F495223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1655 | 752 | 3310 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100279156|Ga0070683_1002791562 |
| Length | 238 |
| Sequence | MSLQWPCDISVTGYAPQLKSCCHSSGTIMQSFWQALQTQRWDDHRYYHHSRINQSLHLLSATSFVCAYVLMFTNPVAAALIGWLVSMTSRQAGHFFFEPKGYDHVNEATHEHKEAIKVGYNLRRKVVLMAIWALSPAILWVDPTLFGIYPDASSADFVQHVGQVWLAVGLGGLIFRTVHLFFIKDVQTGLVWMTKIITDPFHDIKLYYKAPLYLLRGELIAPLHGANELEPSLSTRDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 105 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 139 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 140 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 141 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 142 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 237 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 241 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 242 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 243 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 248 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 249 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 250 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 256 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 259 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 263 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 264 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 265 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 266 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 267 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 268 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 269 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 270 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 272 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 275 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 277 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 278 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 279 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 280 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 281 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 282 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 283 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 284 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 285 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 292 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 293 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 296 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 300 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 309 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 310 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 311 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 319 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 322 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 323 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 324 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 325 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 326 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 327 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 328 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 329 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 330 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 331 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 334 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 412 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 413 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 414 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 415 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 416 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 417 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 418 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 421 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 422 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 423 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 424 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 425 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 426 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 427 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 428 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 429 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 432 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 433 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 434 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 435 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 467 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 468 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 469 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 470 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 472 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 473 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 486 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 491 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 492 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 494 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 495 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 496 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 497 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 498 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 501 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 503 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 505 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 506 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 508 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 509 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 510 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 511 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 512 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 513 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 515 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 516 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 517 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 520 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 521 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 522 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 524 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 525 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 526 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 527 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 529 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 530 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 534 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 535 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 536 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 537 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 538 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 539 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 543 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 544 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 545 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 546 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 547 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 548 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 549 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 550 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 551 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 552 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 553 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 554 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 555 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 556 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 557 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 558 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 559 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 560 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 561 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 562 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 563 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 564 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 565 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 566 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 567 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 568 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 569 | 2791355199 | |||
| 570 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 571 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 572 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 573 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 574 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 575 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 576 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 577 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 578 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 579 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 580 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 581 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 582 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 583 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 584 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 585 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 586 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 587 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 588 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 589 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 590 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 591 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 592 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 593 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 594 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 595 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 596 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 597 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 598 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 599 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 600 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 601 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 602 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 603 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 604 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 605 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 606 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 607 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 608 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 609 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 610 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 611 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 612 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 613 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 614 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 615 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 616 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 617 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 618 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 619 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 620 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 621 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 622 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 623 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 624 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 625 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 626 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 627 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 628 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 629 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 630 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 631 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 632 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 633 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 634 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 635 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 636 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 637 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 638 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 639 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 640 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 641 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 642 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 643 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 644 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 645 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 646 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 647 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 648 | 2922368715 | |||
| 649 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 650 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 651 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 652 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 653 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 654 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 655 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 656 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 657 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 658 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 659 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 660 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 661 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 662 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 663 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 664 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 665 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 666 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 667 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 668 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 669 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 670 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 671 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 672 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 673 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 674 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 675 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 676 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 677 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 678 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 679 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 680 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 681 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 682 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 683 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 684 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 685 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 686 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 687 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 688 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 689 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 690 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 691 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 692 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 693 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 694 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 695 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 696 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 697 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 698 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 699 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 700 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 701 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 702 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 703 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 704 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 705 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 706 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 707 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 708 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 709 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 710 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 711 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 712 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 713 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 714 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 715 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 716 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 717 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 718 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 719 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 720 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 721 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 722 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 723 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 724 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 725 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 726 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 727 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 728 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 729 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 730 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 731 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 732 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 733 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 734 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 735 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 736 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 737 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 738 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 739 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 740 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 741 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 742 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 743 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 744 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 745 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 746 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 747 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 748 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 749 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 750 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 751 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 752 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.99 |
