F495223

General Info

Members Datasets Scaffolds Average Seq Length
1655 752 3310 211

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100279156|Ga0070683_1002791562
Length 238
Sequence MSLQWPCDISVTGYAPQLKSCCHSSGTIMQSFWQALQTQRWDDHRYYHHSRINQSLHLLSATSFVCAYVLMFTNPVAAALIGWLVSMTSRQAGHFFFEPKGYDHVNEATHEHKEAIKVGYNLRRKVVLMAIWALSPAILWVDPTLFGIYPDASSADFVQHVGQVWLAVGLGGLIFRTVHLFFIKDVQTGLVWMTKIITDPFHDIKLYYKAPLYLLRGELIAPLHGANELEPSLSTRDA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
105 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
139 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
140 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
141 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
142 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
152 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
227 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
228 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
236 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
237 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
238 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
239 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
240 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
241 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
242 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
246 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
247 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
248 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
249 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
250 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
258 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
259 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
262 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
263 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
266 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
267 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
268 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
269 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
270 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
271 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
272 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
275 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
276 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
277 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
278 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
281 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
282 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
283 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
284 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
292 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
293 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
294 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
295 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
296 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
300 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
319 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
320 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
321 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
322 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
323 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
326 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
327 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
334 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
335 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
336 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
337 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
338 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
339 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
340 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
341 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
342 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
343 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
344 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
347 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
348 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
349 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
350 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
351 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
352 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
355 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
356 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
357 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
358 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
361 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
362 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
363 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
364 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
383 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
384 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
385 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
386 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
387 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
388 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
389 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
390 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
393 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
397 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
398 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
399 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
400 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
401 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
402 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
405 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
406 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
407 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
408 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
409 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
427 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
428 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
436 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
450 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
451 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
452 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
455 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
459 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
460 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
461 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
465 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
466 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
467 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
468 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
469 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
472 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
473 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
474 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
475 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
476 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
477 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
478 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
479 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
480 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
481 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
482 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
486 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
487 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
488 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
489 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
490 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
491 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
492 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
493 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
494 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
495 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
496 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
497 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
498 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
499 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
500 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
501 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
502 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
503 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
504 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
505 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
506 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
507 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
508 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
509 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
510 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
511 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
512 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
515 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
516 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
517 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
520 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
521 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
522 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
523 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
524 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
525 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
526 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
527 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
528 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
529 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
530 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
534 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
535 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
536 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
537 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
538 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
539 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
543 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
544 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
545 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
546 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
547 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
548 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
549 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
550 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
551 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
552 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
553 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
554 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
555 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
556 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
557 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
558 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
559 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
560 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
561 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
562 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
563 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
564 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
565 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
566 2738543013 Variovorax sp. BT01 Isolate Unclassified
567 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
568 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
569 2791355199
570 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
571 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
572 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
573 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
574 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
575 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
576 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
577 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
578 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
579 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
580 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
581 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
582 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
583 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
584 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
585 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
586 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
587 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
588 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
589 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
590 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
591 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
592 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
593 2831864461 Roseateles noduli HZ7 Isolate Nodule
594 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
595 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
596 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
597 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
598 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
599 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
600 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
601 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
602 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
603 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
604 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
605 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
606 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
607 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
608 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
609 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
610 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
611 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
612 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
613 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
614 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
615 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
616 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
617 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
618 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
619 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
620 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
621 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
622 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
623 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
624 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
625 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
626 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
627 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
628 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
629 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
630 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
631 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
632 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
633 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
634 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
635 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
636 2902330777 Methylobacterium sp. 2A Isolate Unclassified
637 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
638 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
639 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
640 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
641 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
642 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
643 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
644 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
645 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
646 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
647 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
648 2922368715
649 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
650 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
651 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
652 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
653 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
654 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
655 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
656 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
657 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
658 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
659 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
660 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
661 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
662 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
663 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
664 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
665 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
666 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
667 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
668 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
669 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
