159848_c1_1394_1507 37
1482 3300050509 nmdc:mga0qj67_17002_c1 nmdc:mga0qj67_17002_c1_3619_3732 37
1483 3300050509 nmdc:mga0qj67_243482_c1 nmdc:mga0qj67_243482_c1_624_737 37
1484 3300050509 nmdc:mga0qj67_267021_c1 nmdc:mga0qj67_267021_c1_415_528 37
1485 3300050509 nmdc:mga0qj67_361195_c1 nmdc:mga0qj67_361195_c1_61_174 37
1486 3300050509 nmdc:mga0qj67_40316_c1 nmdc:mga0qj67_40316_c1_648_761 37
1487 3300050509 nmdc:mga0qj67_538_c1 nmdc:mga0qj67_538_c1_3424_3537 37
1488 3300050509 nmdc:mga0qj67_580222_c1 nmdc:mga0qj67_580222_c1_373_486 37
1489 3300050509 nmdc:mga0qj67_743619_c1 nmdc:mga0qj67_743619_c1_332_445 37
1490 3300050510 nmdc:mga06r32_10511_c1 nmdc:mga06r32_10511_c1_3532_3645 37
1491 3300050510 nmdc:mga06r32_1189971_c1 nmdc:mga06r32_1189971_c1_530_643 37
1492 3300050510 nmdc:mga06r32_120500_c1 nmdc:mga06r32_120500_c1_1591_1704 37
1493 3300050510 nmdc:mga06r32_1244331_c1 nmdc:mga06r32_1244331_c1_448_561 37
1494 3300050510 nmdc:mga06r32_1538832_c1 nmdc:mga06r32_1538832_c1_369_482 37
1495 3300050510 nmdc:mga06r32_1646800_c1 nmdc:mga06r32_1646800_c1_193_306 37
1496 3300050510 nmdc:mga06r32_1752820_c1 nmdc:mga06r32_1752820_c1_330_452 37
1497 3300050510 nmdc:mga06r32_22307_c1 nmdc:mga06r32_22307_c1_4068_4181 37
1498 3300050510 nmdc:mga06r32_342_c1 nmdc:mga06r32_342_c1_28201_28314 37
1499 3300050510 nmdc:mga06r32_737899_c1 nmdc:mga06r32_737899_c1_524_637 37
1500 3300050511 nmdc:mga08y16_138470_c1 nmdc:mga08y16_138470_c1_1886_1999 37
1501 3300050511 nmdc:mga08y16_1802431_c1 nmdc:mga08y16_1802431_c1_406_519 37
1502 3300050511 nmdc:mga08y16_189594_c1 nmdc:mga08y16_189594_c1_1318_1431 37
1503 3300050511 nmdc:mga08y16_1913539_c1 nmdc:mga08y16_1913539_c1_304_417 37
1504 3300050511 nmdc:mga08y16_21805_c1 nmdc:mga08y16_21805_c1_4159_4272 37
1505 3300050511 nmdc:mga08y16_225415_c1 nmdc:mga08y16_225415_c1_26_139 37
1506 3300050511 nmdc:mga08y16_439827_c1 nmdc:mga08y16_439827_c1_419_532 37
1507 3300050511 nmdc:mga08y16_731829_c1 nmdc:mga08y16_731829_c1_70_183 37
1508 3300050511 nmdc:mga08y16_75914_c1 nmdc:mga08y16_75914_c1_285_398 37
1509 3300050511 nmdc:mga08y16_974337_c1 nmdc:mga08y16_974337_c1_71_184 37
1510 3300050512 nmdc:mga0n895_1200691_c1 nmdc:mga0n895_1200691_c1_111_224 37
1511 3300050512 nmdc:mga0n895_153218_c1 nmdc:mga0n895_153218_c1_676_789 37
1512 3300050512 nmdc:mga0n895_195030_c2 nmdc:mga0n895_195030_c2_1179_1292 37
1513 3300050512 nmdc:mga0n895_218437_c1 nmdc:mga0n895_218437_c1_1289_1402 37
1514 3300050512 nmdc:mga0n895_57615_c1 nmdc:mga0n895_57615_c1_649_762 37
1515 3300050513 nmdc:mga0rr50_1599208_c1 nmdc:mga0rr50_1599208_c1_13_126 37
1516 3300050513 nmdc:mga0rr50_1745_c1 nmdc:mga0rr50_1745_c1_1054_1167 37
1517 3300050513 nmdc:mga0rr50_1802255_c1 nmdc:mga0rr50_1802255_c1_239_352 37
1518 3300050513 nmdc:mga0rr50_223587_c1 nmdc:mga0rr50_223587_c1_444_557 37
1519 3300050513 nmdc:mga0rr50_55828_c1 nmdc:mga0rr50_55828_c1_1176_1289 37
1520 3300050513 nmdc:mga0rr50_58237_c1 nmdc:mga0rr50_58237_c1_603_716 37