| Metatranscriptomes | 0.42 |
| Isolates | 12.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.35 |
| Nodule | 9.49 |
| Rhizoplane | 4.53 |
| Rhizosphere | 62.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100279156 | 3300005329 | Bacteria | 1589 |
| 2 | LJNas_1007582 | 3300000546 | Bacteria | 1169 |
| 3 | JGI24740J21852_10008811 | 3300001979 | Bacteria | 3999 |
| 4 | JGI24735J21928_10001998 | 3300002067 | Bacteria | 7172 |
| 5 | JGI24744J21845_10018209 | 3300002077 | Bacteria | 1393 |
| 6 | JGI25406J46586_10009990 | 3300003203 | Bacteria | 4232 |
| 7 | JGI25406J46586_10043167 | 3300003203 | Bacteria | 1572 |
| 8 | JGI25165J46597_1006536 | 3300003214 | Bacteria | 2058 |
| 9 | JGI25153J46596_10002774 | 3300003215 | Bacteria | 9962 |
| 10 | JGI25153J46596_10027669 | 3300003215 | Bacteria | 1982 |
| 11 | rootL2_10001663 | 3300003322 | Bacteria | 58458 |
| 12 | JGI25160J50197_1019866 | 3300003354 | Bacteria | 2047 |
| 13 | JGI25160J50197_1026122 | 3300003354 | Bacteria | 1616 |
| 14 | JGI25404J52841_10006558 | 3300003659 | Bacteria | 2441 |
| 15 | JGI25404J52841_10010832 | 3300003659 | Bacteria | 1962 |
| 16 | JGI25404J52841_10014898 | 3300003659 | Bacteria | 1688 |
| 17 | JGI25404J52841_10019762 | 3300003659 | Bacteria | 1460 |
| 18 | JGI25404J52841_10021733 | 3300003659 | Bacteria | 1389 |
| 19 | JGI25404J52841_10052187 | 3300003659 | Bacteria | 859 |
| 20 | Ga0055539_1005760 | 3300003752 | Bacteria | 1599 |
| 21 | Ga0055526_1012133 | 3300003771 | Bacteria | 3793 |
| 22 | Ga0055524_1000552 | 3300003775 | Bacteria | 28315 |
| 23 | Ga0055531_10001408 | 3300003794 | Bacteria | 17758 |
| 24 | Ga0055531_10001492 | 3300003794 | Bacteria | 17180 |
| 25 | Ga0055543_1018006 | 3300004625 | Bacteria | 1322 |
| 26 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 27 | Ga0065165_1003197 | 3300005262 | Bacteria | 11962 |
| 28 | Ga0065712_10155411 | 3300005290 | Bacteria | 1339 |
| 29 | Ga0065712_10278757 | 3300005290 | Bacteria | 900 |
| 30 | Ga0070658_10470902 | 3300005327 | Bacteria | 1084 |
| 31 | Ga0070676_10036142 | 3300005328 | Bacteria | 2844 |
| 32 | Ga0070683_100052756 | 3300005329 | Bacteria | 3768 |
| 33 | Ga0070677_10035063 | 3300005333 | Bacteria | 1942 |
| 34 | Ga0068869_100021473 | 3300005334 | Bacteria | 4442 |
| 35 | Ga0068869_100055612 | 3300005334 | Bacteria | 2884 |
| 36 | Ga0070666_10055129 | 3300005335 | Bacteria | 2683 |
| 37 | Ga0070666_10155864 | 3300005335 | Bacteria | 1595 |
| 38 | Ga0070680_100155083 | 3300005336 | Bacteria | 1923 |
| 39 | Ga0070680_100158631 | 3300005336 | Bacteria | 1901 |
| 40 | Ga0070682_100040990 | 3300005337 | Bacteria | 2852 |
| 41 | Ga0070682_100202655 | 3300005337 | Bacteria | 1401 |
| 42 | Ga0070682_100262953 | 3300005337 | Bacteria | 1249 |
| 43 | Ga0068868_100174759 | 3300005338 | Bacteria | 1780 |
| 44 | Ga0068868_100484012 | 3300005338 | Bacteria | 1081 |
| 45 | Ga0070660_100037695 | 3300005339 | Bacteria | 3664 |
| 46 | Ga0070660_100116311 | 3300005339 | Bacteria | 2132 |
| 47 | Ga0070689_100040633 | 3300005340 | Bacteria | 3567 |
| 48 | Ga0070689_100335196 | 3300005340 | Bacteria | 1266 |
| 49 | Ga0070689_100403686 | 3300005340 | Bacteria | 1156 |
| 50 | Ga0070661_100208678 | 3300005344 | Bacteria | 1494 |
| 51 | Ga0070661_100422690 | 3300005344 | Bacteria | 1057 |
| 52 | Ga0070661_100661171 | 3300005344 | Bacteria | 849 |
| 53 | Ga0070668_100050072 | 3300005347 | Bacteria | 3215 |
| 54 | Ga0070668_100069151 | 3300005347 | Bacteria | 2746 |
| 55 | Ga0070668_100174996 | 3300005347 | Bacteria | 1749 |
| 56 | Ga0070668_100282949 | 3300005347 | Bacteria | 1386 |
| 57 | Ga0070668_100766677 | 3300005347 | Bacteria | 855 |
| 58 | Ga0070669_100290393 | 3300005353 | Bacteria | 1312 |
| 59 | Ga0070669_100840998 | 3300005353 | Bacteria | 782 |
| 60 | Ga0070675_100082243 | 3300005354 | Bacteria | 2686 |
| 61 | Ga0070675_100242823 | 3300005354 | Bacteria | 1574 |
| 62 | Ga0070675_100390207 | 3300005354 | Bacteria | 1240 |
| 63 | Ga0070675_100551285 | 3300005354 | Bacteria | 1043 |
| 64 | Ga0070671_100006185 | 3300005355 | Bacteria | 9538 |
| 65 | Ga0070671_100058932 | 3300005355 | Bacteria | 3195 |
| 66 | Ga0070671_100191192 | 3300005355 | Bacteria | 1735 |
| 67 | Ga0070671_100313403 | 3300005355 | Bacteria | 1336 |
| 68 | Ga0070674_100219162 | 3300005356 | Bacteria | 1479 |
| 69 | Ga0070674_100725405 | 3300005356 | Bacteria | 852 |
| 70 | Ga0070673_100062261 | 3300005364 | Bacteria | 2964 |
| 71 | Ga0070673_100742239 | 3300005364 | Bacteria | 903 |
| 72 | Ga0070688_100084177 | 3300005365 | Bacteria | 2065 |
| 73 | Ga0070688_100123413 | 3300005365 | Bacteria | 1738 |
| 74 | Ga0070688_100463505 | 3300005365 | Bacteria | 949 |
| 75 | Ga0070667_100007677 | 3300005367 | Bacteria | 8946 |
| 76 | Ga0070667_100121363 | 3300005367 | Bacteria | 2273 |
| 77 | Ga0070667_100291509 | 3300005367 | Bacteria | 1467 |
| 78 | Ga0070667_100323221 | 3300005367 | Bacteria | 1392 |
| 79 | Ga0070667_100346318 | 3300005367 | Bacteria | 1344 |
| 80 | Ga0070709_10002295 | 3300005434 | Bacteria | 10381 |
| 81 | Ga0070709_10003472 | 3300005434 | Bacteria | 8465 |
| 82 | Ga0070709_10032611 | 3300005434 | Bacteria | 3142 |
| 83 | Ga0070709_10057122 | 3300005434 | Bacteria | 2471 |
| 84 | Ga0070709_10156677 | 3300005434 | Bacteria | 1579 |
| 85 | Ga0070709_10256296 | 3300005434 | Bacteria | 1262 |
| 86 | Ga0070714_100017825 | 3300005435 | Bacteria | 5758 |
| 87 | Ga0070714_100552483 | 3300005435 | Bacteria | 1102 |
| 88 | Ga0070713_100002964 | 3300005436 | Bacteria | 11145 |
| 89 | Ga0070713_100005146 | 3300005436 | Bacteria | 8903 |
| 90 | Ga0070713_100037482 | 3300005436 | Bacteria | 3920 |
| 91 | Ga0070713_100100661 | 3300005436 | Bacteria | 2502 |
| 92 | Ga0070713_100103917 | 3300005436 | Bacteria | 2466 |
| 93 | Ga0070713_100137493 | 3300005436 | Bacteria | 2160 |
| 94 | Ga0070713_100157898 | 3300005436 | Bacteria | 2022 |
| 95 | Ga0070710_10000670 | 3300005437 | Bacteria | 16265 |
| 96 | Ga0070710_10008450 | 3300005437 | Bacteria | 5011 |
| 97 | Ga0070710_10042770 | 3300005437 | Bacteria | 2506 |
| 98 | Ga0070710_10209221 | 3300005437 | Bacteria | 1236 |
| 99 | Ga0070710_10325089 | 3300005437 | Bacteria | 1011 |
| 100 | Ga0070711_100007952 | 3300005439 | Bacteria | 6466 |
| 101 | Ga0070711_100304898 | 3300005439 | Bacteria | 1267 |
| 102 | Ga0070711_100556195 | 3300005439 | Bacteria | 952 |
| 103 | Ga0070663_100009751 | 3300005455 | Bacteria | 5962 |
| 104 | Ga0070663_100145075 | 3300005455 | Bacteria | 1816 |
| 105 | Ga0070663_100153269 | 3300005455 | Bacteria | 1769 |
| 106 | Ga0070663_100283382 | 3300005455 | Bacteria | 1321 |
| 107 | Ga0070663_100551496 | 3300005455 | Bacteria | 963 |
| 108 | Ga0070678_100025881 | 3300005456 | Bacteria | 3957 |
| 109 | Ga0070678_100031470 | 3300005456 | Bacteria | 3661 |
| 110 | Ga0070678_100033640 | 3300005456 | Bacteria | 3561 |
| 111 | Ga0070678_100237058 | 3300005456 | Bacteria | 1523 |
| 112 | Ga0070662_100060618 | 3300005457 | Bacteria | 2759 |
| 113 | Ga0070662_100329276 | 3300005457 | Bacteria | 1247 |
| 114 | Ga0070681_10011776 | 3300005458 | Bacteria | 8669 |
| 115 | Ga0070681_10042493 | 3300005458 | Bacteria | 4554 |
| 116 | Ga0070681_10148627 | 3300005458 | Bacteria | 2271 |
| 117 | Ga0070681_10249375 | 3300005458 | Bacteria | 1688 |
| 118 | Ga0070681_10269621 | 3300005458 | Bacteria | 1614 |
| 119 | Ga0068867_100222223 | 3300005459 | Bacteria | 1523 |
| 120 | Ga0068867_100997727 | 3300005459 | Bacteria | 759 |
| 121 | Ga0070685_10104552 | 3300005466 | Bacteria | 1734 |
| 122 | Ga0070685_10195811 | 3300005466 | Bacteria | 1310 |
| 123 | Ga0070685_10196492 | 3300005466 | Bacteria | 1308 |
| 124 | Ga0070706_100115232 | 3300005467 | Bacteria | 2502 |
| 125 | Ga0070698_100201837 | 3300005471 | Bacteria | 1924 |
| 126 | Ga0070698_100584522 | 3300005471 | Bacteria | 1057 |
| 127 | Ga0070699_100124273 | 3300005518 | Bacteria | 2270 |
| 128 | Ga0070679_100029967 | 3300005530 | Bacteria | 5369 |
| 129 | Ga0070679_100041486 | 3300005530 | Bacteria | 4579 |
| 130 | Ga0070679_100070455 | 3300005530 | Bacteria | 3488 |
| 131 | Ga0070679_100341701 | 3300005530 | Bacteria | 1445 |
| 132 | Ga0070679_100399368 | 3300005530 | Bacteria | 1321 |
| 133 | Ga0070679_100764614 | 3300005530 | Bacteria | 909 |
| 134 | Ga0070684_100017961 | 3300005535 | Bacteria | 5815 |
| 135 | Ga0070684_100081454 | 3300005535 | Bacteria | 2864 |
| 136 | Ga0070697_100139093 | 3300005536 | Bacteria | 2041 |
| 137 | Ga0068853_100004631 | 3300005539 | Bacteria | 10663 |
| 138 | Ga0068853_100017135 | 3300005539 | Bacteria | 5976 |
| 139 | Ga0068853_100070106 | 3300005539 | Bacteria | 3050 |
| 140 | Ga0068853_100203608 | 3300005539 | Bacteria | 1802 |
| 141 | Ga0068853_100289530 | 3300005539 | Bacteria | 1512 |
| 142 | Ga0068853_100321721 | 3300005539 | Bacteria | 1434 |
| 143 | Ga0068853_100382807 | 3300005539 | Bacteria | 1314 |
| 144 | Ga0070672_100085127 | 3300005543 | Bacteria | 2540 |
| 145 | Ga0070672_100130773 | 3300005543 | Bacteria | 2062 |
| 146 | Ga0070672_100137346 | 3300005543 | Bacteria | 2014 |
| 147 | Ga0070672_100151370 | 3300005543 | Bacteria | 1919 |
| 148 | Ga0070686_100125678 | 3300005544 | Bacteria | 1767 |
| 149 | Ga0070686_100181242 | 3300005544 | Bacteria | 1497 |
| 150 | Ga0070686_100367886 | 3300005544 | Bacteria | 1085 |
| 151 | Ga0070693_100084049 | 3300005547 | Bacteria | 1904 |
| 152 | Ga0070693_100305632 | 3300005547 | Bacteria | 1074 |
| 153 | Ga0070693_100675285 | 3300005547 | Bacteria | 754 |
| 154 | Ga0070665_100010558 | 3300005548 | Bacteria | 9346 |
| 155 | Ga0070665_100055362 | 3300005548 | Bacteria | 3978 |
| 156 | Ga0070665_100110027 | 3300005548 | Bacteria | 2757 |
| 157 | Ga0070665_100215615 | 3300005548 | Bacteria | 1920 |
| 158 | Ga0070665_100309023 | 3300005548 | Bacteria | 1584 |
| 159 | Ga0070665_100727119 | 3300005548 | Bacteria | 1006 |
| 160 | Ga0070665_100764734 | 3300005548 | Bacteria | 979 |
| 161 | Ga0070665_100818324 | 3300005548 | Bacteria | 944 |
| 162 | Ga0070665_101289354 | 3300005548 | Bacteria | 740 |
| 163 | Ga0070704_101325221 | 3300005549 | Bacteria | 659 |
| 164 | Ga0068855_100019336 | 3300005563 | Bacteria | 8184 |
| 165 | Ga0068855_100113658 | 3300005563 | Bacteria | 3105 |
| 166 | Ga0068855_100480578 | 3300005563 | Bacteria | 1352 |
| 167 | Ga0070664_100254315 | 3300005564 | Bacteria | 1580 |
| 168 | Ga0068857_100010438 | 3300005577 | Bacteria | 8072 |
| 169 | Ga0068857_100011515 | 3300005577 | Bacteria | 7694 |
| 170 | Ga0068857_100085429 | 3300005577 | Bacteria | 2820 |
| 171 | Ga0068857_100712991 | 3300005577 | Bacteria | 954 |
| 172 | Ga0068854_100038376 | 3300005578 | Bacteria | 3368 |
| 173 | Ga0068854_100044419 | 3300005578 | Bacteria | 3154 |
| 174 | Ga0068854_100184896 | 3300005578 | Bacteria | 1630 |
| 175 | Ga0068854_100606004 | 3300005578 | Bacteria | 935 |
| 176 | Ga0068856_100000434 | 3300005614 | Bacteria | 45889 |
| 177 | Ga0068856_100003274 | 3300005614 | Bacteria | 16460 |
| 178 | Ga0068856_100133783 | 3300005614 | Bacteria | 2485 |
| 179 | Ga0070702_100003925 | 3300005615 | Bacteria | 6740 |
| 180 | Ga0070702_100143508 | 3300005615 | Bacteria | 1524 |
| 181 | Ga0068859_100000206 | 3300005617 | Bacteria | 58246 |
| 182 | Ga0068859_100022208 | 3300005617 | Bacteria | 6362 |
| 183 | Ga0068859_100149624 | 3300005617 | Bacteria | 2410 |
| 184 | Ga0068859_100210081 | 3300005617 | Bacteria | 2032 |
| 185 | Ga0068859_100599584 | 3300005617 | Bacteria | 1195 |
| 186 | Ga0068864_100016310 | 3300005618 | Bacteria | 6184 |
| 187 | Ga0068864_101051402 | 3300005618 | Bacteria | 809 |
| 188 | Ga0068861_100114770 | 3300005719 | Bacteria | 2163 |
| 189 | Ga0068861_100132321 | 3300005719 | Bacteria | 2026 |
| 190 | Ga0068861_100227317 | 3300005719 | Bacteria | 1580 |
| 191 | Ga0068861_100316197 | 3300005719 | Bacteria | 1358 |
| 192 | Ga0068851_10008428 | 3300005834 | Bacteria | 4764 |
| 193 | Ga0068870_10078184 | 3300005840 | Bacteria | 1822 |
| 194 | Ga0068863_100004529 | 3300005841 | Bacteria | 13705 |
| 195 | Ga0068863_100025756 | 3300005841 | Bacteria | 5611 |
| 196 | Ga0068863_100373096 | 3300005841 | Bacteria | 1392 |
| 197 | Ga0068863_100414338 | 3300005841 | Bacteria | 1319 |
| 198 | Ga0068858_100000483 | 3300005842 | Bacteria | 41518 |
| 199 | Ga0068858_100043024 | 3300005842 | Bacteria | 4188 |
| 200 | Ga0068858_100128408 | 3300005842 | Bacteria | 2376 |
| 201 | Ga0068858_100300048 | 3300005842 | Bacteria | 1532 |
| 202 | Ga0068860_100003873 | 3300005843 | Bacteria | 15374 |
| 203 | Ga0068860_100028853 | 3300005843 | Bacteria | 5339 |
| 204 | Ga0068860_100055668 | 3300005843 | Bacteria | 3761 |
| 205 | Ga0068860_100109405 | 3300005843 | Bacteria | 2641 |
| 206 | Ga0068860_100138793 | 3300005843 | Bacteria | 2335 |
| 207 | Ga0068860_100208471 | 3300005843 | Bacteria | 1895 |
| 208 | Ga0068862_100099272 | 3300005844 | Bacteria | 2544 |
| 209 | Ga0068862_100143494 | 3300005844 | Bacteria | 2120 |
| 210 | Ga0068862_100188770 | 3300005844 | Bacteria | 1853 |
| 211 | Ga0068862_100305175 | 3300005844 | Bacteria | 1465 |
| 212 | Ga0068862_100399499 | 3300005844 | Bacteria | 1285 |
| 213 | Ga0068862_100816766 | 3300005844 | Bacteria | 911 |
| 214 | Ga0081455_10000812 | 3300005937 | Bacteria | 40224 |
| 215 | Ga0081455_10009274 | 3300005937 | Bacteria | 10134 |
| 216 | Ga0081455_10015998 | 3300005937 | Bacteria | 7258 |
| 217 | Ga0081455_10020610 | 3300005937 | Bacteria | 6202 |
| 218 | Ga0081455_10028221 | 3300005937 | Bacteria | 5131 |
| 219 | Ga0081538_10004738 | 3300005981 | Bacteria | 12447 |
| 220 | Ga0081538_10020460 | 3300005981 | Bacteria | 4867 |
| 221 | Ga0081538_10112627 | 3300005981 | Bacteria | 1331 |
| 222 | Ga0081540_1001986 | 3300005983 | Bacteria | 17063 |
| 223 | Ga0081540_1002094 | 3300005983 | Bacteria | 16604 |
| 224 | Ga0081540_1006308 | 3300005983 | Bacteria | 8674 |
| 225 | Ga0081540_1010425 | 3300005983 | Bacteria | 6296 |
| 226 | Ga0081540_1020900 | 3300005983 | Bacteria | 3920 |
| 227 | Ga0081540_1026478 | 3300005983 | Bacteria | 3308 |
| 228 | Ga0081540_1027710 | 3300005983 | Bacteria | 3202 |
| 229 | Ga0081540_1105978 | 3300005983 | Bacteria | 1199 |
| 230 | Ga0081539_10000351 | 3300005985 | Bacteria | 101228 |
| 231 | Ga0081539_10001264 | 3300005985 | Bacteria | 44681 |
| 232 | Ga0081539_10020384 | 3300005985 | Bacteria | 4484 |
| 233 | Ga0081539_10072103 | 3300005985 | Bacteria | 1848 |
| 234 | Ga0070717_10013517 | 3300006028 | Bacteria | 6259 |
| 235 | Ga0070717_10053667 | 3300006028 | Bacteria | 3323 |
| 236 | Ga0070717_10067675 | 3300006028 | Bacteria | 2972 |
| 237 | Ga0070717_10077200 | 3300006028 | Bacteria | 2788 |
| 238 | Ga0070717_10185195 | 3300006028 | Bacteria | 1817 |
| 239 | Ga0070717_10211652 | 3300006028 | Bacteria | 1701 |
| 240 | Ga0075365_10044906 | 3300006038 | Bacteria | 2897 |
| 241 | Ga0075365_10054787 | 3300006038 | Bacteria | 2646 |