670 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
671 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
672 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
673 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
674 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
675 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
676 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
677 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
678 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
679 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
680 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
681 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
682 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
683 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
684 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
685 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
686 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
687 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
688 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
689 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
690 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
691 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
692 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
693 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
694 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
695 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
696 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
697 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
698 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
699 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
700 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
701 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
702 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
703 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
704 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
705 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
706 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
707 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
708 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
709 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
710 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
711 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
712 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
713 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
714 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
715 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
716 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
717 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
718 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
719 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
720 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
721 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
722 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
723 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
724 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
725 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
726 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
727 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
728 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
729 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
730 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
731 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
732 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
733 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
734 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
735 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
736 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
737 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
738 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
739 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
740 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
741 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
742 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
743 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
744 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
745 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
746 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
747 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
748 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
749 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
750 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
751 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
752 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.99
Metatranscriptomes 0.42
Isolates 12.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.35
Nodule 9.49
Rhizoplane 4.53
Rhizosphere 62.05
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100279156 3300005329 Bacteria 1589
2 LJNas_1007582 3300000546 Bacteria 1169
3 JGI24740J21852_10008811 3300001979 Bacteria 3999
4 JGI24735J21928_10001998 3300002067 Bacteria 7172
5 JGI24744J21845_10018209 3300002077 Bacteria 1393
6 JGI25406J46586_10009990 3300003203 Bacteria 4232
7 JGI25406J46586_10043167 3300003203 Bacteria 1572
8 JGI25165J46597_1006536 3300003214 Bacteria 2058
9 JGI25153J46596_10002774 3300003215 Bacteria 9962
10 JGI25153J46596_10027669 3300003215 Bacteria 1982
11 rootL2_10001663 3300003322 Bacteria 58458
12 JGI25160J50197_1019866 3300003354 Bacteria 2047
13 JGI25160J50197_1026122 3300003354 Bacteria 1616
14 JGI25404J52841_10006558 3300003659 Bacteria 2441
15 JGI25404J52841_10010832 3300003659 Bacteria 1962
16 JGI25404J52841_10014898 3300003659 Bacteria 1688
17 JGI25404J52841_10019762 3300003659 Bacteria 1460
18 JGI25404J52841_10021733 3300003659 Bacteria 1389
19 JGI25404J52841_10052187 3300003659 Bacteria 859
20 Ga0055539_1005760 3300003752 Bacteria 1599
21 Ga0055526_1012133 3300003771 Bacteria 3793
22 Ga0055524_1000552 3300003775 Bacteria 28315
23 Ga0055531_10001408 3300003794 Bacteria 17758
24 Ga0055531_10001492 3300003794 Bacteria 17180
25 Ga0055543_1018006 3300004625 Bacteria 1322
26 Ga0065165_1000016 3300005262 Bacteria 286248
27 Ga0065165_1003197 3300005262 Bacteria 11962
28 Ga0065712_10155411 3300005290 Bacteria 1339
29 Ga0065712_10278757 3300005290 Bacteria 900
30 Ga0070658_10470902 3300005327 Bacteria 1084
31 Ga0070676_10036142 3300005328 Bacteria 2844
32 Ga0070683_100052756 3300005329 Bacteria 3768
33 Ga0070677_10035063 3300005333 Bacteria 1942
34 Ga0068869_100021473 3300005334 Bacteria 4442
35 Ga0068869_100055612 3300005334 Bacteria 2884
36 Ga0070666_10055129 3300005335 Bacteria 2683
37 Ga0070666_10155864 3300005335 Bacteria 1595
38 Ga0070680_100155083 3300005336 Bacteria 1923
39 Ga0070680_100158631 3300005336 Bacteria 1901
40 Ga0070682_100040990 3300005337 Bacteria 2852
41 Ga0070682_100202655 3300005337 Bacteria 1401
42 Ga0070682_100262953 3300005337 Bacteria 1249
43 Ga0068868_100174759 3300005338 Bacteria 1780
44 Ga0068868_100484012 3300005338 Bacteria 1081
45 Ga0070660_100037695 3300005339 Bacteria 3664
46 Ga0070660_100116311 3300005339 Bacteria 2132
47 Ga0070689_100040633 3300005340 Bacteria 3567
48 Ga0070689_100335196 3300005340 Bacteria 1266
49 Ga0070689_100403686 3300005340 Bacteria 1156
50 Ga0070661_100208678 3300005344 Bacteria 1494
51 Ga0070661_100422690 3300005344 Bacteria 1057
52 Ga0070661_100661171 3300005344 Bacteria 849
53 Ga0070668_100050072 3300005347 Bacteria 3215
54 Ga0070668_100069151 3300005347 Bacteria 2746
55 Ga0070668_100174996 3300005347 Bacteria 1749
56 Ga0070668_100282949 3300005347 Bacteria 1386
57 Ga0070668_100766677 3300005347 Bacteria 855
58 Ga0070669_100290393 3300005353 Bacteria 1312
59 Ga0070669_100840998 3300005353 Bacteria 782
60 Ga0070675_100082243 3300005354 Bacteria 2686
61 Ga0070675_100242823 3300005354 Bacteria 1574
62 Ga0070675_100390207 3300005354 Bacteria 1240
63 Ga0070675_100551285 3300005354 Bacteria 1043
64 Ga0070671_100006185 3300005355 Bacteria 9538
65 Ga0070671_100058932 3300005355 Bacteria 3195
66 Ga0070671_100191192 3300005355 Bacteria 1735
67 Ga0070671_100313403 3300005355 Bacteria 1336
68 Ga0070674_100219162 3300005356 Bacteria 1479
69 Ga0070674_100725405 3300005356 Bacteria 852
70 Ga0070673_100062261 3300005364 Bacteria 2964
71 Ga0070673_100742239 3300005364 Bacteria 903
72 Ga0070688_100084177 3300005365 Bacteria 2065
73 Ga0070688_100123413 3300005365 Bacteria 1738
74 Ga0070688_100463505 3300005365 Bacteria 949
75 Ga0070667_100007677 3300005367 Bacteria 8946
76 Ga0070667_100121363 3300005367 Bacteria 2273
77 Ga0070667_100291509 3300005367 Bacteria 1467
78 Ga0070667_100323221 3300005367 Bacteria 1392
79 Ga0070667_100346318 3300005367 Bacteria 1344
80 Ga0070709_10002295 3300005434 Bacteria 10381
81 Ga0070709_10003472 3300005434 Bacteria 8465
82 Ga0070709_10032611 3300005434 Bacteria 3142
83 Ga0070709_10057122 3300005434 Bacteria 2471
84 Ga0070709_10156677 3300005434 Bacteria 1579
85 Ga0070709_10256296 3300005434 Bacteria 1262
86 Ga0070714_100017825 3300005435 Bacteria 5758
87 Ga0070714_100552483 3300005435 Bacteria 1102
88 Ga0070713_100002964 3300005436 Bacteria 11145
89 Ga0070713_100005146 3300005436 Bacteria 8903
90 Ga0070713_100037482 3300005436 Bacteria 3920
91 Ga0070713_100100661 3300005436 Bacteria 2502
92 Ga0070713_100103917 3300005436 Bacteria 2466
93 Ga0070713_100137493 3300005436 Bacteria 2160
94 Ga0070713_100157898 3300005436 Bacteria 2022
95 Ga0070710_10000670 3300005437 Bacteria 16265
96 Ga0070710_10008450 3300005437 Bacteria 5011
97 Ga0070710_10042770 3300005437 Bacteria 2506
98 Ga0070710_10209221 3300005437 Bacteria 1236
99 Ga0070710_10325089 3300005437 Bacteria 1011
100 Ga0070711_100007952 3300005439 Bacteria 6466
101 Ga0070711_100304898 3300005439 Bacteria 1267
102 Ga0070711_100556195 3300005439 Bacteria 952
103 Ga0070663_100009751 3300005455 Bacteria 5962
104 Ga0070663_100145075 3300005455 Bacteria 1816
105 Ga0070663_100153269 3300005455 Bacteria 1769
106 Ga0070663_100283382 3300005455 Bacteria 1321
107 Ga0070663_100551496 3300005455 Bacteria 963
108 Ga0070678_100025881 3300005456 Bacteria 3957
109 Ga0070678_100031470 3300005456 Bacteria 3661
110 Ga0070678_100033640 3300005456 Bacteria 3561
111 Ga0070678_100237058 3300005456 Bacteria 1523
112 Ga0070662_100060618 3300005457 Bacteria 2759
113 Ga0070662_100329276 3300005457 Bacteria 1247
114 Ga0070681_10011776 3300005458 Bacteria 8669
115 Ga0070681_10042493 3300005458 Bacteria 4554
116 Ga0070681_10148627 3300005458 Bacteria 2271
117 Ga0070681_10249375 3300005458 Bacteria 1688
118 Ga0070681_10269621 3300005458 Bacteria 1614
119 Ga0068867_100222223 3300005459 Bacteria 1523
120 Ga0068867_100997727 3300005459 Bacteria 759
121 Ga0070685_10104552 3300005466 Bacteria 1734
122 Ga0070685_10195811 3300005466 Bacteria 1310
123 Ga0070685_10196492 3300005466 Bacteria 1308
124 Ga0070706_100115232 3300005467 Bacteria 2502
125 Ga0070698_100201837 3300005471 Bacteria 1924
126 Ga0070698_100584522 3300005471 Bacteria 1057
127 Ga0070699_100124273 3300005518 Bacteria 2270
128 Ga0070679_100029967 3300005530 Bacteria 5369
129 Ga0070679_100041486 3300005530 Bacteria 4579
130 Ga0070679_100070455 3300005530 Bacteria 3488
131 Ga0070679_100341701 3300005530 Bacteria 1445
132 Ga0070679_100399368 3300005530 Bacteria 1321
133 Ga0070679_100764614 3300005530 Bacteria 909
134 Ga0070684_100017961 3300005535 Bacteria 5815
135 Ga0070684_100081454 3300005535 Bacteria 2864
136 Ga0070697_100139093 3300005536 Bacteria 2041
137 Ga0068853_100004631 3300005539 Bacteria 10663
138 Ga0068853_100017135 3300005539 Bacteria 5976
139 Ga0068853_100070106 3300005539 Bacteria 3050
140 Ga0068853_100203608 3300005539 Bacteria 1802
141 Ga0068853_100289530 3300005539 Bacteria 1512
142 Ga0068853_100321721 3300005539 Bacteria 1434
143 Ga0068853_100382807 3300005539 Bacteria 1314
144 Ga0070672_100085127 3300005543 Bacteria 2540
145 Ga0070672_100130773 3300005543 Bacteria 2062
146 Ga0070672_100137346 3300005543 Bacteria 2014
147 Ga0070672_100151370 3300005543 Bacteria 1919
148 Ga0070686_100125678 3300005544 Bacteria 1767
149 Ga0070686_100181242 3300005544 Bacteria 1497
150 Ga0070686_100367886 3300005544 Bacteria 1085
151 Ga0070693_100084049 3300005547 Bacteria 1904
152 Ga0070693_100305632 3300005547 Bacteria 1074
153 Ga0070693_100675285 3300005547 Bacteria 754
154 Ga0070665_100010558 3300005548 Bacteria 9346
155 Ga0070665_100055362 3300005548 Bacteria 3978
156 Ga0070665_100110027 3300005548 Bacteria 2757
157 Ga0070665_100215615 3300005548 Bacteria 1920
158 Ga0070665_100309023 3300005548 Bacteria 1584
159 Ga0070665_100727119 3300005548 Bacteria 1006
160 Ga0070665_100764734 3300005548 Bacteria 979
161 Ga0070665_100818324 3300005548 Bacteria 944
162 Ga0070665_101289354 3300005548 Bacteria 740
163 Ga0070704_101325221 3300005549 Bacteria 659
164 Ga0068855_100019336 3300005563 Bacteria 8184
165 Ga0068855_100113658 3300005563 Bacteria 3105
166 Ga0068855_100480578 3300005563 Bacteria 1352
167 Ga0070664_100254315 3300005564 Bacteria 1580
168 Ga0068857_100010438 3300005577 Bacteria 8072
169 Ga0068857_100011515 3300005577 Bacteria 7694
170 Ga0068857_100085429 3300005577 Bacteria 2820
171 Ga0068857_100712991 3300005577 Bacteria 954
172 Ga0068854_100038376 3300005578 Bacteria 3368
173 Ga0068854_100044419 3300005578 Bacteria 3154
174 Ga0068854_100184896 3300005578 Bacteria 1630
175 Ga0068854_100606004 3300005578 Bacteria 935
176 Ga0068856_100000434 3300005614 Bacteria 45889
177 Ga0068856_100003274 3300005614 Bacteria 16460
178 Ga0068856_100133783 3300005614 Bacteria 2485
179 Ga0070702_100003925 3300005615 Bacteria 6740
180 Ga0070702_100143508 3300005615 Bacteria 1524
181 Ga0068859_100000206 3300005617 Bacteria 58246
182 Ga0068859_100022208 3300005617 Bacteria 6362
183 Ga0068859_100149624 3300005617 Bacteria 2410
184 Ga0068859_100210081 3300005617 Bacteria 2032
185 Ga0068859_100599584 3300005617 Bacteria 1195
186 Ga0068864_100016310 3300005618 Bacteria 6184
187 Ga0068864_101051402 3300005618 Bacteria 809
188 Ga0068861_100114770 3300005719 Bacteria 2163
189 Ga0068861_100132321 3300005719 Bacteria 2026
190 Ga0068861_100227317 3300005719 Bacteria 1580
191 Ga0068861_100316197 3300005719 Bacteria 1358
192 Ga0068851_10008428 3300005834 Bacteria 4764
193 Ga0068870_10078184 3300005840 Bacteria 1822
194 Ga0068863_100004529 3300005841 Bacteria 13705
195 Ga0068863_100025756 3300005841 Bacteria 5611
196 Ga0068863_100373096 3300005841 Bacteria 1392
197 Ga0068863_100414338 3300005841 Bacteria 1319
198 Ga0068858_100000483 3300005842 Bacteria 41518
199 Ga0068858_100043024 3300005842 Bacteria 4188
200 Ga0068858_100128408 3300005842 Bacteria 2376
201 Ga0068858_100300048 3300005842 Bacteria 1532
202 Ga0068860_100003873 3300005843 Bacteria 15374
203 Ga0068860_100028853 3300005843 Bacteria 5339
204 Ga0068860_100055668 3300005843 Bacteria 3761
205 Ga0068860_100109405 3300005843 Bacteria 2641
206 Ga0068860_100138793 3300005843 Bacteria 2335
207 Ga0068860_100208471 3300005843 Bacteria 1895
208 Ga0068862_100099272 3300005844 Bacteria 2544
209 Ga0068862_100143494 3300005844 Bacteria 2120
210 Ga0068862_100188770 3300005844 Bacteria 1853
211 Ga0068862_100305175 3300005844 Bacteria 1465
212 Ga0068862_100399499 3300005844 Bacteria 1285
213 Ga0068862_100816766 3300005844 Bacteria 911
214 Ga0081455_10000812 3300005937 Bacteria 40224
215 Ga0081455_10009274 3300005937 Bacteria 10134
216 Ga0081455_10015998 3300005937 Bacteria 7258
217 Ga0081455_10020610 3300005937 Bacteria 6202
218 Ga0081455_10028221 3300005937 Bacteria 5131
219 Ga0081538_10004738 3300005981 Bacteria 12447
220 Ga0081538_10020460 3300005981 Bacteria 4867
221 Ga0081538_10112627 3300005981 Bacteria 1331
222 Ga0081540_1001986 3300005983 Bacteria 17063
223 Ga0081540_1002094 3300005983 Bacteria 16604
224 Ga0081540_1006308 3300005983 Bacteria 8674
225 Ga0081540_1010425 3300005983 Bacteria 6296
226 Ga0081540_1020900 3300005983 Bacteria 3920
227 Ga0081540_1026478 3300005983 Bacteria 3308
228 Ga0081540_1027710 3300005983 Bacteria 3202
229 Ga0081540_1105978 3300005983 Bacteria 1199
230 Ga0081539_10000351 3300005985 Bacteria 101228
231 Ga0081539_10001264 3300005985 Bacteria 44681
232 Ga0081539_10020384 3300005985 Bacteria 4484
233 Ga0081539_10072103 3300005985 Bacteria 1848
234 Ga0070717_10013517 3300006028 Bacteria 6259
235 Ga0070717_10053667 3300006028 Bacteria 3323
236 Ga0070717_10067675 3300006028 Bacteria 2972
237 Ga0070717_10077200 3300006028 Bacteria 2788
238 Ga0070717_10185195 3300006028 Bacteria 1817
239 Ga0070717_10211652 3300006028 Bacteria 1701
240 Ga0075365_10044906 3300006038 Bacteria 2897
241 Ga0075365_10054787 3300006038 Bacteria 2646
242 Ga0075365_10100510 3300006038 Bacteria 1980
243 Ga0075365_10210355 3300006038 Bacteria 1363
244 Ga0075365_10222435 3300006038 Bacteria 1324
245 Ga0075365_10335451 3300006038 Bacteria 1065
246 Ga0075368_10002752 3300006042 Bacteria 5806
247 Ga0075368_10024760 3300006042 Bacteria 2300
248 Ga0075368_10086974 3300006042 Bacteria 1276
249 Ga0075368_10123016 3300006042 Bacteria 1075
250 Ga0075368_10125195 3300006042 Bacteria 1066
251 Ga0075368_10143555 3300006042 Bacteria 995
252 Ga0075368_10172914 3300006042 Bacteria 908
253 Ga0075363_100007371 3300006048 Bacteria 5052
254 Ga0075363_100085490 3300006048 Bacteria 1730
255 Ga0075363_100156297 3300006048 Bacteria 1289
256 Ga0075364_10015286 3300006051 Bacteria 4759
257 Ga0075364_10192691 3300006051 Bacteria 1381
258 Ga0075364_10271556 3300006051 Bacteria 1153
259 Ga0075364_10342696 3300006051 Bacteria 1018
260 Ga0075364_10383648 3300006051 Bacteria 958