1521 3300050514 nmdc:mga08x19_15822_c1 nmdc:mga08x19_15822_c1_494_607 37
1522 3300050514 nmdc:mga08x19_982664_c1 nmdc:mga08x19_982664_c1_148_261 37
1523 3300050515 nmdc:mga0a205_1221074_c1 nmdc:mga0a205_1221074_c1_470_583 37
1524 3300050515 nmdc:mga0a205_15462_c1 nmdc:mga0a205_15462_c1_2327_2440 37
1525 3300050515 nmdc:mga0a205_460_c1 nmdc:mga0a205_460_c1_27778_27891 37
1526 3300050516 nmdc:mga0sz30_173542_c1 nmdc:mga0sz30_173542_c1_227_340 37
1527 3300050516 nmdc:mga0sz30_198196_c1 nmdc:mga0sz30_198196_c1_58_171 37
1528 3300053077 Ga0495601_0004388 Ga0495601_0004388_122_235 37
1529 3300053077 Ga0495601_0161174 Ga0495601_0161174_377_490 37
1530 3300053077 Ga0495601_0170148 Ga0495601_0170148_504_617 37
1531 3300053078 Ga0495612_0143806 Ga0495612_0143806_55_168 37
1532 3300053078 Ga0495612_0299138 Ga0495612_0299138_482_595 37
1533 3300053084 Ga0495595_0005271 Ga0495595_0005271_4593_4706 37
1534 3300053084 Ga0495595_0018372 Ga0495595_0018372_1378_1491 37
1535 3300053084 Ga0495595_0026950 Ga0495595_0026950_956_1069 37
1536 3300053084 Ga0495595_0049086 Ga0495595_0049086_126_239 37
1537 3300053084 Ga0495595_0148363 Ga0495595_0148363_278_391 37
1538 3300053085 Ga0495619_0005469 Ga0495619_0005469_6451_6564 37
1539 3300053085 Ga0495619_0057521 Ga0495619_0057521_614_727 37
1540 3300053085 Ga0495619_0120735 Ga0495619_0120735_1529_1642 37
1541 3300053085 Ga0495619_0610250 Ga0495619_0610250_337_450 37
1542 3300053085 Ga0495619_0638626 Ga0495619_0638626_558_671 37
1543 3300053094 Ga0500566_0510460 Ga0500566_0510460_378_491 37
1544 3300053098 Ga0500650_0303702 Ga0500650_0303702_247_360 37
1545 3300053098 Ga0500650_0334421 Ga0500650_0334421_34_147 37
1546 3300053129 Ga0500628_207511 Ga0500628_207511_198_311 37
1547 3300053139 Ga0500568_0028420 Ga0500568_0028420_1717_1830 37
1548 3300053153 Ga0500616_0000361 Ga0500616_0000361_23906_24019 37
1549 3300053153 Ga0500616_0000816 Ga0500616_0000816_13867_13980 37
1550 3300054114 Ga0501084_0007455 Ga0501084_0007455_2378_2491 37
1551 3300054114 Ga0501084_0017951 Ga0501084_0017951_2996_3133 37
1552 3300054114 Ga0501084_0022306 Ga0501084_0022306_524_637 37
1553 3300054114 Ga0501084_0031121 Ga0501084_0031121_3413_3526 37
1554 3300054114 Ga0501084_0045054 Ga0501084_0045054_767_880 37
1555 3300054114 Ga0501084_0100661 Ga0501084_0100661_923_1036 37
1556 3300054114 Ga0501084_0109556 Ga0501084_0109556_599_712 37
1557 3300054114 Ga0501084_0343225 Ga0501084_0343225_1036_1149 37
1558 3300054114 Ga0501084_0368250 Ga0501084_0368250_951_1064 37
1559 3300054114 Ga0501084_0374621 Ga0501084_0374621_395_508 37
1560 3300054114 Ga0501084_0610701 Ga0501084_0610701_70_183 37
1561 3300054114 Ga0501084_0918450 Ga0501084_0918450_65_178 37
1562 3300054114 Ga0501084_1048356 Ga0501084_1048356_346_459 37
1563 3300054114 Ga0501084_1383447 Ga0501084_1383447_443_556 37
1564 3300054114 Ga0501084_1523805 Ga0501084_1523805_269_382 37
1565 3300054114 Ga0501084_1835301 Ga0501084_1835301_273_386 37
1566 3300059477 Ga0587084_150229 Ga0587084_150229_109_222 37