| 242 | Ga0075365_10100510 | 3300006038 | Bacteria | 1980 |
| 243 | Ga0075365_10210355 | 3300006038 | Bacteria | 1363 |
| 244 | Ga0075365_10222435 | 3300006038 | Bacteria | 1324 |
| 245 | Ga0075365_10335451 | 3300006038 | Bacteria | 1065 |
| 246 | Ga0075368_10002752 | 3300006042 | Bacteria | 5806 |
| 247 | Ga0075368_10024760 | 3300006042 | Bacteria | 2300 |
| 248 | Ga0075368_10086974 | 3300006042 | Bacteria | 1276 |
| 249 | Ga0075368_10123016 | 3300006042 | Bacteria | 1075 |
| 250 | Ga0075368_10125195 | 3300006042 | Bacteria | 1066 |
| 251 | Ga0075368_10143555 | 3300006042 | Bacteria | 995 |
| 252 | Ga0075368_10172914 | 3300006042 | Bacteria | 908 |
| 253 | Ga0075363_100007371 | 3300006048 | Bacteria | 5052 |
| 254 | Ga0075363_100085490 | 3300006048 | Bacteria | 1730 |
| 255 | Ga0075363_100156297 | 3300006048 | Bacteria | 1289 |
| 256 | Ga0075364_10015286 | 3300006051 | Bacteria | 4759 |
| 257 | Ga0075364_10192691 | 3300006051 | Bacteria | 1381 |
| 258 | Ga0075364_10271556 | 3300006051 | Bacteria | 1153 |
| 259 | Ga0075364_10342696 | 3300006051 | Bacteria | 1018 |
| 260 | Ga0075364_10383648 | 3300006051 | Bacteria | 958 |
| 261 | Ga0070715_10110546 | 3300006163 | Bacteria | 1296 |
| 262 | Ga0070715_10186994 | 3300006163 | Bacteria | 1043 |
| 263 | Ga0070716_100021762 | 3300006173 | Bacteria | 3381 |
| 264 | Ga0070716_100022705 | 3300006173 | Bacteria | 3319 |
| 265 | Ga0070712_100152685 | 3300006175 | Bacteria | 1775 |
| 266 | Ga0075362_10039422 | 3300006177 | Bacteria | 2077 |
| 267 | Ga0075362_10078378 | 3300006177 | Bacteria | 1519 |
| 268 | Ga0075362_10104254 | 3300006177 | Bacteria | 1329 |
| 269 | Ga0075362_10114490 | 3300006177 | Bacteria | 1272 |
| 270 | Ga0075362_10163239 | 3300006177 | Bacteria | 1073 |
| 271 | Ga0075362_10176350 | 3300006177 | Bacteria | 1034 |
| 272 | Ga0075362_10201489 | 3300006177 | Bacteria | 969 |
| 273 | Ga0075367_10007138 | 3300006178 | Bacteria | 5700 |
| 274 | Ga0075367_10020451 | 3300006178 | Bacteria | 3686 |
| 275 | Ga0075367_10117291 | 3300006178 | Bacteria | 1638 |
| 276 | Ga0075367_10313083 | 3300006178 | Bacteria | 989 |
| 277 | Ga0075367_10333408 | 3300006178 | Bacteria | 956 |
| 278 | Ga0075369_10005751 | 3300006186 | Bacteria | 4655 |
| 279 | Ga0075369_10063379 | 3300006186 | Bacteria | 1617 |
| 280 | Ga0075369_10124491 | 3300006186 | Bacteria | 1169 |
| 281 | Ga0075369_10216187 | 3300006186 | Bacteria | 887 |
| 282 | Ga0075366_10025122 | 3300006195 | Bacteria | 3477 |
| 283 | Ga0075366_10027084 | 3300006195 | Bacteria | 3362 |
| 284 | Ga0075366_10034731 | 3300006195 | Bacteria | 2971 |
| 285 | Ga0075366_10060099 | 3300006195 | Bacteria | 2258 |
| 286 | Ga0075366_10062649 | 3300006195 | Bacteria | 2210 |
| 287 | Ga0075366_10100900 | 3300006195 | Bacteria | 1732 |
| 288 | Ga0075366_10117755 | 3300006195 | Bacteria | 1600 |
| 289 | Ga0075366_10301952 | 3300006195 | Bacteria | 979 |
| 290 | Ga0075366_10321705 | 3300006195 | Bacteria | 948 |
| 291 | Ga0097621_100204250 | 3300006237 | Bacteria | 1717 |
| 292 | Ga0097621_100455905 | 3300006237 | Bacteria | 1152 |
| 293 | Ga0075370_10003211 | 3300006353 | Bacteria | 7739 |
| 294 | Ga0075370_10082375 | 3300006353 | Bacteria | 1850 |
| 295 | Ga0075370_10094916 | 3300006353 | Bacteria | 1722 |
| 296 | Ga0075370_10098523 | 3300006353 | Bacteria | 1690 |
| 297 | Ga0075370_10214290 | 3300006353 | Bacteria | 1137 |
| 298 | Ga0068871_100390412 | 3300006358 | Bacteria | 1238 |
| 299 | Ga0068871_100499942 | 3300006358 | Bacteria | 1096 |
| 300 | Ga0068871_100652731 | 3300006358 | Bacteria | 961 |
| 301 | Ga0068871_100719567 | 3300006358 | Bacteria | 916 |
| 302 | Ga0075428_100034276 | 3300006844 | Bacteria | 5601 |
| 303 | Ga0075428_100065050 | 3300006844 | Bacteria | 3994 |
| 304 | Ga0075428_100377530 | 3300006844 | Bacteria | 1520 |
| 305 | Ga0075430_100003256 | 3300006846 | Bacteria | 13602 |
| 306 | Ga0075430_100008450 | 3300006846 | Bacteria | 8698 |
| 307 | Ga0075431_100002635 | 3300006847 | Bacteria | 17353 |
| 308 | Ga0075431_100005152 | 3300006847 | Bacteria | 12866 |
| 309 | Ga0075431_100249131 | 3300006847 | Bacteria | 1805 |
| 310 | Ga0075431_101162642 | 3300006847 | Bacteria | 735 |
| 311 | Ga0075433_10396971 | 3300006852 | Bacteria | 1217 |
| 312 | Ga0075434_100598770 | 3300006871 | Bacteria | 1121 |
| 313 | Ga0075429_100029205 | 3300006880 | Bacteria | 4789 |
| 314 | Ga0075429_100539156 | 3300006880 | Bacteria | 1022 |
| 315 | Ga0068865_100340725 | 3300006881 | Bacteria | 1211 |
| 316 | Ga0075436_100159844 | 3300006914 | Bacteria | 1588 |
| 317 | Ga0075436_100399373 | 3300006914 | Bacteria | 996 |
| 318 | Ga0097620_100000206 | 3300006931 | Bacteria | 58246 |
| 319 | Ga0097620_100022208 | 3300006931 | Bacteria | 6362 |
| 320 | Ga0097620_100149620 | 3300006931 | Bacteria | 2410 |
| 321 | Ga0097620_100210080 | 3300006931 | Bacteria | 2032 |
| 322 | Ga0097620_100599522 | 3300006931 | Bacteria | 1195 |
| 323 | Ga0099824_1020485 | 3300006942 | Bacteria | 4856 |
| 324 | Ga0099823_1000159 | 3300006944 | Bacteria | 36164 |
| 325 | Ga0075435_100067945 | 3300007076 | Bacteria | 2902 |
| 326 | Ga0075435_100276952 | 3300007076 | Bacteria | 1432 |
| 327 | Ga0099794_10095570 | 3300007265 | Bacteria | 1479 |
| 328 | Ga0099794_10177106 | 3300007265 | Bacteria | 1088 |
| 329 | Ga0099794_10211826 | 3300007265 | Bacteria | 994 |
| 330 | Ga0099795_10017622 | 3300007788 | Bacteria | 2280 |
| 331 | Ga0099795_10100443 | 3300007788 | Bacteria | 1134 |
| 332 | Ga0105250_10028249 | 3300009092 | Bacteria | 2259 |
| 333 | Ga0105240_10004109 | 3300009093 | Bacteria | 22344 |
| 334 | Ga0105240_10006884 | 3300009093 | Bacteria | 16614 |
| 335 | Ga0105240_10007517 | 3300009093 | Bacteria | 15813 |
| 336 | Ga0105240_10378469 | 3300009093 | Bacteria | 1599 |
| 337 | Ga0105240_10986428 | 3300009093 | Bacteria | 902 |
| 338 | Ga0111539_10433569 | 3300009094 | Bacteria | 1530 |
| 339 | Ga0111539_10509493 | 3300009094 | Bacteria | 1401 |
| 340 | Ga0105245_10023295 | 3300009098 | Bacteria | 5435 |
| 341 | Ga0105245_10243558 | 3300009098 | Bacteria | 1744 |
| 342 | Ga0105247_10000088 | 3300009101 | Bacteria | 98964 |
| 343 | Ga0105247_10037140 | 3300009101 | Bacteria | 2972 |
| 344 | Ga0114129_10080790 | 3300009147 | Bacteria | 4519 |
| 345 | Ga0114129_10226450 | 3300009147 | Bacteria | 2520 |
| 346 | Ga0105243_10304844 | 3300009148 | Bacteria | 1445 |
| 347 | Ga0105241_10002534 | 3300009174 | Bacteria | 13706 |
| 348 | Ga0105241_10056815 | 3300009174 | Bacteria | 3001 |
| 349 | Ga0105241_10117210 | 3300009174 | Bacteria | 2140 |
| 350 | Ga0105241_10369194 | 3300009174 | Bacteria | 1251 |
| 351 | Ga0105241_10503693 | 3300009174 | Bacteria | 1080 |
| 352 | Ga0105241_10557055 | 3300009174 | Bacteria | 1030 |
| 353 | Ga0105241_10590319 | 3300009174 | Bacteria | 1002 |
| 354 | Ga0105242_10955988 | 3300009176 | Bacteria | 861 |
| 355 | Ga0105248_10040166 | 3300009177 | Bacteria | 5245 |
| 356 | Ga0105248_10800594 | 3300009177 | Bacteria | 1064 |
| 357 | Ga0105248_10847988 | 3300009177 | Bacteria | 1031 |
| 358 | Ga0105237_10108162 | 3300009545 | Bacteria | 2772 |
| 359 | Ga0105237_10111732 | 3300009545 | Bacteria | 2724 |
| 360 | Ga0105237_10141359 | 3300009545 | Bacteria | 2401 |
| 361 | Ga0105237_10231894 | 3300009545 | Bacteria | 1847 |
| 362 | Ga0105237_10433139 | 3300009545 | Bacteria | 1321 |
| 363 | Ga0105237_10596895 | 3300009545 | Bacteria | 1111 |
| 364 | Ga0105238_10001191 | 3300009551 | Bacteria | 26202 |
| 365 | Ga0105238_10004162 | 3300009551 | Bacteria | 14357 |
| 366 | Ga0105238_10152200 | 3300009551 | Bacteria | 2288 |
| 367 | Ga0105238_10199197 | 3300009551 | Bacteria | 1978 |
| 368 | Ga0105238_10319332 | 3300009551 | Bacteria | 1539 |
| 369 | Ga0105238_10678669 | 3300009551 | Bacteria | 1041 |
| 370 | Ga0105238_10840998 | 3300009551 | Bacteria | 935 |
| 371 | Ga0105238_10942235 | 3300009551 | Bacteria | 883 |
| 372 | Ga0105249_10041598 | 3300009553 | Bacteria | 4178 |
| 373 | Ga0105249_10396614 | 3300009553 | Bacteria | 1409 |
| 374 | Ga0105249_10461447 | 3300009553 | Bacteria | 1310 |
| 375 | Ga0105249_10972474 | 3300009553 | Bacteria | 917 |
| 376 | Ga0105249_11037232 | 3300009553 | Bacteria | 889 |
| 377 | Ga0105249_11732008 | 3300009553 | Bacteria | 697 |
| 378 | Ga0099796_10061171 | 3300010159 | Bacteria | 1335 |
| 379 | Ga0105239_10033506 | 3300010375 | Bacteria | 5641 |
| 380 | Ga0105239_10126755 | 3300010375 | Bacteria | 2838 |
| 381 | Ga0105239_10129504 | 3300010375 | Bacteria | 2806 |
| 382 | Ga0105239_10133572 | 3300010375 | Bacteria | 2762 |
| 383 | Ga0105239_10140807 | 3300010375 | Bacteria | 2687 |
| 384 | Ga0105239_10500351 | 3300010375 | Bacteria | 1382 |
| 385 | Ga0105246_10011299 | 3300011119 | Bacteria | 5541 |
| 386 | Ga0105246_10267874 | 3300011119 | Bacteria | 1364 |
| 387 | Ga0105246_10461059 | 3300011119 | Bacteria | 1070 |
| 388 | Ga0105246_10488503 | 3300011119 | Bacteria | 1043 |
| 389 | Ga0157319_1000015 | 3300012497 | Bacteria | 130857 |
| 390 | Ga0157373_10310421 | 3300013100 | Bacteria | 1121 |
| 391 | Ga0157370_10080792 | 3300013104 | Bacteria | 3061 |
| 392 | Ga0157370_10680539 | 3300013104 | Bacteria | 939 |
| 393 | Ga0157369_10082169 | 3300013105 | Bacteria | 3447 |
| 394 | Ga0157369_10226457 | 3300013105 | Bacteria | 1956 |
| 395 | Ga0157374_10212671 | 3300013296 | Bacteria | 1896 |
| 396 | Ga0157374_10329455 | 3300013296 | Bacteria | 1514 |
| 397 | Ga0157374_10417474 | 3300013296 | Bacteria | 1340 |
| 398 | Ga0157374_10436252 | 3300013296 | Bacteria | 1310 |
| 399 | Ga0163162_10255848 | 3300013306 | Bacteria | 1883 |
| 400 | Ga0163162_10404593 | 3300013306 | Bacteria | 1498 |
| 401 | Ga0163162_10756192 | 3300013306 | Bacteria | 1091 |
| 402 | Ga0157372_10250867 | 3300013307 | Bacteria | 2054 |
| 403 | Ga0157372_10538428 | 3300013307 | Bacteria | 1361 |
| 404 | Ga0157372_11177496 | 3300013307 | Bacteria | 886 |
| 405 | Ga0157375_10020701 | 3300013308 | Bacteria | 6017 |
| 406 | Ga0157375_10161601 | 3300013308 | Bacteria | 2382 |
| 407 | Ga0163163_10026516 | 3300014325 | Bacteria | 5541 |
| 408 | Ga0163163_10436090 | 3300014325 | Bacteria | 1369 |
| 409 | Ga0163163_11263290 | 3300014325 | Bacteria | 801 |
| 410 | Ga0163163_11469439 | 3300014325 | Bacteria | 743 |
| 411 | Ga0157380_10389449 | 3300014326 | Bacteria | 1318 |
| 412 | Ga0157380_10496500 | 3300014326 | Bacteria | 1184 |
| 413 | Ga0157379_10059904 | 3300014968 | Bacteria | 3404 |
| 414 | Ga0157379_10138347 | 3300014968 | Bacteria | 2195 |
| 415 | Ga0157379_10209971 | 3300014968 | Bacteria | 1762 |
| 416 | Ga0157379_10338134 | 3300014968 | Bacteria | 1376 |
| 417 | Ga0157379_10525540 | 3300014968 | Bacteria | 1099 |
| 418 | Ga0157379_10592968 | 3300014968 | Bacteria | 1034 |
| 419 | Ga0157376_10375316 | 3300014969 | Bacteria | 1368 |
| 420 | Ga0157376_10474953 | 3300014969 | Bacteria | 1224 |
| 421 | Ga0157376_10858747 | 3300014969 | Bacteria | 923 |
| 422 | Ga0163161_10051818 | 3300017792 | Bacteria | 2975 |
| 423 | Ga0163161_10157812 | 3300017792 | Bacteria | 1728 |
| 424 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 425 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 426 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 427 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 428 | Ga0213874_10016178 | 3300021377 | Bacteria | 1981 |
| 429 | Ga0213876_10133106 | 3300021384 | Bacteria | 1322 |
| 430 | Ga0213875_10084537 | 3300021388 | Bacteria | 1480 |
| 431 | Ga0213871_10003352 | 3300021441 | Bacteria | 3075 |
| 432 | Ga0224572_1004877 | 3300024225 | Bacteria | 2365 |
| 433 | Ga0209563_102960 | 3300025230 | Bacteria | 3652 |
| 434 | Ga0207425_1004681 | 3300025245 | Bacteria | 4044 |
| 435 | Ga0209677_100732 | 3300025253 | Bacteria | 16720 |
| 436 | Ga0209677_105587 | 3300025253 | Bacteria | 3242 |
| 437 | Ga0209148_1000424 | 3300025254 | Bacteria | 47087 |
| 438 | Ga0209148_1023745 | 3300025254 | Bacteria | 973 |
| 439 | Ga0209233_1002009 | 3300025261 | Bacteria | 7706 |
| 440 | Ga0209455_1002336 | 3300025272 | Bacteria | 7415 |
| 441 | Ga0209455_1003026 | 3300025272 | Bacteria | 6155 |
| 442 | Ga0209455_1016893 | 3300025272 | Bacteria | 1550 |
| 443 | Ga0209673_1005096 | 3300025273 | Bacteria | 6745 |
| 444 | Ga0209673_1039730 | 3300025273 | Bacteria | 1354 |
| 445 | Ga0209130_1035841 | 3300025284 | Bacteria | 989 |
| 446 | Ga0209564_1005101 | 3300025295 | Bacteria | 7642 |
| 447 | Ga0209564_1013333 | 3300025295 | Bacteria | 3504 |
| 448 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 449 | Ga0209758_1000613 | 3300025297 | Bacteria | 55154 |
| 450 | Ga0209758_1000880 | 3300025297 | Bacteria | 41231 |
| 451 | Ga0209758_1001679 | 3300025297 | Bacteria | 24954 |
| 452 | Ga0209758_1002992 | 3300025297 | Bacteria | 16198 |
| 453 | Ga0209758_1020502 | 3300025297 | Bacteria | 3124 |
| 454 | Ga0209758_1070085 | 3300025297 | Bacteria | 1108 |
| 455 | Ga0209758_1072679 | 3300025297 | Bacteria | 1075 |
| 456 | Ga0209050_1005153 | 3300025298 | Bacteria | 8376 |
| 457 | Ga0209256_1000394 | 3300025299 | Bacteria | 69416 |
| 458 | Ga0209256_1000665 | 3300025299 | Bacteria | 46496 |
| 459 | Ga0209256_1003785 | 3300025299 | Bacteria | 10186 |
| 460 | Ga0207426_1000425 | 3300025302 | Bacteria | 69088 |
| 461 | Ga0207426_1009082 | 3300025302 | Bacteria | 3954 |
| 462 | Ga0207426_1015297 | 3300025302 | Bacteria | 2786 |
| 463 | Ga0209051_1001627 | 3300025303 | Bacteria | 18254 |
| 464 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 465 | Ga0209257_1002239 | 3300025304 | Bacteria | 19852 |
| 466 | Ga0209257_1002312 | 3300025304 | Bacteria | 19272 |
| 467 | Ga0207656_10047458 | 3300025321 | Bacteria | 1846 |
| 468 | Ga0207653_10158684 | 3300025885 | Bacteria | 836 |
| 469 | Ga0207682_10003055 | 3300025893 | Bacteria | 7348 |
| 470 | Ga0207692_10000488 | 3300025898 | Bacteria | 13997 |
| 471 | Ga0207692_10000857 | 3300025898 | Bacteria | 10930 |
| 472 | Ga0207692_10022931 | 3300025898 | Bacteria | 2881 |
| 473 | Ga0207692_10314398 | 3300025898 | Bacteria | 957 |
| 474 | Ga0207642_10552515 | 3300025899 | Bacteria | 711 |
| 475 | Ga0207710_10000205 | 3300025900 | Bacteria | 54586 |
| 476 | Ga0207710_10037281 | 3300025900 | Bacteria | 2147 |
| 477 | Ga0207688_10014539 | 3300025901 | Bacteria | 4276 |
| 478 | Ga0207688_10015986 | 3300025901 | Bacteria | 4068 |
| 479 | Ga0207688_10161197 | 3300025901 | Bacteria | 1330 |
| 480 | Ga0207680_10119839 | 3300025903 | Bacteria | 1719 |
| 481 | Ga0207680_10223895 | 3300025903 | Bacteria | 1291 |
| 482 | Ga0207647_10000220 | 3300025904 | Bacteria | 46910 |
| 483 | Ga0207647_10046056 | 3300025904 | Bacteria | 2718 |
| 484 | Ga0207647_10231752 | 3300025904 | Bacteria | 1062 |
| 485 | Ga0207699_10001075 | 3300025906 | Bacteria | 12927 |
| 486 | Ga0207699_10061939 | 3300025906 | Bacteria | 2253 |
| 487 | Ga0207699_10201177 | 3300025906 | Bacteria | 1350 |
| 488 | Ga0207645_10067417 | 3300025907 | Bacteria | 2287 |
| 489 | Ga0207645_10182847 | 3300025907 | Bacteria | 1376 |
| 490 | Ga0207645_10217012 | 3300025907 | Bacteria | 1260 |
| 491 | Ga0207645_10606027 | 3300025907 | Bacteria | 743 |
| 492 | Ga0207643_10044593 | 3300025908 | Bacteria | 2504 |
| 493 | Ga0207684_10373494 | 3300025910 | Bacteria | 1227 |
| 494 | Ga0207654_10000081 | 3300025911 | Bacteria | 62713 |
| 495 | Ga0207654_10017803 | 3300025911 | Bacteria | 3721 |
| 496 | Ga0207654_10092583 | 3300025911 | Bacteria | 1846 |
| 497 | Ga0207654_10104057 | 3300025911 | Bacteria | 1754 |
| 498 | Ga0207654_10159853 | 3300025911 | Bacteria | 1454 |
| 499 | Ga0207654_10692299 | 3300025911 | Bacteria | 732 |
| 500 | Ga0207707_10000178 | 3300025912 | Bacteria | 66057 |
| 501 | Ga0207707_10019742 | 3300025912 | Bacteria | 5883 |
| 502 | Ga0207707_10071082 | 3300025912 | Bacteria | 3032 |
| 503 | Ga0207707_10187064 | 3300025912 | Bacteria | 1807 |
| 504 | Ga0207707_10251777 | 3300025912 | Bacteria | 1534 |
| 505 | Ga0207707_10437840 | 3300025912 | Bacteria | 1119 |
| 506 | Ga0207695_10000792 | 3300025913 | Bacteria | 59401 |
| 507 | Ga0207695_10002487 | 3300025913 | Bacteria | 27129 |
| 508 | Ga0207695_10082664 | 3300025913 | Bacteria | 3246 |
| 509 | Ga0207695_10087886 | 3300025913 | Bacteria | 3130 |
| 510 | Ga0207671_10008093 | 3300025914 | Bacteria | 8976 |
| 511 | Ga0207671_10033736 | 3300025914 | Bacteria | 3807 |
| 512 | Ga0207671_10044293 | 3300025914 | Bacteria | 3291 |
| 513 | Ga0207671_10294072 | 3300025914 | Bacteria | 1283 |
| 514 | Ga0207671_10659455 | 3300025914 | Bacteria | 833 |
| 515 | Ga0207693_10060906 | 3300025915 | Bacteria | 2956 |
| 516 | Ga0207693_10194705 | 3300025915 | Bacteria | 1595 |
| 517 | Ga0207693_10518640 | 3300025915 | Bacteria | 930 |
| 518 | Ga0207693_10784005 | 3300025915 | Bacteria | 735 |
| 519 | Ga0207663_10095110 | 3300025916 | Bacteria | 1987 |
| 520 | Ga0207663_10140180 | 3300025916 | Bacteria | 1683 |
| 521 | Ga0207660_10041651 | 3300025917 | Bacteria | 3219 |
| 522 | Ga0207660_10073413 | 3300025917 | Bacteria | 2494 |
| 523 | Ga0207662_10048779 | 3300025918 | Bacteria | 2510 |
| 524 | Ga0207657_10042401 | 3300025919 | Bacteria | 4015 |
| 525 | Ga0207657_10124247 | 3300025919 | Bacteria | 2120 |