261 Ga0070715_10110546 3300006163 Bacteria 1296
262 Ga0070715_10186994 3300006163 Bacteria 1043
263 Ga0070716_100021762 3300006173 Bacteria 3381
264 Ga0070716_100022705 3300006173 Bacteria 3319
265 Ga0070712_100152685 3300006175 Bacteria 1775
266 Ga0075362_10039422 3300006177 Bacteria 2077
267 Ga0075362_10078378 3300006177 Bacteria 1519
268 Ga0075362_10104254 3300006177 Bacteria 1329
269 Ga0075362_10114490 3300006177 Bacteria 1272
270 Ga0075362_10163239 3300006177 Bacteria 1073
271 Ga0075362_10176350 3300006177 Bacteria 1034
272 Ga0075362_10201489 3300006177 Bacteria 969
273 Ga0075367_10007138 3300006178 Bacteria 5700
274 Ga0075367_10020451 3300006178 Bacteria 3686
275 Ga0075367_10117291 3300006178 Bacteria 1638
276 Ga0075367_10313083 3300006178 Bacteria 989
277 Ga0075367_10333408 3300006178 Bacteria 956
278 Ga0075369_10005751 3300006186 Bacteria 4655
279 Ga0075369_10063379 3300006186 Bacteria 1617
280 Ga0075369_10124491 3300006186 Bacteria 1169
281 Ga0075369_10216187 3300006186 Bacteria 887
282 Ga0075366_10025122 3300006195 Bacteria 3477
283 Ga0075366_10027084 3300006195 Bacteria 3362
284 Ga0075366_10034731 3300006195 Bacteria 2971
285 Ga0075366_10060099 3300006195 Bacteria 2258
286 Ga0075366_10062649 3300006195 Bacteria 2210
287 Ga0075366_10100900 3300006195 Bacteria 1732
288 Ga0075366_10117755 3300006195 Bacteria 1600
289 Ga0075366_10301952 3300006195 Bacteria 979
290 Ga0075366_10321705 3300006195 Bacteria 948
291 Ga0097621_100204250 3300006237 Bacteria 1717
292 Ga0097621_100455905 3300006237 Bacteria 1152
293 Ga0075370_10003211 3300006353 Bacteria 7739
294 Ga0075370_10082375 3300006353 Bacteria 1850
295 Ga0075370_10094916 3300006353 Bacteria 1722
296 Ga0075370_10098523 3300006353 Bacteria 1690
297 Ga0075370_10214290 3300006353 Bacteria 1137
298 Ga0068871_100390412 3300006358 Bacteria 1238
299 Ga0068871_100499942 3300006358 Bacteria 1096
300 Ga0068871_100652731 3300006358 Bacteria 961
301 Ga0068871_100719567 3300006358 Bacteria 916
302 Ga0075428_100034276 3300006844 Bacteria 5601
303 Ga0075428_100065050 3300006844 Bacteria 3994
304 Ga0075428_100377530 3300006844 Bacteria 1520
305 Ga0075430_100003256 3300006846 Bacteria 13602
306 Ga0075430_100008450 3300006846 Bacteria 8698
307 Ga0075431_100002635 3300006847 Bacteria 17353
308 Ga0075431_100005152 3300006847 Bacteria 12866
309 Ga0075431_100249131 3300006847 Bacteria 1805
310 Ga0075431_101162642 3300006847 Bacteria 735
311 Ga0075433_10396971 3300006852 Bacteria 1217
312 Ga0075434_100598770 3300006871 Bacteria 1121
313 Ga0075429_100029205 3300006880 Bacteria 4789
314 Ga0075429_100539156 3300006880 Bacteria 1022
315 Ga0068865_100340725 3300006881 Bacteria 1211
316 Ga0075436_100159844 3300006914 Bacteria 1588
317 Ga0075436_100399373 3300006914 Bacteria 996
318 Ga0097620_100000206 3300006931 Bacteria 58246
319 Ga0097620_100022208 3300006931 Bacteria 6362
320 Ga0097620_100149620 3300006931 Bacteria 2410
321 Ga0097620_100210080 3300006931 Bacteria 2032
322 Ga0097620_100599522 3300006931 Bacteria 1195
323 Ga0099824_1020485 3300006942 Bacteria 4856
324 Ga0099823_1000159 3300006944 Bacteria 36164
325 Ga0075435_100067945 3300007076 Bacteria 2902
326 Ga0075435_100276952 3300007076 Bacteria 1432
327 Ga0099794_10095570 3300007265 Bacteria 1479
328 Ga0099794_10177106 3300007265 Bacteria 1088
329 Ga0099794_10211826 3300007265 Bacteria 994
330 Ga0099795_10017622 3300007788 Bacteria 2280
331 Ga0099795_10100443 3300007788 Bacteria 1134
332 Ga0105250_10028249 3300009092 Bacteria 2259
333 Ga0105240_10004109 3300009093 Bacteria 22344
334 Ga0105240_10006884 3300009093 Bacteria 16614
335 Ga0105240_10007517 3300009093 Bacteria 15813
336 Ga0105240_10378469 3300009093 Bacteria 1599
337 Ga0105240_10986428 3300009093 Bacteria 902
338 Ga0111539_10433569 3300009094 Bacteria 1530
339 Ga0111539_10509493 3300009094 Bacteria 1401
340 Ga0105245_10023295 3300009098 Bacteria 5435
341 Ga0105245_10243558 3300009098 Bacteria 1744
342 Ga0105247_10000088 3300009101 Bacteria 98964
343 Ga0105247_10037140 3300009101 Bacteria 2972
344 Ga0114129_10080790 3300009147 Bacteria 4519
345 Ga0114129_10226450 3300009147 Bacteria 2520
346 Ga0105243_10304844 3300009148 Bacteria 1445
347 Ga0105241_10002534 3300009174 Bacteria 13706
348 Ga0105241_10056815 3300009174 Bacteria 3001
349 Ga0105241_10117210 3300009174 Bacteria 2140
350 Ga0105241_10369194 3300009174 Bacteria 1251
351 Ga0105241_10503693 3300009174 Bacteria 1080
352 Ga0105241_10557055 3300009174 Bacteria 1030
353 Ga0105241_10590319 3300009174 Bacteria 1002
354 Ga0105242_10955988 3300009176 Bacteria 861
355 Ga0105248_10040166 3300009177 Bacteria 5245
356 Ga0105248_10800594 3300009177 Bacteria 1064
357 Ga0105248_10847988 3300009177 Bacteria 1031
358 Ga0105237_10108162 3300009545 Bacteria 2772
359 Ga0105237_10111732 3300009545 Bacteria 2724
360 Ga0105237_10141359 3300009545 Bacteria 2401
361 Ga0105237_10231894 3300009545 Bacteria 1847
362 Ga0105237_10433139 3300009545 Bacteria 1321
363 Ga0105237_10596895 3300009545 Bacteria 1111
364 Ga0105238_10001191 3300009551 Bacteria 26202
365 Ga0105238_10004162 3300009551 Bacteria 14357
366 Ga0105238_10152200 3300009551 Bacteria 2288
367 Ga0105238_10199197 3300009551 Bacteria 1978
368 Ga0105238_10319332 3300009551 Bacteria 1539
369 Ga0105238_10678669 3300009551 Bacteria 1041
370 Ga0105238_10840998 3300009551 Bacteria 935
371 Ga0105238_10942235 3300009551 Bacteria 883
372 Ga0105249_10041598 3300009553 Bacteria 4178
373 Ga0105249_10396614 3300009553 Bacteria 1409
374 Ga0105249_10461447 3300009553 Bacteria 1310
375 Ga0105249_10972474 3300009553 Bacteria 917
376 Ga0105249_11037232 3300009553 Bacteria 889
377 Ga0105249_11732008 3300009553 Bacteria 697
378 Ga0099796_10061171 3300010159 Bacteria 1335
379 Ga0105239_10033506 3300010375 Bacteria 5641
380 Ga0105239_10126755 3300010375 Bacteria 2838
381 Ga0105239_10129504 3300010375 Bacteria 2806
382 Ga0105239_10133572 3300010375 Bacteria 2762
383 Ga0105239_10140807 3300010375 Bacteria 2687
384 Ga0105239_10500351 3300010375 Bacteria 1382
385 Ga0105246_10011299 3300011119 Bacteria 5541
386 Ga0105246_10267874 3300011119 Bacteria 1364
387 Ga0105246_10461059 3300011119 Bacteria 1070
388 Ga0105246_10488503 3300011119 Bacteria 1043
389 Ga0157319_1000015 3300012497 Bacteria 130857
390 Ga0157373_10310421 3300013100 Bacteria 1121
391 Ga0157370_10080792 3300013104 Bacteria 3061
392 Ga0157370_10680539 3300013104 Bacteria 939
393 Ga0157369_10082169 3300013105 Bacteria 3447
394 Ga0157369_10226457 3300013105 Bacteria 1956
395 Ga0157374_10212671 3300013296 Bacteria 1896
396 Ga0157374_10329455 3300013296 Bacteria 1514
397 Ga0157374_10417474 3300013296 Bacteria 1340
398 Ga0157374_10436252 3300013296 Bacteria 1310
399 Ga0163162_10255848 3300013306 Bacteria 1883
400 Ga0163162_10404593 3300013306 Bacteria 1498
401 Ga0163162_10756192 3300013306 Bacteria 1091
402 Ga0157372_10250867 3300013307 Bacteria 2054
403 Ga0157372_10538428 3300013307 Bacteria 1361
404 Ga0157372_11177496 3300013307 Bacteria 886
405 Ga0157375_10020701 3300013308 Bacteria 6017
406 Ga0157375_10161601 3300013308 Bacteria 2382
407 Ga0163163_10026516 3300014325 Bacteria 5541
408 Ga0163163_10436090 3300014325 Bacteria 1369
409 Ga0163163_11263290 3300014325 Bacteria 801
410 Ga0163163_11469439 3300014325 Bacteria 743
411 Ga0157380_10389449 3300014326 Bacteria 1318
412 Ga0157380_10496500 3300014326 Bacteria 1184
413 Ga0157379_10059904 3300014968 Bacteria 3404
414 Ga0157379_10138347 3300014968 Bacteria 2195
415 Ga0157379_10209971 3300014968 Bacteria 1762
416 Ga0157379_10338134 3300014968 Bacteria 1376
417 Ga0157379_10525540 3300014968 Bacteria 1099
418 Ga0157379_10592968 3300014968 Bacteria 1034
419 Ga0157376_10375316 3300014969 Bacteria 1368
420 Ga0157376_10474953 3300014969 Bacteria 1224
421 Ga0157376_10858747 3300014969 Bacteria 923
422 Ga0163161_10051818 3300017792 Bacteria 2975
423 Ga0163161_10157812 3300017792 Bacteria 1728
424 Ga0214544_1000001 3300021320 Bacteria 783667
425 Ga0214542_1000005 3300021321 Bacteria 389646
426 Ga0214545_1000003 3300021324 Bacteria 720274
427 Ga0214543_1000002 3300021327 Bacteria 712733
428 Ga0213874_10016178 3300021377 Bacteria 1981
429 Ga0213876_10133106 3300021384 Bacteria 1322
430 Ga0213875_10084537 3300021388 Bacteria 1480
431 Ga0213871_10003352 3300021441 Bacteria 3075
432 Ga0224572_1004877 3300024225 Bacteria 2365
433 Ga0209563_102960 3300025230 Bacteria 3652
434 Ga0207425_1004681 3300025245 Bacteria 4044
435 Ga0209677_100732 3300025253 Bacteria 16720
436 Ga0209677_105587 3300025253 Bacteria 3242
437 Ga0209148_1000424 3300025254 Bacteria 47087
438 Ga0209148_1023745 3300025254 Bacteria 973
439 Ga0209233_1002009 3300025261 Bacteria 7706
440 Ga0209455_1002336 3300025272 Bacteria 7415
441 Ga0209455_1003026 3300025272 Bacteria 6155
442 Ga0209455_1016893 3300025272 Bacteria 1550
443 Ga0209673_1005096 3300025273 Bacteria 6745
444 Ga0209673_1039730 3300025273 Bacteria 1354
445 Ga0209130_1035841 3300025284 Bacteria 989
446 Ga0209564_1005101 3300025295 Bacteria 7642
447 Ga0209564_1013333 3300025295 Bacteria 3504
448 Ga0209758_1000026 3300025297 Bacteria 582706
449 Ga0209758_1000613 3300025297 Bacteria 55154
450 Ga0209758_1000880 3300025297 Bacteria 41231
451 Ga0209758_1001679 3300025297 Bacteria 24954
452 Ga0209758_1002992 3300025297 Bacteria 16198
453 Ga0209758_1020502 3300025297 Bacteria 3124
454 Ga0209758_1070085 3300025297 Bacteria 1108
455 Ga0209758_1072679 3300025297 Bacteria 1075
456 Ga0209050_1005153 3300025298 Bacteria 8376
457 Ga0209256_1000394 3300025299 Bacteria 69416
458 Ga0209256_1000665 3300025299 Bacteria 46496
459 Ga0209256_1003785 3300025299 Bacteria 10186
460 Ga0207426_1000425 3300025302 Bacteria 69088
461 Ga0207426_1009082 3300025302 Bacteria 3954
462 Ga0207426_1015297 3300025302 Bacteria 2786
463 Ga0209051_1001627 3300025303 Bacteria 18254
464 Ga0209257_1000426 3300025304 Bacteria 81095
465 Ga0209257_1002239 3300025304 Bacteria 19852
466 Ga0209257_1002312 3300025304 Bacteria 19272
467 Ga0207656_10047458 3300025321 Bacteria 1846
468 Ga0207653_10158684 3300025885 Bacteria 836
469 Ga0207682_10003055 3300025893 Bacteria 7348
470 Ga0207692_10000488 3300025898 Bacteria 13997
471 Ga0207692_10000857 3300025898 Bacteria 10930
472 Ga0207692_10022931 3300025898 Bacteria 2881
473 Ga0207692_10314398 3300025898 Bacteria 957
474 Ga0207642_10552515 3300025899 Bacteria 711
475 Ga0207710_10000205 3300025900 Bacteria 54586
476 Ga0207710_10037281 3300025900 Bacteria 2147
477 Ga0207688_10014539 3300025901 Bacteria 4276
478 Ga0207688_10015986 3300025901 Bacteria 4068
479 Ga0207688_10161197 3300025901 Bacteria 1330
480 Ga0207680_10119839 3300025903 Bacteria 1719
481 Ga0207680_10223895 3300025903 Bacteria 1291
482 Ga0207647_10000220 3300025904 Bacteria 46910
483 Ga0207647_10046056 3300025904 Bacteria 2718
484 Ga0207647_10231752 3300025904 Bacteria 1062
485 Ga0207699_10001075 3300025906 Bacteria 12927
486 Ga0207699_10061939 3300025906 Bacteria 2253
487 Ga0207699_10201177 3300025906 Bacteria 1350
488 Ga0207645_10067417 3300025907 Bacteria 2287
489 Ga0207645_10182847 3300025907 Bacteria 1376
490 Ga0207645_10217012 3300025907 Bacteria 1260
491 Ga0207645_10606027 3300025907 Bacteria 743
492 Ga0207643_10044593 3300025908 Bacteria 2504
493 Ga0207684_10373494 3300025910 Bacteria 1227
494 Ga0207654_10000081 3300025911 Bacteria 62713
495 Ga0207654_10017803 3300025911 Bacteria 3721
496 Ga0207654_10092583 3300025911 Bacteria 1846
497 Ga0207654_10104057 3300025911 Bacteria 1754
498 Ga0207654_10159853 3300025911 Bacteria 1454
499 Ga0207654_10692299 3300025911 Bacteria 732
500 Ga0207707_10000178 3300025912 Bacteria 66057
501 Ga0207707_10019742 3300025912 Bacteria 5883
502 Ga0207707_10071082 3300025912 Bacteria 3032
503 Ga0207707_10187064 3300025912 Bacteria 1807
504 Ga0207707_10251777 3300025912 Bacteria 1534
505 Ga0207707_10437840 3300025912 Bacteria 1119
506 Ga0207695_10000792 3300025913 Bacteria 59401
507 Ga0207695_10002487 3300025913 Bacteria 27129
508 Ga0207695_10082664 3300025913 Bacteria 3246
509 Ga0207695_10087886 3300025913 Bacteria 3130
510 Ga0207671_10008093 3300025914 Bacteria 8976
511 Ga0207671_10033736 3300025914 Bacteria 3807
512 Ga0207671_10044293 3300025914 Bacteria 3291
513 Ga0207671_10294072 3300025914 Bacteria 1283
514 Ga0207671_10659455 3300025914 Bacteria 833
515 Ga0207693_10060906 3300025915 Bacteria 2956
516 Ga0207693_10194705 3300025915 Bacteria 1595
517 Ga0207693_10518640 3300025915 Bacteria 930
518 Ga0207693_10784005 3300025915 Bacteria 735
519 Ga0207663_10095110 3300025916 Bacteria 1987
520 Ga0207663_10140180 3300025916 Bacteria 1683
521 Ga0207660_10041651 3300025917 Bacteria 3219
522 Ga0207660_10073413 3300025917 Bacteria 2494
523 Ga0207662_10048779 3300025918 Bacteria 2510
524 Ga0207657_10042401 3300025919 Bacteria 4015
525 Ga0207657_10124247 3300025919 Bacteria 2120
526 Ga0207657_10663718 3300025919 Bacteria 811
527 Ga0207649_10250247 3300025920 Bacteria 1276
528 Ga0207652_10200952 3300025921 Bacteria 1793
529 Ga0207652_10391561 3300025921 Bacteria 1254
530 Ga0207681_10280630 3300025923 Bacteria 1311
531 Ga0207694_10000134 3300025924 Bacteria 75759
532 Ga0207694_10018077 3300025924 Bacteria 5329
533 Ga0207650_10006480 3300025925 Bacteria 7975
534 Ga0207650_10356241 3300025925 Bacteria 1205
535 Ga0207650_10656616 3300025925 Bacteria 884
536 Ga0207659_10062440 3300025926 Bacteria 2689
537 Ga0207659_10110192 3300025926 Bacteria 2091
538 Ga0207659_10165245 3300025926 Bacteria 1741
539 Ga0207659_10166988 3300025926 Bacteria 1733
540 Ga0207687_10021001 3300025927 Bacteria 4335
541 Ga0207687_10076758 3300025927 Bacteria 2401
542 Ga0207687_10117251 3300025927 Bacteria 1986
543 Ga0207700_10006387 3300025928 Bacteria 7114
544 Ga0207700_10025306 3300025928 Bacteria 4119
545 Ga0207700_10211906 3300025928 Bacteria 1638
546 Ga0207700_10309784 3300025928 Bacteria 1365
547 Ga0207700_10386625 3300025928 Bacteria 1224
548 Ga0207700_10409095 3300025928 Bacteria 1190
549 Ga0207700_10422184 3300025928 Bacteria 1172
550 Ga0207700_10604217 3300025928 Bacteria 976
551 Ga0207664_10008339 3300025929 Bacteria 7222
552 Ga0207664_10051200 3300025929 Bacteria 3259
553 Ga0207664_10125084 3300025929 Bacteria 2158
554 Ga0207664_10539369 3300025929 Bacteria 1046
555 Ga0207664_10598778 3300025929 Bacteria 990
556 Ga0207644_10009052 3300025931 Bacteria 6528
557 Ga0207644_10010871 3300025931 Bacteria 6009
558 Ga0207644_10235234 3300025931 Bacteria 1457
559 Ga0207644_10792522 3300025931 Bacteria 792
560 Ga0207706_10025374 3300025933 Bacteria 5310
561 Ga0207706_10105930 3300025933 Bacteria 2474
562 Ga0207706_10387884 3300025933 Bacteria 1212
563 Ga0207686_10075811 3300025934 Bacteria 2178
564 Ga0207709_10242467 3300025935 Bacteria 1312
565 Ga0207709_10313806 3300025935 Bacteria 1171
566 Ga0207670_10032892 3300025936 Bacteria 3338
567 Ga0207670_10264080 3300025936 Bacteria 1335
568 Ga0207669_10146654 3300025937 Bacteria 1646
569 Ga0207669_10534670 3300025937 Bacteria 943
570 Ga0207665_10010001 3300025939 Bacteria 6228
571 Ga0207665_10014958 3300025939 Bacteria 5097
572 Ga0207665_10167266 3300025939 Bacteria 1586
573 Ga0207665_10233958 3300025939 Bacteria 1351
574 Ga0207665_10545099 3300025939 Bacteria 901
575 Ga0207691_10000698 3300025940 Bacteria 33205
576 Ga0207691_10357503 3300025940 Bacteria 1249
577 Ga0207691_10407572 3300025940 Bacteria 1159
578 Ga0207691_10776048 3300025940 Bacteria 806
579 Ga0207711_10017689 3300025941 Bacteria 5922
580 Ga0207661_10004454 3300025944 Bacteria 9840
581 Ga0207661_10025602 3300025944 Bacteria 4487
582 Ga0207661_10240481 3300025944 Bacteria 1606
583 Ga0207679_10123560 3300025945 Bacteria 2064
584 Ga0207679_10572923 3300025945 Bacteria 1015
585 Ga0207667_10008395 3300025949 Bacteria 12275
586 Ga0207667_10062284 3300025949 Bacteria 3901
587 Ga0207667_10098987 3300025949 Bacteria 3008
588 Ga0207667_10244331 3300025949 Bacteria 1837
589 Ga0207651_10179912 3300025960 Bacteria 1676
590 Ga0207712_10290484 3300025961 Bacteria 1338
591 Ga0207712_10490877 3300025961 Bacteria 1048
592 Ga0207668_10144482 3300025972 Bacteria 1833
593 Ga0207668_10394476 3300025972 Bacteria 1168
594 Ga0207640_10011779 3300025981 Bacteria 4962
595 Ga0207640_10032524 3300025981 Bacteria 3235
596 Ga0207640_10513349 3300025981 Bacteria 1000
597 Ga0207658_10047097 3300025986 Bacteria 3153
598 Ga0207658_10432628 3300025986 Bacteria 1162
599 Ga0207658_10504302 3300025986 Bacteria 1078
600 Ga0207677_10123528 3300026023 Bacteria 1952
601 Ga0207677_10146925 3300026023 Bacteria 1813
602 Ga0207703_10002506 3300026035 Bacteria 15883
603 Ga0207703_10089825 3300026035 Bacteria 2581
604 Ga0207703_10097235 3300026035 Bacteria 2487
605 Ga0207703_10125220 3300026035 Bacteria 2211
606 Ga0207703_10364295 3300026035 Bacteria 1334
607 Ga0207703_10552775 3300026035 Bacteria 1085
608 Ga0207703_10683644 3300026035 Bacteria 975
609 Ga0207639_10028198 3300026041 Bacteria 4097
610 Ga0207639_10063368 3300026041 Bacteria 2862
611 Ga0207639_10152276 3300026041 Bacteria 1938
612 Ga0207639_10160206 3300026041 Bacteria 1895
613 Ga0207639_10451595 3300026041 Bacteria 1167
614 Ga0207678_10023360 3300026067 Bacteria 5407
615 Ga0207678_10040710 3300026067 Bacteria 4028
616 Ga0207678_10263659 3300026067 Bacteria 1477
617 Ga0207678_10266186 3300026067 Bacteria 1469
618 Ga0207678_10441853 3300026067 Bacteria 1130
619 Ga0207678_10565382 3300026067 Bacteria 995
620 Ga0207708_10505868 3300026075 Bacteria 1013
621 Ga0207708_10970513 3300026075 Bacteria 737
622 Ga0207702_10000041 3300026078 Bacteria 150754
623 Ga0207702_10000180 3300026078 Bacteria 76230
624 Ga0207702_10008051 3300026078 Bacteria 8919
625 Ga0207641_10791698 3300026088 Bacteria 937
626 Ga0207648_10135849 3300026089 Bacteria 2166