1567 3300059490 Ga0587066_108750 Ga0587066_108750_251_364 37
1568 3300059490 Ga0587066_213575 Ga0587066_213575_370_483 37
1569 3300059491 Ga0587070_117591 Ga0587070_117591_405_518 37
1570 3300059491 Ga0587070_137665 Ga0587070_137665_294_407 37
1571 3300059491 Ga0587070_156549 Ga0587070_156549_347_460 37
1572 3300059492 Ga0587073_0221845 Ga0587073_0221845_139_252 37
1573 3300059493 Ga0587077_246322 Ga0587077_246322_169_282 37
1574 3300059504 Ga0587082_120842 Ga0587082_120842_317_433 37
1575 3300059504 Ga0587082_145203 Ga0587082_145203_143_256 37
1576 3300059505 Ga0587083_0022054 Ga0587083_0022054_507_620 37
1577 3300059505 Ga0587083_0051723 Ga0587083_0051723_194_307 37
1578 3300059505 Ga0587083_0215026 Ga0587083_0215026_181_294 37
1579 3300059506 Ga0587085_040029 Ga0587085_040029_249_362 37
1580 3300059506 Ga0587085_159900 Ga0587085_159900_122_235 37
1581 3300059507 Ga0587086_093632 Ga0587086_093632_293_406 37
1582 3300059508 Ga0587088_056893 Ga0587088_056893_133_246 37
1583 3300059511 Ga0587091_019178 Ga0587091_019178_558_671 37
1584 3300059511 Ga0587091_233257 Ga0587091_233257_81_194 37
1585 3300059512 Ga0587092_071063 Ga0587092_071063_265_378 37
1586 3300059513 Ga0587094_037029 Ga0587094_037029_393_506 37
1587 3300059513 Ga0587094_094244 Ga0587094_094244_258_371 37
1588 3300059604 Ga0587098_071333 Ga0587098_071333_279_392 37
1589 3300059605 Ga0587106_049143 Ga0587106_049143_226_339 37
1590 3300059605 Ga0587106_158080 Ga0587106_158080_170_283 37
1591 3300059625 Ga0587113_037196 Ga0587113_037196_298_411 37
1592 3300059626 Ga0587115_024490 Ga0587115_024490_682_795 37
1593 3300059628 Ga0587122_022736 Ga0587122_022736_248_361 37
1594 3300059628 Ga0587122_042692 Ga0587122_042692_197_310 37
1595 3300059630 Ga0587128_045618 Ga0587128_045618_326_439 37
1596 3300059630 Ga0587128_132866 Ga0587128_132866_194_307 37
1597 3300059640 Ga0587067_041105 Ga0587067_041105_358_471 37
1598 3300059640 Ga0587067_050188 Ga0587067_050188_180_293 37
1599 3300059641 Ga0587068_085230 Ga0587068_085230_260_373 37
1600 3300059641 Ga0587068_095386 Ga0587068_095386_319_432 37
1601 3300059641 Ga0587068_131506 Ga0587068_131506_248_361 37
1602 3300059642 Ga0587069_099636 Ga0587069_099636_285_398 37
1603 3300059643 Ga0587072_090424 Ga0587072_090424_167_280 37
1604 3300059643 Ga0587072_198065 Ga0587072_198065_323_436 37
1605 3300059645 Ga0587076_182945 Ga0587076_182945_225_338 37
1606 3300059646 Ga0587078_056666 Ga0587078_056666_184_297 37
1607 3300059646 Ga0587078_064639 Ga0587078_064639_130_243 37
1608 3300059646 Ga0587078_079749 Ga0587078_079749_313_426 37
1609 3300059647 Ga0587079_046204 Ga0587079_046204_355_468 37
1610 3300059647 Ga0587079_114616 Ga0587079_114616_356_469 37
1611 3300059647 Ga0587079_136658 Ga0587079_136658_355_468 37
1612 3300059649 Ga0587102_054742 Ga0587102_054742_280_393 37
1613 3300059651 Ga0587105_026106 Ga0587105_026106_155_268 37
1614 3300059652 Ga0587107_035137 Ga0587107_035137_266_379 37
1615 3300059654 Ga0587110_007484 Ga0587110_007484_642_755 37