| 526 | Ga0207657_10663718 | 3300025919 | Bacteria | 811 |
| 527 | Ga0207649_10250247 | 3300025920 | Bacteria | 1276 |
| 528 | Ga0207652_10200952 | 3300025921 | Bacteria | 1793 |
| 529 | Ga0207652_10391561 | 3300025921 | Bacteria | 1254 |
| 530 | Ga0207681_10280630 | 3300025923 | Bacteria | 1311 |
| 531 | Ga0207694_10000134 | 3300025924 | Bacteria | 75759 |
| 532 | Ga0207694_10018077 | 3300025924 | Bacteria | 5329 |
| 533 | Ga0207650_10006480 | 3300025925 | Bacteria | 7975 |
| 534 | Ga0207650_10356241 | 3300025925 | Bacteria | 1205 |
| 535 | Ga0207650_10656616 | 3300025925 | Bacteria | 884 |
| 536 | Ga0207659_10062440 | 3300025926 | Bacteria | 2689 |
| 537 | Ga0207659_10110192 | 3300025926 | Bacteria | 2091 |
| 538 | Ga0207659_10165245 | 3300025926 | Bacteria | 1741 |
| 539 | Ga0207659_10166988 | 3300025926 | Bacteria | 1733 |
| 540 | Ga0207687_10021001 | 3300025927 | Bacteria | 4335 |
| 541 | Ga0207687_10076758 | 3300025927 | Bacteria | 2401 |
| 542 | Ga0207687_10117251 | 3300025927 | Bacteria | 1986 |
| 543 | Ga0207700_10006387 | 3300025928 | Bacteria | 7114 |
| 544 | Ga0207700_10025306 | 3300025928 | Bacteria | 4119 |
| 545 | Ga0207700_10211906 | 3300025928 | Bacteria | 1638 |
| 546 | Ga0207700_10309784 | 3300025928 | Bacteria | 1365 |
| 547 | Ga0207700_10386625 | 3300025928 | Bacteria | 1224 |
| 548 | Ga0207700_10409095 | 3300025928 | Bacteria | 1190 |
| 549 | Ga0207700_10422184 | 3300025928 | Bacteria | 1172 |
| 550 | Ga0207700_10604217 | 3300025928 | Bacteria | 976 |
| 551 | Ga0207664_10008339 | 3300025929 | Bacteria | 7222 |
| 552 | Ga0207664_10051200 | 3300025929 | Bacteria | 3259 |
| 553 | Ga0207664_10125084 | 3300025929 | Bacteria | 2158 |
| 554 | Ga0207664_10539369 | 3300025929 | Bacteria | 1046 |
| 555 | Ga0207664_10598778 | 3300025929 | Bacteria | 990 |
| 556 | Ga0207644_10009052 | 3300025931 | Bacteria | 6528 |
| 557 | Ga0207644_10010871 | 3300025931 | Bacteria | 6009 |
| 558 | Ga0207644_10235234 | 3300025931 | Bacteria | 1457 |
| 559 | Ga0207644_10792522 | 3300025931 | Bacteria | 792 |
| 560 | Ga0207706_10025374 | 3300025933 | Bacteria | 5310 |
| 561 | Ga0207706_10105930 | 3300025933 | Bacteria | 2474 |
| 562 | Ga0207706_10387884 | 3300025933 | Bacteria | 1212 |
| 563 | Ga0207686_10075811 | 3300025934 | Bacteria | 2178 |
| 564 | Ga0207709_10242467 | 3300025935 | Bacteria | 1312 |
| 565 | Ga0207709_10313806 | 3300025935 | Bacteria | 1171 |
| 566 | Ga0207670_10032892 | 3300025936 | Bacteria | 3338 |
| 567 | Ga0207670_10264080 | 3300025936 | Bacteria | 1335 |
| 568 | Ga0207669_10146654 | 3300025937 | Bacteria | 1646 |
| 569 | Ga0207669_10534670 | 3300025937 | Bacteria | 943 |
| 570 | Ga0207665_10010001 | 3300025939 | Bacteria | 6228 |
| 571 | Ga0207665_10014958 | 3300025939 | Bacteria | 5097 |
| 572 | Ga0207665_10167266 | 3300025939 | Bacteria | 1586 |
| 573 | Ga0207665_10233958 | 3300025939 | Bacteria | 1351 |
| 574 | Ga0207665_10545099 | 3300025939 | Bacteria | 901 |
| 575 | Ga0207691_10000698 | 3300025940 | Bacteria | 33205 |
| 576 | Ga0207691_10357503 | 3300025940 | Bacteria | 1249 |
| 577 | Ga0207691_10407572 | 3300025940 | Bacteria | 1159 |
| 578 | Ga0207691_10776048 | 3300025940 | Bacteria | 806 |
| 579 | Ga0207711_10017689 | 3300025941 | Bacteria | 5922 |
| 580 | Ga0207661_10004454 | 3300025944 | Bacteria | 9840 |
| 581 | Ga0207661_10025602 | 3300025944 | Bacteria | 4487 |
| 582 | Ga0207661_10240481 | 3300025944 | Bacteria | 1606 |
| 583 | Ga0207679_10123560 | 3300025945 | Bacteria | 2064 |
| 584 | Ga0207679_10572923 | 3300025945 | Bacteria | 1015 |
| 585 | Ga0207667_10008395 | 3300025949 | Bacteria | 12275 |
| 586 | Ga0207667_10062284 | 3300025949 | Bacteria | 3901 |
| 587 | Ga0207667_10098987 | 3300025949 | Bacteria | 3008 |
| 588 | Ga0207667_10244331 | 3300025949 | Bacteria | 1837 |
| 589 | Ga0207651_10179912 | 3300025960 | Bacteria | 1676 |
| 590 | Ga0207712_10290484 | 3300025961 | Bacteria | 1338 |
| 591 | Ga0207712_10490877 | 3300025961 | Bacteria | 1048 |
| 592 | Ga0207668_10144482 | 3300025972 | Bacteria | 1833 |
| 593 | Ga0207668_10394476 | 3300025972 | Bacteria | 1168 |
| 594 | Ga0207640_10011779 | 3300025981 | Bacteria | 4962 |
| 595 | Ga0207640_10032524 | 3300025981 | Bacteria | 3235 |
| 596 | Ga0207640_10513349 | 3300025981 | Bacteria | 1000 |
| 597 | Ga0207658_10047097 | 3300025986 | Bacteria | 3153 |
| 598 | Ga0207658_10432628 | 3300025986 | Bacteria | 1162 |
| 599 | Ga0207658_10504302 | 3300025986 | Bacteria | 1078 |
| 600 | Ga0207677_10123528 | 3300026023 | Bacteria | 1952 |
| 601 | Ga0207677_10146925 | 3300026023 | Bacteria | 1813 |
| 602 | Ga0207703_10002506 | 3300026035 | Bacteria | 15883 |
| 603 | Ga0207703_10089825 | 3300026035 | Bacteria | 2581 |
| 604 | Ga0207703_10097235 | 3300026035 | Bacteria | 2487 |
| 605 | Ga0207703_10125220 | 3300026035 | Bacteria | 2211 |
| 606 | Ga0207703_10364295 | 3300026035 | Bacteria | 1334 |
| 607 | Ga0207703_10552775 | 3300026035 | Bacteria | 1085 |
| 608 | Ga0207703_10683644 | 3300026035 | Bacteria | 975 |
| 609 | Ga0207639_10028198 | 3300026041 | Bacteria | 4097 |
| 610 | Ga0207639_10063368 | 3300026041 | Bacteria | 2862 |
| 611 | Ga0207639_10152276 | 3300026041 | Bacteria | 1938 |
| 612 | Ga0207639_10160206 | 3300026041 | Bacteria | 1895 |
| 613 | Ga0207639_10451595 | 3300026041 | Bacteria | 1167 |
| 614 | Ga0207678_10023360 | 3300026067 | Bacteria | 5407 |
| 615 | Ga0207678_10040710 | 3300026067 | Bacteria | 4028 |
| 616 | Ga0207678_10263659 | 3300026067 | Bacteria | 1477 |
| 617 | Ga0207678_10266186 | 3300026067 | Bacteria | 1469 |
| 618 | Ga0207678_10441853 | 3300026067 | Bacteria | 1130 |
| 619 | Ga0207678_10565382 | 3300026067 | Bacteria | 995 |
| 620 | Ga0207708_10505868 | 3300026075 | Bacteria | 1013 |
| 621 | Ga0207708_10970513 | 3300026075 | Bacteria | 737 |
| 622 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 623 | Ga0207702_10000180 | 3300026078 | Bacteria | 76230 |
| 624 | Ga0207702_10008051 | 3300026078 | Bacteria | 8919 |
| 625 | Ga0207641_10791698 | 3300026088 | Bacteria | 937 |
| 626 | Ga0207648_10135849 | 3300026089 | Bacteria | 2166 |
| 627 | Ga0207648_10175136 | 3300026089 | Bacteria | 1897 |
| 628 | Ga0207648_10478752 | 3300026089 | Bacteria | 1137 |
| 629 | Ga0207648_10894958 | 3300026089 | Bacteria | 829 |
| 630 | Ga0207676_10024491 | 3300026095 | Bacteria | 4466 |
| 631 | Ga0207676_10066448 | 3300026095 | Bacteria | 2876 |
| 632 | Ga0207676_10264901 | 3300026095 | Bacteria | 1553 |
| 633 | Ga0207674_10001084 | 3300026116 | Bacteria | 35396 |
| 634 | Ga0207674_10004586 | 3300026116 | Bacteria | 16588 |
| 635 | Ga0207674_10046856 | 3300026116 | Bacteria | 4436 |
| 636 | Ga0207674_10276058 | 3300026116 | Bacteria | 1628 |
| 637 | Ga0207674_10753848 | 3300026116 | Bacteria | 940 |
| 638 | Ga0207675_100029542 | 3300026118 | Bacteria | 5107 |
| 639 | Ga0207675_100236585 | 3300026118 | Bacteria | 1763 |
| 640 | Ga0207675_100395269 | 3300026118 | Bacteria | 1361 |
| 641 | Ga0207675_100400597 | 3300026118 | Bacteria | 1352 |
| 642 | Ga0207683_10025663 | 3300026121 | Bacteria | 5083 |
| 643 | Ga0207683_10047657 | 3300026121 | Bacteria | 3752 |
| 644 | Ga0207683_10223487 | 3300026121 | Bacteria | 1716 |
| 645 | Ga0207683_10715959 | 3300026121 | Bacteria | 928 |
| 646 | Ga0207683_10751715 | 3300026121 | Bacteria | 905 |
| 647 | Ga0207698_10158401 | 3300026142 | Bacteria | 1976 |
| 648 | Ga0207698_10615903 | 3300026142 | Bacteria | 1072 |
| 649 | Ga0207698_10632251 | 3300026142 | Bacteria | 1058 |
| 650 | Ga0209389_1000090 | 3300027296 | Bacteria | 83470 |
| 651 | Ga0209389_1000119 | 3300027296 | Bacteria | 70614 |
| 652 | Ga0209371_1009241 | 3300027312 | Bacteria | 3151 |
| 653 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 654 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 655 | Ga0209489_100385 | 3300027361 | Bacteria | 79532 |
| 656 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 657 | Ga0209970_1000101 | 3300027614 | Bacteria | 12138 |
| 658 | Ga0209588_1054177 | 3300027671 | Bacteria | 1297 |
| 659 | Ga0209813_10001497 | 3300027866 | Bacteria | 5255 |
| 660 | Ga0209813_10066346 | 3300027866 | Bacteria | 1164 |
| 661 | Ga0265355_1000790 | 3300028036 | Bacteria | 1840 |
| 662 | Ga0268266_10005802 | 3300028379 | Bacteria | 11431 |
| 663 | Ga0268266_10055170 | 3300028379 | Bacteria | 3415 |
| 664 | Ga0268266_10528405 | 3300028379 | Bacteria | 1128 |
| 665 | Ga0268266_10623795 | 3300028379 | Bacteria | 1036 |
| 666 | Ga0268266_10645702 | 3300028379 | Bacteria | 1018 |
| 667 | Ga0268266_10748518 | 3300028379 | Bacteria | 943 |
| 668 | Ga0268265_10046489 | 3300028380 | Bacteria | 3245 |
| 669 | Ga0268265_10084689 | 3300028380 | Bacteria | 2513 |
| 670 | Ga0268265_10148699 | 3300028380 | Bacteria | 1972 |
| 671 | Ga0268265_10263512 | 3300028380 | Bacteria | 1533 |
| 672 | Ga0268265_11018659 | 3300028380 | Bacteria | 819 |
| 673 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 674 | Ga0268264_10100469 | 3300028381 | Bacteria | 2512 |
| 675 | Ga0268264_10154241 | 3300028381 | Bacteria | 2062 |
| 676 | Ga0265337_1002785 | 3300028556 | Bacteria | 7834 |
| 677 | Ga0265326_10001368 | 3300028558 | Bacteria | 8631 |
| 678 | Ga0265319_1002644 | 3300028563 | Bacteria | 9625 |
| 679 | Ga0265334_10013730 | 3300028573 | Bacteria | 3386 |
| 680 | Ga0265318_10005911 | 3300028577 | Bacteria | 5688 |
| 681 | Ga0265323_10004952 | 3300028653 | Bacteria | 5686 |
| 682 | Ga0265322_10005073 | 3300028654 | Bacteria | 3898 |
| 683 | Ga0265336_10000169 | 3300028666 | Bacteria | 45875 |
| 684 | Ga0307517_10003969 | 3300028786 | Bacteria | 22921 |
| 685 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 686 | Ga0307515_10000433 | 3300028794 | Bacteria | 100295 |
| 687 | Ga0265338_10000624 | 3300028800 | Bacteria | 61670 |
| 688 | Ga0265324_10005252 | 3300029957 | Bacteria | 5630 |
| 689 | Ga0268256_1009760 | 3300030500 | Bacteria | 3151 |
| 690 | Ga0307511_10000022 | 3300030521 | Bacteria | 116875 |
| 691 | Ga0307511_10000448 | 3300030521 | Bacteria | 44274 |
| 692 | Ga0307511_10155467 | 3300030521 | Bacteria | 1299 |
| 693 | Ga0307512_10177664 | 3300030522 | Bacteria | 1204 |
| 694 | Ga0265763_1000840 | 3300030763 | Bacteria | 2035 |
| 695 | Ga0265770_1000728 | 3300030878 | Bacteria | 4592 |
| 696 | Ga0265765_1020014 | 3300030879 | Unclassified | 804 |
| 697 | Ga0265773_1003679 | 3300031018 | Bacteria | 1020 |
| 698 | Ga0265760_10000431 | 3300031090 | Bacteria | 11784 |
| 699 | Ga0265330_10106670 | 3300031235 | Bacteria | 1198 |
| 700 | Ga0265332_10145336 | 3300031238 | Bacteria | 993 |
| 701 | Ga0265320_10049671 | 3300031240 | Bacteria | 2041 |
| 702 | Ga0265320_10217099 | 3300031240 | Bacteria | 852 |
| 703 | Ga0265325_10003656 | 3300031241 | Bacteria | 9969 |
| 704 | Ga0265325_10025892 | 3300031241 | Bacteria | 3182 |
| 705 | Ga0265329_10020107 | 3300031242 | Bacteria | 2259 |
| 706 | Ga0265340_10011120 | 3300031247 | Bacteria | 4795 |
| 707 | Ga0265340_10042738 | 3300031247 | Bacteria | 2223 |
| 708 | Ga0265340_10044657 | 3300031247 | Bacteria | 2168 |
| 709 | Ga0265340_10150268 | 3300031247 | Bacteria | 1062 |
| 710 | Ga0265339_10000158 | 3300031249 | Bacteria | 56155 |
| 711 | Ga0265339_10151289 | 3300031249 | Bacteria | 1173 |
| 712 | Ga0265327_10001335 | 3300031251 | Bacteria | 31984 |
| 713 | Ga0265316_10126964 | 3300031344 | Bacteria | 1923 |
| 714 | Ga0265316_10292396 | 3300031344 | Bacteria | 1188 |
| 715 | Ga0265316_10610113 | 3300031344 | Bacteria | 773 |
| 716 | Ga0307513_10032139 | 3300031456 | Bacteria | 5923 |
| 717 | Ga0307513_10077494 | 3300031456 | Bacteria | 3442 |
| 718 | Ga0307513_10217751 | 3300031456 | Bacteria | 1733 |
| 719 | Ga0307513_10568487 | 3300031456 | Bacteria | 845 |
| 720 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 721 | Ga0307509_10131732 | 3300031507 | Bacteria | 2454 |
| 722 | Ga0307509_10141543 | 3300031507 | Bacteria | 2339 |
| 723 | Ga0307509_10380853 | 3300031507 | Bacteria | 1124 |
| 724 | Ga0307408_100040215 | 3300031548 | Bacteria | 3310 |
| 725 | Ga0265313_10000426 | 3300031595 | Bacteria | 45023 |
| 726 | Ga0265313_10013755 | 3300031595 | Bacteria | 4828 |
| 727 | Ga0307508_10000501 | 3300031616 | Bacteria | 46845 |
| 728 | Ga0307514_10000662 | 3300031649 | Bacteria | 62034 |
| 729 | Ga0307514_10001541 | 3300031649 | Bacteria | 27415 |
| 730 | Ga0265314_10012027 | 3300031711 | Bacteria | 7096 |
| 731 | Ga0265314_10172596 | 3300031711 | Bacteria | 1304 |
| 732 | Ga0265314_10183498 | 3300031711 | Bacteria | 1251 |
| 733 | Ga0265342_10034197 | 3300031712 | Bacteria | 3120 |
| 734 | Ga0265342_10053047 | 3300031712 | Bacteria | 2414 |
| 735 | Ga0307516_10006301 | 3300031730 | Bacteria | 13940 |
| 736 | Ga0307516_10057831 | 3300031730 | Bacteria | 3776 |
| 737 | Ga0307516_10436154 | 3300031730 | Bacteria | 967 |
| 738 | Ga0307413_10193843 | 3300031824 | Bacteria | 1461 |
| 739 | Ga0307406_10322270 | 3300031901 | Bacteria | 1196 |
| 740 | Ga0307406_10607269 | 3300031901 | Bacteria | 903 |
| 741 | Ga0307406_10959092 | 3300031901 | Bacteria | 731 |
| 742 | Ga0307406_10998288 | 3300031901 | Bacteria | 718 |
| 743 | Ga0307412_10549067 | 3300031911 | Bacteria | 970 |
| 744 | Ga0307409_100257156 | 3300031995 | Bacteria | 1600 |
| 745 | Ga0307416_100230868 | 3300032002 | Bacteria | 1784 |
| 746 | Ga0307411_10088379 | 3300032005 | Bacteria | 2155 |
| 747 | Ga0307415_100173160 | 3300032126 | Bacteria | 1685 |
| 748 | Ga0307415_100322348 | 3300032126 | Bacteria | 1289 |
| 749 | Ga0307507_10026407 | 3300033179 | Bacteria | 6261 |
| 750 | Ga0307507_10099921 | 3300033179 | Bacteria | 2434 |
| 751 | Ga0307510_10049005 | 3300033180 | Bacteria | 4499 |
| 752 | Ga0307510_10081087 | 3300033180 | Bacteria | 3149 |
| 753 | Ga0316214_1008501 | 3300033545 | Bacteria | 1382 |
| 754 | Ga0373938_0003935 | 3300034957 | Bacteria | 2459 |
| 755 | Ga0373926_0094914 | 3300035083 | Bacteria | 1112 |
| 756 | Ga0373926_0128461 | 3300035083 | Bacteria | 959 |
| 757 | Ga0373926_0160634 | 3300035083 | Bacteria | 858 |
| 758 | Ga0373934_0003996 | 3300035086 | Bacteria | 5427 |
| 759 | Ga0373934_0199755 | 3300035086 | Bacteria | 823 |
| 760 | Ga0373944_0032747 | 3300035089 | Bacteria | 1572 |
| 761 | Ga0373944_0106958 | 3300035089 | Bacteria | 951 |
| 762 | Ga0373949_0030173 | 3300035090 | Bacteria | 1288 |
| 763 | Ga0373923_0000165 | 3300035111 | Bacteria | 13011 |
| 764 | Ga0373923_0004503 | 3300035111 | Bacteria | 4627 |
| 765 | Ga0373923_0018585 | 3300035111 | Bacteria | 2678 |
| 766 | Ga0373923_0121252 | 3300035111 | Bacteria | 1169 |
| 767 | Ga0373932_0146480 | 3300035112 | Bacteria | 807 |
| 768 | Ga0373936_0011221 | 3300035113 | Bacteria | 3388 |
| 769 | Ga0373936_0015552 | 3300035113 | Bacteria | 2916 |
| 770 | Ga0373936_0101340 | 3300035113 | Bacteria | 1215 |
| 771 | Ga0373945_0060670 | 3300035116 | Bacteria | 1411 |
| 772 | Ga0373953_0001078 | 3300035117 | Bacteria | 7702 |
| 773 | Ga0373953_0104995 | 3300035117 | Bacteria | 1191 |
| 774 | Ga0373954_0000260 | 3300035118 | Bacteria | 19074 |
| 775 | Ga0373954_0005989 | 3300035118 | Bacteria | 5290 |
| 776 | Ga0373954_0009341 | 3300035118 | Bacteria | 4313 |
| 777 | Ga0373956_0001075 | 3300035119 | Bacteria | 11230 |
| 778 | Ga0373957_0002893 | 3300035120 | Bacteria | 4970 |
| 779 | Ga0373957_0003647 | 3300035120 | Bacteria | 4588 |
| 780 | Ga0373957_0008300 | 3300035120 | Bacteria | 3358 |
| 781 | Ga0373960_0162529 | 3300035121 | Bacteria | 770 |
| 782 | Ga0373946_0062775 | 3300035171 | Bacteria | 1585 |
| 783 | Ga0373946_0098579 | 3300035171 | Bacteria | 1306 |
| 784 | Ga0373946_0326325 | 3300035171 | Bacteria | 763 |
| 785 | Ga0373955_0001777 | 3300035172 | Bacteria | 9248 |
| 786 | Ga0373955_0008401 | 3300035172 | Bacteria | 4795 |
| 787 | Ga0316574_0128357 | 3300035398 | Bacteria | 1631 |
| 788 | Ga0373924_0001923 | 3300035410 | Bacteria | 6909 |
| 789 | Ga0373924_0006876 | 3300035410 | Bacteria | 4090 |
| 790 | Ga0373931_0091988 | 3300035691 | Bacteria | 1691 |
| 791 | Ga0373935_0000353 | 3300035692 | Bacteria | 23390 |
| 792 | Ga0373935_0005100 | 3300035692 | Bacteria | 7740 |
| 793 | Ga0373935_0008475 | 3300035692 | Bacteria | 6153 |
| 794 | Ga0373935_0014443 | 3300035692 | Bacteria | 4764 |
| 795 | Ga0373935_0055839 | 3300035692 | Bacteria | 2516 |
| 796 | Ga0373927_0001254 | 3300035695 | Bacteria | 19248 |
| 797 | Ga0373927_0008448 | 3300035695 | Bacteria | 6925 |
| 798 | Ga0373927_0114331 | 3300035695 | Bacteria | 1759 |
| 799 | Ga0373927_0215731 | 3300035695 | Bacteria | 1260 |
| 800 | Ga0373927_0447223 | 3300035695 | Bacteria | 853 |
| 801 | Ga0373933_0004010 | 3300035724 | Bacteria | 8111 |
| 802 | Ga0373933_0045081 | 3300035724 | Bacteria | 2614 |
| 803 | Ga0373933_0244233 | 3300035724 | Bacteria | 1155 |
| 804 | Ga0373947_0012509 | 3300035725 | Bacteria | 4867 |
| 805 | Ga0373947_0030732 | 3300035725 | Bacteria | 3157 |
| 806 | Ga0373947_0294280 | 3300035725 | Bacteria | 1081 |
| 807 | Ga0373947_0785591 | 3300035725 | Bacteria | 650 |
| 808 | Ga0373937_0083363 | 3300036401 | Bacteria | 2957 |
| 809 | Ga0373937_0147496 | 3300036401 | Bacteria | 2203 |
| 810 | Ga0373937_0961177 | 3300036401 | Bacteria | 803 |