627 Ga0207648_10175136 3300026089 Bacteria 1897
628 Ga0207648_10478752 3300026089 Bacteria 1137
629 Ga0207648_10894958 3300026089 Bacteria 829
630 Ga0207676_10024491 3300026095 Bacteria 4466
631 Ga0207676_10066448 3300026095 Bacteria 2876
632 Ga0207676_10264901 3300026095 Bacteria 1553
633 Ga0207674_10001084 3300026116 Bacteria 35396
634 Ga0207674_10004586 3300026116 Bacteria 16588
635 Ga0207674_10046856 3300026116 Bacteria 4436
636 Ga0207674_10276058 3300026116 Bacteria 1628
637 Ga0207674_10753848 3300026116 Bacteria 940
638 Ga0207675_100029542 3300026118 Bacteria 5107
639 Ga0207675_100236585 3300026118 Bacteria 1763
640 Ga0207675_100395269 3300026118 Bacteria 1361
641 Ga0207675_100400597 3300026118 Bacteria 1352
642 Ga0207683_10025663 3300026121 Bacteria 5083
643 Ga0207683_10047657 3300026121 Bacteria 3752
644 Ga0207683_10223487 3300026121 Bacteria 1716
645 Ga0207683_10715959 3300026121 Bacteria 928
646 Ga0207683_10751715 3300026121 Bacteria 905
647 Ga0207698_10158401 3300026142 Bacteria 1976
648 Ga0207698_10615903 3300026142 Bacteria 1072
649 Ga0207698_10632251 3300026142 Bacteria 1058
650 Ga0209389_1000090 3300027296 Bacteria 83470
651 Ga0209389_1000119 3300027296 Bacteria 70614
652 Ga0209371_1009241 3300027312 Bacteria 3151
653 Ga0209589_1000010 3300027357 Bacteria 237657
654 Ga0209489_100011 3300027361 Bacteria 244710
655 Ga0209489_100385 3300027361 Bacteria 79532
656 Ga0209700_100013 3300027363 Bacteria 341906
657 Ga0209970_1000101 3300027614 Bacteria 12138
658 Ga0209588_1054177 3300027671 Bacteria 1297
659 Ga0209813_10001497 3300027866 Bacteria 5255
660 Ga0209813_10066346 3300027866 Bacteria 1164
661 Ga0265355_1000790 3300028036 Bacteria 1840
662 Ga0268266_10005802 3300028379 Bacteria 11431
663 Ga0268266_10055170 3300028379 Bacteria 3415
664 Ga0268266_10528405 3300028379 Bacteria 1128
665 Ga0268266_10623795 3300028379 Bacteria 1036
666 Ga0268266_10645702 3300028379 Bacteria 1018
667 Ga0268266_10748518 3300028379 Bacteria 943
668 Ga0268265_10046489 3300028380 Bacteria 3245
669 Ga0268265_10084689 3300028380 Bacteria 2513
670 Ga0268265_10148699 3300028380 Bacteria 1972
671 Ga0268265_10263512 3300028380 Bacteria 1533
672 Ga0268265_11018659 3300028380 Bacteria 819
673 Ga0268264_10000093 3300028381 Bacteria 232057
674 Ga0268264_10100469 3300028381 Bacteria 2512
675 Ga0268264_10154241 3300028381 Bacteria 2062
676 Ga0265337_1002785 3300028556 Bacteria 7834
677 Ga0265326_10001368 3300028558 Bacteria 8631
678 Ga0265319_1002644 3300028563 Bacteria 9625
679 Ga0265334_10013730 3300028573 Bacteria 3386
680 Ga0265318_10005911 3300028577 Bacteria 5688
681 Ga0265323_10004952 3300028653 Bacteria 5686
682 Ga0265322_10005073 3300028654 Bacteria 3898
683 Ga0265336_10000169 3300028666 Bacteria 45875
684 Ga0307517_10003969 3300028786 Bacteria 22921
685 Ga0307515_10000040 3300028794 Bacteria 322704
686 Ga0307515_10000433 3300028794 Bacteria 100295
687 Ga0265338_10000624 3300028800 Bacteria 61670
688 Ga0265324_10005252 3300029957 Bacteria 5630
689 Ga0268256_1009760 3300030500 Bacteria 3151
690 Ga0307511_10000022 3300030521 Bacteria 116875
691 Ga0307511_10000448 3300030521 Bacteria 44274
692 Ga0307511_10155467 3300030521 Bacteria 1299
693 Ga0307512_10177664 3300030522 Bacteria 1204
694 Ga0265763_1000840 3300030763 Bacteria 2035
695 Ga0265770_1000728 3300030878 Bacteria 4592
696 Ga0265765_1020014 3300030879 Unclassified 804
697 Ga0265773_1003679 3300031018 Bacteria 1020
698 Ga0265760_10000431 3300031090 Bacteria 11784
699 Ga0265330_10106670 3300031235 Bacteria 1198
700 Ga0265332_10145336 3300031238 Bacteria 993
701 Ga0265320_10049671 3300031240 Bacteria 2041
702 Ga0265320_10217099 3300031240 Bacteria 852
703 Ga0265325_10003656 3300031241 Bacteria 9969
704 Ga0265325_10025892 3300031241 Bacteria 3182
705 Ga0265329_10020107 3300031242 Bacteria 2259
706 Ga0265340_10011120 3300031247 Bacteria 4795
707 Ga0265340_10042738 3300031247 Bacteria 2223
708 Ga0265340_10044657 3300031247 Bacteria 2168
709 Ga0265340_10150268 3300031247 Bacteria 1062
710 Ga0265339_10000158 3300031249 Bacteria 56155
711 Ga0265339_10151289 3300031249 Bacteria 1173
712 Ga0265327_10001335 3300031251 Bacteria 31984
713 Ga0265316_10126964 3300031344 Bacteria 1923
714 Ga0265316_10292396 3300031344 Bacteria 1188
715 Ga0265316_10610113 3300031344 Bacteria 773
716 Ga0307513_10032139 3300031456 Bacteria 5923
717 Ga0307513_10077494 3300031456 Bacteria 3442
718 Ga0307513_10217751 3300031456 Bacteria 1733
719 Ga0307513_10568487 3300031456 Bacteria 845
720 Ga0307509_10000003 3300031507 Bacteria 577578
721 Ga0307509_10131732 3300031507 Bacteria 2454
722 Ga0307509_10141543 3300031507 Bacteria 2339
723 Ga0307509_10380853 3300031507 Bacteria 1124
724 Ga0307408_100040215 3300031548 Bacteria 3310
725 Ga0265313_10000426 3300031595 Bacteria 45023
726 Ga0265313_10013755 3300031595 Bacteria 4828
727 Ga0307508_10000501 3300031616 Bacteria 46845
728 Ga0307514_10000662 3300031649 Bacteria 62034
729 Ga0307514_10001541 3300031649 Bacteria 27415
730 Ga0265314_10012027 3300031711 Bacteria 7096
731 Ga0265314_10172596 3300031711 Bacteria 1304
732 Ga0265314_10183498 3300031711 Bacteria 1251
733 Ga0265342_10034197 3300031712 Bacteria 3120
734 Ga0265342_10053047 3300031712 Bacteria 2414
735 Ga0307516_10006301 3300031730 Bacteria 13940
736 Ga0307516_10057831 3300031730 Bacteria 3776
737 Ga0307516_10436154 3300031730 Bacteria 967
738 Ga0307413_10193843 3300031824 Bacteria 1461
739 Ga0307406_10322270 3300031901 Bacteria 1196
740 Ga0307406_10607269 3300031901 Bacteria 903
741 Ga0307406_10959092 3300031901 Bacteria 731
742 Ga0307406_10998288 3300031901 Bacteria 718
743 Ga0307412_10549067 3300031911 Bacteria 970
744 Ga0307409_100257156 3300031995 Bacteria 1600
745 Ga0307416_100230868 3300032002 Bacteria 1784
746 Ga0307411_10088379 3300032005 Bacteria 2155
747 Ga0307415_100173160 3300032126 Bacteria 1685
748 Ga0307415_100322348 3300032126 Bacteria 1289
749 Ga0307507_10026407 3300033179 Bacteria 6261
750 Ga0307507_10099921 3300033179 Bacteria 2434
751 Ga0307510_10049005 3300033180 Bacteria 4499
752 Ga0307510_10081087 3300033180 Bacteria 3149
753 Ga0316214_1008501 3300033545 Bacteria 1382
754 Ga0373938_0003935 3300034957 Bacteria 2459
755 Ga0373926_0094914 3300035083 Bacteria 1112
756 Ga0373926_0128461 3300035083 Bacteria 959
757 Ga0373926_0160634 3300035083 Bacteria 858
758 Ga0373934_0003996 3300035086 Bacteria 5427
759 Ga0373934_0199755 3300035086 Bacteria 823
760 Ga0373944_0032747 3300035089 Bacteria 1572
761 Ga0373944_0106958 3300035089 Bacteria 951
762 Ga0373949_0030173 3300035090 Bacteria 1288
763 Ga0373923_0000165 3300035111 Bacteria 13011
764 Ga0373923_0004503 3300035111 Bacteria 4627
765 Ga0373923_0018585 3300035111 Bacteria 2678
766 Ga0373923_0121252 3300035111 Bacteria 1169
767 Ga0373932_0146480 3300035112 Bacteria 807
768 Ga0373936_0011221 3300035113 Bacteria 3388
769 Ga0373936_0015552 3300035113 Bacteria 2916
770 Ga0373936_0101340 3300035113 Bacteria 1215
771 Ga0373945_0060670 3300035116 Bacteria 1411
772 Ga0373953_0001078 3300035117 Bacteria 7702
773 Ga0373953_0104995 3300035117 Bacteria 1191
774 Ga0373954_0000260 3300035118 Bacteria 19074
775 Ga0373954_0005989 3300035118 Bacteria 5290
776 Ga0373954_0009341 3300035118 Bacteria 4313
777 Ga0373956_0001075 3300035119 Bacteria 11230
778 Ga0373957_0002893 3300035120 Bacteria 4970
779 Ga0373957_0003647 3300035120 Bacteria 4588
780 Ga0373957_0008300 3300035120 Bacteria 3358
781 Ga0373960_0162529 3300035121 Bacteria 770
782 Ga0373946_0062775 3300035171 Bacteria 1585
783 Ga0373946_0098579 3300035171 Bacteria 1306
784 Ga0373946_0326325 3300035171 Bacteria 763
785 Ga0373955_0001777 3300035172 Bacteria 9248
786 Ga0373955_0008401 3300035172 Bacteria 4795
787 Ga0316574_0128357 3300035398 Bacteria 1631
788 Ga0373924_0001923 3300035410 Bacteria 6909
789 Ga0373924_0006876 3300035410 Bacteria 4090
790 Ga0373931_0091988 3300035691 Bacteria 1691
791 Ga0373935_0000353 3300035692 Bacteria 23390
792 Ga0373935_0005100 3300035692 Bacteria 7740
793 Ga0373935_0008475 3300035692 Bacteria 6153
794 Ga0373935_0014443 3300035692 Bacteria 4764
795 Ga0373935_0055839 3300035692 Bacteria 2516
796 Ga0373927_0001254 3300035695 Bacteria 19248
797 Ga0373927_0008448 3300035695 Bacteria 6925
798 Ga0373927_0114331 3300035695 Bacteria 1759
799 Ga0373927_0215731 3300035695 Bacteria 1260
800 Ga0373927_0447223 3300035695 Bacteria 853
801 Ga0373933_0004010 3300035724 Bacteria 8111
802 Ga0373933_0045081 3300035724 Bacteria 2614
803 Ga0373933_0244233 3300035724 Bacteria 1155
804 Ga0373947_0012509 3300035725 Bacteria 4867
805 Ga0373947_0030732 3300035725 Bacteria 3157
806 Ga0373947_0294280 3300035725 Bacteria 1081
807 Ga0373947_0785591 3300035725 Bacteria 650
808 Ga0373937_0083363 3300036401 Bacteria 2957
809 Ga0373937_0147496 3300036401 Bacteria 2203
810 Ga0373937_0961177 3300036401 Bacteria 803
811 Ga0373925_0003844 3300037068 Bacteria 11505
812 Ga0373925_0008725 3300037068 Bacteria 7384
813 Ga0373925_0134855 3300037068 Bacteria 1928
814 Ga0373925_0315611 3300037068 Bacteria 1264
815 Ga0395900_0036595 3300037418 Bacteria 5060
816 Ga0395900_0390946 3300037418 Bacteria 1357
817 Ga0395898_0012280 3300037466 Bacteria 8858
818 Ga0395898_0020773 3300037466 Bacteria 6665
819 Ga0395898_0031282 3300037466 Bacteria 5319
820 Ga0395905_0005034 3300037471 Bacteria 13609
821 Ga0395905_0125094 3300037471 Bacteria 2418
822 Ga0436364_0101562 3300037853 Bacteria 7723
823 Ga0436364_0214101 3300037853 Bacteria 833
824 Ga0436364_0814306 3300037853 Bacteria 976
825 Ga0395901_0042972 3300038443 Bacteria 4688
826 Ga0395901_0077854 3300038443 Bacteria 3461
827 Ga0395901_0430844 3300038443 Bacteria 1351
828 Ga0436365_0751202 3300039437 Bacteria 840
829 Ga0436365_0757494 3300039437 Bacteria 2546
830 Ga0436365_1050534 3300039437 Bacteria 11907
831 Ga0436365_1113004 3300039437 Bacteria 2265
832 Ga0436365_1316409 3300039437 Bacteria 4050
833 Ga0436365_1377083 3300039437 Bacteria 3569
834 Ga0436365_1732811 3300039437 Bacteria 1196
835 Ga0436365_1915185 3300039437 Bacteria 1175
836 Ga0436360_0362794 3300039438 Bacteria 1072
837 Ga0436360_0674534 3300039438 Bacteria 4355
838 Ga0436361_0774376 3300039447 Bacteria 939
839 Ga0436363_0472452 3300039450 Bacteria 2131
840 Ga0436363_0486884 3300039450 Bacteria 1284
841 Ga0436363_0823763 3300039450 Bacteria 7847
842 Ga0436362_0713937 3300039453 Bacteria 8877
843 Ga0451793_0637898 3300041452 Bacteria 730
844 Ga0451800_0317729 3300041459 Bacteria 797
845 Ga0451807_0379786 3300041486 Bacteria 1181
846 Ga0451837_0000079 3300041494 Bacteria 1280
847 Ga0450890_002431 3300042127 Bacteria 2564
848 Ga0439446_0030138 3300042156 Bacteria 1568
849 Ga0451577_0831056 3300042876 Bacteria 834
850 Ga0466972_0000090 3300044658 Bacteria 82487
851 Ga0466972_0022537 3300044658 Bacteria 3135
852 Ga0466972_0174536 3300044658 Bacteria 1008
853 Ga0466966_0002487 3300044684 Bacteria 12067
854 Ga0466966_0288628 3300044684 Bacteria 986
855 Ga0466961_0000081 3300044693 Bacteria 59450
856 Ga0466963_0059425 3300044694 Bacteria 2552
857 Ga0466963_0103431 3300044694 Bacteria 1951
858 Ga0466964_0140411 3300044706 Bacteria 1110
859 Ga0466971_0085562 3300044719 Bacteria 1441
860 Ga0466957_0045181 3300044842 Bacteria 2671
861 Ga0466959_0033379 3300045049 Bacteria 3806
862 Ga0466967_0299724 3300045976 Bacteria 1546
863 Ga0466967_0397999 3300045976 Bacteria 1339
864 Ga0466967_0479546 3300045976 Bacteria 1218
865 Ga0466967_0784865 3300045976 Bacteria 945
866 Ga0495592_0003370 3300046454 Bacteria 11446
867 Ga0495592_0027243 3300046454 Bacteria 4333
868 Ga0495592_0068885 3300046454 Bacteria 2581
869 Ga0495592_0165805 3300046454 Bacteria 1516
870 Ga0495592_0166031 3300046454 Bacteria 1515
871 Ga0495603_0009474 3300046455 Bacteria 5883
872 Ga0495603_0135893 3300046455 Bacteria 1431
873 Ga0495603_0139253 3300046455 Bacteria 1412
874 Ga0495590_0041795 3300046457 Bacteria 1598
875 Ga0495590_0089197 3300046457 Bacteria 1090
876 Ga0495590_0098789 3300046457 Bacteria 1036
877 Ga0495629_0000226 3300046459 Bacteria 50363
878 Ga0495629_0018660 3300046459 Bacteria 4958
879 Ga0495629_0036628 3300046459 Bacteria 3461
880 Ga0495629_0156541 3300046459 Bacteria 1583
881 Ga0495629_0243497 3300046459 Bacteria 1238
882 Ga0495638_0010518 3300046460 Bacteria 6415
883 Ga0495638_0012364 3300046460 Bacteria 5853
884 Ga0495638_0135238 3300046460 Bacteria 1444
885 Ga0495638_0231151 3300046460 Bacteria 1029
886 Ga0495641_0001402 3300046461 Bacteria 20514
887 Ga0495641_0022355 3300046461 Bacteria 3165
888 Ga0495641_0075719 3300046461 Bacteria 1509
889 Ga0495651_0011108 3300046462 Bacteria 6926
890 Ga0495651_0012131 3300046462 Bacteria 6632
891 Ga0495651_0013785 3300046462 Bacteria 6251
892 Ga0495651_0019499 3300046462 Bacteria 5258
893 Ga0495651_0021122 3300046462 Bacteria 5056
894 Ga0495653_0125116 3300046463 Bacteria 1827
895 Ga0495653_0199815 3300046463 Bacteria 1357
896 Ga0495653_0350629 3300046463 Bacteria 949
897 Ga0495650_0121346 3300046471 Bacteria 962
898 Ga0495650_0123108 3300046471 Bacteria 953
899 Ga0495580_0019535 3300046472 Bacteria 5034
900 Ga0495580_0024592 3300046472 Bacteria 4406
901 Ga0495582_0000106 3300046473 Bacteria 43588
902 Ga0495605_0097459 3300046474 Bacteria 1355
903 Ga0495605_0114083 3300046474 Bacteria 1230
904 Ga0495639_0000170 3300046475 Bacteria 34055
905 Ga0495639_0014214 3300046475 Bacteria 3445
906 Ga0495639_0121414 3300046475 Bacteria 1247
907 Ga0495662_0000901 3300046476 Bacteria 14514
908 Ga0495662_0060425 3300046476 Bacteria 1830
909 Ga0495664_0017874 3300046477 Bacteria 4055
910 Ga0495664_0019572 3300046477 Bacteria 3894
911 Ga0495664_0020424 3300046477 Bacteria 3820
912 Ga0495664_0195945 3300046477 Bacteria 1225
913 Ga0495584_0097453 3300046491 Bacteria 1485
914 Ga0495584_0121322 3300046491 Bacteria 1324
915 Ga0495584_0175040 3300046491 Bacteria 1091
916 Ga0495584_0259743 3300046491 Bacteria 883
917 Ga0495585_0060023 3300046492 Bacteria 2094
918 Ga0495585_0172338 3300046492 Bacteria 1117
919 Ga0495594_0000410 3300046499 Bacteria 21582
920 Ga0495594_0071925 3300046499 Bacteria 1924
921 Ga0495594_0103711 3300046499 Bacteria 1601
922 Ga0495594_0185809 3300046499 Bacteria 1184
923 Ga0495594_0202371 3300046499 Bacteria 1132
924 Ga0495606_0039928 3300046507 Bacteria 3157
925 Ga0495606_0126209 3300046507 Bacteria 1526
926 Ga0495606_0131462 3300046507 Bacteria 1488
927 Ga0495608_0010478 3300046511 Bacteria 6469
928 Ga0495608_0039371 3300046511 Bacteria 3168
929 Ga0495608_0117029 3300046511 Bacteria 1710
930 Ga0495608_0266059 3300046511 Bacteria 1066
931 Ga0495616_0053102 3300046513 Bacteria 2015
932 Ga0495618_0198968 3300046514 Bacteria 1269
933 Ga0495618_0240578 3300046514 Bacteria 1138
934 Ga0495628_0034766 3300046516 Bacteria 4052
935 Ga0495628_0048266 3300046516 Bacteria 3375
936 Ga0495628_0062339 3300046516 Bacteria 2922
937 Ga0495628_0065885 3300046516 Bacteria 2832
938 Ga0495628_0124504 3300046516 Bacteria 1975
939 Ga0495628_0142482 3300046516 Bacteria 1829
940 Ga0495628_0252540 3300046516 Bacteria 1316
941 Ga0495630_0002054 3300046517 Bacteria 14003
942 Ga0495630_0003128 3300046517 Bacteria 11478
943 Ga0495631_0129242 3300046518 Bacteria 1086
944 Ga0495632_0041192 3300046519 Bacteria 2322
945 Ga0495643_0020565 3300046522 Bacteria 3802
946 Ga0495643_0309441 3300046522 Bacteria 717
947 Ga0495648_0312185 3300046524 Bacteria 732
948 Ga0495666_0034381 3300046526 Bacteria 2474
949 Ga0495642_0041494 3300046528 Bacteria 1872
950 Ga0495652_0024980 3300046529 Bacteria 5287
951 Ga0495652_0075447 3300046529 Bacteria 2800
952 Ga0495652_0090736 3300046529 Bacteria 2499
953 Ga0495652_0128952 3300046529 Bacteria 2005
954 Ga0495652_0238843 3300046529 Bacteria 1354
955 Ga0495652_0266349 3300046529 Bacteria 1262
956 Ga0495652_0460694 3300046529 Bacteria 888
957 Ga0495665_0001435 3300046531 Bacteria 12785
958 Ga0495665_0021219 3300046531 Bacteria 3489
959 Ga0495665_0025497 3300046531 Bacteria 3176
960 Ga0495665_0174022 3300046531 Bacteria 1120
961 Ga0495640_0001153 3300046533 Bacteria 20655
962 Ga0495640_0014225 3300046533 Bacteria 6030
963 Ga0495640_0021578 3300046533 Bacteria 4725
964 Ga0495640_0028306 3300046533 Bacteria 4036
965 Ga0495640_0043972 3300046533 Bacteria 3107
966 Ga0495640_0061392 3300046533 Bacteria 2553
967 Ga0495640_0091895 3300046533 Bacteria 2002
968 Ga0495586_0006037 3300046535 Bacteria 6476
969 Ga0495586_0089167 3300046535 Bacteria 1702
970 Ga0495586_0307023 3300046535 Bacteria 909
971 Ga0495587_0044282 3300046536 Bacteria 2647
972 Ga0495587_0165677 3300046536 Bacteria 1256
973 Ga0495621_0025902 3300046539 Bacteria 1974
974 Ga0495597_0073434 3300046542 Bacteria 1470
975 Ga0495597_0145087 3300046542 Bacteria 977
976 Ga0495645_0007549 3300046543 Bacteria 7564
977 Ga0495645_0010186 3300046543 Bacteria 6586
978 Ga0495645_0012442 3300046543 Bacteria 5997
979 Ga0495645_0035959 3300046543 Bacteria 3611
980 Ga0495645_0055187 3300046543 Bacteria 2885
981 Ga0495622_0002206 3300046557 Bacteria 9495
982 Ga0495622_0086870 3300046557 Bacteria 1438
983 Ga0495622_0300562 3300046557 Bacteria 699
984 Ga0495633_0123301 3300046558 Bacteria 1200
985 Ga0495667_0021690 3300046559 Bacteria 4334
986 Ga0495667_0044847 3300046559 Bacteria 2928
987 Ga0495667_0055246 3300046559 Bacteria 2611
988 Ga0495656_0059118 3300046615 Bacteria 1666
989 Ga0495656_0092628 3300046615 Bacteria 1384
990 Ga0495656_0412453 3300046615 Bacteria 708
991 Ga0495668_0234909 3300046616 Bacteria 1004
992 Ga0495668_0239031 3300046616 Bacteria 994
993 Ga0495634_0001983 3300046642 Bacteria 17430
994 Ga0495634_0151465 3300046642 Bacteria 1467
995 Ga0495634_0220325 3300046642 Bacteria 1171
996 Ga0495634_0270931 3300046642 Bacteria 1033
997 Ga0495625_0035865 3300046660 Bacteria 3651
998 Ga0495625_0142804 3300046660 Bacteria 1614