1616 3300059654 Ga0587110_019641 Ga0587110_019641_325_438 37
1617 3300059655 Ga0587114_021661 Ga0587114_021661_500_613 37
1618 3300059660 Ga0587124_031029 Ga0587124_031029_249_362 37
1619 3300060344 Ga0587071_061998 Ga0587071_061998_345_458 37
1620 3300060344 Ga0587071_162477 Ga0587071_162477_253_366 37
1621 3300060344 Ga0587071_182486 Ga0587071_182486_81_194 37
1622 3300060353 Ga0501082_0005568 Ga0501082_0005568_6792_6905 37
1623 3300060353 Ga0501082_0012938 Ga0501082_0012938_251_364 37
1624 3300060353 Ga0501082_0013609 Ga0501082_0013609_6082_6195 37
1625 3300060353 Ga0501082_0024808 Ga0501082_0024808_3449_3586 37
1626 3300060353 Ga0501082_0062677 Ga0501082_0062677_348_461 37
1627 3300060353 Ga0501082_0084870 Ga0501082_0084870_559_672 37
1628 3300060353 Ga0501082_0095374 Ga0501082_0095374_856_969 37
1629 3300060353 Ga0501082_0125341 Ga0501082_0125341_1433_1546 37
1630 3300060353 Ga0501082_0137403 Ga0501082_0137403_1211_1324 37
1631 3300060353 Ga0501082_0140077 Ga0501082_0140077_995_1108 37
1632 3300060353 Ga0501082_0286587 Ga0501082_0286587_222_335 37
1633 3300060353 Ga0501082_0326846 Ga0501082_0326846_1165_1278 37
1634 3300060353 Ga0501082_0330973 Ga0501082_0330973_898_1011 37
1635 3300060353 Ga0501082_0377492 Ga0501082_0377492_172_285 37
1636 3300060353 Ga0501082_0405009 Ga0501082_0405009_567_680 37
1637 3300060353 Ga0501082_0449213 Ga0501082_0449213_719_832 37
1638 3300060353 Ga0501082_0884438 Ga0501082_0884438_213_326 37
1639 3300060353 Ga0501082_1796379 Ga0501082_1796379_165_278 37
1640 3300060353 Ga0501082_1870277 Ga0501082_1870277_348_461 37
1641 3300061734 Ga0530510_0000429 Ga0530510_0000429_11522_11635 37
1642 3300061734 Ga0530510_0007861 Ga0530510_0007861_778_891 37
1643 3300061734 Ga0530510_0010040 Ga0530510_0010040_2348_2461 37
1644 3300061734 Ga0530510_0020154 Ga0530510_0020154_3522_3635 37
1645 3300061734 Ga0530510_0023058 Ga0530510_0023058_396_509 37
1646 3300061734 Ga0530510_0024142 Ga0530510_0024142_2074_2187 37
1647 3300061734 Ga0530510_0031838 Ga0530510_0031838_1170_1307 37
1648 3300061734 Ga0530510_0033114 Ga0530510_0033114_806_919 37
1649 3300061734 Ga0530510_0041048 Ga0530510_0041048_944_1057 37
1650 3300061734 Ga0530510_0051239 Ga0530510_0051239_2159_2272 37
1651 3300061734 Ga0530510_0107332 Ga0530510_0107332_402_515 37
1652 3300061734 Ga0530510_0194403 Ga0530510_0194403_817_930 37
1653 3300061734 Ga0530510_0324699 Ga0530510_0324699_566_679 37
1654 3300061734 Ga0530510_0442498 Ga0530510_0442498_663_776 37
1655 3300061734 Ga0530510_0571992 Ga0530510_0571992_587_700 37
1656 3300061734 Ga0530510_0611653 Ga0530510_0611653_586_699 37
1657 3300061734 Ga0530510_0712561 Ga0530510_0712561_453_566 37
1658 3300061734 Ga0530510_0935269 Ga0530510_0935269_483_596 37
1659 3300061734 Ga0530510_1078602 Ga0530510_1078602_487_600 37

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00444

Ribosomal_L36

Ribosomal protein L36

9

45

0.99

Feature Viewer

pLDDT pTM Quality
79.94 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map