| 811 | Ga0373925_0003844 | 3300037068 | Bacteria | 11505 |
| 812 | Ga0373925_0008725 | 3300037068 | Bacteria | 7384 |
| 813 | Ga0373925_0134855 | 3300037068 | Bacteria | 1928 |
| 814 | Ga0373925_0315611 | 3300037068 | Bacteria | 1264 |
| 815 | Ga0395900_0036595 | 3300037418 | Bacteria | 5060 |
| 816 | Ga0395900_0390946 | 3300037418 | Bacteria | 1357 |
| 817 | Ga0395898_0012280 | 3300037466 | Bacteria | 8858 |
| 818 | Ga0395898_0020773 | 3300037466 | Bacteria | 6665 |
| 819 | Ga0395898_0031282 | 3300037466 | Bacteria | 5319 |
| 820 | Ga0395905_0005034 | 3300037471 | Bacteria | 13609 |
| 821 | Ga0395905_0125094 | 3300037471 | Bacteria | 2418 |
| 822 | Ga0436364_0101562 | 3300037853 | Bacteria | 7723 |
| 823 | Ga0436364_0214101 | 3300037853 | Bacteria | 833 |
| 824 | Ga0436364_0814306 | 3300037853 | Bacteria | 976 |
| 825 | Ga0395901_0042972 | 3300038443 | Bacteria | 4688 |
| 826 | Ga0395901_0077854 | 3300038443 | Bacteria | 3461 |
| 827 | Ga0395901_0430844 | 3300038443 | Bacteria | 1351 |
| 828 | Ga0436365_0751202 | 3300039437 | Bacteria | 840 |
| 829 | Ga0436365_0757494 | 3300039437 | Bacteria | 2546 |
| 830 | Ga0436365_1050534 | 3300039437 | Bacteria | 11907 |
| 831 | Ga0436365_1113004 | 3300039437 | Bacteria | 2265 |
| 832 | Ga0436365_1316409 | 3300039437 | Bacteria | 4050 |
| 833 | Ga0436365_1377083 | 3300039437 | Bacteria | 3569 |
| 834 | Ga0436365_1732811 | 3300039437 | Bacteria | 1196 |
| 835 | Ga0436365_1915185 | 3300039437 | Bacteria | 1175 |
| 836 | Ga0436360_0362794 | 3300039438 | Bacteria | 1072 |
| 837 | Ga0436360_0674534 | 3300039438 | Bacteria | 4355 |
| 838 | Ga0436361_0774376 | 3300039447 | Bacteria | 939 |
| 839 | Ga0436363_0472452 | 3300039450 | Bacteria | 2131 |
| 840 | Ga0436363_0486884 | 3300039450 | Bacteria | 1284 |
| 841 | Ga0436363_0823763 | 3300039450 | Bacteria | 7847 |
| 842 | Ga0436362_0713937 | 3300039453 | Bacteria | 8877 |
| 843 | Ga0451793_0637898 | 3300041452 | Bacteria | 730 |
| 844 | Ga0451800_0317729 | 3300041459 | Bacteria | 797 |
| 845 | Ga0451807_0379786 | 3300041486 | Bacteria | 1181 |
| 846 | Ga0451837_0000079 | 3300041494 | Bacteria | 1280 |
| 847 | Ga0450890_002431 | 3300042127 | Bacteria | 2564 |
| 848 | Ga0439446_0030138 | 3300042156 | Bacteria | 1568 |
| 849 | Ga0451577_0831056 | 3300042876 | Bacteria | 834 |
| 850 | Ga0466972_0000090 | 3300044658 | Bacteria | 82487 |
| 851 | Ga0466972_0022537 | 3300044658 | Bacteria | 3135 |
| 852 | Ga0466972_0174536 | 3300044658 | Bacteria | 1008 |
| 853 | Ga0466966_0002487 | 3300044684 | Bacteria | 12067 |
| 854 | Ga0466966_0288628 | 3300044684 | Bacteria | 986 |
| 855 | Ga0466961_0000081 | 3300044693 | Bacteria | 59450 |
| 856 | Ga0466963_0059425 | 3300044694 | Bacteria | 2552 |
| 857 | Ga0466963_0103431 | 3300044694 | Bacteria | 1951 |
| 858 | Ga0466964_0140411 | 3300044706 | Bacteria | 1110 |
| 859 | Ga0466971_0085562 | 3300044719 | Bacteria | 1441 |
| 860 | Ga0466957_0045181 | 3300044842 | Bacteria | 2671 |
| 861 | Ga0466959_0033379 | 3300045049 | Bacteria | 3806 |
| 862 | Ga0466967_0299724 | 3300045976 | Bacteria | 1546 |
| 863 | Ga0466967_0397999 | 3300045976 | Bacteria | 1339 |
| 864 | Ga0466967_0479546 | 3300045976 | Bacteria | 1218 |
| 865 | Ga0466967_0784865 | 3300045976 | Bacteria | 945 |
| 866 | Ga0495592_0003370 | 3300046454 | Bacteria | 11446 |
| 867 | Ga0495592_0027243 | 3300046454 | Bacteria | 4333 |
| 868 | Ga0495592_0068885 | 3300046454 | Bacteria | 2581 |
| 869 | Ga0495592_0165805 | 3300046454 | Bacteria | 1516 |
| 870 | Ga0495592_0166031 | 3300046454 | Bacteria | 1515 |
| 871 | Ga0495603_0009474 | 3300046455 | Bacteria | 5883 |
| 872 | Ga0495603_0135893 | 3300046455 | Bacteria | 1431 |
| 873 | Ga0495603_0139253 | 3300046455 | Bacteria | 1412 |
| 874 | Ga0495590_0041795 | 3300046457 | Bacteria | 1598 |
| 875 | Ga0495590_0089197 | 3300046457 | Bacteria | 1090 |
| 876 | Ga0495590_0098789 | 3300046457 | Bacteria | 1036 |
| 877 | Ga0495629_0000226 | 3300046459 | Bacteria | 50363 |
| 878 | Ga0495629_0018660 | 3300046459 | Bacteria | 4958 |
| 879 | Ga0495629_0036628 | 3300046459 | Bacteria | 3461 |
| 880 | Ga0495629_0156541 | 3300046459 | Bacteria | 1583 |
| 881 | Ga0495629_0243497 | 3300046459 | Bacteria | 1238 |
| 882 | Ga0495638_0010518 | 3300046460 | Bacteria | 6415 |
| 883 | Ga0495638_0012364 | 3300046460 | Bacteria | 5853 |
| 884 | Ga0495638_0135238 | 3300046460 | Bacteria | 1444 |
| 885 | Ga0495638_0231151 | 3300046460 | Bacteria | 1029 |
| 886 | Ga0495641_0001402 | 3300046461 | Bacteria | 20514 |
| 887 | Ga0495641_0022355 | 3300046461 | Bacteria | 3165 |
| 888 | Ga0495641_0075719 | 3300046461 | Bacteria | 1509 |
| 889 | Ga0495651_0011108 | 3300046462 | Bacteria | 6926 |
| 890 | Ga0495651_0012131 | 3300046462 | Bacteria | 6632 |
| 891 | Ga0495651_0013785 | 3300046462 | Bacteria | 6251 |
| 892 | Ga0495651_0019499 | 3300046462 | Bacteria | 5258 |
| 893 | Ga0495651_0021122 | 3300046462 | Bacteria | 5056 |
| 894 | Ga0495653_0125116 | 3300046463 | Bacteria | 1827 |
| 895 | Ga0495653_0199815 | 3300046463 | Bacteria | 1357 |
| 896 | Ga0495653_0350629 | 3300046463 | Bacteria | 949 |
| 897 | Ga0495650_0121346 | 3300046471 | Bacteria | 962 |
| 898 | Ga0495650_0123108 | 3300046471 | Bacteria | 953 |
| 899 | Ga0495580_0019535 | 3300046472 | Bacteria | 5034 |
| 900 | Ga0495580_0024592 | 3300046472 | Bacteria | 4406 |
| 901 | Ga0495582_0000106 | 3300046473 | Bacteria | 43588 |
| 902 | Ga0495605_0097459 | 3300046474 | Bacteria | 1355 |
| 903 | Ga0495605_0114083 | 3300046474 | Bacteria | 1230 |
| 904 | Ga0495639_0000170 | 3300046475 | Bacteria | 34055 |
| 905 | Ga0495639_0014214 | 3300046475 | Bacteria | 3445 |
| 906 | Ga0495639_0121414 | 3300046475 | Bacteria | 1247 |
| 907 | Ga0495662_0000901 | 3300046476 | Bacteria | 14514 |
| 908 | Ga0495662_0060425 | 3300046476 | Bacteria | 1830 |
| 909 | Ga0495664_0017874 | 3300046477 | Bacteria | 4055 |
| 910 | Ga0495664_0019572 | 3300046477 | Bacteria | 3894 |
| 911 | Ga0495664_0020424 | 3300046477 | Bacteria | 3820 |
| 912 | Ga0495664_0195945 | 3300046477 | Bacteria | 1225 |
| 913 | Ga0495584_0097453 | 3300046491 | Bacteria | 1485 |
| 914 | Ga0495584_0121322 | 3300046491 | Bacteria | 1324 |
| 915 | Ga0495584_0175040 | 3300046491 | Bacteria | 1091 |
| 916 | Ga0495584_0259743 | 3300046491 | Bacteria | 883 |
| 917 | Ga0495585_0060023 | 3300046492 | Bacteria | 2094 |
| 918 | Ga0495585_0172338 | 3300046492 | Bacteria | 1117 |
| 919 | Ga0495594_0000410 | 3300046499 | Bacteria | 21582 |
| 920 | Ga0495594_0071925 | 3300046499 | Bacteria | 1924 |
| 921 | Ga0495594_0103711 | 3300046499 | Bacteria | 1601 |
| 922 | Ga0495594_0185809 | 3300046499 | Bacteria | 1184 |
| 923 | Ga0495594_0202371 | 3300046499 | Bacteria | 1132 |
| 924 | Ga0495606_0039928 | 3300046507 | Bacteria | 3157 |
| 925 | Ga0495606_0126209 | 3300046507 | Bacteria | 1526 |
| 926 | Ga0495606_0131462 | 3300046507 | Bacteria | 1488 |
| 927 | Ga0495608_0010478 | 3300046511 | Bacteria | 6469 |
| 928 | Ga0495608_0039371 | 3300046511 | Bacteria | 3168 |
| 929 | Ga0495608_0117029 | 3300046511 | Bacteria | 1710 |
| 930 | Ga0495608_0266059 | 3300046511 | Bacteria | 1066 |
| 931 | Ga0495616_0053102 | 3300046513 | Bacteria | 2015 |
| 932 | Ga0495618_0198968 | 3300046514 | Bacteria | 1269 |
| 933 | Ga0495618_0240578 | 3300046514 | Bacteria | 1138 |
| 934 | Ga0495628_0034766 | 3300046516 | Bacteria | 4052 |
| 935 | Ga0495628_0048266 | 3300046516 | Bacteria | 3375 |
| 936 | Ga0495628_0062339 | 3300046516 | Bacteria | 2922 |
| 937 | Ga0495628_0065885 | 3300046516 | Bacteria | 2832 |
| 938 | Ga0495628_0124504 | 3300046516 | Bacteria | 1975 |
| 939 | Ga0495628_0142482 | 3300046516 | Bacteria | 1829 |
| 940 | Ga0495628_0252540 | 3300046516 | Bacteria | 1316 |
| 941 | Ga0495630_0002054 | 3300046517 | Bacteria | 14003 |
| 942 | Ga0495630_0003128 | 3300046517 | Bacteria | 11478 |
| 943 | Ga0495631_0129242 | 3300046518 | Bacteria | 1086 |
| 944 | Ga0495632_0041192 | 3300046519 | Bacteria | 2322 |
| 945 | Ga0495643_0020565 | 3300046522 | Bacteria | 3802 |
| 946 | Ga0495643_0309441 | 3300046522 | Bacteria | 717 |
| 947 | Ga0495648_0312185 | 3300046524 | Bacteria | 732 |
| 948 | Ga0495666_0034381 | 3300046526 | Bacteria | 2474 |
| 949 | Ga0495642_0041494 | 3300046528 | Bacteria | 1872 |
| 950 | Ga0495652_0024980 | 3300046529 | Bacteria | 5287 |
| 951 | Ga0495652_0075447 | 3300046529 | Bacteria | 2800 |
| 952 | Ga0495652_0090736 | 3300046529 | Bacteria | 2499 |
| 953 | Ga0495652_0128952 | 3300046529 | Bacteria | 2005 |
| 954 | Ga0495652_0238843 | 3300046529 | Bacteria | 1354 |
| 955 | Ga0495652_0266349 | 3300046529 | Bacteria | 1262 |
| 956 | Ga0495652_0460694 | 3300046529 | Bacteria | 888 |
| 957 | Ga0495665_0001435 | 3300046531 | Bacteria | 12785 |
| 958 | Ga0495665_0021219 | 3300046531 | Bacteria | 3489 |
| 959 | Ga0495665_0025497 | 3300046531 | Bacteria | 3176 |
| 960 | Ga0495665_0174022 | 3300046531 | Bacteria | 1120 |
| 961 | Ga0495640_0001153 | 3300046533 | Bacteria | 20655 |
| 962 | Ga0495640_0014225 | 3300046533 | Bacteria | 6030 |
| 963 | Ga0495640_0021578 | 3300046533 | Bacteria | 4725 |
| 964 | Ga0495640_0028306 | 3300046533 | Bacteria | 4036 |
| 965 | Ga0495640_0043972 | 3300046533 | Bacteria | 3107 |
| 966 | Ga0495640_0061392 | 3300046533 | Bacteria | 2553 |
| 967 | Ga0495640_0091895 | 3300046533 | Bacteria | 2002 |
| 968 | Ga0495586_0006037 | 3300046535 | Bacteria | 6476 |
| 969 | Ga0495586_0089167 | 3300046535 | Bacteria | 1702 |
| 970 | Ga0495586_0307023 | 3300046535 | Bacteria | 909 |
| 971 | Ga0495587_0044282 | 3300046536 | Bacteria | 2647 |
| 972 | Ga0495587_0165677 | 3300046536 | Bacteria | 1256 |
| 973 | Ga0495621_0025902 | 3300046539 | Bacteria | 1974 |
| 974 | Ga0495597_0073434 | 3300046542 | Bacteria | 1470 |
| 975 | Ga0495597_0145087 | 3300046542 | Bacteria | 977 |
| 976 | Ga0495645_0007549 | 3300046543 | Bacteria | 7564 |
| 977 | Ga0495645_0010186 | 3300046543 | Bacteria | 6586 |
| 978 | Ga0495645_0012442 | 3300046543 | Bacteria | 5997 |
| 979 | Ga0495645_0035959 | 3300046543 | Bacteria | 3611 |
| 980 | Ga0495645_0055187 | 3300046543 | Bacteria | 2885 |
| 981 | Ga0495622_0002206 | 3300046557 | Bacteria | 9495 |
| 982 | Ga0495622_0086870 | 3300046557 | Bacteria | 1438 |
| 983 | Ga0495622_0300562 | 3300046557 | Bacteria | 699 |
| 984 | Ga0495633_0123301 | 3300046558 | Bacteria | 1200 |
| 985 | Ga0495667_0021690 | 3300046559 | Bacteria | 4334 |
| 986 | Ga0495667_0044847 | 3300046559 | Bacteria | 2928 |
| 987 | Ga0495667_0055246 | 3300046559 | Bacteria | 2611 |
| 988 | Ga0495656_0059118 | 3300046615 | Bacteria | 1666 |
| 989 | Ga0495656_0092628 | 3300046615 | Bacteria | 1384 |
| 990 | Ga0495656_0412453 | 3300046615 | Bacteria | 708 |
| 991 | Ga0495668_0234909 | 3300046616 | Bacteria | 1004 |
| 992 | Ga0495668_0239031 | 3300046616 | Bacteria | 994 |
| 993 | Ga0495634_0001983 | 3300046642 | Bacteria | 17430 |
| 994 | Ga0495634_0151465 | 3300046642 | Bacteria | 1467 |
| 995 | Ga0495634_0220325 | 3300046642 | Bacteria | 1171 |
| 996 | Ga0495634_0270931 | 3300046642 | Bacteria | 1033 |
| 997 | Ga0495625_0035865 | 3300046660 | Bacteria | 3651 |
| 998 | Ga0495625_0142804 | 3300046660 | Bacteria | 1614 |
| 999 | Ga0495625_0433559 | 3300046660 | Bacteria | 815 |
| 1000 | Ga0495635_0000551 | 3300046663 | Bacteria | 23870 |
| 1001 | Ga0495635_0000794 | 3300046663 | Bacteria | 20607 |
| 1002 | Ga0495635_0011793 | 3300046663 | Bacteria | 6128 |
| 1003 | Ga0495635_0117210 | 3300046663 | Bacteria | 1817 |
| 1004 | Ga0495635_0118079 | 3300046663 | Bacteria | 1810 |
| 1005 | Ga0495635_0154987 | 3300046663 | Bacteria | 1559 |
| 1006 | Ga0495659_0010438 | 3300046664 | Bacteria | 2979 |
| 1007 | Ga0495659_0107646 | 3300046664 | Bacteria | 1086 |
| 1008 | Ga0495661_0113850 | 3300046665 | Bacteria | 1504 |
| 1009 | Ga0495657_0001697 | 3300046675 | Bacteria | 18874 |
| 1010 | Ga0495657_0010679 | 3300046675 | Bacteria | 6904 |
| 1011 | Ga0495657_0014502 | 3300046675 | Bacteria | 5783 |
| 1012 | Ga0495599_0000991 | 3300046678 | Bacteria | 15920 |
| 1013 | Ga0495599_0001294 | 3300046678 | Bacteria | 14210 |
| 1014 | Ga0495599_0005248 | 3300046678 | Bacteria | 7730 |
| 1015 | Ga0495599_0048745 | 3300046678 | Bacteria | 2655 |
| 1016 | Ga0495599_0445237 | 3300046678 | Bacteria | 767 |
| 1017 | Ga0495623_0008013 | 3300046679 | Bacteria | 6865 |
| 1018 | Ga0495623_0075818 | 3300046679 | Bacteria | 2087 |
| 1019 | Ga0495646_0018652 | 3300046680 | Bacteria | 4393 |
| 1020 | Ga0495646_0155273 | 3300046680 | Bacteria | 1270 |
| 1021 | Ga0495646_0318109 | 3300046680 | Bacteria | 820 |
| 1022 | Ga0495647_0000487 | 3300046681 | Bacteria | 11563 |
| 1023 | Ga0495647_0058022 | 3300046681 | Bacteria | 1520 |
| 1024 | Ga0495647_0059450 | 3300046681 | Bacteria | 1505 |
| 1025 | Ga0495658_0018960 | 3300046683 | Bacteria | 3585 |
| 1026 | Ga0495669_0038533 | 3300046684 | Bacteria | 2117 |
| 1027 | Ga0495613_0009914 | 3300046689 | Bacteria | 7083 |
| 1028 | Ga0495613_0012442 | 3300046689 | Bacteria | 6323 |
| 1029 | Ga0495613_0024790 | 3300046689 | Bacteria | 4470 |
| 1030 | Ga0495613_0039795 | 3300046689 | Bacteria | 3484 |
| 1031 | Ga0495613_0287016 | 3300046689 | Bacteria | 1141 |
| 1032 | Ga0495613_0292150 | 3300046689 | Bacteria | 1130 |
| 1033 | Ga0495624_0009177 | 3300046690 | Bacteria | 6858 |
| 1034 | Ga0495624_0074184 | 3300046690 | Bacteria | 2114 |
| 1035 | Ga0495624_0103271 | 3300046690 | Bacteria | 1754 |
| 1036 | Ga0495624_0161541 | 3300046690 | Bacteria | 1368 |
| 1037 | Ga0495624_0224829 | 3300046690 | Bacteria | 1138 |
| 1038 | Ga0495624_0466601 | 3300046690 | Bacteria | 756 |
| 1039 | Ga0495649_0004829 | 3300046694 | Bacteria | 8721 |
| 1040 | Ga0495600_0044747 | 3300046809 | Bacteria | 2887 |
| 1041 | Ga0495600_0106410 | 3300046809 | Bacteria | 1827 |
| 1042 | Ga0495600_0336289 | 3300046809 | Bacteria | 947 |
| 1043 | Ga0495600_0427951 | 3300046809 | Bacteria | 821 |
| 1044 | Ga0495660_0190467 | 3300046810 | Bacteria | 986 |
| 1045 | Ga0495581_0000010 | 3300047315 | Bacteria | 64779 |
| 1046 | Ga0495581_0014969 | 3300047315 | Bacteria | 4500 |
| 1047 | Ga0495581_0024470 | 3300047315 | Bacteria | 3499 |
| 1048 | Ga0495604_0003777 | 3300047317 | Bacteria | 12054 |
| 1049 | Ga0495604_0010950 | 3300047317 | Bacteria | 7199 |
| 1050 | Ga0495604_0037419 | 3300047317 | Bacteria | 3821 |
| 1051 | Ga0495604_0047723 | 3300047317 | Bacteria | 3334 |
| 1052 | Ga0495604_0172676 | 3300047317 | Bacteria | 1518 |
| 1053 | Ga0495636_0240436 | 3300047318 | Bacteria | 835 |
| 1054 | Ga0495674_0000082 | 3300047319 | Bacteria | 65609 |
| 1055 | Ga0495674_0001491 | 3300047319 | Bacteria | 22945 |
| 1056 | Ga0495674_0036604 | 3300047319 | Bacteria | 4416 |
| 1057 | Ga0495674_0073409 | 3300047319 | Bacteria | 2949 |
| 1058 | Ga0495674_0206208 | 3300047319 | Bacteria | 1629 |
| 1059 | Ga0495672_0022035 | 3300047320 | Bacteria | 4147 |
| 1060 | Ga0495672_0114834 | 3300047320 | Bacteria | 1440 |
| 1061 | Ga0495676_0114381 | 3300047321 | Bacteria | 1974 |
| 1062 | Ga0495676_0130801 | 3300047321 | Bacteria | 1812 |
| 1063 | Ga0495680_0002698 | 3300047322 | Bacteria | 17916 |
| 1064 | Ga0495680_0014505 | 3300047322 | Bacteria | 6820 |
| 1065 | Ga0495680_0173431 | 3300047322 | Bacteria | 1560 |
| 1066 | Ga0495680_0296230 | 3300047322 | Bacteria | 1137 |
| 1067 | Ga0495680_0399496 | 3300047322 | Bacteria | 949 |
| 1068 | Ga0495683_0083409 | 3300047323 | Bacteria | 1556 |
| 1069 | Ga0495687_041243 | 3300047443 | Bacteria | 2026 |
| 1070 | Ga0495687_044725 | 3300047443 | Bacteria | 1922 |
| 1071 | Ga0495675_0004242 | 3300047444 | Bacteria | 8666 |
| 1072 | Ga0495675_0039121 | 3300047444 | Bacteria | 3020 |
| 1073 | Ga0495679_066436 | 3300047446 | Bacteria | 1047 |
| 1074 | Ga0495673_0108674 | 3300047469 | Bacteria | 1112 |
| 1075 | Ga0495684_0004100 | 3300047471 | Bacteria | 11375 |
| 1076 | Ga0495684_0023587 | 3300047471 | Bacteria | 4730 |
| 1077 | Ga0495684_0050325 | 3300047471 | Bacteria | 3182 |
| 1078 | Ga0495684_0060049 | 3300047471 | Bacteria | 2895 |
| 1079 | Ga0495686_0062203 | 3300047472 | Bacteria | 2316 |
| 1080 | Ga0495593_0000986 | 3300047673 | Bacteria | 16708 |
| 1081 | Ga0495593_0071820 | 3300047673 | Bacteria | 1797 |
| 1082 | Ga0495615_0060495 | 3300048090 | Bacteria | 998 |
| 1083 | Ga0496100_0004736 | 3300048903 | Bacteria | 7255 |
| 1084 | Ga0496100_0131686 | 3300048903 | Bacteria | 1762 |
| 1085 | Ga0496100_0166632 | 3300048903 | Bacteria | 1583 |
| 1086 | Ga0496100_0639256 | 3300048903 | Bacteria | 828 |
| 1087 | Ga0496101_0043827 | 3300048904 | Bacteria | 3199 |
| 1088 | Ga0496101_0146555 | 3300048904 | Bacteria | 1803 |
| 1089 | Ga0496101_0156660 | 3300048904 | Bacteria | 1745 |
| 1090 | Ga0496102_0094756 | 3300048905 | Bacteria | 2766 |
| 1091 | Ga0496102_0156122 | 3300048905 | Bacteria | 2145 |
| 1092 | Ga0496102_0221798 | 3300048905 | Bacteria | 1782 |
| 1093 | Ga0496102_0303013 | 3300048905 | Bacteria | 1506 |
| 1094 | Ga0496102_0313425 | 3300048905 | Bacteria | 1478 |
| 1095 | Ga0496102_0321875 | 3300048905 | Bacteria | 1457 |
| 1096 | Ga0496102_1156005 | 3300048905 | Bacteria | 694 |