999 Ga0495625_0433559 3300046660 Bacteria 815
1000 Ga0495635_0000551 3300046663 Bacteria 23870
1001 Ga0495635_0000794 3300046663 Bacteria 20607
1002 Ga0495635_0011793 3300046663 Bacteria 6128
1003 Ga0495635_0117210 3300046663 Bacteria 1817
1004 Ga0495635_0118079 3300046663 Bacteria 1810
1005 Ga0495635_0154987 3300046663 Bacteria 1559
1006 Ga0495659_0010438 3300046664 Bacteria 2979
1007 Ga0495659_0107646 3300046664 Bacteria 1086
1008 Ga0495661_0113850 3300046665 Bacteria 1504
1009 Ga0495657_0001697 3300046675 Bacteria 18874
1010 Ga0495657_0010679 3300046675 Bacteria 6904
1011 Ga0495657_0014502 3300046675 Bacteria 5783
1012 Ga0495599_0000991 3300046678 Bacteria 15920
1013 Ga0495599_0001294 3300046678 Bacteria 14210
1014 Ga0495599_0005248 3300046678 Bacteria 7730
1015 Ga0495599_0048745 3300046678 Bacteria 2655
1016 Ga0495599_0445237 3300046678 Bacteria 767
1017 Ga0495623_0008013 3300046679 Bacteria 6865
1018 Ga0495623_0075818 3300046679 Bacteria 2087
1019 Ga0495646_0018652 3300046680 Bacteria 4393
1020 Ga0495646_0155273 3300046680 Bacteria 1270
1021 Ga0495646_0318109 3300046680 Bacteria 820
1022 Ga0495647_0000487 3300046681 Bacteria 11563
1023 Ga0495647_0058022 3300046681 Bacteria 1520
1024 Ga0495647_0059450 3300046681 Bacteria 1505
1025 Ga0495658_0018960 3300046683 Bacteria 3585
1026 Ga0495669_0038533 3300046684 Bacteria 2117
1027 Ga0495613_0009914 3300046689 Bacteria 7083
1028 Ga0495613_0012442 3300046689 Bacteria 6323
1029 Ga0495613_0024790 3300046689 Bacteria 4470
1030 Ga0495613_0039795 3300046689 Bacteria 3484
1031 Ga0495613_0287016 3300046689 Bacteria 1141
1032 Ga0495613_0292150 3300046689 Bacteria 1130
1033 Ga0495624_0009177 3300046690 Bacteria 6858
1034 Ga0495624_0074184 3300046690 Bacteria 2114
1035 Ga0495624_0103271 3300046690 Bacteria 1754
1036 Ga0495624_0161541 3300046690 Bacteria 1368
1037 Ga0495624_0224829 3300046690 Bacteria 1138
1038 Ga0495624_0466601 3300046690 Bacteria 756
1039 Ga0495649_0004829 3300046694 Bacteria 8721
1040 Ga0495600_0044747 3300046809 Bacteria 2887
1041 Ga0495600_0106410 3300046809 Bacteria 1827
1042 Ga0495600_0336289 3300046809 Bacteria 947
1043 Ga0495600_0427951 3300046809 Bacteria 821
1044 Ga0495660_0190467 3300046810 Bacteria 986
1045 Ga0495581_0000010 3300047315 Bacteria 64779
1046 Ga0495581_0014969 3300047315 Bacteria 4500
1047 Ga0495581_0024470 3300047315 Bacteria 3499
1048 Ga0495604_0003777 3300047317 Bacteria 12054
1049 Ga0495604_0010950 3300047317 Bacteria 7199
1050 Ga0495604_0037419 3300047317 Bacteria 3821
1051 Ga0495604_0047723 3300047317 Bacteria 3334
1052 Ga0495604_0172676 3300047317 Bacteria 1518
1053 Ga0495636_0240436 3300047318 Bacteria 835
1054 Ga0495674_0000082 3300047319 Bacteria 65609
1055 Ga0495674_0001491 3300047319 Bacteria 22945
1056 Ga0495674_0036604 3300047319 Bacteria 4416
1057 Ga0495674_0073409 3300047319 Bacteria 2949
1058 Ga0495674_0206208 3300047319 Bacteria 1629
1059 Ga0495672_0022035 3300047320 Bacteria 4147
1060 Ga0495672_0114834 3300047320 Bacteria 1440
1061 Ga0495676_0114381 3300047321 Bacteria 1974
1062 Ga0495676_0130801 3300047321 Bacteria 1812
1063 Ga0495680_0002698 3300047322 Bacteria 17916
1064 Ga0495680_0014505 3300047322 Bacteria 6820
1065 Ga0495680_0173431 3300047322 Bacteria 1560
1066 Ga0495680_0296230 3300047322 Bacteria 1137
1067 Ga0495680_0399496 3300047322 Bacteria 949
1068 Ga0495683_0083409 3300047323 Bacteria 1556
1069 Ga0495687_041243 3300047443 Bacteria 2026
1070 Ga0495687_044725 3300047443 Bacteria 1922
1071 Ga0495675_0004242 3300047444 Bacteria 8666
1072 Ga0495675_0039121 3300047444 Bacteria 3020
1073 Ga0495679_066436 3300047446 Bacteria 1047
1074 Ga0495673_0108674 3300047469 Bacteria 1112
1075 Ga0495684_0004100 3300047471 Bacteria 11375
1076 Ga0495684_0023587 3300047471 Bacteria 4730
1077 Ga0495684_0050325 3300047471 Bacteria 3182
1078 Ga0495684_0060049 3300047471 Bacteria 2895
1079 Ga0495686_0062203 3300047472 Bacteria 2316
1080 Ga0495593_0000986 3300047673 Bacteria 16708
1081 Ga0495593_0071820 3300047673 Bacteria 1797
1082 Ga0495615_0060495 3300048090 Bacteria 998
1083 Ga0496100_0004736 3300048903 Bacteria 7255
1084 Ga0496100_0131686 3300048903 Bacteria 1762
1085 Ga0496100_0166632 3300048903 Bacteria 1583
1086 Ga0496100_0639256 3300048903 Bacteria 828
1087 Ga0496101_0043827 3300048904 Bacteria 3199
1088 Ga0496101_0146555 3300048904 Bacteria 1803
1089 Ga0496101_0156660 3300048904 Bacteria 1745
1090 Ga0496102_0094756 3300048905 Bacteria 2766
1091 Ga0496102_0156122 3300048905 Bacteria 2145
1092 Ga0496102_0221798 3300048905 Bacteria 1782
1093 Ga0496102_0303013 3300048905 Bacteria 1506
1094 Ga0496102_0313425 3300048905 Bacteria 1478
1095 Ga0496102_0321875 3300048905 Bacteria 1457
1096 Ga0496102_1156005 3300048905 Bacteria 694
1097 Ga0496103_0107858 3300048906 Bacteria 1767
1098 Ga0496103_0241844 3300048906 Bacteria 1161
1099 Ga0496104_0012536 3300048907 Bacteria 7626
1100 Ga0496104_0041518 3300048907 Bacteria 4314
1101 Ga0496104_0074952 3300048907 Bacteria 3221
1102 Ga0496104_0094161 3300048907 Bacteria 2865
1103 Ga0496104_0121347 3300048907 Bacteria 2509
1104 Ga0496104_0169645 3300048907 Bacteria 2092
1105 Ga0496104_0228325 3300048907 Bacteria 1774
1106 Ga0496104_0672697 3300048907 Bacteria 943
1107 Ga0496105_0003866 3300048908 Bacteria 11194
1108 Ga0496105_0031344 3300048908 Bacteria 4358
1109 Ga0496105_0167629 3300048908 Bacteria 1801
1110 Ga0496105_0464855 3300048908 Bacteria 997
1111 Ga0496106_0002192 3300048909 Bacteria 14600
1112 Ga0496106_0007842 3300048909 Bacteria 7902
1113 Ga0496106_0117538 3300048909 Bacteria 2075
1114 Ga0496106_0146330 3300048909 Bacteria 1861
1115 Ga0496106_0551945 3300048909 Bacteria 924
1116 Ga0496106_0819991 3300048909 Bacteria 737
1117 Ga0496107_0006208 3300048910 Bacteria 8212
1118 Ga0496107_0070725 3300048910 Bacteria 2534
1119 Ga0496107_0085807 3300048910 Bacteria 2297
1120 Ga0496107_0094596 3300048910 Bacteria 2186
1121 Ga0496108_0033321 3300048911 Bacteria 4280
1122 Ga0496108_0046989 3300048911 Bacteria 3608
1123 Ga0496108_0176014 3300048911 Bacteria 1852
1124 Ga0496108_0314549 3300048911 Bacteria 1365
1125 Ga0496108_0414491 3300048911 Bacteria 1176
1126 Ga0496108_0512203 3300048911 Bacteria 1048
1127 Ga0496108_0787428 3300048911 Bacteria 821
1128 Ga0496109_0000958 3300048912 Bacteria 23843
1129 Ga0496109_0080371 3300048912 Bacteria 3003
1130 Ga0496109_0170853 3300048912 Bacteria 2039
1131 Ga0496109_0274367 3300048912 Bacteria 1589
1132 Ga0496109_0793725 3300048912 Bacteria 885
1133 Ga0496110_0024058 3300048913 Bacteria 5189
1134 Ga0496111_0026562 3300048914 Bacteria 4089
1135 Ga0496111_0054052 3300048914 Bacteria 2902
1136 Ga0496111_0077043 3300048914 Bacteria 2431
1137 Ga0496111_0095184 3300048914 Bacteria 2185
1138 Ga0496112_0008372 3300048915 Bacteria 9263
1139 Ga0496112_0024283 3300048915 Bacteria 5802
1140 Ga0496112_0030971 3300048915 Bacteria 5183
1141 Ga0496112_0090356 3300048915 Bacteria 3031
1142 Ga0496112_0236383 3300048915 Bacteria 1781
1143 Ga0496112_0273390 3300048915 Bacteria 1637
1144 Ga0496112_0632997 3300048915 Bacteria 1000
1145 Ga0496113_0009951 3300048916 Bacteria 6266
1146 Ga0496113_0016793 3300048916 Bacteria 5064
1147 Ga0496113_0024585 3300048916 Bacteria 4283
1148 Ga0496113_0057462 3300048916 Bacteria 2924
1149 Ga0496113_0289787 3300048916 Bacteria 1309
1150 Ga0496113_0735865 3300048916 Bacteria 786
1151 Ga0496114_0042126 3300048917 Bacteria 3783
1152 Ga0496114_0102072 3300048917 Bacteria 2450
1153 Ga0496115_0157497 3300048918 Bacteria 1876
1154 Ga0496115_0529526 3300048918 Bacteria 944
1155 Ga0496117_0040854 3300048920 Bacteria 3406
1156 Ga0496117_0102683 3300048920 Bacteria 1804
1157 Ga0496118_0021563 3300048921 Bacteria 5665
1158 Ga0496118_0023025 3300048921 Bacteria 5424
1159 Ga0496119_0013564 3300048922 Bacteria 6475
1160 Ga0496119_0052365 3300048922 Bacteria 2500
1161 Ga0496119_0224084 3300048922 Bacteria 961
1162 Ga0496119_0228825 3300048922 Bacteria 948
1163 Ga0496119_0272337 3300048922 Bacteria 845
1164 Ga0496120_0034276 3300048923 Bacteria 3043
1165 Ga0496121_0000461 3300048924 Bacteria 79954
1166 Ga0496121_0000476 3300048924 Bacteria 78015
1167 Ga0496121_0005046 3300048924 Bacteria 17245
1168 Ga0496121_0006583 3300048924 Bacteria 14331
1169 Ga0496121_0112781 3300048924 Bacteria 2070
1170 Ga0496121_0160194 3300048924 Bacteria 1646
1171 Ga0496121_0182896 3300048924 Bacteria 1510
1172 Ga0496121_0510984 3300048924 Bacteria 760
1173 Ga0496122_0133344 3300048925 Bacteria 1572
1174 Ga0496124_0007605 3300048927 Bacteria 11486
1175 Ga0496124_0036185 3300048927 Bacteria 4310
1176 Ga0496125_0119465 3300048928 Bacteria 1885
1177 Ga0496125_0149755 3300048928 Bacteria 1605
1178 Ga0496125_0217837 3300048928 Bacteria 1233
1179 Ga0496125_0296277 3300048928 Bacteria 993
1180 Ga0496126_0004139 3300048929 Bacteria 17539
1181 Ga0496126_0011296 3300048929 Bacteria 9264
1182 Ga0496126_0014548 3300048929 Bacteria 7948
1183 Ga0496126_0024714 3300048929 Bacteria 5796
1184 Ga0496126_0097468 3300048929 Bacteria 2577
1185 Ga0496126_0097534 3300048929 Bacteria 2576
1186 Ga0496126_0125191 3300048929 Bacteria 2225
1187 Ga0496126_0323320 3300048929 Bacteria 1267
1188 Ga0496126_0353480 3300048929 Bacteria 1201
1189 Ga0496126_0367643 3300048929 Bacteria 1173
1190 Ga0496126_0805463 3300048929 Bacteria 720
1191 Ga0495678_135213 3300049459 Bacteria 813
1192 Ga0501031_0575769 3300049568 Bacteria 725
1193 Ga0501032_0001484 3300049569 Bacteria 18715
1194 Ga0501032_0004833 3300049569 Bacteria 10101
1195 Ga0501033_0002476 3300049570 Bacteria 15652
1196 Ga0501033_0009580 3300049570 Bacteria 7451
1197 Ga0501034_0000955 3300049571 Bacteria 41785
1198 Ga0501034_0006672 3300049571 Bacteria 12378
1199 Ga0501036_0001778 3300049572 Bacteria 16732
1200 Ga0501036_0302526 3300049572 Bacteria 1337
1201 Ga0501037_0000374 3300049573 Bacteria 37235
1202 Ga0501037_0004631 3300049573 Bacteria 9997
1203 Ga0501038_0013942 3300049574 Bacteria 7325
1204 Ga0501038_0053706 3300049574 Bacteria 3467
1205 Ga0501039_0013178 3300049575 Bacteria 6319
1206 Ga0501039_0030505 3300049575 Bacteria 4157
1207 Ga0501041_0057297 3300049577 Bacteria 2383
1208 Ga0501041_0255008 3300049577 Bacteria 1103
1209 Ga0501041_0456195 3300049577 Bacteria 812
1210 Ga0501043_0000932 3300049579 Bacteria 25912
1211 Ga0501043_0012177 3300049579 Bacteria 6722
1212 Ga0501046_0020537 3300049580 Bacteria 5460
1213 Ga0501046_0030167 3300049580 Bacteria 4402
1214 Ga0501047_0003152 3300049581 Bacteria 15642
1215 Ga0501047_0050929 3300049581 Bacteria 3999
1216 Ga0501048_0022290 3300049582 Bacteria 4634
1217 Ga0501048_0317315 3300049582 Bacteria 1110
1218 Ga0501068_0019232 3300049584 Bacteria 3963
1219 Ga0501068_0244784 3300049584 Bacteria 1142
1220 Ga0501069_0029303 3300049585 Bacteria 3021
1221 Ga0501070_0032912 3300049586 Bacteria 4336
1222 Ga0501070_0129945 3300049586 Bacteria 2081
1223 Ga0501070_0981546 3300049586 Bacteria 656
1224 Ga0501071_0286668 3300049587 Bacteria 1247
1225 Ga0501071_0314336 3300049587 Bacteria 1189
1226 Ga0501071_0579914 3300049587 Bacteria 862
1227 Ga0501072_0008393 3300049588 Bacteria 7841
1228 Ga0501073_0002378 3300049589 Bacteria 14090
1229 Ga0501074_0054841 3300049590 Bacteria 2874
1230 Ga0501074_0119673 3300049590 Bacteria 1883
1231 Ga0501075_0011346 3300049591 Bacteria 6306
1232 Ga0501076_0556463 3300049592 Bacteria 946
1233 Ga0501079_0013407 3300049741 Bacteria 6252
1234 Ga0501079_0015285 3300049741 Bacteria 5855
1235 Ga0501080_0002661 3300049742 Bacteria 15625
1236 Ga0501080_0043997 3300049742 Bacteria 4157
1237 Ga0501080_0136654 3300049742 Bacteria 2268
1238 Ga0501081_0001519 3300049743 Bacteria 14264
1239 Ga0501081_0821944 3300049743 Bacteria 700
1240 Ga0501083_0078315 3300049744 Bacteria 2193
1241 Ga0501083_0096022 3300049744 Bacteria 1956
1242 Ga0501083_0151019 3300049744 Bacteria 1521
1243 Ga0501035_0038248 3300049822 Bacteria 4345
1244 Ga0501035_0430917 3300049822 Bacteria 1093
1245 Ga0501044_0000315 3300049823 Bacteria 61159
1246 Ga0501044_0039486 3300049823 Bacteria 4924
1247 Ga0501044_0041106 3300049823 Bacteria 4814
1248 Ga0501044_0103974 3300049823 Bacteria 2854
1249 Ga0501044_1161440 3300049823 Bacteria 640
1250 Ga0501045_0069136 3300049824 Bacteria 2596
1251 nmdc:mga03683_129219_c1 3300050489 Bacteria 1129
1252 nmdc:mga03683_28017_c2 3300050489 Bacteria 1564
1253 nmdc:mga03683_284384_c1 3300050489 Bacteria 773
1254 nmdc:mga03683_47499_c1 3300050489 Bacteria 1781
1255 nmdc:mga03683_48622_c1 3300050489 Bacteria 1135
1256 nmdc:mga03683_81960_c1 3300050489 Bacteria 1394
1257 nmdc:mga03683_88489_c1 3300050489 Bacteria 1347
1258 nmdc:mga03n38_34354_c1 3300050490 Bacteria 2165
1259 nmdc:mga03n38_371785_c1 3300050490 Bacteria 782
1260 nmdc:mga03n38_89347_c1 3300050490 Bacteria 1463
1261 nmdc:mga03n38_9411_c1 3300050490 Bacteria 3555
1262 nmdc:mga00v17_137207_c1 3300050491 Bacteria 1567
1263 nmdc:mga00v17_189332_c1 3300050491 Bacteria 1329
1264 nmdc:mga00v17_311526_c1 3300050491 Bacteria 1023
1265 nmdc:mga00v17_399062_c1 3300050491 Bacteria 894
1266 nmdc:mga00v17_64127_c1 3300050491 Bacteria 2264
1267 nmdc:mga0yw44_14964_c1 3300050492 Bacteria 4140
1268 nmdc:mga0yw44_404972_c1 3300050492 Bacteria 923
1269 nmdc:mga0yw44_431629_c1 3300050492 Bacteria 892
1270 nmdc:mga0yw44_50039_c1 3300050492 Bacteria 2525
1271 nmdc:mga0yw44_61226_c1 3300050492 Bacteria 2308
1272 nmdc:mga0yw44_63502_c1 3300050492 Bacteria 2271
1273 nmdc:mga0yw44_646546_c1 3300050492 Bacteria 719
1274 nmdc:mga0k408_131832_c1 3300050493 Bacteria 1484
1275 nmdc:mga0k408_141786_c1 3300050493 Bacteria 1430
1276 nmdc:mga0k408_185742_c1 3300050493 Bacteria 1240
1277 nmdc:mga0k408_224347_c1 3300050493 Bacteria 1122
1278 nmdc:mga0k408_25826_c1 3300050493 Bacteria 3329
1279 nmdc:mga0k408_35346_c1 3300050493 Bacteria 2866
1280 nmdc:mga0k408_38466_c2 3300050493 Bacteria 1554
1281 nmdc:mga0k408_38889_c1 3300050493 Bacteria 2731
1282 nmdc:mga0k408_52488_c1 3300050493 Bacteria 2363
1283 nmdc:mga0k408_5474_c1 3300050493 Bacteria 6759
1284 nmdc:mga0k408_72072_c1 3300050493 Bacteria 2017
1285 nmdc:mga06z11_115797_c1 3300050494 Bacteria 1490
1286 nmdc:mga06z11_117534_c1 3300050494 Bacteria 1480
1287 nmdc:mga06z11_117607_c1 3300050494 Bacteria 1480
1288 nmdc:mga06z11_224978_c1 3300050494 Bacteria 1098
1289 nmdc:mga06z11_307641_c1 3300050494 Bacteria 943
1290 nmdc:mga06z11_327381_c1 3300050494 Bacteria 915
1291 nmdc:mga06z11_48647_c1 3300050494 Bacteria 2159
1292 nmdc:mga06z11_515372_c1 3300050494 Bacteria 725
1293 nmdc:mga04h51_3096_c1 3300050495 Bacteria 4013
1294 nmdc:mga04h51_4452_c1 3300050495 Bacteria 3487
1295 nmdc:mga04h51_46049_c1 3300050495 Bacteria 1444
1296 nmdc:mga04h51_79306_c1 3300050495 Bacteria 1162
1297 nmdc:mga07m45_109775_c1 3300050496 Bacteria 1588
1298 nmdc:mga07m45_113357_c1 3300050496 Bacteria 1563
1299 nmdc:mga07m45_151879_c1 3300050496 Bacteria 1343
1300 nmdc:mga07m45_152399_c1 3300050496 Bacteria 1341
1301 nmdc:mga07m45_157768_c1 3300050496 Bacteria 1317
1302 nmdc:mga07m45_170535_c1 3300050496 Bacteria 1265
1303 nmdc:mga07m45_186013_c1 3300050496 Bacteria 1208
1304 nmdc:mga07m45_278720_c1 3300050496 Bacteria 973
1305 nmdc:mga07m45_29312_c1 3300050496 Bacteria 3042
1306 nmdc:mga07m45_36869_c1 3300050496 Bacteria 2257
1307 nmdc:mga07m45_457628_c1 3300050496 Bacteria 740
1308 nmdc:mga07m45_56539_c1 3300050496 Bacteria 2218
1309 nmdc:mga05p37_306830_c1 3300050507 Bacteria 1883
1310 nmdc:mga09592_192242_c1 3300050508 Bacteria 1766
1311 nmdc:mga09592_37295_c1 3300050508 Bacteria 4077
1312 nmdc:mga0qj67_21919_c1 3300050509 Bacteria 4902
1313 nmdc:mga0qj67_221_c1 3300050509 Bacteria 38873
1314 nmdc:mga06r32_1124255_c1 3300050510 Bacteria 734
1315 nmdc:mga06r32_20596_c1 3300050510 Bacteria 6074
1316 nmdc:mga06r32_6177_c1 3300050510 Bacteria 10758
1317 nmdc:mga06r32_93225_c1 3300050510 Bacteria 2945
1318 nmdc:mga06r32_9721_c1 3300050510 Bacteria 8687
1319 nmdc:mga08y16_661709_c1 3300050511 Bacteria 1047
1320 nmdc:mga0n895_178880_c1 3300050512 Bacteria 2152
1321 nmdc:mga0n895_289793_c1 3300050512 Bacteria 1660
1322 nmdc:mga0rr50_562965_c1 3300050513 Bacteria 971
1323 nmdc:mga0rr50_73454_c1 3300050513 Bacteria 2615
1324 nmdc:mga0rr50_93385_c2 3300050513 Bacteria 1727
1325 nmdc:mga08x19_339798_c1 3300050514 Bacteria 1047
1326 nmdc:mga08x19_61833_c1 3300050514 Bacteria 2427
1327 nmdc:mga0a205_537113_c1 3300050515 Bacteria 1025
1328 nmdc:mga0sz30_103612_c1 3300050516 Bacteria 1244
1329 nmdc:mga0sz30_21351_c2 3300050516 Bacteria 2212
1330 nmdc:mga0sz30_40305_c1 3300050516 Bacteria 1963
1331 nmdc:mga0sz30_7895_c2 3300050516 Bacteria 919
1332 Ga0495601_0004169 3300053077 Bacteria 8335
1333 Ga0495601_0031180 3300053077 Bacteria 3313
1334 Ga0495601_0130804 3300053077 Bacteria 1634
1335 Ga0495601_0145255 3300053077 Bacteria 1548
1336 Ga0495601_0279227 3300053077 Bacteria 1089
1337 Ga0495612_0007486 3300053078 Bacteria 4462
1338 Ga0495612_0057089 3300053078 Bacteria 1612
1339 Ga0495612_0108673 3300053078 Bacteria 1185
1340 Ga0500610_0187823 3300053079 Bacteria 1006
1341 Ga0500635_0002501 3300053080 Bacteria 4563
1342 Ga0495655_0167879 3300053083 Bacteria 701
1343 Ga0495595_0002260 3300053084 Bacteria 7497
1344 Ga0495619_0081533 3300053085 Bacteria 2178
1345 Ga0495619_0091836 3300053085 Bacteria 2056
1346 Ga0495619_0212192 3300053085 Bacteria 1341
1347 Ga0495619_0310818 3300053085 Bacteria 1091
1348 Ga0495619_0325119 3300053085 Bacteria 1064
1349 Ga0500578_0220309 3300053086 Bacteria 1154
1350 Ga0500578_0230641 3300053086 Bacteria 1122
1351 Ga0500643_000057 3300053087 Bacteria 131401
1352 Ga0500643_052426 3300053087 Bacteria 1163
1353 Ga0500644_0028954 3300053088 Bacteria 1737
1354 Ga0500646_0000154 3300053090 Bacteria 20271
1355 Ga0500647_0006967 3300053091 Bacteria 4820
1356 Ga0500647_0193329 3300053091 Bacteria 927
1357 Ga0500647_0246304 3300053091 Bacteria 788
1358 Ga0500583_0046075 3300053092 Bacteria 2005
1359 Ga0500583_0090817 3300053092 Bacteria 1486
1360 Ga0500583_0099743 3300053092 Bacteria 1421
1361 Ga0500583_0119966 3300053092 Bacteria 1301
1362 Ga0500651_0073476 3300053093 Bacteria 2125
1363 Ga0500651_0144897 3300053093 Bacteria 1429
1364 Ga0500566_0001040 3300053094 Bacteria 16059
1365 Ga0500566_0021628 3300053094 Bacteria 3780
1366 Ga0500566_0305228 3300053094 Bacteria 747
1367 Ga0500640_001081 3300053095 Bacteria 7849
1368 Ga0500641_0064918 3300053096 Bacteria 1526
1369 Ga0500641_0096832 3300053096 Bacteria 1263
1370 Ga0500641_0150649 3300053096 Bacteria 1004
1371 Ga0500641_0283834 3300053096 Bacteria 685
1372 Ga0500648_221272 3300053097 Bacteria 927
1373 Ga0500654_183937 3300053099 Bacteria 661
1374 Ga0500555_003125 3300053103 Bacteria 4726
1375 Ga0500555_043808 3300053103 Bacteria 1240
1376 Ga0500556_0048231 3300053104 Bacteria 1531
1377 Ga0500557_000129 3300053105 Bacteria 19306
1378 Ga0500562_117937 3300053108 Bacteria 723
1379 Ga0500572_000148 3300053111 Bacteria 24267
1380 Ga0500572_001485 3300053111 Bacteria 6330
1381 Ga0500572_014260 3300053111 Bacteria 1982
1382 Ga0500591_016850 3300053115 Bacteria 3526
1383 Ga0500594_0070505 3300053118 Bacteria 1027
1384 Ga0500595_001155 3300053119 Bacteria 14615
1385 Ga0500595_001379 3300053119 Bacteria 13036
1386 Ga0500595_007140 3300053119 Bacteria 4663
1387 Ga0500595_032957 3300053119 Bacteria 1723
1388 Ga0500595_033623 3300053119 Bacteria 1700
1389 Ga0500595_038970 3300053119 Bacteria 1541
1390 Ga0500608_032512 3300053122 Bacteria 2480
1391 Ga0500608_169383 3300053122 Bacteria 938
1392 Ga0500614_000313 3300053123 Bacteria 12526
1393 Ga0500621_152410 3300053126 Bacteria 866
1394 Ga0500642_0000180 3300053130 Bacteria 26182
1395 Ga0500642_0010401 3300053130 Bacteria 3278
1396 Ga0500655_028287 3300053133 Bacteria 1072
1397 Ga0500658_0129611 3300053134 Bacteria 1124
1398 Ga0500559_0001230 3300053136 Bacteria 15155
1399 Ga0500559_0005930 3300053136 Bacteria 5556
1400 Ga0500559_0024957 3300053136 Bacteria 2544
1401 Ga0500561_0051192 3300053137 Bacteria 1128
1402 Ga0500568_0056017 3300053139 Bacteria 1537
1403 Ga0500568_0137232 3300053139 Bacteria 907
1404 Ga0500573_0107782 3300053140 Bacteria 1561
1405 Ga0500588_0116236 3300053146 Bacteria 939
1406 Ga0500590_063732 3300053148 Bacteria 1847
1407 Ga0500590_158266 3300053148 Bacteria 1012
1408 Ga0500603_000076 3300053150 Bacteria 22738
1409 Ga0500603_040666 3300053150 Bacteria 1239
1410 Ga0500603_085600 3300053150 Bacteria 919
1411 Ga0500604_0019662 3300053151 Bacteria 1893
1412 Ga0500604_0154966 3300053151 Bacteria 779
1413 Ga0500616_0000092 3300053153 Bacteria 183860
1414 Ga0500616_0118689 3300053153 Bacteria 1267
1415 Ga0500616_0215741 3300053153 Bacteria 840
1416 Ga0500620_152139 3300053155 Bacteria 805
1417 Ga0500622_0024890 3300053156 Bacteria 3165
1418 Ga0500627_0023107 3300053158 Bacteria 2531
1419 Ga0500630_005759 3300053159 Bacteria 6056
1420 Ga0500638_017487 3300053162 Bacteria 3328
1421 Ga0500638_036871 3300053162 Bacteria 2371
1422 Ga0500639_000014 3300053163 Bacteria 122926
1423 Ga0500636_0000324 3300053177 Bacteria 26370
1424 Ga0500636_0025074 3300053177 Bacteria 3523
1425 Ga0500636_0037661 3300053177 Bacteria 2861
1426 Ga0500637_0000705 3300053178 Bacteria 13305
1427 Ga0500637_0012032 3300053178 Bacteria 4498
1428 Ga0500637_0027169 3300053178 Bacteria 3158
1429 Ga0500637_0102004 3300053178 Bacteria 1663
1430 Ga0500637_0179561 3300053178 Bacteria 1214
1431 Ga0500625_002854 3300053729 Bacteria 6626
1432 Ga0500596_000214 3300053735 Bacteria 9758
1433 Ga0500596_004388 3300053735 Bacteria 2588
1434 Ga0500596_006106 3300053735 Bacteria 2064
1435 Ga0500599_002006 3300053736 Bacteria 2407
1436 Ga0500601_000851 3300053737 Bacteria 3719
1437 Ga0501084_0118044 3300054114 Bacteria 2230
1438 Ga0501084_0125927 3300054114 Bacteria 2156
1439 Ga0501084_0129718 3300054114 Bacteria 2122
1440 Ga0500661_006724 3300055283 Bacteria 2139
1441 Ga0500661_009700 3300055283 Bacteria 1759
1442 Ga0587082_067466 3300059504 Bacteria 720
1443 Ga0587083_0107069 3300059505 Bacteria 705
1444 Ga0501082_0038236 3300060353 Bacteria 4140
1445 Ga0530510_0022282 3300061734 Bacteria 4511
1446 2507511056 2507262055 Bacteria 8048963
1447 2508544873 2508501009 Bacteria 7784016
1448 2508696907 2508501042 Bacteria 8719808
1449 2509151837 2508501128 Bacteria 8613869
1450 2511400386 2511231028 Bacteria 8046582
1451 2513623516 2513237092 Bacteria 8341956
1452 2513649713 2513237095 Bacteria 8976980
1453 2513678541 2513237098 Bacteria 9902361
1454 2513696526 2513237101 Bacteria 7952346
1455 2513701174 2513237102 Bacteria 7703324
1456 2513716953 2513237104 Bacteria 10034502
1457 2513874682 2513237139 Bacteria 8737671
1458 2513892130 2513237141 Bacteria 8496279
1459 2514010600 2513237161 Bacteria 8871253
1460 2515625372 2515154112 Bacteria 8294334
1461 2517100623 2517093001 Bacteria 9002274
1462 2524438151 2524023205 Bacteria 8918781
1463 2524468849 2524023210 Bacteria 9029266
1464 2528856708 2528768022 Bacteria 10457665
1465 2596374236 2595698237 Bacteria 6712432
1466 2617350808 2617270735 Bacteria 9163226
1467 2617373178 2617270741 Bacteria 8201522
1468 2723843034 2721755755 Bacteria 8322773
1469 2739249163 2738543013 Bacteria 5618633
1470 2745076967 2744054633 Bacteria 8678936
1471 2793064698 2791355196 Bacteria 7323613
1472 2793083663
1473 2805916681 2802429603 Bacteria 8777136
1474 2818238185 2816332527 Bacteria 8933356
1475 2824607513 2824600985 Bacteria 8488197
1476 2824617029 2824609381 Bacteria 8672835
1477 2824626270 2824617872 Bacteria 8814715
1478 2824634925 2824626560 Bacteria 8813858
1479 2824643453 2824635225 Bacteria 8785348
1480 2824652243 2824644064 Bacteria 8743947
1481 2824658744 2824653114 Bacteria 8493680
1482 2824670762 2824661429 Bacteria 9877870
1483 2824678886 2824671348 Bacteria 8369588
1484 2824687018 2824679649 Bacteria 8248951
1485 2824695398 2824687955 Bacteria 8360029
1486 2824703745 2824696289 Bacteria 8335049
1487 2824713111 2824704595 Bacteria 9667483
1488 2824722646 2824714736 Bacteria 8717648
1489 2824732216 2824723954 Bacteria 8758240
1490 2824737084 2824732956 Bacteria 7810675
1491 2824753452 2824746037 Bacteria 7911610
1492 2824763197 2824753945 Bacteria 9787441
1493 2824771396 2824763712 Bacteria 9792355
1494 2824780472 2824773399 Bacteria 8360218
1495 2829748345 2829745981 Bacteria 5406054
1496 2831869442 2831864461 Bacteria 6502356
1497 2838127927 2838122688 Bacteria 8803140
1498 2841943221 2841941048 Bacteria 8688029
1499 2841954047 2841949485 Bacteria 8680857
1500 2841960187 2841957949 Bacteria 8652217
1501 2841968139 2841966195 Bacteria 8673214
1502 2841976652 2841974524 Bacteria 8931498
1503 2841988024 2841983080 Bacteria 8395090
1504 2842042668 2842038055 Bacteria 8002051
1505 2842050711 2842045827 Bacteria 8006841
1506 2844316880 2844315083 Bacteria 8138177
1507 2847938594 2847930680 Bacteria 9342022
1508 2847944206 2847939898 Bacteria 8606328
1509 2848298708 2848297114 Bacteria 3608511
1510 2849081568 2849076700 Bacteria 7039503
1511 2857512221 2857509624 Bacteria 7472071
1512 2874597788 2874590934 Bacteria 8299676
1513 2874612632 2874604998 Bacteria 7834745
1514 2874617663 2874612657 Bacteria 8252029
1515 2874623401 2874620515 Bacteria 8290088
1516 2874634181 2874628541 Bacteria 8630250
1517 2874651317 2874645413 Bacteria 8214782
1518 2876764080 2876761206 Bacteria 10111113
1519 2876776388 2876771140 Bacteria 8287509
1520 2876817497 2876808645 Bacteria 8824342
1521 2876820956 2876818435 Bacteria 8274608
1522 2879081749 2879074833 Bacteria 8279565
1523 2879088430 2879083081 Bacteria 8587928
1524 2879108832 2879099564 Bacteria 10442239
1525 2879118085 2879110137 Bacteria 8907982
1526 2879130463 2879127579 Bacteria 8294491
1527 2879146349 2879142872 Bacteria 8267021
1528 2881370714 2881364244 Bacteria 7710352
1529 2881671303 2881665667 Bacteria 8175609
1530 2885366903 2885366525 Bacteria 8326213
1531 2885387143 2885383462 Bacteria 9473874
1532 2885413398 2885409591 Bacteria 9235467
1533 2886850740 2886848708 Bacteria 5632523
1534 2888381492 2888378607 Bacteria 9652610
1535 2888389155 2888388044 Bacteria 7304136
1536 2888421894 2888419890 Bacteria 7857137
1537 2889033666 2889033259 Bacteria 9099371
1538 2889307571 2889306138 Bacteria 6358934
1539 2902333107 2902330777 Bacteria 6395352
1540 2902410190 2902405164 Bacteria 6784948
1541 2903733930 2903727486 Bacteria 8281579
1542 2903772030 2903768456 Bacteria 9749579
1543 2904672668 2904666416 Bacteria 8226587
1544 2904719262 2904711408 Bacteria 9771557
1545 2906604546 2906602504 Bacteria 8295279
1546 2906635208 2906626472 Bacteria 8826946
1547 2906649115 2906643746 Bacteria 8722424
1548 2908781634 2908775508 Bacteria 8092255
1549 2919704348 2919704043 Bacteria 5560311
1550 2922367031 2922361189 Bacteria 7436256
1551 2922371156
1552 2922390189 2922386360 Bacteria 7017218
1553 2922393526 2922393267 Bacteria 8285685
1554 2928126604 2928125067 Bacteria 5937560
1555 2929619543 2929615660 Bacteria 9193770
1556 2929627987 2929624759 Bacteria 9339455
1557 2932785867 2932784394 Bacteria 9704911
1558 2932798346 2932794094 Bacteria 7915132
1559 2932804142 2932801729 Bacteria 7987968
1560 2932817240 2932809354 Bacteria 9135765
1561 2932826729 2932818245 Bacteria 9955613
1562 2932830912 2932828146 Bacteria 9745859
1563 2933581463 2933577622 Bacteria 9116884
1564 2935612713 2935608549 Bacteria 8203142
1565 2935620980 2935616580 Bacteria 9032984
1566 2935640053 2935638405 Bacteria 10015038
1567 2935655165 2935648319 Bacteria 8801166
1568 2935664046 2935656913 Bacteria 8965014
1569 2935667108 2935665750 Bacteria 9571747
1570 2935680252 2935675223 Bacteria 9928132
1571 2935690238 2935684952 Bacteria 9590419
1572 2935699674 2935694250 Bacteria 9291695
1573 2935704864 2935703347 Bacteria 10242284
1574 2935718065 2935713505 Bacteria 9608509
1575 2935726785 2935722832 Bacteria 9608746
1576 2935735554 2935732158 Bacteria 9706831
1577 2935745175 2935741537 Bacteria 9707219
1578 2935755249 2935750917 Bacteria 9590372
1579 2935762234 2935760218 Bacteria 9817913
1580 2935773611 2935769743 Bacteria 7878163
1581 2935780169 2935777560 Bacteria 8077691
1582 2935788484 2935785616 Bacteria 7962367
1583 2935796640 2935793552 Bacteria 8012592
1584 2935803734 2935801545 Bacteria 9301974
1585 2935811652 2935810662 Bacteria 9401221
1586 2935824202 2935819856 Bacteria 8261050
1587 2935829536 2935827899 Bacteria 10038562
1588 2935842502 2935837841 Bacteria 9454360
1589 2935852651 2935847175 Bacteria 8228321
1590 2935858787 2935855204 Bacteria 9035059
1591 2935866815 2935864058 Bacteria 9784707
1592 2935876946 2935873716 Bacteria 9632195
1593 2935884052 2935883170 Bacteria 7964738
1594 2935912197 2935908558 Bacteria 8568796
1595 2935922410 2935916978 Bacteria 9113783
1596 2935929226 2935926038 Bacteria 8601059
1597 2935935857 2935934488 Bacteria 8602579
1598 2935947423 2935942939 Bacteria 8599779
1599 2935953482 2935951376 Bacteria 8602333
1600 2935962009 2935959822 Bacteria 7869783
1601 2935968508 2935967501 Bacteria 8603075
1602 2935976692 2935975950 Bacteria 8347125
1603 2935990691 2935984226 Bacteria 8302647
1604 2935993414 2935992306 Bacteria 9802711
1605 2936004309 2936002035 Bacteria 9362176
1606 2936015456 2936011229 Bacteria 8801034
1607 2936024090 2936019824 Bacteria 8804134
1608 2936033105 2936028420 Bacteria 8965941
1609 2936038234 2936037263 Bacteria 9446081
1610 2936051198 2936046547 Bacteria 8903709
1611 2936058576 2936055302 Bacteria 8785755
1612 2940561470 2940556831 Bacteria 9590747
1613 2941533660 2941531003 Bacteria 7653939
1614 2941547385 2941538514 Bacteria 9402094
1615 3005486150 3005483717 Bacteria 7877331
1616 3005507091 3005506211 Bacteria 6943378
1617 3005593053 3005587118 Bacteria 7794411
1618 3005596509 3005594810 Bacteria 8716512
1619 3005712579 3005710791 Bacteria 7622528
1620 3005719638 3005718088 Bacteria 8283608
1621 643602447 643348564 Bacteria 8839022
1622 8006930088 8006926726 Bacteria 6749210
1623 8006966568 8006964411 Bacteria 8966052
1624 8006989411 8006984368 Bacteria 9651211
1625 8006997879 8006994254 Bacteria 8309700
1626 8016516475 8016511872 Bacteria 9921665
1627 8016523881 8016522445 Bacteria 8156687
1628 8016541683 8016539877 Bacteria 8155419
1629 8016551589 8016548790 Bacteria 8155074
1630 8016559972 8016557553 Bacteria 8154380
1631 8016567068 8016566248 Bacteria 8158151
1632 8016579785 8016575299 Bacteria 8154085
1633 8016597900 8016595262 Bacteria 8149947
1634 8016604036 8016603502 Bacteria 8731218
1635 8016620620 8016613128 Bacteria 8794220
1636 8016629375 8016622563 Bacteria 7999408
1637 8016633883 8016630954 Bacteria 9217207
1638 8017060064 8017057580 Bacteria 10023680
1639 8019537096 8019530166 Bacteria 8155624
1640 8019542447 8019538911 Bacteria 7872763
1641 8019548313 8019547302 Bacteria 7996444
1642 8019579572 8019576017 Bacteria 10049540
1643 8019587282 8019586578 Bacteria 10212056
1644 8019604059 8019597564 Bacteria 10041141
1645 8019614470 8019608314 Bacteria 10042931
1646 8019625095 8019619141 Bacteria 9218857
1647 8019637086 8019629233 Bacteria 8687553
1648 8019642516 8019638758 Bacteria 9062356
1649 8019674490 8019668869 Bacteria 8791617
1650 8019681616 8019678201 Bacteria 8863603
1651 8019694160 8019687851 Bacteria 8712826
1652 8055749199 8055742211 Bacteria 9226248
1653 8056674910 8056673599 Bacteria 7871253
1654 8056682335 8056681323 Bacteria 8472857
1655 8056969681 8056967851 Bacteria 9038162
1656 Ga0070683_100279156
1657 LJNas_1007582
1658 JGI24740J21852_10008811
1659 JGI24735J21928_10001998
1660 JGI24744J21845_10018209
1661 JGI25406J46586_10009990
1662 JGI25406J46586_10043167
1663 JGI25165J46597_1006536
1664 JGI25153J46596_10002774
1665 JGI25153J46596_10027669
1666 rootL2_10001663
1667 JGI25160J50197_1019866
1668 JGI25160J50197_1026122
1669 JGI25404J52841_10006558
1670 JGI25404J52841_10010832
1671 JGI25404J52841_10014898
1672 JGI25404J52841_10019762
1673 JGI25404J52841_10021733
1674 JGI25404J52841_10052187
1675 Ga0055539_1005760
1676 Ga0055526_1012133
1677 Ga0055524_1000552
1678 Ga0055531_10001408
1679 Ga0055531_10001492
1680 Ga0055543_1018006
1681 Ga0065165_1000016
1682 Ga0065165_1003197
1683 Ga0065712_10155411
1684 Ga0065712_10278757
1685 Ga0070658_10470902
1686 Ga0070676_10036142
1687 Ga0070683_100052756
1688 Ga0070677_10035063
1689 Ga0068869_100021473
1690 Ga0068869_100055612
1691 Ga0070666_10055129
1692 Ga0070666_10155864
1693 Ga0070680_100155083
1694 Ga0070680_100158631
1695 Ga0070682_100040990
1696 Ga0070682_100202655
1697 Ga0070682_100262953
1698 Ga0068868_100174759
1699 Ga0068868_100484012
1700 Ga0070660_100037695
1701 Ga0070660_100116311
1702 Ga0070689_100040633
1703 Ga0070689_100335196
1704 Ga0070689_100403686
1705 Ga0070661_100208678
1706 Ga0070661_100422690
1707 Ga0070661_100661171
1708 Ga0070668_100050072
1709 Ga0070668_100069151
1710 Ga0070668_100174996
1711 Ga0070668_100282949
1712 Ga0070668_100766677
1713 Ga0070669_100290393
1714 Ga0070669_100840998
1715 Ga0070675_100082243
1716 Ga0070675_100242823
1717 Ga0070675_100390207
1718 Ga0070675_100551285
1719 Ga0070671_100006185
1720 Ga0070671_100058932
1721 Ga0070671_100191192
1722 Ga0070671_100313403
1723 Ga0070674_100219162
1724 Ga0070674_100725405
1725 Ga0070673_100062261
1726 Ga0070673_100742239
1727 Ga0070688_100084177
1728 Ga0070688_100123413
1729 Ga0070688_100463505
1730 Ga0070667_100007677
1731 Ga0070667_100121363
1732 Ga0070667_100291509
1733 Ga0070667_100323221
1734 Ga0070667_100346318
1735 Ga0070709_10002295
1736 Ga0070709_10003472
1737 Ga0070709_10032611
1738 Ga0070709_10057122
1739 Ga0070709_10156677
1740 Ga0070709_10256296
1741 Ga0070714_100017825
1742 Ga0070714_100552483
1743 Ga0070713_100002964
1744 Ga0070713_100005146
1745 Ga0070713_100037482
1746 Ga0070713_100100661
1747 Ga0070713_100103917
1748 Ga0070713_100137493
1749 Ga0070713_100157898
1750 Ga0070710_10000670
1751 Ga0070710_10008450
1752 Ga0070710_10042770
1753 Ga0070710_10209221
1754 Ga0070710_10325089
1755 Ga0070711_100007952
1756 Ga0070711_100304898
1757 Ga0070711_100556195
1758 Ga0070663_100009751
1759 Ga0070663_100145075
1760 Ga0070663_100153269
1761 Ga0070663_100283382
1762 Ga0070663_100551496
1763 Ga0070678_100025881
1764 Ga0070678_100031470
1765 Ga0070678_100033640
1766 Ga0070678_100237058
1767 Ga0070662_100060618
1768 Ga0070662_100329276
1769 Ga0070681_10011776
1770 Ga0070681_10042493
1771 Ga0070681_10148627
1772 Ga0070681_10249375
1773 Ga0070681_10269621
1774 Ga0068867_100222223
1775 Ga0068867_100997727
1776 Ga0070685_10104552
1777 Ga0070685_10195811
1778 Ga0070685_10196492
1779 Ga0070706_100115232
1780 Ga0070698_100201837
1781 Ga0070698_100584522
1782 Ga0070699_100124273
1783 Ga0070679_100029967
1784 Ga0070679_100041486
1785 Ga0070679_100070455
1786 Ga0070679_100341701
1787 Ga0070679_100399368
1788 Ga0070679_100764614
1789 Ga0070684_100017961
1790 Ga0070684_100081454
1791 Ga0070697_100139093
1792 Ga0068853_100004631
1793 Ga0068853_100017135
1794 Ga0068853_100070106
1795 Ga0068853_100203608
1796 Ga0068853_100289530
1797 Ga0068853_100321721
1798 Ga0068853_100382807
1799 Ga0070672_100085127
1800 Ga0070672_100130773
1801 Ga0070672_100137346
1802 Ga0070672_100151370
1803 Ga0070686_100125678
1804 Ga0070686_100181242
1805 Ga0070686_100367886
1806 Ga0070693_100084049
1807 Ga0070693_100305632
1808 Ga0070693_100675285
1809 Ga0070665_100010558
1810 Ga0070665_100055362
1811 Ga0070665_100110027
1812 Ga0070665_100215615
1813 Ga0070665_100309023
1814 Ga0070665_100727119
1815 Ga0070665_100764734
1816 Ga0070665_100818324
1817 Ga0070665_101289354
1818 Ga0070704_101325221
1819 Ga0068855_100019336
1820 Ga0068855_100113658