| 1097 | Ga0496103_0107858 | 3300048906 | Bacteria | 1767 |
| 1098 | Ga0496103_0241844 | 3300048906 | Bacteria | 1161 |
| 1099 | Ga0496104_0012536 | 3300048907 | Bacteria | 7626 |
| 1100 | Ga0496104_0041518 | 3300048907 | Bacteria | 4314 |
| 1101 | Ga0496104_0074952 | 3300048907 | Bacteria | 3221 |
| 1102 | Ga0496104_0094161 | 3300048907 | Bacteria | 2865 |
| 1103 | Ga0496104_0121347 | 3300048907 | Bacteria | 2509 |
| 1104 | Ga0496104_0169645 | 3300048907 | Bacteria | 2092 |
| 1105 | Ga0496104_0228325 | 3300048907 | Bacteria | 1774 |
| 1106 | Ga0496104_0672697 | 3300048907 | Bacteria | 943 |
| 1107 | Ga0496105_0003866 | 3300048908 | Bacteria | 11194 |
| 1108 | Ga0496105_0031344 | 3300048908 | Bacteria | 4358 |
| 1109 | Ga0496105_0167629 | 3300048908 | Bacteria | 1801 |
| 1110 | Ga0496105_0464855 | 3300048908 | Bacteria | 997 |
| 1111 | Ga0496106_0002192 | 3300048909 | Bacteria | 14600 |
| 1112 | Ga0496106_0007842 | 3300048909 | Bacteria | 7902 |
| 1113 | Ga0496106_0117538 | 3300048909 | Bacteria | 2075 |
| 1114 | Ga0496106_0146330 | 3300048909 | Bacteria | 1861 |
| 1115 | Ga0496106_0551945 | 3300048909 | Bacteria | 924 |
| 1116 | Ga0496106_0819991 | 3300048909 | Bacteria | 737 |
| 1117 | Ga0496107_0006208 | 3300048910 | Bacteria | 8212 |
| 1118 | Ga0496107_0070725 | 3300048910 | Bacteria | 2534 |
| 1119 | Ga0496107_0085807 | 3300048910 | Bacteria | 2297 |
| 1120 | Ga0496107_0094596 | 3300048910 | Bacteria | 2186 |
| 1121 | Ga0496108_0033321 | 3300048911 | Bacteria | 4280 |
| 1122 | Ga0496108_0046989 | 3300048911 | Bacteria | 3608 |
| 1123 | Ga0496108_0176014 | 3300048911 | Bacteria | 1852 |
| 1124 | Ga0496108_0314549 | 3300048911 | Bacteria | 1365 |
| 1125 | Ga0496108_0414491 | 3300048911 | Bacteria | 1176 |
| 1126 | Ga0496108_0512203 | 3300048911 | Bacteria | 1048 |
| 1127 | Ga0496108_0787428 | 3300048911 | Bacteria | 821 |
| 1128 | Ga0496109_0000958 | 3300048912 | Bacteria | 23843 |
| 1129 | Ga0496109_0080371 | 3300048912 | Bacteria | 3003 |
| 1130 | Ga0496109_0170853 | 3300048912 | Bacteria | 2039 |
| 1131 | Ga0496109_0274367 | 3300048912 | Bacteria | 1589 |
| 1132 | Ga0496109_0793725 | 3300048912 | Bacteria | 885 |
| 1133 | Ga0496110_0024058 | 3300048913 | Bacteria | 5189 |
| 1134 | Ga0496111_0026562 | 3300048914 | Bacteria | 4089 |
| 1135 | Ga0496111_0054052 | 3300048914 | Bacteria | 2902 |
| 1136 | Ga0496111_0077043 | 3300048914 | Bacteria | 2431 |
| 1137 | Ga0496111_0095184 | 3300048914 | Bacteria | 2185 |
| 1138 | Ga0496112_0008372 | 3300048915 | Bacteria | 9263 |
| 1139 | Ga0496112_0024283 | 3300048915 | Bacteria | 5802 |
| 1140 | Ga0496112_0030971 | 3300048915 | Bacteria | 5183 |
| 1141 | Ga0496112_0090356 | 3300048915 | Bacteria | 3031 |
| 1142 | Ga0496112_0236383 | 3300048915 | Bacteria | 1781 |
| 1143 | Ga0496112_0273390 | 3300048915 | Bacteria | 1637 |
| 1144 | Ga0496112_0632997 | 3300048915 | Bacteria | 1000 |
| 1145 | Ga0496113_0009951 | 3300048916 | Bacteria | 6266 |
| 1146 | Ga0496113_0016793 | 3300048916 | Bacteria | 5064 |
| 1147 | Ga0496113_0024585 | 3300048916 | Bacteria | 4283 |
| 1148 | Ga0496113_0057462 | 3300048916 | Bacteria | 2924 |
| 1149 | Ga0496113_0289787 | 3300048916 | Bacteria | 1309 |
| 1150 | Ga0496113_0735865 | 3300048916 | Bacteria | 786 |
| 1151 | Ga0496114_0042126 | 3300048917 | Bacteria | 3783 |
| 1152 | Ga0496114_0102072 | 3300048917 | Bacteria | 2450 |
| 1153 | Ga0496115_0157497 | 3300048918 | Bacteria | 1876 |
| 1154 | Ga0496115_0529526 | 3300048918 | Bacteria | 944 |
| 1155 | Ga0496117_0040854 | 3300048920 | Bacteria | 3406 |
| 1156 | Ga0496117_0102683 | 3300048920 | Bacteria | 1804 |
| 1157 | Ga0496118_0021563 | 3300048921 | Bacteria | 5665 |
| 1158 | Ga0496118_0023025 | 3300048921 | Bacteria | 5424 |
| 1159 | Ga0496119_0013564 | 3300048922 | Bacteria | 6475 |
| 1160 | Ga0496119_0052365 | 3300048922 | Bacteria | 2500 |
| 1161 | Ga0496119_0224084 | 3300048922 | Bacteria | 961 |
| 1162 | Ga0496119_0228825 | 3300048922 | Bacteria | 948 |
| 1163 | Ga0496119_0272337 | 3300048922 | Bacteria | 845 |
| 1164 | Ga0496120_0034276 | 3300048923 | Bacteria | 3043 |
| 1165 | Ga0496121_0000461 | 3300048924 | Bacteria | 79954 |
| 1166 | Ga0496121_0000476 | 3300048924 | Bacteria | 78015 |
| 1167 | Ga0496121_0005046 | 3300048924 | Bacteria | 17245 |
| 1168 | Ga0496121_0006583 | 3300048924 | Bacteria | 14331 |
| 1169 | Ga0496121_0112781 | 3300048924 | Bacteria | 2070 |
| 1170 | Ga0496121_0160194 | 3300048924 | Bacteria | 1646 |
| 1171 | Ga0496121_0182896 | 3300048924 | Bacteria | 1510 |
| 1172 | Ga0496121_0510984 | 3300048924 | Bacteria | 760 |
| 1173 | Ga0496122_0133344 | 3300048925 | Bacteria | 1572 |
| 1174 | Ga0496124_0007605 | 3300048927 | Bacteria | 11486 |
| 1175 | Ga0496124_0036185 | 3300048927 | Bacteria | 4310 |
| 1176 | Ga0496125_0119465 | 3300048928 | Bacteria | 1885 |
| 1177 | Ga0496125_0149755 | 3300048928 | Bacteria | 1605 |
| 1178 | Ga0496125_0217837 | 3300048928 | Bacteria | 1233 |
| 1179 | Ga0496125_0296277 | 3300048928 | Bacteria | 993 |
| 1180 | Ga0496126_0004139 | 3300048929 | Bacteria | 17539 |
| 1181 | Ga0496126_0011296 | 3300048929 | Bacteria | 9264 |
| 1182 | Ga0496126_0014548 | 3300048929 | Bacteria | 7948 |
| 1183 | Ga0496126_0024714 | 3300048929 | Bacteria | 5796 |
| 1184 | Ga0496126_0097468 | 3300048929 | Bacteria | 2577 |
| 1185 | Ga0496126_0097534 | 3300048929 | Bacteria | 2576 |
| 1186 | Ga0496126_0125191 | 3300048929 | Bacteria | 2225 |
| 1187 | Ga0496126_0323320 | 3300048929 | Bacteria | 1267 |
| 1188 | Ga0496126_0353480 | 3300048929 | Bacteria | 1201 |
| 1189 | Ga0496126_0367643 | 3300048929 | Bacteria | 1173 |
| 1190 | Ga0496126_0805463 | 3300048929 | Bacteria | 720 |
| 1191 | Ga0495678_135213 | 3300049459 | Bacteria | 813 |
| 1192 | Ga0501031_0575769 | 3300049568 | Bacteria | 725 |
| 1193 | Ga0501032_0001484 | 3300049569 | Bacteria | 18715 |
| 1194 | Ga0501032_0004833 | 3300049569 | Bacteria | 10101 |
| 1195 | Ga0501033_0002476 | 3300049570 | Bacteria | 15652 |
| 1196 | Ga0501033_0009580 | 3300049570 | Bacteria | 7451 |
| 1197 | Ga0501034_0000955 | 3300049571 | Bacteria | 41785 |
| 1198 | Ga0501034_0006672 | 3300049571 | Bacteria | 12378 |
| 1199 | Ga0501036_0001778 | 3300049572 | Bacteria | 16732 |
| 1200 | Ga0501036_0302526 | 3300049572 | Bacteria | 1337 |
| 1201 | Ga0501037_0000374 | 3300049573 | Bacteria | 37235 |
| 1202 | Ga0501037_0004631 | 3300049573 | Bacteria | 9997 |
| 1203 | Ga0501038_0013942 | 3300049574 | Bacteria | 7325 |
| 1204 | Ga0501038_0053706 | 3300049574 | Bacteria | 3467 |
| 1205 | Ga0501039_0013178 | 3300049575 | Bacteria | 6319 |
| 1206 | Ga0501039_0030505 | 3300049575 | Bacteria | 4157 |
| 1207 | Ga0501041_0057297 | 3300049577 | Bacteria | 2383 |
| 1208 | Ga0501041_0255008 | 3300049577 | Bacteria | 1103 |
| 1209 | Ga0501041_0456195 | 3300049577 | Bacteria | 812 |
| 1210 | Ga0501043_0000932 | 3300049579 | Bacteria | 25912 |
| 1211 | Ga0501043_0012177 | 3300049579 | Bacteria | 6722 |
| 1212 | Ga0501046_0020537 | 3300049580 | Bacteria | 5460 |
| 1213 | Ga0501046_0030167 | 3300049580 | Bacteria | 4402 |
| 1214 | Ga0501047_0003152 | 3300049581 | Bacteria | 15642 |
| 1215 | Ga0501047_0050929 | 3300049581 | Bacteria | 3999 |
| 1216 | Ga0501048_0022290 | 3300049582 | Bacteria | 4634 |
| 1217 | Ga0501048_0317315 | 3300049582 | Bacteria | 1110 |
| 1218 | Ga0501068_0019232 | 3300049584 | Bacteria | 3963 |
| 1219 | Ga0501068_0244784 | 3300049584 | Bacteria | 1142 |
| 1220 | Ga0501069_0029303 | 3300049585 | Bacteria | 3021 |
| 1221 | Ga0501070_0032912 | 3300049586 | Bacteria | 4336 |
| 1222 | Ga0501070_0129945 | 3300049586 | Bacteria | 2081 |
| 1223 | Ga0501070_0981546 | 3300049586 | Bacteria | 656 |
| 1224 | Ga0501071_0286668 | 3300049587 | Bacteria | 1247 |
| 1225 | Ga0501071_0314336 | 3300049587 | Bacteria | 1189 |
| 1226 | Ga0501071_0579914 | 3300049587 | Bacteria | 862 |
| 1227 | Ga0501072_0008393 | 3300049588 | Bacteria | 7841 |
| 1228 | Ga0501073_0002378 | 3300049589 | Bacteria | 14090 |
| 1229 | Ga0501074_0054841 | 3300049590 | Bacteria | 2874 |
| 1230 | Ga0501074_0119673 | 3300049590 | Bacteria | 1883 |
| 1231 | Ga0501075_0011346 | 3300049591 | Bacteria | 6306 |
| 1232 | Ga0501076_0556463 | 3300049592 | Bacteria | 946 |
| 1233 | Ga0501079_0013407 | 3300049741 | Bacteria | 6252 |
| 1234 | Ga0501079_0015285 | 3300049741 | Bacteria | 5855 |
| 1235 | Ga0501080_0002661 | 3300049742 | Bacteria | 15625 |
| 1236 | Ga0501080_0043997 | 3300049742 | Bacteria | 4157 |
| 1237 | Ga0501080_0136654 | 3300049742 | Bacteria | 2268 |
| 1238 | Ga0501081_0001519 | 3300049743 | Bacteria | 14264 |
| 1239 | Ga0501081_0821944 | 3300049743 | Bacteria | 700 |
| 1240 | Ga0501083_0078315 | 3300049744 | Bacteria | 2193 |
| 1241 | Ga0501083_0096022 | 3300049744 | Bacteria | 1956 |
| 1242 | Ga0501083_0151019 | 3300049744 | Bacteria | 1521 |
| 1243 | Ga0501035_0038248 | 3300049822 | Bacteria | 4345 |
| 1244 | Ga0501035_0430917 | 3300049822 | Bacteria | 1093 |
| 1245 | Ga0501044_0000315 | 3300049823 | Bacteria | 61159 |
| 1246 | Ga0501044_0039486 | 3300049823 | Bacteria | 4924 |
| 1247 | Ga0501044_0041106 | 3300049823 | Bacteria | 4814 |
| 1248 | Ga0501044_0103974 | 3300049823 | Bacteria | 2854 |
| 1249 | Ga0501044_1161440 | 3300049823 | Bacteria | 640 |
| 1250 | Ga0501045_0069136 | 3300049824 | Bacteria | 2596 |
| 1251 | nmdc:mga03683_129219_c1 | 3300050489 | Bacteria | 1129 |
| 1252 | nmdc:mga03683_28017_c2 | 3300050489 | Bacteria | 1564 |
| 1253 | nmdc:mga03683_284384_c1 | 3300050489 | Bacteria | 773 |
| 1254 | nmdc:mga03683_47499_c1 | 3300050489 | Bacteria | 1781 |
| 1255 | nmdc:mga03683_48622_c1 | 3300050489 | Bacteria | 1135 |
| 1256 | nmdc:mga03683_81960_c1 | 3300050489 | Bacteria | 1394 |
| 1257 | nmdc:mga03683_88489_c1 | 3300050489 | Bacteria | 1347 |
| 1258 | nmdc:mga03n38_34354_c1 | 3300050490 | Bacteria | 2165 |
| 1259 | nmdc:mga03n38_371785_c1 | 3300050490 | Bacteria | 782 |
| 1260 | nmdc:mga03n38_89347_c1 | 3300050490 | Bacteria | 1463 |
| 1261 | nmdc:mga03n38_9411_c1 | 3300050490 | Bacteria | 3555 |
| 1262 | nmdc:mga00v17_137207_c1 | 3300050491 | Bacteria | 1567 |
| 1263 | nmdc:mga00v17_189332_c1 | 3300050491 | Bacteria | 1329 |
| 1264 | nmdc:mga00v17_311526_c1 | 3300050491 | Bacteria | 1023 |
| 1265 | nmdc:mga00v17_399062_c1 | 3300050491 | Bacteria | 894 |
| 1266 | nmdc:mga00v17_64127_c1 | 3300050491 | Bacteria | 2264 |
| 1267 | nmdc:mga0yw44_14964_c1 | 3300050492 | Bacteria | 4140 |
| 1268 | nmdc:mga0yw44_404972_c1 | 3300050492 | Bacteria | 923 |
| 1269 | nmdc:mga0yw44_431629_c1 | 3300050492 | Bacteria | 892 |
| 1270 | nmdc:mga0yw44_50039_c1 | 3300050492 | Bacteria | 2525 |
| 1271 | nmdc:mga0yw44_61226_c1 | 3300050492 | Bacteria | 2308 |
| 1272 | nmdc:mga0yw44_63502_c1 | 3300050492 | Bacteria | 2271 |
| 1273 | nmdc:mga0yw44_646546_c1 | 3300050492 | Bacteria | 719 |
| 1274 | nmdc:mga0k408_131832_c1 | 3300050493 | Bacteria | 1484 |
| 1275 | nmdc:mga0k408_141786_c1 | 3300050493 | Bacteria | 1430 |
| 1276 | nmdc:mga0k408_185742_c1 | 3300050493 | Bacteria | 1240 |
| 1277 | nmdc:mga0k408_224347_c1 | 3300050493 | Bacteria | 1122 |
| 1278 | nmdc:mga0k408_25826_c1 | 3300050493 | Bacteria | 3329 |
| 1279 | nmdc:mga0k408_35346_c1 | 3300050493 | Bacteria | 2866 |
| 1280 | nmdc:mga0k408_38466_c2 | 3300050493 | Bacteria | 1554 |
| 1281 | nmdc:mga0k408_38889_c1 | 3300050493 | Bacteria | 2731 |
| 1282 | nmdc:mga0k408_52488_c1 | 3300050493 | Bacteria | 2363 |
| 1283 | nmdc:mga0k408_5474_c1 | 3300050493 | Bacteria | 6759 |
| 1284 | nmdc:mga0k408_72072_c1 | 3300050493 | Bacteria | 2017 |
| 1285 | nmdc:mga06z11_115797_c1 | 3300050494 | Bacteria | 1490 |
| 1286 | nmdc:mga06z11_117534_c1 | 3300050494 | Bacteria | 1480 |
| 1287 | nmdc:mga06z11_117607_c1 | 3300050494 | Bacteria | 1480 |
| 1288 | nmdc:mga06z11_224978_c1 | 3300050494 | Bacteria | 1098 |
| 1289 | nmdc:mga06z11_307641_c1 | 3300050494 | Bacteria | 943 |
| 1290 | nmdc:mga06z11_327381_c1 | 3300050494 | Bacteria | 915 |
| 1291 | nmdc:mga06z11_48647_c1 | 3300050494 | Bacteria | 2159 |
| 1292 | nmdc:mga06z11_515372_c1 | 3300050494 | Bacteria | 725 |
| 1293 | nmdc:mga04h51_3096_c1 | 3300050495 | Bacteria | 4013 |
| 1294 | nmdc:mga04h51_4452_c1 | 3300050495 | Bacteria | 3487 |
| 1295 | nmdc:mga04h51_46049_c1 | 3300050495 | Bacteria | 1444 |
| 1296 | nmdc:mga04h51_79306_c1 | 3300050495 | Bacteria | 1162 |
| 1297 | nmdc:mga07m45_109775_c1 | 3300050496 | Bacteria | 1588 |
| 1298 | nmdc:mga07m45_113357_c1 | 3300050496 | Bacteria | 1563 |
| 1299 | nmdc:mga07m45_151879_c1 | 3300050496 | Bacteria | 1343 |
| 1300 | nmdc:mga07m45_152399_c1 | 3300050496 | Bacteria | 1341 |
| 1301 | nmdc:mga07m45_157768_c1 | 3300050496 | Bacteria | 1317 |
| 1302 | nmdc:mga07m45_170535_c1 | 3300050496 | Bacteria | 1265 |
| 1303 | nmdc:mga07m45_186013_c1 | 3300050496 | Bacteria | 1208 |
| 1304 | nmdc:mga07m45_278720_c1 | 3300050496 | Bacteria | 973 |
| 1305 | nmdc:mga07m45_29312_c1 | 3300050496 | Bacteria | 3042 |
| 1306 | nmdc:mga07m45_36869_c1 | 3300050496 | Bacteria | 2257 |
| 1307 | nmdc:mga07m45_457628_c1 | 3300050496 | Bacteria | 740 |
| 1308 | nmdc:mga07m45_56539_c1 | 3300050496 | Bacteria | 2218 |
| 1309 | nmdc:mga05p37_306830_c1 | 3300050507 | Bacteria | 1883 |
| 1310 | nmdc:mga09592_192242_c1 | 3300050508 | Bacteria | 1766 |
| 1311 | nmdc:mga09592_37295_c1 | 3300050508 | Bacteria | 4077 |
| 1312 | nmdc:mga0qj67_21919_c1 | 3300050509 | Bacteria | 4902 |
| 1313 | nmdc:mga0qj67_221_c1 | 3300050509 | Bacteria | 38873 |
| 1314 | nmdc:mga06r32_1124255_c1 | 3300050510 | Bacteria | 734 |
| 1315 | nmdc:mga06r32_20596_c1 | 3300050510 | Bacteria | 6074 |
| 1316 | nmdc:mga06r32_6177_c1 | 3300050510 | Bacteria | 10758 |
| 1317 | nmdc:mga06r32_93225_c1 | 3300050510 | Bacteria | 2945 |
| 1318 | nmdc:mga06r32_9721_c1 | 3300050510 | Bacteria | 8687 |
| 1319 | nmdc:mga08y16_661709_c1 | 3300050511 | Bacteria | 1047 |
| 1320 | nmdc:mga0n895_178880_c1 | 3300050512 | Bacteria | 2152 |
| 1321 | nmdc:mga0n895_289793_c1 | 3300050512 | Bacteria | 1660 |
| 1322 | nmdc:mga0rr50_562965_c1 | 3300050513 | Bacteria | 971 |
| 1323 | nmdc:mga0rr50_73454_c1 | 3300050513 | Bacteria | 2615 |
| 1324 | nmdc:mga0rr50_93385_c2 | 3300050513 | Bacteria | 1727 |
| 1325 | nmdc:mga08x19_339798_c1 | 3300050514 | Bacteria | 1047 |
| 1326 | nmdc:mga08x19_61833_c1 | 3300050514 | Bacteria | 2427 |
| 1327 | nmdc:mga0a205_537113_c1 | 3300050515 | Bacteria | 1025 |
| 1328 | nmdc:mga0sz30_103612_c1 | 3300050516 | Bacteria | 1244 |
| 1329 | nmdc:mga0sz30_21351_c2 | 3300050516 | Bacteria | 2212 |
| 1330 | nmdc:mga0sz30_40305_c1 | 3300050516 | Bacteria | 1963 |
| 1331 | nmdc:mga0sz30_7895_c2 | 3300050516 | Bacteria | 919 |
| 1332 | Ga0495601_0004169 | 3300053077 | Bacteria | 8335 |
| 1333 | Ga0495601_0031180 | 3300053077 | Bacteria | 3313 |
| 1334 | Ga0495601_0130804 | 3300053077 | Bacteria | 1634 |
| 1335 | Ga0495601_0145255 | 3300053077 | Bacteria | 1548 |
| 1336 | Ga0495601_0279227 | 3300053077 | Bacteria | 1089 |
| 1337 | Ga0495612_0007486 | 3300053078 | Bacteria | 4462 |
| 1338 | Ga0495612_0057089 | 3300053078 | Bacteria | 1612 |
| 1339 | Ga0495612_0108673 | 3300053078 | Bacteria | 1185 |
| 1340 | Ga0500610_0187823 | 3300053079 | Bacteria | 1006 |
| 1341 | Ga0500635_0002501 | 3300053080 | Bacteria | 4563 |
| 1342 | Ga0495655_0167879 | 3300053083 | Bacteria | 701 |
| 1343 | Ga0495595_0002260 | 3300053084 | Bacteria | 7497 |
| 1344 | Ga0495619_0081533 | 3300053085 | Bacteria | 2178 |
| 1345 | Ga0495619_0091836 | 3300053085 | Bacteria | 2056 |
| 1346 | Ga0495619_0212192 | 3300053085 | Bacteria | 1341 |
| 1347 | Ga0495619_0310818 | 3300053085 | Bacteria | 1091 |
| 1348 | Ga0495619_0325119 | 3300053085 | Bacteria | 1064 |
| 1349 | Ga0500578_0220309 | 3300053086 | Bacteria | 1154 |
| 1350 | Ga0500578_0230641 | 3300053086 | Bacteria | 1122 |
| 1351 | Ga0500643_000057 | 3300053087 | Bacteria | 131401 |
| 1352 | Ga0500643_052426 | 3300053087 | Bacteria | 1163 |
| 1353 | Ga0500644_0028954 | 3300053088 | Bacteria | 1737 |
| 1354 | Ga0500646_0000154 | 3300053090 | Bacteria | 20271 |
| 1355 | Ga0500647_0006967 | 3300053091 | Bacteria | 4820 |
| 1356 | Ga0500647_0193329 | 3300053091 | Bacteria | 927 |
| 1357 | Ga0500647_0246304 | 3300053091 | Bacteria | 788 |
| 1358 | Ga0500583_0046075 | 3300053092 | Bacteria | 2005 |
| 1359 | Ga0500583_0090817 | 3300053092 | Bacteria | 1486 |
| 1360 | Ga0500583_0099743 | 3300053092 | Bacteria | 1421 |
| 1361 | Ga0500583_0119966 | 3300053092 | Bacteria | 1301 |
| 1362 | Ga0500651_0073476 | 3300053093 | Bacteria | 2125 |
| 1363 | Ga0500651_0144897 | 3300053093 | Bacteria | 1429 |
| 1364 | Ga0500566_0001040 | 3300053094 | Bacteria | 16059 |
| 1365 | Ga0500566_0021628 | 3300053094 | Bacteria | 3780 |
| 1366 | Ga0500566_0305228 | 3300053094 | Bacteria | 747 |
| 1367 | Ga0500640_001081 | 3300053095 | Bacteria | 7849 |
| 1368 | Ga0500641_0064918 | 3300053096 | Bacteria | 1526 |
| 1369 | Ga0500641_0096832 | 3300053096 | Bacteria | 1263 |
| 1370 | Ga0500641_0150649 | 3300053096 | Bacteria | 1004 |
| 1371 | Ga0500641_0283834 | 3300053096 | Bacteria | 685 |
| 1372 | Ga0500648_221272 | 3300053097 | Bacteria | 927 |
| 1373 | Ga0500654_183937 | 3300053099 | Bacteria | 661 |