1821 Ga0068855_100480578
1822 Ga0070664_100254315
1823 Ga0068857_100010438
1824 Ga0068857_100011515
1825 Ga0068857_100085429
1826 Ga0068857_100712991
1827 Ga0068854_100038376
1828 Ga0068854_100044419
1829 Ga0068854_100184896
1830 Ga0068854_100606004
1831 Ga0068856_100000434
1832 Ga0068856_100003274
1833 Ga0068856_100133783
1834 Ga0070702_100003925
1835 Ga0070702_100143508
1836 Ga0068859_100000206
1837 Ga0068859_100022208
1838 Ga0068859_100149624
1839 Ga0068859_100210081
1840 Ga0068859_100599584
1841 Ga0068864_100016310
1842 Ga0068864_101051402
1843 Ga0068861_100114770
1844 Ga0068861_100132321
1845 Ga0068861_100227317
1846 Ga0068861_100316197
1847 Ga0068851_10008428
1848 Ga0068870_10078184
1849 Ga0068863_100004529
1850 Ga0068863_100025756
1851 Ga0068863_100373096
1852 Ga0068863_100414338
1853 Ga0068858_100000483
1854 Ga0068858_100043024
1855 Ga0068858_100128408
1856 Ga0068858_100300048
1857 Ga0068860_100003873
1858 Ga0068860_100028853
1859 Ga0068860_100055668
1860 Ga0068860_100109405
1861 Ga0068860_100138793
1862 Ga0068860_100208471
1863 Ga0068862_100099272
1864 Ga0068862_100143494
1865 Ga0068862_100188770
1866 Ga0068862_100305175
1867 Ga0068862_100399499
1868 Ga0068862_100816766
1869 Ga0081455_10000812
1870 Ga0081455_10009274
1871 Ga0081455_10015998
1872 Ga0081455_10020610
1873 Ga0081455_10028221
1874 Ga0081538_10004738
1875 Ga0081538_10020460
1876 Ga0081538_10112627
1877 Ga0081540_1001986
1878 Ga0081540_1002094
1879 Ga0081540_1006308
1880 Ga0081540_1010425
1881 Ga0081540_1020900
1882 Ga0081540_1026478
1883 Ga0081540_1027710
1884 Ga0081540_1105978
1885 Ga0081539_10000351
1886 Ga0081539_10001264
1887 Ga0081539_10020384
1888 Ga0081539_10072103
1889 Ga0070717_10013517
1890 Ga0070717_10053667
1891 Ga0070717_10067675
1892 Ga0070717_10077200
1893 Ga0070717_10185195
1894 Ga0070717_10211652
1895 Ga0075365_10044906
1896 Ga0075365_10054787
1897 Ga0075365_10100510
1898 Ga0075365_10210355
1899 Ga0075365_10222435
1900 Ga0075365_10335451
1901 Ga0075368_10002752
1902 Ga0075368_10024760
1903 Ga0075368_10086974
1904 Ga0075368_10123016
1905 Ga0075368_10125195
1906 Ga0075368_10143555
1907 Ga0075368_10172914
1908 Ga0075363_100007371
1909 Ga0075363_100085490
1910 Ga0075363_100156297
1911 Ga0075364_10015286
1912 Ga0075364_10192691
1913 Ga0075364_10271556
1914 Ga0075364_10342696
1915 Ga0075364_10383648
1916 Ga0070715_10110546
1917 Ga0070715_10186994
1918 Ga0070716_100021762
1919 Ga0070716_100022705
1920 Ga0070712_100152685
1921 Ga0075362_10039422
1922 Ga0075362_10078378
1923 Ga0075362_10104254
1924 Ga0075362_10114490
1925 Ga0075362_10163239
1926 Ga0075362_10176350
1927 Ga0075362_10201489
1928 Ga0075367_10007138
1929 Ga0075367_10020451
1930 Ga0075367_10117291
1931 Ga0075367_10313083
1932 Ga0075367_10333408
1933 Ga0075369_10005751
1934 Ga0075369_10063379
1935 Ga0075369_10124491
1936 Ga0075369_10216187
1937 Ga0075366_10025122
1938 Ga0075366_10027084
1939 Ga0075366_10034731
1940 Ga0075366_10060099
1941 Ga0075366_10062649
1942 Ga0075366_10100900
1943 Ga0075366_10117755
1944 Ga0075366_10301952
1945 Ga0075366_10321705
1946 Ga0097621_100204250
1947 Ga0097621_100455905
1948 Ga0075370_10003211
1949 Ga0075370_10082375
1950 Ga0075370_10094916
1951 Ga0075370_10098523
1952 Ga0075370_10214290
1953 Ga0068871_100390412
1954 Ga0068871_100499942
1955 Ga0068871_100652731
1956 Ga0068871_100719567
1957 Ga0075428_100034276
1958 Ga0075428_100065050
1959 Ga0075428_100377530
1960 Ga0075430_100003256
1961 Ga0075430_100008450
1962 Ga0075431_100002635
1963 Ga0075431_100005152
1964 Ga0075431_100249131
1965 Ga0075431_101162642
1966 Ga0075433_10396971
1967 Ga0075434_100598770
1968 Ga0075429_100029205
1969 Ga0075429_100539156
1970 Ga0068865_100340725
1971 Ga0075436_100159844
1972 Ga0075436_100399373
1973 Ga0097620_100000206
1974 Ga0097620_100022208
1975 Ga0097620_100149620
1976 Ga0097620_100210080
1977 Ga0097620_100599522
1978 Ga0099824_1020485
1979 Ga0099823_1000159
1980 Ga0075435_100067945
1981 Ga0075435_100276952
1982 Ga0099794_10095570
1983 Ga0099794_10177106
1984 Ga0099794_10211826
1985 Ga0099795_10017622
1986 Ga0099795_10100443
1987 Ga0105250_10028249
1988 Ga0105240_10004109
1989 Ga0105240_10006884
1990 Ga0105240_10007517
1991 Ga0105240_10378469
1992 Ga0105240_10986428
1993 Ga0111539_10433569
1994 Ga0111539_10509493
1995 Ga0105245_10023295
1996 Ga0105245_10243558
1997 Ga0105247_10000088
1998 Ga0105247_10037140
1999 Ga0114129_10080790
2000 Ga0114129_10226450
2001 Ga0105243_10304844
2002 Ga0105241_10002534
2003 Ga0105241_10056815
2004 Ga0105241_10117210
2005 Ga0105241_10369194
2006 Ga0105241_10503693
2007 Ga0105241_10557055
2008 Ga0105241_10590319
2009 Ga0105242_10955988
2010 Ga0105248_10040166
2011 Ga0105248_10800594
2012 Ga0105248_10847988
2013 Ga0105237_10108162
2014 Ga0105237_10111732
2015 Ga0105237_10141359
2016 Ga0105237_10231894
2017 Ga0105237_10433139
2018 Ga0105237_10596895
2019 Ga0105238_10001191
2020 Ga0105238_10004162
2021 Ga0105238_10152200
2022 Ga0105238_10199197
2023 Ga0105238_10319332
2024 Ga0105238_10678669
2025 Ga0105238_10840998
2026 Ga0105238_10942235
2027 Ga0105249_10041598
2028 Ga0105249_10396614
2029 Ga0105249_10461447
2030 Ga0105249_10972474
2031 Ga0105249_11037232
2032 Ga0105249_11732008
2033 Ga0099796_10061171
2034 Ga0105239_10033506
2035 Ga0105239_10126755
2036 Ga0105239_10129504
2037 Ga0105239_10133572
2038 Ga0105239_10140807
2039 Ga0105239_10500351
2040 Ga0105246_10011299
2041 Ga0105246_10267874
2042 Ga0105246_10461059
2043 Ga0105246_10488503
2044 Ga0157319_1000015
2045 Ga0157373_10310421
2046 Ga0157370_10080792
2047 Ga0157370_10680539
2048 Ga0157369_10082169
2049 Ga0157369_10226457
2050 Ga0157374_10212671
2051 Ga0157374_10329455
2052 Ga0157374_10417474
2053 Ga0157374_10436252
2054 Ga0163162_10255848
2055 Ga0163162_10404593
2056 Ga0163162_10756192
2057 Ga0157372_10250867
2058 Ga0157372_10538428
2059 Ga0157372_11177496
2060 Ga0157375_10020701
2061 Ga0157375_10161601
2062 Ga0163163_10026516
2063 Ga0163163_10436090
2064 Ga0163163_11263290
2065 Ga0163163_11469439
2066 Ga0157380_10389449
2067 Ga0157380_10496500
2068 Ga0157379_10059904
2069 Ga0157379_10138347
2070 Ga0157379_10209971
2071 Ga0157379_10338134
2072 Ga0157379_10525540
2073 Ga0157379_10592968
2074 Ga0157376_10375316
2075 Ga0157376_10474953
2076 Ga0157376_10858747
2077 Ga0163161_10051818
2078 Ga0163161_10157812
2079 Ga0214544_1000001
2080 Ga0214542_1000005
2081 Ga0214545_1000003
2082 Ga0214543_1000002
2083 Ga0213874_10016178
2084 Ga0213876_10133106
2085 Ga0213875_10084537
2086 Ga0213871_10003352
2087 Ga0224572_1004877
2088 Ga0209563_102960
2089 Ga0207425_1004681
2090 Ga0209677_100732
2091 Ga0209677_105587
2092 Ga0209148_1000424
2093 Ga0209148_1023745
2094 Ga0209233_1002009
2095 Ga0209455_1002336
2096 Ga0209455_1003026
2097 Ga0209455_1016893
2098 Ga0209673_1005096
2099 Ga0209673_1039730
2100 Ga0209130_1035841
2101 Ga0209564_1005101
2102 Ga0209564_1013333
2103 Ga0209758_1000026
2104 Ga0209758_1000613
2105 Ga0209758_1000880
2106 Ga0209758_1001679
2107 Ga0209758_1002992
2108 Ga0209758_1020502
2109 Ga0209758_1070085
2110 Ga0209758_1072679
2111 Ga0209050_1005153
2112 Ga0209256_1000394
2113 Ga0209256_1000665
2114 Ga0209256_1003785
2115 Ga0207426_1000425
2116 Ga0207426_1009082
2117 Ga0207426_1015297
2118 Ga0209051_1001627
2119 Ga0209257_1000426
2120 Ga0209257_1002239
2121 Ga0209257_1002312
2122 Ga0207656_10047458
2123 Ga0207653_10158684
2124 Ga0207682_10003055
2125 Ga0207692_10000488
2126 Ga0207692_10000857
2127 Ga0207692_10022931
2128 Ga0207692_10314398
2129 Ga0207642_10552515
2130 Ga0207710_10000205
2131 Ga0207710_10037281
2132 Ga0207688_10014539
2133 Ga0207688_10015986
2134 Ga0207688_10161197
2135 Ga0207680_10119839
2136 Ga0207680_10223895
2137 Ga0207647_10000220
2138 Ga0207647_10046056
2139 Ga0207647_10231752
2140 Ga0207699_10001075
2141 Ga0207699_10061939
2142 Ga0207699_10201177
2143 Ga0207645_10067417
2144 Ga0207645_10182847
2145 Ga0207645_10217012
2146 Ga0207645_10606027
2147 Ga0207643_10044593
2148 Ga0207684_10373494
2149 Ga0207654_10000081
2150 Ga0207654_10017803
2151 Ga0207654_10092583
2152 Ga0207654_10104057
2153 Ga0207654_10159853
2154 Ga0207654_10692299
2155 Ga0207707_10000178
2156 Ga0207707_10019742
2157 Ga0207707_10071082
2158 Ga0207707_10187064
2159 Ga0207707_10251777
2160 Ga0207707_10437840
2161 Ga0207695_10000792
2162 Ga0207695_10002487
2163 Ga0207695_10082664
2164 Ga0207695_10087886
2165 Ga0207671_10008093
2166 Ga0207671_10033736
2167 Ga0207671_10044293
2168 Ga0207671_10294072
2169 Ga0207671_10659455
2170 Ga0207693_10060906
2171 Ga0207693_10194705
2172 Ga0207693_10518640
2173 Ga0207693_10784005
2174 Ga0207663_10095110
2175 Ga0207663_10140180
2176 Ga0207660_10041651
2177 Ga0207660_10073413
2178 Ga0207662_10048779
2179 Ga0207657_10042401
2180 Ga0207657_10124247
2181 Ga0207657_10663718
2182 Ga0207649_10250247
2183 Ga0207652_10200952
2184 Ga0207652_10391561
2185 Ga0207681_10280630
2186 Ga0207694_10000134
2187 Ga0207694_10018077
2188 Ga0207650_10006480
2189 Ga0207650_10356241
2190 Ga0207650_10656616
2191 Ga0207659_10062440
2192 Ga0207659_10110192
2193 Ga0207659_10165245
2194 Ga0207659_10166988
2195 Ga0207687_10021001
2196 Ga0207687_10076758
2197 Ga0207687_10117251
2198 Ga0207700_10006387
2199 Ga0207700_10025306
2200 Ga0207700_10211906
2201 Ga0207700_10309784
2202 Ga0207700_10386625
2203 Ga0207700_10409095
2204 Ga0207700_10422184
2205 Ga0207700_10604217
2206 Ga0207664_10008339
2207 Ga0207664_10051200
2208 Ga0207664_10125084
2209 Ga0207664_10539369
2210 Ga0207664_10598778
2211 Ga0207644_10009052
2212 Ga0207644_10010871
2213 Ga0207644_10235234
2214 Ga0207644_10792522
2215 Ga0207706_10025374
2216 Ga0207706_10105930
2217 Ga0207706_10387884
2218 Ga0207686_10075811
2219 Ga0207709_10242467
2220 Ga0207709_10313806
2221 Ga0207670_10032892
2222 Ga0207670_10264080
2223 Ga0207669_10146654
2224 Ga0207669_10534670
2225 Ga0207665_10010001
2226 Ga0207665_10014958
2227 Ga0207665_10167266
2228 Ga0207665_10233958
2229 Ga0207665_10545099
2230 Ga0207691_10000698
2231 Ga0207691_10357503
2232 Ga0207691_10407572
2233 Ga0207691_10776048
2234 Ga0207711_10017689
2235 Ga0207661_10004454
2236 Ga0207661_10025602
2237 Ga0207661_10240481
2238 Ga0207679_10123560
2239 Ga0207679_10572923
2240 Ga0207667_10008395
2241 Ga0207667_10062284
2242 Ga0207667_10098987
2243 Ga0207667_10244331
2244 Ga0207651_10179912
2245 Ga0207712_10290484
2246 Ga0207712_10490877
2247 Ga0207668_10144482
2248 Ga0207668_10394476
2249 Ga0207640_10011779
2250 Ga0207640_10032524
2251 Ga0207640_10513349
2252 Ga0207658_10047097
2253 Ga0207658_10432628
2254 Ga0207658_10504302
2255 Ga0207677_10123528
2256 Ga0207677_10146925
2257 Ga0207703_10002506
2258 Ga0207703_10089825
2259 Ga0207703_10097235
2260 Ga0207703_10125220
2261 Ga0207703_10364295
2262 Ga0207703_10552775
2263 Ga0207703_10683644
2264 Ga0207639_10028198
2265 Ga0207639_10063368
2266 Ga0207639_10152276
2267 Ga0207639_10160206
2268 Ga0207639_10451595
2269 Ga0207678_10023360
2270 Ga0207678_10040710
2271 Ga0207678_10263659
2272 Ga0207678_10266186
2273 Ga0207678_10441853
2274 Ga0207678_10565382
2275 Ga0207708_10505868
2276 Ga0207708_10970513
2277 Ga0207702_10000041
2278 Ga0207702_10000180
2279 Ga0207702_10008051
2280 Ga0207641_10791698
2281 Ga0207648_10135849
2282 Ga0207648_10175136
2283 Ga0207648_10478752
2284 Ga0207648_10894958
2285 Ga0207676_10024491
2286 Ga0207676_10066448
2287 Ga0207676_10264901
2288 Ga0207674_10001084
2289 Ga0207674_10004586
2290 Ga0207674_10046856
2291 Ga0207674_10276058
2292 Ga0207674_10753848
2293 Ga0207675_100029542
2294 Ga0207675_100236585
2295 Ga0207675_100395269
2296 Ga0207675_100400597
2297 Ga0207683_10025663
2298 Ga0207683_10047657
2299 Ga0207683_10223487
2300 Ga0207683_10715959
2301 Ga0207683_10751715
2302 Ga0207698_10158401
2303 Ga0207698_10615903
2304 Ga0207698_10632251
2305 Ga0209389_1000090
2306 Ga0209389_1000119
2307 Ga0209371_1009241
2308 Ga0209589_1000010
2309 Ga0209489_100011
2310 Ga0209489_100385
2311 Ga0209700_100013
2312 Ga0209970_1000101
2313 Ga0209588_1054177
2314 Ga0209813_10001497
2315 Ga0209813_10066346
2316 Ga0265355_1000790
2317 Ga0268266_10005802
2318 Ga0268266_10055170
2319 Ga0268266_10528405
2320 Ga0268266_10623795
2321 Ga0268266_10645702
2322 Ga0268266_10748518
2323 Ga0268265_10046489
2324 Ga0268265_10084689
2325 Ga0268265_10148699
2326 Ga0268265_10263512
2327 Ga0268265_11018659
2328 Ga0268264_10000093
2329 Ga0268264_10100469
2330 Ga0268264_10154241
2331 Ga0265337_1002785
2332 Ga0265326_10001368
2333 Ga0265319_1002644
2334 Ga0265334_10013730
2335 Ga0265318_10005911
2336 Ga0265323_10004952
2337 Ga0265322_10005073
2338 Ga0265336_10000169
2339 Ga0307517_10003969
2340 Ga0307515_10000040
2341 Ga0307515_10000433
2342 Ga0265338_10000624
2343 Ga0265324_10005252
2344 Ga0268256_1009760
2345 Ga0307511_10000022
2346 Ga0307511_10000448
2347 Ga0307511_10155467
2348 Ga0307512_10177664
2349 Ga0265763_1000840
2350 Ga0265770_1000728
2351 Ga0265765_1020014
2352 Ga0265773_1003679
2353 Ga0265760_10000431
2354 Ga0265330_10106670
2355 Ga0265332_10145336
2356 Ga0265320_10049671
2357 Ga0265320_10217099
2358 Ga0265325_10003656
2359 Ga0265325_10025892
2360 Ga0265329_10020107
2361 Ga0265340_10011120
2362 Ga0265340_10042738
2363 Ga0265340_10044657
2364 Ga0265340_10150268
2365 Ga0265339_10000158
2366 Ga0265339_10151289
2367 Ga0265327_10001335
2368 Ga0265316_10126964
2369 Ga0265316_10292396
2370 Ga0265316_10610113
2371 Ga0307513_10032139
2372 Ga0307513_10077494
2373 Ga0307513_10217751
2374 Ga0307513_10568487
2375 Ga0307509_10000003
2376 Ga0307509_10131732
2377 Ga0307509_10141543
2378 Ga0307509_10380853
2379 Ga0307408_100040215
2380 Ga0265313_10000426
2381 Ga0265313_10013755
2382 Ga0307508_10000501
2383 Ga0307514_10000662
2384 Ga0307514_10001541
2385 Ga0265314_10012027
2386 Ga0265314_10172596
2387 Ga0265314_10183498
2388 Ga0265342_10034197
2389 Ga0265342_10053047
2390 Ga0307516_10006301
2391 Ga0307516_10057831
2392 Ga0307516_10436154
2393 Ga0307413_10193843
2394 Ga0307406_10322270
2395 Ga0307406_10607269
2396 Ga0307406_10959092
2397 Ga0307406_10998288
2398 Ga0307412_10549067
2399 Ga0307409_100257156
2400 Ga0307416_100230868
2401 Ga0307411_10088379
2402 Ga0307415_100173160
2403 Ga0307415_100322348
2404 Ga0307507_10026407
2405 Ga0307507_10099921
2406 Ga0307510_10049005
2407 Ga0307510_10081087
2408 Ga0316214_1008501
2409 Ga0373938_0003935
2410 Ga0373926_0094914
2411 Ga0373926_0128461
2412 Ga0373926_0160634
2413 Ga0373934_0003996
2414 Ga0373934_0199755
2415 Ga0373944_0032747
2416 Ga0373944_0106958
2417 Ga0373949_0030173
2418 Ga0373923_0000165
2419 Ga0373923_0004503
2420 Ga0373923_0018585
2421 Ga0373923_0121252
2422 Ga0373932_0146480
2423 Ga0373936_0011221
2424 Ga0373936_0015552
2425 Ga0373936_0101340
2426 Ga0373945_0060670
2427 Ga0373953_0001078
2428 Ga0373953_0104995
2429 Ga0373954_0000260
2430 Ga0373954_0005989
2431 Ga0373954_0009341
2432 Ga0373956_0001075
2433 Ga0373957_0002893
2434 Ga0373957_0003647
2435 Ga0373957_0008300
2436 Ga0373960_0162529
2437 Ga0373946_0062775
2438 Ga0373946_0098579
2439 Ga0373946_0326325
2440 Ga0373955_0001777
2441 Ga0373955_0008401
2442 Ga0316574_0128357
2443 Ga0373924_0001923
2444 Ga0373924_0006876
2445 Ga0373931_0091988
2446 Ga0373935_0000353
2447 Ga0373935_0005100
2448 Ga0373935_0008475
2449 Ga0373935_0014443
2450 Ga0373935_0055839
2451 Ga0373927_0001254
2452 Ga0373927_0008448
2453 Ga0373927_0114331
2454 Ga0373927_0215731
2455 Ga0373927_0447223
2456 Ga0373933_0004010
2457 Ga0373933_0045081
2458 Ga0373933_0244233
2459 Ga0373947_0012509
2460 Ga0373947_0030732
2461 Ga0373947_0294280
2462 Ga0373947_0785591
2463 Ga0373937_0083363
2464 Ga0373937_0147496
2465 Ga0373937_0961177
2466 Ga0373925_0003844
2467 Ga0373925_0008725
2468 Ga0373925_0134855
2469 Ga0373925_0315611
2470 Ga0395900_0036595
2471 Ga0395900_0390946
2472 Ga0395898_0012280
2473 Ga0395898_0020773
2474 Ga0395898_0031282
2475 Ga0395905_0005034
2476 Ga0395905_0125094
2477 Ga0436364_0101562
2478 Ga0436364_0214101
2479 Ga0436364_0814306
2480 Ga0395901_0042972
2481 Ga0395901_0077854
2482 Ga0395901_0430844
2483 Ga0436365_0751202
2484 Ga0436365_0757494
2485 Ga0436365_1050534
2486 Ga0436365_1113004
2487 Ga0436365_1316409
2488 Ga0436365_1377083
2489 Ga0436365_1732811
2490 Ga0436365_1915185
2491 Ga0436360_0362794
2492 Ga0436360_0674534
2493 Ga0436361_0774376
2494 Ga0436363_0472452
2495 Ga0436363_0486884
2496 Ga0436363_0823763
2497 Ga0436362_0713937
2498 Ga0451793_0637898
2499 Ga0451800_0317729
2500 Ga0451807_0379786
2501 Ga0451837_0000079
2502 Ga0450890_002431
2503 Ga0439446_0030138
2504 Ga0451577_0831056
2505 Ga0466972_0000090
2506 Ga0466972_0022537
2507 Ga0466972_0174536
2508 Ga0466966_0002487
2509 Ga0466966_0288628
2510 Ga0466961_0000081
2511 Ga0466963_0059425
2512 Ga0466963_0103431
2513 Ga0466964_0140411
2514 Ga0466971_0085562
2515 Ga0466957_0045181
2516 Ga0466959_0033379
2517 Ga0466967_0299724
2518 Ga0466967_0397999
2519 Ga0466967_0479546
2520 Ga0466967_0784865
2521 Ga0495592_0003370
2522 Ga0495592_0027243
2523 Ga0495592_0068885
2524 Ga0495592_0165805
2525 Ga0495592_0166031
2526 Ga0495603_0009474
2527 Ga0495603_0135893
2528 Ga0495603_0139253
2529 Ga0495590_0041795
2530 Ga0495590_0089197
2531 Ga0495590_0098789
2532 Ga0495629_0000226
2533 Ga0495629_0018660
2534 Ga0495629_0036628
2535 Ga0495629_0156541
2536 Ga0495629_0243497
2537 Ga0495638_0010518
2538 Ga0495638_0012364
2539 Ga0495638_0135238
2540 Ga0495638_0231151
2541 Ga0495641_0001402
2542 Ga0495641_0022355
2543 Ga0495641_0075719
2544 Ga0495651_0011108
2545 Ga0495651_0012131
2546 Ga0495651_0013785
2547 Ga0495651_0019499
2548 Ga0495651_0021122
2549 Ga0495653_0125116
2550 Ga0495653_0199815
2551 Ga0495653_0350629
2552 Ga0495650_0121346
2553 Ga0495650_0123108
2554 Ga0495580_0019535
2555 Ga0495580_0024592
2556 Ga0495582_0000106
2557 Ga0495605_0097459
2558 Ga0495605_0114083
2559 Ga0495639_0000170