| 1374 | Ga0500555_003125 | 3300053103 | Bacteria | 4726 |
| 1375 | Ga0500555_043808 | 3300053103 | Bacteria | 1240 |
| 1376 | Ga0500556_0048231 | 3300053104 | Bacteria | 1531 |
| 1377 | Ga0500557_000129 | 3300053105 | Bacteria | 19306 |
| 1378 | Ga0500562_117937 | 3300053108 | Bacteria | 723 |
| 1379 | Ga0500572_000148 | 3300053111 | Bacteria | 24267 |
| 1380 | Ga0500572_001485 | 3300053111 | Bacteria | 6330 |
| 1381 | Ga0500572_014260 | 3300053111 | Bacteria | 1982 |
| 1382 | Ga0500591_016850 | 3300053115 | Bacteria | 3526 |
| 1383 | Ga0500594_0070505 | 3300053118 | Bacteria | 1027 |
| 1384 | Ga0500595_001155 | 3300053119 | Bacteria | 14615 |
| 1385 | Ga0500595_001379 | 3300053119 | Bacteria | 13036 |
| 1386 | Ga0500595_007140 | 3300053119 | Bacteria | 4663 |
| 1387 | Ga0500595_032957 | 3300053119 | Bacteria | 1723 |
| 1388 | Ga0500595_033623 | 3300053119 | Bacteria | 1700 |
| 1389 | Ga0500595_038970 | 3300053119 | Bacteria | 1541 |
| 1390 | Ga0500608_032512 | 3300053122 | Bacteria | 2480 |
| 1391 | Ga0500608_169383 | 3300053122 | Bacteria | 938 |
| 1392 | Ga0500614_000313 | 3300053123 | Bacteria | 12526 |
| 1393 | Ga0500621_152410 | 3300053126 | Bacteria | 866 |
| 1394 | Ga0500642_0000180 | 3300053130 | Bacteria | 26182 |
| 1395 | Ga0500642_0010401 | 3300053130 | Bacteria | 3278 |
| 1396 | Ga0500655_028287 | 3300053133 | Bacteria | 1072 |
| 1397 | Ga0500658_0129611 | 3300053134 | Bacteria | 1124 |
| 1398 | Ga0500559_0001230 | 3300053136 | Bacteria | 15155 |
| 1399 | Ga0500559_0005930 | 3300053136 | Bacteria | 5556 |
| 1400 | Ga0500559_0024957 | 3300053136 | Bacteria | 2544 |
| 1401 | Ga0500561_0051192 | 3300053137 | Bacteria | 1128 |
| 1402 | Ga0500568_0056017 | 3300053139 | Bacteria | 1537 |
| 1403 | Ga0500568_0137232 | 3300053139 | Bacteria | 907 |
| 1404 | Ga0500573_0107782 | 3300053140 | Bacteria | 1561 |
| 1405 | Ga0500588_0116236 | 3300053146 | Bacteria | 939 |
| 1406 | Ga0500590_063732 | 3300053148 | Bacteria | 1847 |
| 1407 | Ga0500590_158266 | 3300053148 | Bacteria | 1012 |
| 1408 | Ga0500603_000076 | 3300053150 | Bacteria | 22738 |
| 1409 | Ga0500603_040666 | 3300053150 | Bacteria | 1239 |
| 1410 | Ga0500603_085600 | 3300053150 | Bacteria | 919 |
| 1411 | Ga0500604_0019662 | 3300053151 | Bacteria | 1893 |
| 1412 | Ga0500604_0154966 | 3300053151 | Bacteria | 779 |
| 1413 | Ga0500616_0000092 | 3300053153 | Bacteria | 183860 |
| 1414 | Ga0500616_0118689 | 3300053153 | Bacteria | 1267 |
| 1415 | Ga0500616_0215741 | 3300053153 | Bacteria | 840 |
| 1416 | Ga0500620_152139 | 3300053155 | Bacteria | 805 |
| 1417 | Ga0500622_0024890 | 3300053156 | Bacteria | 3165 |
| 1418 | Ga0500627_0023107 | 3300053158 | Bacteria | 2531 |
| 1419 | Ga0500630_005759 | 3300053159 | Bacteria | 6056 |
| 1420 | Ga0500638_017487 | 3300053162 | Bacteria | 3328 |
| 1421 | Ga0500638_036871 | 3300053162 | Bacteria | 2371 |
| 1422 | Ga0500639_000014 | 3300053163 | Bacteria | 122926 |
| 1423 | Ga0500636_0000324 | 3300053177 | Bacteria | 26370 |
| 1424 | Ga0500636_0025074 | 3300053177 | Bacteria | 3523 |
| 1425 | Ga0500636_0037661 | 3300053177 | Bacteria | 2861 |
| 1426 | Ga0500637_0000705 | 3300053178 | Bacteria | 13305 |
| 1427 | Ga0500637_0012032 | 3300053178 | Bacteria | 4498 |
| 1428 | Ga0500637_0027169 | 3300053178 | Bacteria | 3158 |
| 1429 | Ga0500637_0102004 | 3300053178 | Bacteria | 1663 |
| 1430 | Ga0500637_0179561 | 3300053178 | Bacteria | 1214 |
| 1431 | Ga0500625_002854 | 3300053729 | Bacteria | 6626 |
| 1432 | Ga0500596_000214 | 3300053735 | Bacteria | 9758 |
| 1433 | Ga0500596_004388 | 3300053735 | Bacteria | 2588 |
| 1434 | Ga0500596_006106 | 3300053735 | Bacteria | 2064 |
| 1435 | Ga0500599_002006 | 3300053736 | Bacteria | 2407 |
| 1436 | Ga0500601_000851 | 3300053737 | Bacteria | 3719 |
| 1437 | Ga0501084_0118044 | 3300054114 | Bacteria | 2230 |
| 1438 | Ga0501084_0125927 | 3300054114 | Bacteria | 2156 |
| 1439 | Ga0501084_0129718 | 3300054114 | Bacteria | 2122 |
| 1440 | Ga0500661_006724 | 3300055283 | Bacteria | 2139 |
| 1441 | Ga0500661_009700 | 3300055283 | Bacteria | 1759 |
| 1442 | Ga0587082_067466 | 3300059504 | Bacteria | 720 |
| 1443 | Ga0587083_0107069 | 3300059505 | Bacteria | 705 |
| 1444 | Ga0501082_0038236 | 3300060353 | Bacteria | 4140 |
| 1445 | Ga0530510_0022282 | 3300061734 | Bacteria | 4511 |
| 1446 | 2507511056 | 2507262055 | Bacteria | 8048963 |
| 1447 | 2508544873 | 2508501009 | Bacteria | 7784016 |
| 1448 | 2508696907 | 2508501042 | Bacteria | 8719808 |
| 1449 | 2509151837 | 2508501128 | Bacteria | 8613869 |
| 1450 | 2511400386 | 2511231028 | Bacteria | 8046582 |
| 1451 | 2513623516 | 2513237092 | Bacteria | 8341956 |
| 1452 | 2513649713 | 2513237095 | Bacteria | 8976980 |
| 1453 | 2513678541 | 2513237098 | Bacteria | 9902361 |
| 1454 | 2513696526 | 2513237101 | Bacteria | 7952346 |
| 1455 | 2513701174 | 2513237102 | Bacteria | 7703324 |
| 1456 | 2513716953 | 2513237104 | Bacteria | 10034502 |
| 1457 | 2513874682 | 2513237139 | Bacteria | 8737671 |
| 1458 | 2513892130 | 2513237141 | Bacteria | 8496279 |
| 1459 | 2514010600 | 2513237161 | Bacteria | 8871253 |
| 1460 | 2515625372 | 2515154112 | Bacteria | 8294334 |
| 1461 | 2517100623 | 2517093001 | Bacteria | 9002274 |
| 1462 | 2524438151 | 2524023205 | Bacteria | 8918781 |
| 1463 | 2524468849 | 2524023210 | Bacteria | 9029266 |
| 1464 | 2528856708 | 2528768022 | Bacteria | 10457665 |
| 1465 | 2596374236 | 2595698237 | Bacteria | 6712432 |
| 1466 | 2617350808 | 2617270735 | Bacteria | 9163226 |
| 1467 | 2617373178 | 2617270741 | Bacteria | 8201522 |
| 1468 | 2723843034 | 2721755755 | Bacteria | 8322773 |
| 1469 | 2739249163 | 2738543013 | Bacteria | 5618633 |
| 1470 | 2745076967 | 2744054633 | Bacteria | 8678936 |
| 1471 | 2793064698 | 2791355196 | Bacteria | 7323613 |
| 1472 | 2793083663 | |||
| 1473 | 2805916681 | 2802429603 | Bacteria | 8777136 |
| 1474 | 2818238185 | 2816332527 | Bacteria | 8933356 |
| 1475 | 2824607513 | 2824600985 | Bacteria | 8488197 |
| 1476 | 2824617029 | 2824609381 | Bacteria | 8672835 |
| 1477 | 2824626270 | 2824617872 | Bacteria | 8814715 |
| 1478 | 2824634925 | 2824626560 | Bacteria | 8813858 |
| 1479 | 2824643453 | 2824635225 | Bacteria | 8785348 |
| 1480 | 2824652243 | 2824644064 | Bacteria | 8743947 |
| 1481 | 2824658744 | 2824653114 | Bacteria | 8493680 |
| 1482 | 2824670762 | 2824661429 | Bacteria | 9877870 |
| 1483 | 2824678886 | 2824671348 | Bacteria | 8369588 |
| 1484 | 2824687018 | 2824679649 | Bacteria | 8248951 |
| 1485 | 2824695398 | 2824687955 | Bacteria | 8360029 |
| 1486 | 2824703745 | 2824696289 | Bacteria | 8335049 |
| 1487 | 2824713111 | 2824704595 | Bacteria | 9667483 |
| 1488 | 2824722646 | 2824714736 | Bacteria | 8717648 |
| 1489 | 2824732216 | 2824723954 | Bacteria | 8758240 |
| 1490 | 2824737084 | 2824732956 | Bacteria | 7810675 |
| 1491 | 2824753452 | 2824746037 | Bacteria | 7911610 |
| 1492 | 2824763197 | 2824753945 | Bacteria | 9787441 |
| 1493 | 2824771396 | 2824763712 | Bacteria | 9792355 |
| 1494 | 2824780472 | 2824773399 | Bacteria | 8360218 |
| 1495 | 2829748345 | 2829745981 | Bacteria | 5406054 |
| 1496 | 2831869442 | 2831864461 | Bacteria | 6502356 |
| 1497 | 2838127927 | 2838122688 | Bacteria | 8803140 |
| 1498 | 2841943221 | 2841941048 | Bacteria | 8688029 |
| 1499 | 2841954047 | 2841949485 | Bacteria | 8680857 |
| 1500 | 2841960187 | 2841957949 | Bacteria | 8652217 |
| 1501 | 2841968139 | 2841966195 | Bacteria | 8673214 |
| 1502 | 2841976652 | 2841974524 | Bacteria | 8931498 |
| 1503 | 2841988024 | 2841983080 | Bacteria | 8395090 |
| 1504 | 2842042668 | 2842038055 | Bacteria | 8002051 |
| 1505 | 2842050711 | 2842045827 | Bacteria | 8006841 |
| 1506 | 2844316880 | 2844315083 | Bacteria | 8138177 |
| 1507 | 2847938594 | 2847930680 | Bacteria | 9342022 |
| 1508 | 2847944206 | 2847939898 | Bacteria | 8606328 |
| 1509 | 2848298708 | 2848297114 | Bacteria | 3608511 |
| 1510 | 2849081568 | 2849076700 | Bacteria | 7039503 |
| 1511 | 2857512221 | 2857509624 | Bacteria | 7472071 |
| 1512 | 2874597788 | 2874590934 | Bacteria | 8299676 |
| 1513 | 2874612632 | 2874604998 | Bacteria | 7834745 |
| 1514 | 2874617663 | 2874612657 | Bacteria | 8252029 |
| 1515 | 2874623401 | 2874620515 | Bacteria | 8290088 |
| 1516 | 2874634181 | 2874628541 | Bacteria | 8630250 |
| 1517 | 2874651317 | 2874645413 | Bacteria | 8214782 |
| 1518 | 2876764080 | 2876761206 | Bacteria | 10111113 |
| 1519 | 2876776388 | 2876771140 | Bacteria | 8287509 |
| 1520 | 2876817497 | 2876808645 | Bacteria | 8824342 |
| 1521 | 2876820956 | 2876818435 | Bacteria | 8274608 |
| 1522 | 2879081749 | 2879074833 | Bacteria | 8279565 |
| 1523 | 2879088430 | 2879083081 | Bacteria | 8587928 |
| 1524 | 2879108832 | 2879099564 | Bacteria | 10442239 |
| 1525 | 2879118085 | 2879110137 | Bacteria | 8907982 |
| 1526 | 2879130463 | 2879127579 | Bacteria | 8294491 |
| 1527 | 2879146349 | 2879142872 | Bacteria | 8267021 |
| 1528 | 2881370714 | 2881364244 | Bacteria | 7710352 |
| 1529 | 2881671303 | 2881665667 | Bacteria | 8175609 |
| 1530 | 2885366903 | 2885366525 | Bacteria | 8326213 |
| 1531 | 2885387143 | 2885383462 | Bacteria | 9473874 |
| 1532 | 2885413398 | 2885409591 | Bacteria | 9235467 |
| 1533 | 2886850740 | 2886848708 | Bacteria | 5632523 |
| 1534 | 2888381492 | 2888378607 | Bacteria | 9652610 |
| 1535 | 2888389155 | 2888388044 | Bacteria | 7304136 |
| 1536 | 2888421894 | 2888419890 | Bacteria | 7857137 |
| 1537 | 2889033666 | 2889033259 | Bacteria | 9099371 |
| 1538 | 2889307571 | 2889306138 | Bacteria | 6358934 |
| 1539 | 2902333107 | 2902330777 | Bacteria | 6395352 |
| 1540 | 2902410190 | 2902405164 | Bacteria | 6784948 |
| 1541 | 2903733930 | 2903727486 | Bacteria | 8281579 |
| 1542 | 2903772030 | 2903768456 | Bacteria | 9749579 |
| 1543 | 2904672668 | 2904666416 | Bacteria | 8226587 |
| 1544 | 2904719262 | 2904711408 | Bacteria | 9771557 |
| 1545 | 2906604546 | 2906602504 | Bacteria | 8295279 |
| 1546 | 2906635208 | 2906626472 | Bacteria | 8826946 |
| 1547 | 2906649115 | 2906643746 | Bacteria | 8722424 |
| 1548 | 2908781634 | 2908775508 | Bacteria | 8092255 |
| 1549 | 2919704348 | 2919704043 | Bacteria | 5560311 |
| 1550 | 2922367031 | 2922361189 | Bacteria | 7436256 |
| 1551 | 2922371156 | |||
| 1552 | 2922390189 | 2922386360 | Bacteria | 7017218 |
| 1553 | 2922393526 | 2922393267 | Bacteria | 8285685 |
| 1554 | 2928126604 | 2928125067 | Bacteria | 5937560 |
| 1555 | 2929619543 | 2929615660 | Bacteria | 9193770 |
| 1556 | 2929627987 | 2929624759 | Bacteria | 9339455 |
| 1557 | 2932785867 | 2932784394 | Bacteria | 9704911 |
| 1558 | 2932798346 | 2932794094 | Bacteria | 7915132 |
| 1559 | 2932804142 | 2932801729 | Bacteria | 7987968 |
| 1560 | 2932817240 | 2932809354 | Bacteria | 9135765 |
| 1561 | 2932826729 | 2932818245 | Bacteria | 9955613 |
| 1562 | 2932830912 | 2932828146 | Bacteria | 9745859 |
| 1563 | 2933581463 | 2933577622 | Bacteria | 9116884 |
| 1564 | 2935612713 | 2935608549 | Bacteria | 8203142 |
| 1565 | 2935620980 | 2935616580 | Bacteria | 9032984 |
| 1566 | 2935640053 | 2935638405 | Bacteria | 10015038 |
| 1567 | 2935655165 | 2935648319 | Bacteria | 8801166 |
| 1568 | 2935664046 | 2935656913 | Bacteria | 8965014 |
| 1569 | 2935667108 | 2935665750 | Bacteria | 9571747 |
| 1570 | 2935680252 | 2935675223 | Bacteria | 9928132 |
| 1571 | 2935690238 | 2935684952 | Bacteria | 9590419 |
| 1572 | 2935699674 | 2935694250 | Bacteria | 9291695 |
| 1573 | 2935704864 | 2935703347 | Bacteria | 10242284 |
| 1574 | 2935718065 | 2935713505 | Bacteria | 9608509 |
| 1575 | 2935726785 | 2935722832 | Bacteria | 9608746 |
| 1576 | 2935735554 | 2935732158 | Bacteria | 9706831 |
| 1577 | 2935745175 | 2935741537 | Bacteria | 9707219 |
| 1578 | 2935755249 | 2935750917 | Bacteria | 9590372 |
| 1579 | 2935762234 | 2935760218 | Bacteria | 9817913 |
| 1580 | 2935773611 | 2935769743 | Bacteria | 7878163 |
| 1581 | 2935780169 | 2935777560 | Bacteria | 8077691 |
| 1582 | 2935788484 | 2935785616 | Bacteria | 7962367 |
| 1583 | 2935796640 | 2935793552 | Bacteria | 8012592 |
| 1584 | 2935803734 | 2935801545 | Bacteria | 9301974 |
| 1585 | 2935811652 | 2935810662 | Bacteria | 9401221 |
| 1586 | 2935824202 | 2935819856 | Bacteria | 8261050 |
| 1587 | 2935829536 | 2935827899 | Bacteria | 10038562 |
| 1588 | 2935842502 | 2935837841 | Bacteria | 9454360 |
| 1589 | 2935852651 | 2935847175 | Bacteria | 8228321 |
| 1590 | 2935858787 | 2935855204 | Bacteria | 9035059 |
| 1591 | 2935866815 | 2935864058 | Bacteria | 9784707 |
| 1592 | 2935876946 | 2935873716 | Bacteria | 9632195 |
| 1593 | 2935884052 | 2935883170 | Bacteria | 7964738 |
| 1594 | 2935912197 | 2935908558 | Bacteria | 8568796 |
| 1595 | 2935922410 | 2935916978 | Bacteria | 9113783 |
| 1596 | 2935929226 | 2935926038 | Bacteria | 8601059 |
| 1597 | 2935935857 | 2935934488 | Bacteria | 8602579 |
| 1598 | 2935947423 | 2935942939 | Bacteria | 8599779 |
| 1599 | 2935953482 | 2935951376 | Bacteria | 8602333 |
| 1600 | 2935962009 | 2935959822 | Bacteria | 7869783 |
| 1601 | 2935968508 | 2935967501 | Bacteria | 8603075 |
| 1602 | 2935976692 | 2935975950 | Bacteria | 8347125 |
| 1603 | 2935990691 | 2935984226 | Bacteria | 8302647 |
| 1604 | 2935993414 | 2935992306 | Bacteria | 9802711 |
| 1605 | 2936004309 | 2936002035 | Bacteria | 9362176 |
| 1606 | 2936015456 | 2936011229 | Bacteria | 8801034 |
| 1607 | 2936024090 | 2936019824 | Bacteria | 8804134 |
| 1608 | 2936033105 | 2936028420 | Bacteria | 8965941 |
| 1609 | 2936038234 | 2936037263 | Bacteria | 9446081 |
| 1610 | 2936051198 | 2936046547 | Bacteria | 8903709 |
| 1611 | 2936058576 | 2936055302 | Bacteria | 8785755 |
| 1612 | 2940561470 | 2940556831 | Bacteria | 9590747 |
| 1613 | 2941533660 | 2941531003 | Bacteria | 7653939 |
| 1614 | 2941547385 | 2941538514 | Bacteria | 9402094 |
| 1615 | 3005486150 | 3005483717 | Bacteria | 7877331 |
| 1616 | 3005507091 | 3005506211 | Bacteria | 6943378 |
| 1617 | 3005593053 | 3005587118 | Bacteria | 7794411 |
| 1618 | 3005596509 | 3005594810 | Bacteria | 8716512 |
| 1619 | 3005712579 | 3005710791 | Bacteria | 7622528 |
| 1620 | 3005719638 | 3005718088 | Bacteria | 8283608 |
| 1621 | 643602447 | 643348564 | Bacteria | 8839022 |
| 1622 | 8006930088 | 8006926726 | Bacteria | 6749210 |
| 1623 | 8006966568 | 8006964411 | Bacteria | 8966052 |
| 1624 | 8006989411 | 8006984368 | Bacteria | 9651211 |
| 1625 | 8006997879 | 8006994254 | Bacteria | 8309700 |
| 1626 | 8016516475 | 8016511872 | Bacteria | 9921665 |
| 1627 | 8016523881 | 8016522445 | Bacteria | 8156687 |
| 1628 | 8016541683 | 8016539877 | Bacteria | 8155419 |
| 1629 | 8016551589 | 8016548790 | Bacteria | 8155074 |
| 1630 | 8016559972 | 8016557553 | Bacteria | 8154380 |
| 1631 | 8016567068 | 8016566248 | Bacteria | 8158151 |
| 1632 | 8016579785 | 8016575299 | Bacteria | 8154085 |
| 1633 | 8016597900 | 8016595262 | Bacteria | 8149947 |
| 1634 | 8016604036 | 8016603502 | Bacteria | 8731218 |
| 1635 | 8016620620 | 8016613128 | Bacteria | 8794220 |
| 1636 | 8016629375 | 8016622563 | Bacteria | 7999408 |
| 1637 | 8016633883 | 8016630954 | Bacteria | 9217207 |
| 1638 | 8017060064 | 8017057580 | Bacteria | 10023680 |
| 1639 | 8019537096 | 8019530166 | Bacteria | 8155624 |
| 1640 | 8019542447 | 8019538911 | Bacteria | 7872763 |
| 1641 | 8019548313 | 8019547302 | Bacteria | 7996444 |
| 1642 | 8019579572 | 8019576017 | Bacteria | 10049540 |
| 1643 | 8019587282 | 8019586578 | Bacteria | 10212056 |
| 1644 | 8019604059 | 8019597564 | Bacteria | 10041141 |
| 1645 | 8019614470 | 8019608314 | Bacteria | 10042931 |
| 1646 | 8019625095 | 8019619141 | Bacteria | 9218857 |
| 1647 | 8019637086 | 8019629233 | Bacteria | 8687553 |
| 1648 | 8019642516 | 8019638758 | Bacteria | 9062356 |
| 1649 | 8019674490 | 8019668869 | Bacteria | 8791617 |
| 1650 | 8019681616 | 8019678201 | Bacteria | 8863603 |
| 1651 | 8019694160 | 8019687851 | Bacteria | 8712826 |
| 1652 | 8055749199 | 8055742211 | Bacteria | 9226248 |
| 1653 | 8056674910 | 8056673599 | Bacteria | 7871253 |
| 1654 | 8056682335 | 8056681323 | Bacteria | 8472857 |
| 1655 | 8056969681 | 8056967851 | Bacteria | 9038162 |
| 1656 | Ga0070683_100279156 | |||
| 1657 | LJNas_1007582 | |||
| 1658 | JGI24740J21852_10008811 | |||
| 1659 | JGI24735J21928_10001998 | |||
| 1660 | JGI24744J21845_10018209 | |||
| 1661 | JGI25406J46586_10009990 | |||
| 1662 | JGI25406J46586_10043167 | |||
| 1663 | JGI25165J46597_1006536 | |||
| 1664 | JGI25153J46596_10002774 | |||
| 1665 | JGI25153J46596_10027669 | |||
| 1666 | rootL2_10001663 | |||
| 1667 | JGI25160J50197_1019866 | |||
| 1668 | JGI25160J50197_1026122 | |||
| 1669 | JGI25404J52841_10006558 | |||
| 1670 | JGI25404J52841_10010832 | |||
| 1671 | JGI25404J52841_10014898 | |||
| 1672 | JGI25404J52841_10019762 | |||
| 1673 | JGI25404J52841_10021733 | |||
| 1674 | JGI25404J52841_10052187 | |||
| 1675 | Ga0055539_1005760 | |||
| 1676 | Ga0055526_1012133 | |||
| 1677 | Ga0055524_1000552 | |||
| 1678 | Ga0055531_10001408 | |||
| 1679 | Ga0055531_10001492 | |||
| 1680 | Ga0055543_1018006 | |||
| 1681 | Ga0065165_1000016 | |||
| 1682 | Ga0065165_1003197 | |||