2560 Ga0495639_0014214
2561 Ga0495639_0121414
2562 Ga0495662_0000901
2563 Ga0495662_0060425
2564 Ga0495664_0017874
2565 Ga0495664_0019572
2566 Ga0495664_0020424
2567 Ga0495664_0195945
2568 Ga0495584_0097453
2569 Ga0495584_0121322
2570 Ga0495584_0175040
2571 Ga0495584_0259743
2572 Ga0495585_0060023
2573 Ga0495585_0172338
2574 Ga0495594_0000410
2575 Ga0495594_0071925
2576 Ga0495594_0103711
2577 Ga0495594_0185809
2578 Ga0495594_0202371
2579 Ga0495606_0039928
2580 Ga0495606_0126209
2581 Ga0495606_0131462
2582 Ga0495608_0010478
2583 Ga0495608_0039371
2584 Ga0495608_0117029
2585 Ga0495608_0266059
2586 Ga0495616_0053102
2587 Ga0495618_0198968
2588 Ga0495618_0240578
2589 Ga0495628_0034766
2590 Ga0495628_0048266
2591 Ga0495628_0062339
2592 Ga0495628_0065885
2593 Ga0495628_0124504
2594 Ga0495628_0142482
2595 Ga0495628_0252540
2596 Ga0495630_0002054
2597 Ga0495630_0003128
2598 Ga0495631_0129242
2599 Ga0495632_0041192
2600 Ga0495643_0020565
2601 Ga0495643_0309441
2602 Ga0495648_0312185
2603 Ga0495666_0034381
2604 Ga0495642_0041494
2605 Ga0495652_0024980
2606 Ga0495652_0075447
2607 Ga0495652_0090736
2608 Ga0495652_0128952
2609 Ga0495652_0238843
2610 Ga0495652_0266349
2611 Ga0495652_0460694
2612 Ga0495665_0001435
2613 Ga0495665_0021219
2614 Ga0495665_0025497
2615 Ga0495665_0174022
2616 Ga0495640_0001153
2617 Ga0495640_0014225
2618 Ga0495640_0021578
2619 Ga0495640_0028306
2620 Ga0495640_0043972
2621 Ga0495640_0061392
2622 Ga0495640_0091895
2623 Ga0495586_0006037
2624 Ga0495586_0089167
2625 Ga0495586_0307023
2626 Ga0495587_0044282
2627 Ga0495587_0165677
2628 Ga0495621_0025902
2629 Ga0495597_0073434
2630 Ga0495597_0145087
2631 Ga0495645_0007549
2632 Ga0495645_0010186
2633 Ga0495645_0012442
2634 Ga0495645_0035959
2635 Ga0495645_0055187
2636 Ga0495622_0002206
2637 Ga0495622_0086870
2638 Ga0495622_0300562
2639 Ga0495633_0123301
2640 Ga0495667_0021690
2641 Ga0495667_0044847
2642 Ga0495667_0055246
2643 Ga0495656_0059118
2644 Ga0495656_0092628
2645 Ga0495656_0412453
2646 Ga0495668_0234909
2647 Ga0495668_0239031
2648 Ga0495634_0001983
2649 Ga0495634_0151465
2650 Ga0495634_0220325
2651 Ga0495634_0270931
2652 Ga0495625_0035865
2653 Ga0495625_0142804
2654 Ga0495625_0433559
2655 Ga0495635_0000551
2656 Ga0495635_0000794
2657 Ga0495635_0011793
2658 Ga0495635_0117210
2659 Ga0495635_0118079
2660 Ga0495635_0154987
2661 Ga0495659_0010438
2662 Ga0495659_0107646
2663 Ga0495661_0113850
2664 Ga0495657_0001697
2665 Ga0495657_0010679
2666 Ga0495657_0014502
2667 Ga0495599_0000991
2668 Ga0495599_0001294
2669 Ga0495599_0005248
2670 Ga0495599_0048745
2671 Ga0495599_0445237
2672 Ga0495623_0008013
2673 Ga0495623_0075818
2674 Ga0495646_0018652
2675 Ga0495646_0155273
2676 Ga0495646_0318109
2677 Ga0495647_0000487
2678 Ga0495647_0058022
2679 Ga0495647_0059450
2680 Ga0495658_0018960
2681 Ga0495669_0038533
2682 Ga0495613_0009914
2683 Ga0495613_0012442
2684 Ga0495613_0024790
2685 Ga0495613_0039795
2686 Ga0495613_0287016
2687 Ga0495613_0292150
2688 Ga0495624_0009177
2689 Ga0495624_0074184
2690 Ga0495624_0103271
2691 Ga0495624_0161541
2692 Ga0495624_0224829
2693 Ga0495624_0466601
2694 Ga0495649_0004829
2695 Ga0495600_0044747
2696 Ga0495600_0106410
2697 Ga0495600_0336289
2698 Ga0495600_0427951
2699 Ga0495660_0190467
2700 Ga0495581_0000010
2701 Ga0495581_0014969
2702 Ga0495581_0024470
2703 Ga0495604_0003777
2704 Ga0495604_0010950
2705 Ga0495604_0037419
2706 Ga0495604_0047723
2707 Ga0495604_0172676
2708 Ga0495636_0240436
2709 Ga0495674_0000082
2710 Ga0495674_0001491
2711 Ga0495674_0036604
2712 Ga0495674_0073409
2713 Ga0495674_0206208
2714 Ga0495672_0022035
2715 Ga0495672_0114834
2716 Ga0495676_0114381
2717 Ga0495676_0130801
2718 Ga0495680_0002698
2719 Ga0495680_0014505
2720 Ga0495680_0173431
2721 Ga0495680_0296230
2722 Ga0495680_0399496
2723 Ga0495683_0083409
2724 Ga0495687_041243
2725 Ga0495687_044725
2726 Ga0495675_0004242
2727 Ga0495675_0039121
2728 Ga0495679_066436
2729 Ga0495673_0108674
2730 Ga0495684_0004100
2731 Ga0495684_0023587
2732 Ga0495684_0050325
2733 Ga0495684_0060049
2734 Ga0495686_0062203
2735 Ga0495593_0000986
2736 Ga0495593_0071820
2737 Ga0495615_0060495
2738 Ga0496100_0004736
2739 Ga0496100_0131686
2740 Ga0496100_0166632
2741 Ga0496100_0639256
2742 Ga0496101_0043827
2743 Ga0496101_0146555
2744 Ga0496101_0156660
2745 Ga0496102_0094756
2746 Ga0496102_0156122
2747 Ga0496102_0221798
2748 Ga0496102_0303013
2749 Ga0496102_0313425
2750 Ga0496102_0321875
2751 Ga0496102_1156005
2752 Ga0496103_0107858
2753 Ga0496103_0241844
2754 Ga0496104_0012536
2755 Ga0496104_0041518
2756 Ga0496104_0074952
2757 Ga0496104_0094161
2758 Ga0496104_0121347
2759 Ga0496104_0169645
2760 Ga0496104_0228325
2761 Ga0496104_0672697
2762 Ga0496105_0003866
2763 Ga0496105_0031344
2764 Ga0496105_0167629
2765 Ga0496105_0464855
2766 Ga0496106_0002192
2767 Ga0496106_0007842
2768 Ga0496106_0117538
2769 Ga0496106_0146330
2770 Ga0496106_0551945
2771 Ga0496106_0819991
2772 Ga0496107_0006208
2773 Ga0496107_0070725
2774 Ga0496107_0085807
2775 Ga0496107_0094596
2776 Ga0496108_0033321
2777 Ga0496108_0046989
2778 Ga0496108_0176014
2779 Ga0496108_0314549
2780 Ga0496108_0414491
2781 Ga0496108_0512203
2782 Ga0496108_0787428
2783 Ga0496109_0000958
2784 Ga0496109_0080371
2785 Ga0496109_0170853
2786 Ga0496109_0274367
2787 Ga0496109_0793725
2788 Ga0496110_0024058
2789 Ga0496111_0026562
2790 Ga0496111_0054052
2791 Ga0496111_0077043
2792 Ga0496111_0095184
2793 Ga0496112_0008372
2794 Ga0496112_0024283
2795 Ga0496112_0030971
2796 Ga0496112_0090356
2797 Ga0496112_0236383
2798 Ga0496112_0273390
2799 Ga0496112_0632997
2800 Ga0496113_0009951
2801 Ga0496113_0016793
2802 Ga0496113_0024585
2803 Ga0496113_0057462
2804 Ga0496113_0289787
2805 Ga0496113_0735865
2806 Ga0496114_0042126
2807 Ga0496114_0102072
2808 Ga0496115_0157497
2809 Ga0496115_0529526
2810 Ga0496117_0040854
2811 Ga0496117_0102683
2812 Ga0496118_0021563
2813 Ga0496118_0023025
2814 Ga0496119_0013564
2815 Ga0496119_0052365
2816 Ga0496119_0224084
2817 Ga0496119_0228825
2818 Ga0496119_0272337
2819 Ga0496120_0034276
2820 Ga0496121_0000461
2821 Ga0496121_0000476
2822 Ga0496121_0005046
2823 Ga0496121_0006583
2824 Ga0496121_0112781
2825 Ga0496121_0160194
2826 Ga0496121_0182896
2827 Ga0496121_0510984
2828 Ga0496122_0133344
2829 Ga0496124_0007605
2830 Ga0496124_0036185
2831 Ga0496125_0119465
2832 Ga0496125_0149755
2833 Ga0496125_0217837
2834 Ga0496125_0296277
2835 Ga0496126_0004139
2836 Ga0496126_0011296
2837 Ga0496126_0014548
2838 Ga0496126_0024714
2839 Ga0496126_0097468
2840 Ga0496126_0097534
2841 Ga0496126_0125191
2842 Ga0496126_0323320
2843 Ga0496126_0353480
2844 Ga0496126_0367643
2845 Ga0496126_0805463
2846 Ga0495678_135213
2847 Ga0501031_0575769
2848 Ga0501032_0001484
2849 Ga0501032_0004833
2850 Ga0501033_0002476
2851 Ga0501033_0009580
2852 Ga0501034_0000955
2853 Ga0501034_0006672
2854 Ga0501036_0001778
2855 Ga0501036_0302526
2856 Ga0501037_0000374
2857 Ga0501037_0004631
2858 Ga0501038_0013942
2859 Ga0501038_0053706
2860 Ga0501039_0013178
2861 Ga0501039_0030505
2862 Ga0501041_0057297
2863 Ga0501041_0255008
2864 Ga0501041_0456195
2865 Ga0501043_0000932
2866 Ga0501043_0012177
2867 Ga0501046_0020537
2868 Ga0501046_0030167
2869 Ga0501047_0003152
2870 Ga0501047_0050929
2871 Ga0501048_0022290
2872 Ga0501048_0317315
2873 Ga0501068_0019232
2874 Ga0501068_0244784
2875 Ga0501069_0029303
2876 Ga0501070_0032912
2877 Ga0501070_0129945
2878 Ga0501070_0981546
2879 Ga0501071_0286668
2880 Ga0501071_0314336
2881 Ga0501071_0579914
2882 Ga0501072_0008393
2883 Ga0501073_0002378
2884 Ga0501074_0054841
2885 Ga0501074_0119673
2886 Ga0501075_0011346
2887 Ga0501076_0556463
2888 Ga0501079_0013407
2889 Ga0501079_0015285
2890 Ga0501080_0002661
2891 Ga0501080_0043997
2892 Ga0501080_0136654
2893 Ga0501081_0001519
2894 Ga0501081_0821944
2895 Ga0501083_0078315
2896 Ga0501083_0096022
2897 Ga0501083_0151019
2898 Ga0501035_0038248
2899 Ga0501035_0430917
2900 Ga0501044_0000315
2901 Ga0501044_0039486
2902 Ga0501044_0041106
2903 Ga0501044_0103974
2904 Ga0501044_1161440
2905 Ga0501045_0069136
2906 nmdc:mga03683_129219_c1
2907 nmdc:mga03683_28017_c2
2908 nmdc:mga03683_284384_c1
2909 nmdc:mga03683_47499_c1
2910 nmdc:mga03683_48622_c1
2911 nmdc:mga03683_81960_c1
2912 nmdc:mga03683_88489_c1
2913 nmdc:mga03n38_34354_c1
2914 nmdc:mga03n38_371785_c1
2915 nmdc:mga03n38_89347_c1
2916 nmdc:mga03n38_9411_c1
2917 nmdc:mga00v17_137207_c1
2918 nmdc:mga00v17_189332_c1
2919 nmdc:mga00v17_311526_c1
2920 nmdc:mga00v17_399062_c1
2921 nmdc:mga00v17_64127_c1
2922 nmdc:mga0yw44_14964_c1
2923 nmdc:mga0yw44_404972_c1
2924 nmdc:mga0yw44_431629_c1
2925 nmdc:mga0yw44_50039_c1
2926 nmdc:mga0yw44_61226_c1
2927 nmdc:mga0yw44_63502_c1
2928 nmdc:mga0yw44_646546_c1
2929 nmdc:mga0k408_131832_c1
2930 nmdc:mga0k408_141786_c1
2931 nmdc:mga0k408_185742_c1
2932 nmdc:mga0k408_224347_c1
2933 nmdc:mga0k408_25826_c1
2934 nmdc:mga0k408_35346_c1
2935 nmdc:mga0k408_38466_c2
2936 nmdc:mga0k408_38889_c1
2937 nmdc:mga0k408_52488_c1
2938 nmdc:mga0k408_5474_c1
2939 nmdc:mga0k408_72072_c1
2940 nmdc:mga06z11_115797_c1
2941 nmdc:mga06z11_117534_c1
2942 nmdc:mga06z11_117607_c1
2943 nmdc:mga06z11_224978_c1
2944 nmdc:mga06z11_307641_c1
2945 nmdc:mga06z11_327381_c1
2946 nmdc:mga06z11_48647_c1
2947 nmdc:mga06z11_515372_c1
2948 nmdc:mga04h51_3096_c1
2949 nmdc:mga04h51_4452_c1
2950 nmdc:mga04h51_46049_c1
2951 nmdc:mga04h51_79306_c1
2952 nmdc:mga07m45_109775_c1
2953 nmdc:mga07m45_113357_c1
2954 nmdc:mga07m45_151879_c1
2955 nmdc:mga07m45_152399_c1
2956 nmdc:mga07m45_157768_c1
2957 nmdc:mga07m45_170535_c1
2958 nmdc:mga07m45_186013_c1
2959 nmdc:mga07m45_278720_c1
2960 nmdc:mga07m45_29312_c1
2961 nmdc:mga07m45_36869_c1
2962 nmdc:mga07m45_457628_c1
2963 nmdc:mga07m45_56539_c1
2964 nmdc:mga05p37_306830_c1
2965 nmdc:mga09592_192242_c1
2966 nmdc:mga09592_37295_c1
2967 nmdc:mga0qj67_21919_c1
2968 nmdc:mga0qj67_221_c1
2969 nmdc:mga06r32_1124255_c1
2970 nmdc:mga06r32_20596_c1
2971 nmdc:mga06r32_6177_c1
2972 nmdc:mga06r32_93225_c1
2973 nmdc:mga06r32_9721_c1
2974 nmdc:mga08y16_661709_c1
2975 nmdc:mga0n895_178880_c1
2976 nmdc:mga0n895_289793_c1
2977 nmdc:mga0rr50_562965_c1
2978 nmdc:mga0rr50_73454_c1
2979 nmdc:mga0rr50_93385_c2
2980 nmdc:mga08x19_339798_c1
2981 nmdc:mga08x19_61833_c1
2982 nmdc:mga0a205_537113_c1
2983 nmdc:mga0sz30_103612_c1
2984 nmdc:mga0sz30_21351_c2
2985 nmdc:mga0sz30_40305_c1
2986 nmdc:mga0sz30_7895_c2
2987 Ga0495601_0004169
2988 Ga0495601_0031180
2989 Ga0495601_0130804
2990 Ga0495601_0145255
2991 Ga0495601_0279227
2992 Ga0495612_0007486
2993 Ga0495612_0057089
2994 Ga0495612_0108673
2995 Ga0500610_0187823
2996 Ga0500635_0002501
2997 Ga0495655_0167879
2998 Ga0495595_0002260
2999 Ga0495619_0081533
3000 Ga0495619_0091836
3001 Ga0495619_0212192
3002 Ga0495619_0310818
3003 Ga0495619_0325119
3004 Ga0500578_0220309
3005 Ga0500578_0230641
3006 Ga0500643_000057
3007 Ga0500643_052426
3008 Ga0500644_0028954
3009 Ga0500646_0000154
3010 Ga0500647_0006967
3011 Ga0500647_0193329
3012 Ga0500647_0246304
3013 Ga0500583_0046075
3014 Ga0500583_0090817
3015 Ga0500583_0099743
3016 Ga0500583_0119966
3017 Ga0500651_0073476
3018 Ga0500651_0144897
3019 Ga0500566_0001040
3020 Ga0500566_0021628
3021 Ga0500566_0305228
3022 Ga0500640_001081
3023 Ga0500641_0064918
3024 Ga0500641_0096832
3025 Ga0500641_0150649
3026 Ga0500641_0283834
3027 Ga0500648_221272
3028 Ga0500654_183937
3029 Ga0500555_003125
3030 Ga0500555_043808
3031 Ga0500556_0048231
3032 Ga0500557_000129
3033 Ga0500562_117937
3034 Ga0500572_000148
3035 Ga0500572_001485
3036 Ga0500572_014260
3037 Ga0500591_016850
3038 Ga0500594_0070505
3039 Ga0500595_001155
3040 Ga0500595_001379
3041 Ga0500595_007140
3042 Ga0500595_032957
3043 Ga0500595_033623
3044 Ga0500595_038970
3045 Ga0500608_032512
3046 Ga0500608_169383
3047 Ga0500614_000313
3048 Ga0500621_152410
3049 Ga0500642_0000180
3050 Ga0500642_0010401
3051 Ga0500655_028287
3052 Ga0500658_0129611
3053 Ga0500559_0001230
3054 Ga0500559_0005930
3055 Ga0500559_0024957
3056 Ga0500561_0051192
3057 Ga0500568_0056017
3058 Ga0500568_0137232
3059 Ga0500573_0107782
3060 Ga0500588_0116236
3061 Ga0500590_063732
3062 Ga0500590_158266
3063 Ga0500603_000076
3064 Ga0500603_040666
3065 Ga0500603_085600
3066 Ga0500604_0019662
3067 Ga0500604_0154966
3068 Ga0500616_0000092
3069 Ga0500616_0118689
3070 Ga0500616_0215741
3071 Ga0500620_152139
3072 Ga0500622_0024890
3073 Ga0500627_0023107
3074 Ga0500630_005759
3075 Ga0500638_017487
3076 Ga0500638_036871
3077 Ga0500639_000014
3078 Ga0500636_0000324
3079 Ga0500636_0025074
3080 Ga0500636_0037661
3081 Ga0500637_0000705
3082 Ga0500637_0012032
3083 Ga0500637_0027169
3084 Ga0500637_0102004
3085 Ga0500637_0179561
3086 Ga0500625_002854
3087 Ga0500596_000214
3088 Ga0500596_004388
3089 Ga0500596_006106
3090 Ga0500599_002006
3091 Ga0500601_000851
3092 Ga0501084_0118044
3093 Ga0501084_0125927
3094 Ga0501084_0129718
3095 Ga0500661_006724
3096 Ga0500661_009700
3097 Ga0587082_067466
3098 Ga0587083_0107069
3099 Ga0501082_0038236
3100 Ga0530510_0022282
3101 2507511056
3102 2508544873
3103 2508696907
3104 2509151837
3105 2511400386
3106 2513623516
3107 2513649713
3108 2513678541
3109 2513696526
3110 2513701174
3111 2513716953
3112 2513874682
3113 2513892130
3114 2514010600
3115 2515625372
3116 2517100623
3117 2524438151
3118 2524468849
3119 2528856708
3120 2596374236
3121 2617350808
3122 2617373178
3123 2723843034
3124 2739249163
3125 2745076967
3126 2793064698
3127 2793083663
3128 2805916681
3129 2818238185
3130 2824607513
3131 2824617029
3132 2824626270
3133 2824634925
3134 2824643453
3135 2824652243
3136 2824658744
3137 2824670762
3138 2824678886
3139 2824687018
3140 2824695398
3141 2824703745
3142 2824713111
3143 2824722646
3144 2824732216
3145 2824737084
3146 2824753452
3147 2824763197
3148 2824771396
3149 2824780472
3150 2829748345
3151 2831869442
3152 2838127927
3153 2841943221
3154 2841954047
3155 2841960187
3156 2841968139
3157 2841976652
3158 2841988024
3159 2842042668
3160 2842050711
3161 2844316880
3162 2847938594
3163 2847944206
3164 2848298708
3165 2849081568
3166 2857512221
3167 2874597788
3168 2874612632
3169 2874617663
3170 2874623401
3171 2874634181
3172 2874651317
3173 2876764080
3174 2876776388
3175 2876817497
3176 2876820956
3177 2879081749
3178 2879088430
3179 2879108832
3180 2879118085
3181 2879130463
3182 2879146349
3183 2881370714
3184 2881671303
3185 2885366903
3186 2885387143
3187 2885413398
3188 2886850740
3189 2888381492
3190 2888389155
3191 2888421894
3192 2889033666
3193 2889307571
3194 2902333107
3195 2902410190
3196 2903733930
3197 2903772030
3198 2904672668
3199 2904719262
3200 2906604546
3201 2906635208
3202 2906649115
3203 2908781634
3204 2919704348
3205 2922367031
3206 2922371156
3207 2922390189
3208 2922393526
3209 2928126604
3210 2929619543
3211 2929627987
3212 2932785867
3213 2932798346
3214 2932804142
3215 2932817240
3216 2932826729
3217 2932830912
3218 2933581463
3219 2935612713
3220 2935620980
3221 2935640053
3222 2935655165
3223 2935664046
3224 2935667108
3225 2935680252
3226 2935690238
3227 2935699674
3228 2935704864
3229 2935718065
3230 2935726785
3231 2935735554
3232 2935745175
3233 2935755249
3234 2935762234
3235 2935773611
3236 2935780169
3237 2935788484
3238 2935796640
3239 2935803734
3240 2935811652
3241 2935824202
3242 2935829536
3243 2935842502
3244 2935852651
3245 2935858787
3246 2935866815
3247 2935876946
3248 2935884052
3249 2935912197
3250 2935922410
3251 2935929226
3252 2935935857
3253 2935947423
3254 2935953482
3255 2935962009
3256 2935968508
3257 2935976692
3258 2935990691
3259 2935993414
3260 2936004309
3261 2936015456
3262 2936024090
3263 2936033105
3264 2936038234
3265 2936051198
3266 2936058576
3267 2940561470
3268 2941533660
3269 2941547385
3270 3005486150
3271 3005507091
3272 3005593053
3273 3005596509
3274 3005712579
3275 3005719638
3276 643602447
3277 8006930088
3278 8006966568
3279 8006989411
3280 8006997879
3281 8016516475
3282 8016523881
3283 8016541683
3284 8016551589
3285 8016559972
3286 8016567068
3287 8016579785
3288 8016597900
3289 8016604036
3290 8016620620
3291 8016629375
3292 8016633883
3293 8017060064
3294 8019537096
3295 8019542447
3296 8019548313
3297 8019579572
3298 8019587282
3299 8019604059
3300 8019614470
3301 8019625095
3302 8019637086
3303 8019642516
3304 8019674490
3305 8019681616
3306 8019694160
3307 8055749199
3308 8056674910
3309 8056682335
3310 8056969681

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yev-assembly2.cif.gz_A structure of caa3-type cytochrome oxidase 0.3296 25 151
8h0q-assembly1.cif.gz_R structure of the grp14-27-grpr-gq complex 0.3259 32 166
5j7y-assembly1.cif.gz_BC architecture of loose respirasome 0.318 24 167
6zgr-assembly1.cif.gz_A crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.3179 23 190
6hcl-assembly1.cif.gz_A crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution 0.3144 23 191
ID Description Score Start End Superfamily
af_P76198_215_409_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3623 4 193 1.20.1250.20
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3459 1 188 1.20.1250.20
af_F1QQL3_14_285_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3426 34 167 1.20.1070.10
af_Q555W6_322_550_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3401 23 190 1.20.1250.20
af_A4I001_41_293_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3298 24 158 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A554X8U7-F1-model_v4 Prokaryotic cytochrome b561 0.9769 4 195 GO:0016020
AF-A0A653J9Z0-F1-model_v4 Membrane protein 0.9741 4 190 GO:0016020
AF-A0A657B8S9-F1-model_v4 DUF962 domain-containing protein 0.9721 3 198 GO:0016020
AF-A0A848G0S1-F1-model_v4 DUF962 domain-containing protein 0.9703 1 190 GO:0016020
AF-A0A5E7ZP03-F1-model_v4 Membrane protein 0.9694 4 190 GO:0016020

Map