| 1683 | Ga0065712_10155411 | |||
| 1684 | Ga0065712_10278757 | |||
| 1685 | Ga0070658_10470902 | |||
| 1686 | Ga0070676_10036142 | |||
| 1687 | Ga0070683_100052756 | |||
| 1688 | Ga0070677_10035063 | |||
| 1689 | Ga0068869_100021473 | |||
| 1690 | Ga0068869_100055612 | |||
| 1691 | Ga0070666_10055129 | |||
| 1692 | Ga0070666_10155864 | |||
| 1693 | Ga0070680_100155083 | |||
| 1694 | Ga0070680_100158631 | |||
| 1695 | Ga0070682_100040990 | |||
| 1696 | Ga0070682_100202655 | |||
| 1697 | Ga0070682_100262953 | |||
| 1698 | Ga0068868_100174759 | |||
| 1699 | Ga0068868_100484012 | |||
| 1700 | Ga0070660_100037695 | |||
| 1701 | Ga0070660_100116311 | |||
| 1702 | Ga0070689_100040633 | |||
| 1703 | Ga0070689_100335196 | |||
| 1704 | Ga0070689_100403686 | |||
| 1705 | Ga0070661_100208678 | |||
| 1706 | Ga0070661_100422690 | |||
| 1707 | Ga0070661_100661171 | |||
| 1708 | Ga0070668_100050072 | |||
| 1709 | Ga0070668_100069151 | |||
| 1710 | Ga0070668_100174996 | |||
| 1711 | Ga0070668_100282949 | |||
| 1712 | Ga0070668_100766677 | |||
| 1713 | Ga0070669_100290393 | |||
| 1714 | Ga0070669_100840998 | |||
| 1715 | Ga0070675_100082243 | |||
| 1716 | Ga0070675_100242823 | |||
| 1717 | Ga0070675_100390207 | |||
| 1718 | Ga0070675_100551285 | |||
| 1719 | Ga0070671_100006185 | |||
| 1720 | Ga0070671_100058932 | |||
| 1721 | Ga0070671_100191192 | |||
| 1722 | Ga0070671_100313403 | |||
| 1723 | Ga0070674_100219162 | |||
| 1724 | Ga0070674_100725405 | |||
| 1725 | Ga0070673_100062261 | |||
| 1726 | Ga0070673_100742239 | |||
| 1727 | Ga0070688_100084177 | |||
| 1728 | Ga0070688_100123413 | |||
| 1729 | Ga0070688_100463505 | |||
| 1730 | Ga0070667_100007677 | |||
| 1731 | Ga0070667_100121363 | |||
| 1732 | Ga0070667_100291509 | |||
| 1733 | Ga0070667_100323221 | |||
| 1734 | Ga0070667_100346318 | |||
| 1735 | Ga0070709_10002295 | |||
| 1736 | Ga0070709_10003472 | |||
| 1737 | Ga0070709_10032611 | |||
| 1738 | Ga0070709_10057122 | |||
| 1739 | Ga0070709_10156677 | |||
| 1740 | Ga0070709_10256296 | |||
| 1741 | Ga0070714_100017825 | |||
| 1742 | Ga0070714_100552483 | |||
| 1743 | Ga0070713_100002964 | |||
| 1744 | Ga0070713_100005146 | |||
| 1745 | Ga0070713_100037482 | |||
| 1746 | Ga0070713_100100661 | |||
| 1747 | Ga0070713_100103917 | |||
| 1748 | Ga0070713_100137493 | |||
| 1749 | Ga0070713_100157898 | |||
| 1750 | Ga0070710_10000670 | |||
| 1751 | Ga0070710_10008450 | |||
| 1752 | Ga0070710_10042770 | |||
| 1753 | Ga0070710_10209221 | |||
| 1754 | Ga0070710_10325089 | |||
| 1755 | Ga0070711_100007952 | |||
| 1756 | Ga0070711_100304898 | |||
| 1757 | Ga0070711_100556195 | |||
| 1758 | Ga0070663_100009751 | |||
| 1759 | Ga0070663_100145075 | |||
| 1760 | Ga0070663_100153269 | |||
| 1761 | Ga0070663_100283382 | |||
| 1762 | Ga0070663_100551496 | |||
| 1763 | Ga0070678_100025881 | |||
| 1764 | Ga0070678_100031470 | |||
| 1765 | Ga0070678_100033640 | |||
| 1766 | Ga0070678_100237058 | |||
| 1767 | Ga0070662_100060618 | |||
| 1768 | Ga0070662_100329276 | |||
| 1769 | Ga0070681_10011776 | |||
| 1770 | Ga0070681_10042493 | |||
| 1771 | Ga0070681_10148627 | |||
| 1772 | Ga0070681_10249375 | |||
| 1773 | Ga0070681_10269621 | |||
| 1774 | Ga0068867_100222223 | |||
| 1775 | Ga0068867_100997727 | |||
| 1776 | Ga0070685_10104552 | |||
| 1777 | Ga0070685_10195811 | |||
| 1778 | Ga0070685_10196492 | |||
| 1779 | Ga0070706_100115232 | |||
| 1780 | Ga0070698_100201837 | |||
| 1781 | Ga0070698_100584522 | |||
| 1782 | Ga0070699_100124273 | |||
| 1783 | Ga0070679_100029967 | |||
| 1784 | Ga0070679_100041486 | |||
| 1785 | Ga0070679_100070455 | |||
| 1786 | Ga0070679_100341701 | |||
| 1787 | Ga0070679_100399368 | |||
| 1788 | Ga0070679_100764614 | |||
| 1789 | Ga0070684_100017961 | |||
| 1790 | Ga0070684_100081454 | |||
| 1791 | Ga0070697_100139093 | |||
| 1792 | Ga0068853_100004631 | |||
| 1793 | Ga0068853_100017135 | |||
| 1794 | Ga0068853_100070106 | |||
| 1795 | Ga0068853_100203608 | |||
| 1796 | Ga0068853_100289530 | |||
| 1797 | Ga0068853_100321721 | |||
| 1798 | Ga0068853_100382807 | |||
| 1799 | Ga0070672_100085127 | |||
| 1800 | Ga0070672_100130773 | |||
| 1801 | Ga0070672_100137346 | |||
| 1802 | Ga0070672_100151370 | |||
| 1803 | Ga0070686_100125678 | |||
| 1804 | Ga0070686_100181242 | |||
| 1805 | Ga0070686_100367886 | |||
| 1806 | Ga0070693_100084049 | |||
| 1807 | Ga0070693_100305632 | |||
| 1808 | Ga0070693_100675285 | |||
| 1809 | Ga0070665_100010558 | |||
| 1810 | Ga0070665_100055362 | |||
| 1811 | Ga0070665_100110027 | |||
| 1812 | Ga0070665_100215615 | |||
| 1813 | Ga0070665_100309023 | |||
| 1814 | Ga0070665_100727119 | |||
| 1815 | Ga0070665_100764734 | |||
| 1816 | Ga0070665_100818324 | |||
| 1817 | Ga0070665_101289354 | |||
| 1818 | Ga0070704_101325221 | |||
| 1819 | Ga0068855_100019336 | |||
| 1820 | Ga0068855_100113658 | |||
| 1821 | Ga0068855_100480578 | |||
| 1822 | Ga0070664_100254315 | |||
| 1823 | Ga0068857_100010438 | |||
| 1824 | Ga0068857_100011515 | |||
| 1825 | Ga0068857_100085429 | |||
| 1826 | Ga0068857_100712991 | |||
| 1827 | Ga0068854_100038376 | |||
| 1828 | Ga0068854_100044419 | |||
| 1829 | Ga0068854_100184896 | |||
| 1830 | Ga0068854_100606004 | |||
| 1831 | Ga0068856_100000434 | |||
| 1832 | Ga0068856_100003274 | |||
| 1833 | Ga0068856_100133783 | |||
| 1834 | Ga0070702_100003925 | |||
| 1835 | Ga0070702_100143508 | |||
| 1836 | Ga0068859_100000206 | |||
| 1837 | Ga0068859_100022208 | |||
| 1838 | Ga0068859_100149624 | |||
| 1839 | Ga0068859_100210081 | |||
| 1840 | Ga0068859_100599584 | |||
| 1841 | Ga0068864_100016310 | |||
| 1842 | Ga0068864_101051402 | |||
| 1843 | Ga0068861_100114770 | |||
| 1844 | Ga0068861_100132321 | |||
| 1845 | Ga0068861_100227317 | |||
| 1846 | Ga0068861_100316197 | |||
| 1847 | Ga0068851_10008428 | |||
| 1848 | Ga0068870_10078184 | |||
| 1849 | Ga0068863_100004529 | |||
| 1850 | Ga0068863_100025756 | |||
| 1851 | Ga0068863_100373096 | |||
| 1852 | Ga0068863_100414338 | |||
| 1853 | Ga0068858_100000483 | |||
| 1854 | Ga0068858_100043024 | |||
| 1855 | Ga0068858_100128408 | |||
| 1856 | Ga0068858_100300048 | |||
| 1857 | Ga0068860_100003873 | |||
| 1858 | Ga0068860_100028853 | |||
| 1859 | Ga0068860_100055668 | |||
| 1860 | Ga0068860_100109405 | |||
| 1861 | Ga0068860_100138793 | |||
| 1862 | Ga0068860_100208471 | |||
| 1863 | Ga0068862_100099272 | |||
| 1864 | Ga0068862_100143494 | |||
| 1865 | Ga0068862_100188770 | |||
| 1866 | Ga0068862_100305175 | |||
| 1867 | Ga0068862_100399499 | |||
| 1868 | Ga0068862_100816766 | |||
| 1869 | Ga0081455_10000812 | |||
| 1870 | Ga0081455_10009274 | |||
| 1871 | Ga0081455_10015998 | |||
| 1872 | Ga0081455_10020610 | |||
| 1873 | Ga0081455_10028221 | |||
| 1874 | Ga0081538_10004738 | |||
| 1875 | Ga0081538_10020460 | |||
| 1876 | Ga0081538_10112627 | |||
| 1877 | Ga0081540_1001986 | |||
| 1878 | Ga0081540_1002094 | |||
| 1879 | Ga0081540_1006308 | |||
| 1880 | Ga0081540_1010425 | |||
| 1881 | Ga0081540_1020900 | |||
| 1882 | Ga0081540_1026478 | |||
| 1883 | Ga0081540_1027710 | |||
| 1884 | Ga0081540_1105978 | |||
| 1885 | Ga0081539_10000351 | |||
| 1886 | Ga0081539_10001264 | |||
| 1887 | Ga0081539_10020384 | |||
| 1888 | Ga0081539_10072103 | |||
| 1889 | Ga0070717_10013517 | |||
| 1890 | Ga0070717_10053667 | |||
| 1891 | Ga0070717_10067675 | |||
| 1892 | Ga0070717_10077200 | |||
| 1893 | Ga0070717_10185195 | |||
| 1894 | Ga0070717_10211652 | |||
| 1895 | Ga0075365_10044906 | |||
| 1896 | Ga0075365_10054787 | |||
| 1897 | Ga0075365_10100510 | |||
| 1898 | Ga0075365_10210355 | |||
| 1899 | Ga0075365_10222435 | |||
| 1900 | Ga0075365_10335451 | |||
| 1901 | Ga0075368_10002752 | |||
| 1902 | Ga0075368_10024760 | |||
| 1903 | Ga0075368_10086974 | |||
| 1904 | Ga0075368_10123016 | |||
| 1905 | Ga0075368_10125195 | |||
| 1906 | Ga0075368_10143555 | |||
| 1907 | Ga0075368_10172914 | |||
| 1908 | Ga0075363_100007371 | |||
| 1909 | Ga0075363_100085490 | |||
| 1910 | Ga0075363_100156297 | |||
| 1911 | Ga0075364_10015286 | |||
| 1912 | Ga0075364_10192691 | |||
| 1913 | Ga0075364_10271556 | |||
| 1914 | Ga0075364_10342696 | |||
| 1915 | Ga0075364_10383648 | |||
| 1916 | Ga0070715_10110546 | |||
| 1917 | Ga0070715_10186994 | |||
| 1918 | Ga0070716_100021762 | |||
| 1919 | Ga0070716_100022705 | |||
| 1920 | Ga0070712_100152685 | |||
| 1921 | Ga0075362_10039422 | |||
| 1922 | Ga0075362_10078378 | |||
| 1923 | Ga0075362_10104254 | |||
| 1924 | Ga0075362_10114490 | |||
| 1925 | Ga0075362_10163239 | |||
| 1926 | Ga0075362_10176350 | |||
| 1927 | Ga0075362_10201489 | |||
| 1928 | Ga0075367_10007138 | |||
| 1929 | Ga0075367_10020451 | |||
| 1930 | Ga0075367_10117291 | |||
| 1931 | Ga0075367_10313083 | |||
| 1932 | Ga0075367_10333408 | |||
| 1933 | Ga0075369_10005751 | |||
| 1934 | Ga0075369_10063379 | |||
| 1935 | Ga0075369_10124491 | |||
| 1936 | Ga0075369_10216187 | |||
| 1937 | Ga0075366_10025122 | |||
| 1938 | Ga0075366_10027084 | |||
| 1939 | Ga0075366_10034731 | |||
| 1940 | Ga0075366_10060099 | |||
| 1941 | Ga0075366_10062649 | |||
| 1942 | Ga0075366_10100900 | |||
| 1943 | Ga0075366_10117755 | |||
| 1944 | Ga0075366_10301952 | |||
| 1945 | Ga0075366_10321705 | |||
| 1946 | Ga0097621_100204250 | |||
| 1947 | Ga0097621_100455905 | |||
| 1948 | Ga0075370_10003211 | |||
| 1949 | Ga0075370_10082375 | |||
| 1950 | Ga0075370_10094916 | |||
| 1951 | Ga0075370_10098523 | |||
| 1952 | Ga0075370_10214290 | |||
| 1953 | Ga0068871_100390412 | |||
| 1954 | Ga0068871_100499942 | |||
| 1955 | Ga0068871_100652731 | |||
| 1956 | Ga0068871_100719567 | |||
| 1957 | Ga0075428_100034276 | |||
| 1958 | Ga0075428_100065050 | |||
| 1959 | Ga0075428_100377530 | |||
| 1960 | Ga0075430_100003256 | |||
| 1961 | Ga0075430_100008450 | |||
| 1962 | Ga0075431_100002635 | |||
| 1963 | Ga0075431_100005152 | |||
| 1964 | Ga0075431_100249131 | |||
| 1965 | Ga0075431_101162642 | |||
| 1966 | Ga0075433_10396971 | |||
| 1967 | Ga0075434_100598770 | |||
| 1968 | Ga0075429_100029205 | |||
| 1969 | Ga0075429_100539156 | |||
| 1970 | Ga0068865_100340725 | |||
| 1971 | Ga0075436_100159844 | |||
| 1972 | Ga0075436_100399373 | |||
| 1973 | Ga0097620_100000206 | |||
| 1974 | Ga0097620_100022208 | |||
| 1975 | Ga0097620_100149620 | |||
| 1976 | Ga0097620_100210080 | |||
| 1977 | Ga0097620_100599522 | |||
| 1978 | Ga0099824_1020485 | |||
| 1979 | Ga0099823_1000159 | |||
| 1980 | Ga0075435_100067945 | |||
| 1981 | Ga0075435_100276952 | |||
| 1982 | Ga0099794_10095570 | |||
| 1983 | Ga0099794_10177106 | |||
| 1984 | Ga0099794_10211826 | |||
| 1985 | Ga0099795_10017622 | |||
| 1986 | Ga0099795_10100443 | |||
| 1987 | Ga0105250_10028249 | |||
| 1988 | Ga0105240_10004109 | |||
| 1989 | Ga0105240_10006884 | |||
| 1990 | Ga0105240_10007517 | |||
| 1991 | Ga0105240_10378469 | |||
| 1992 | Ga0105240_10986428 | |||
| 1993 | Ga0111539_10433569 | |||
| 1994 | Ga0111539_10509493 | |||
| 1995 | Ga0105245_10023295 | |||
| 1996 | Ga0105245_10243558 | |||
| 1997 | Ga0105247_10000088 | |||
| 1998 | Ga0105247_10037140 | |||
| 1999 | Ga0114129_10080790 | |||
| 2000 | Ga0114129_10226450 | |||
| 2001 | Ga0105243_10304844 | |||
| 2002 | Ga0105241_10002534 | |||
| 2003 | Ga0105241_10056815 | |||
| 2004 | Ga0105241_10117210 | |||
| 2005 | Ga0105241_10369194 | |||
| 2006 | Ga0105241_10503693 | |||
| 2007 | Ga0105241_10557055 | |||
| 2008 | Ga0105241_10590319 | |||
| 2009 | Ga0105242_10955988 | |||
| 2010 | Ga0105248_10040166 | |||
| 2011 | Ga0105248_10800594 | |||
| 2012 | Ga0105248_10847988 | |||
| 2013 | Ga0105237_10108162 | |||
| 2014 | Ga0105237_10111732 | |||
| 2015 | Ga0105237_10141359 | |||
| 2016 | Ga0105237_10231894 | |||
| 2017 | Ga0105237_10433139 | |||
| 2018 | Ga0105237_10596895 | |||
| 2019 | Ga0105238_10001191 | |||
| 2020 | Ga0105238_10004162 | |||
| 2021 | Ga0105238_10152200 | |||
| 2022 | Ga0105238_10199197 | |||
| 2023 | Ga0105238_10319332 | |||
| 2024 | Ga0105238_10678669 | |||
| 2025 | Ga0105238_10840998 | |||
| 2026 | Ga0105238_10942235 | |||
| 2027 | Ga0105249_10041598 | |||
| 2028 | Ga0105249_10396614 | |||
| 2029 | Ga0105249_10461447 | |||
| 2030 | Ga0105249_10972474 | |||
| 2031 | Ga0105249_11037232 | |||
| 2032 | Ga0105249_11732008 | |||
| 2033 | Ga0099796_10061171 | |||
| 2034 | Ga0105239_10033506 | |||
| 2035 | Ga0105239_10126755 | |||
| 2036 | Ga0105239_10129504 | |||
| 2037 | Ga0105239_10133572 | |||
| 2038 | Ga0105239_10140807 | |||
| 2039 | Ga0105239_10500351 | |||
| 2040 | Ga0105246_10011299 | |||
| 2041 | Ga0105246_10267874 | |||
| 2042 | Ga0105246_10461059 | |||
| 2043 | Ga0105246_10488503 | |||
| 2044 | Ga0157319_1000015 | |||
| 2045 | Ga0157373_10310421 | |||
| 2046 | Ga0157370_10080792 | |||
| 2047 | Ga0157370_10680539 | |||
| 2048 | Ga0157369_10082169 | |||
| 2049 | Ga0157369_10226457 | |||
| 2050 | Ga0157374_10212671 | |||
| 2051 | Ga0157374_10329455 | |||
| 2052 | Ga0157374_10417474 | |||
| 2053 | Ga0157374_10436252 | |||
| 2054 | Ga0163162_10255848 | |||
| 2055 | Ga0163162_10404593 | |||
| 2056 | Ga0163162_10756192 | |||
| 2057 | Ga0157372_10250867 | |||
| 2058 | Ga0157372_10538428 | |||
| 2059 | Ga0157372_11177496 | |||
| 2060 | Ga0157375_10020701 | |||
| 2061 | Ga0157375_10161601 | |||
| 2062 | Ga0163163_10026516 | |||
| 2063 | Ga0163163_10436090 | |||
| 2064 | Ga0163163_11263290 | |||
| 2065 | Ga0163163_11469439 | |||
| 2066 | Ga0157380_10389449 | |||
| 2067 | Ga0157380_10496500 | |||
| 2068 | Ga0157379_10059904 | |||
| 2069 | Ga0157379_10138347 | |||
| 2070 | Ga0157379_10209971 | |||
| 2071 | Ga0157379_10338134 | |||
| 2072 | Ga0157379_10525540 | |||
| 2073 | Ga0157379_10592968 | |||
| 2074 | Ga0157376_10375316 | |||
| 2075 | Ga0157376_10474953 | |||
| 2076 | Ga0157376_10858747 | |||
| 2077 | Ga0163161_10051818 | |||
| 2078 | Ga0163161_10157812 | |||
| 2079 | Ga0214544_1000001 | |||
| 2080 | Ga0214542_1000005 | |||
| 2081 | Ga0214545_1000003 | |||
| 2082 | Ga0214543_1000002 | |||
| 2083 | Ga0213874_10016178 | |||
| 2084 | Ga0213876_10133106 | |||
| 2085 | Ga0213875_10084537 | |||
| 2086 | Ga0213871_10003352 | |||
| 2087 | Ga0224572_1004877 | |||
| 2088 | Ga0209563_102960 | |||
| 2089 | Ga0207425_1004681 | |||
| 2090 | Ga0209677_100732 | |||
| 2091 | Ga0209677_105587 | |||
| 2092 | Ga0209148_1000424 | |||
| 2093 | Ga0209148_1023745 | |||
| 2094 | Ga0209233_1002009 | |||
| 2095 | Ga0209455_1002336 | |||
| 2096 | Ga0209455_1003026 | |||
| 2097 | Ga0209455_1016893 | |||
| 2098 | Ga0209673_1005096 | |||
| 2099 | Ga0209673_1039730 | |||
| 2100 | Ga0209130_1035841 | |||
| 2101 | Ga0209564_1005101 | |||
| 2102 | Ga0209564_1013333 | |||
| 2103 | Ga0209758_1000026 | |||
| 2104 | Ga0209758_1000613 | |||
| 2105 | Ga0209758_1000880 | |||
| 2106 | Ga0209758_1001679 | |||
| 2107 | Ga0209758_1002992 | |||
| 2108 | Ga0209758_1020502 | |||
| 2109 | Ga0209758_1070085 | |||
| 2110 | Ga0209758_1072679 | |||
| 2111 | Ga0209050_1005153 | |||
| 2112 | Ga0209256_1000394 | |||
| 2113 | Ga0209256_1000665 | |||
| 2114 | Ga0209256_1003785 | |||
| 2115 | Ga0207426_1000425 | |||
| 2116 | Ga0207426_1009082 | |||
| 2117 | Ga0207426_1015297 | |||
| 2118 | Ga0209051_1001627 | |||
| 2119 | Ga0209257_1000426 | |||
| 2120 | Ga0209257_1002239 | |||
| 2121 | Ga0209257_1002312 | |||
| 2122 | Ga0207656_10047458 | |||
| 2123 | Ga0207653_10158684 | |||
| 2124 | Ga0207682_10003055 | |||
| 2125 | Ga0207692_10000488 | |||
| 2126 | Ga0207692_10000857 | |||
| 2127 | Ga0207692_10022931 | |||
| 2128 | Ga0207692_10314398 | |||
| 2129 | Ga0207642_10552515 | |||
| 2130 | Ga0207710_10000205 | |||
| 2131 | Ga0207710_10037281 | |||
| 2132 | Ga0207688_10014539 | |||
| 2133 | Ga0207688_10015986 | |||
| 2134 | Ga0207688_10161197 | |||
| 2135 | Ga0207680_10119839 | |||
| 2136 | Ga0207680_10223895 | |||
| 2137 | Ga0207647_10000220 | |||
| 2138 | Ga0207647_10046056 | |||
| 2139 | Ga0207647_10231752 | |||
| 2140 | Ga0207699_10001075 | |||
| 2141 | Ga0207699_10061939 | |||
| 2142 | Ga0207699_10201177 | |||
| 2143 | Ga0207645_10067417 | |||
| 2144 | Ga0207645_10182847 | |||
| 2145 | Ga0207645_10217012 | |||
| 2146 | Ga0207645_10606027 | |||
| 2147 | Ga0207643_10044593 | |||
| 2148 | Ga0207684_10373494 | |||
| 2149 | Ga0207654_10000081 | |||
| 2150 | Ga0207654_10017803 | |||
| 2151 | Ga0207654_10092583 | |||
| 2152 | Ga0207654_10104057 | |||
| 2153 | Ga0207654_10159853 | |||
| 2154 | Ga0207654_10692299 | |||
| 2155 | Ga0207707_10000178 | |||
| 2156 | Ga0207707_10019742 | |||
| 2157 | Ga0207707_10071082 | |||
| 2158 | Ga0207707_10187064 | |||
| 2159 | Ga0207707_10251777 | |||
| 2160 | Ga0207707_10437840 | |||
| 2161 | Ga0207695_10000792 | |||
| 2162 | Ga0207695_10002487 | |||
| 2163 | Ga0207695_10082664 | |||
| 2164 | Ga0207695_10087886 | |||
| 2165 | Ga0207671_10008093 | |||
| 2166 | Ga0207671_10033736 | |||
| 2167 | Ga0207671_10044293 | |||
| 2168 | Ga0207671_10294072 | |||
| 2169 | Ga0207671_10659455 | |||
| 2170 | Ga0207693_10060906 | |||
| 2171 | Ga0207693_10194705 | |||
| 2172 | Ga0207693_10518640 | |||
| 2173 | Ga0207693_10784005 | |||
| 2174 | Ga0207663_10095110 | |||
| 2175 | Ga0207663_10140180 | |||
| 2176 | Ga0207660_10041651 | |||
| 2177 | Ga0207660_10073413 | |||
| 2178 | Ga0207662_10048779 | |||
| 2179 | Ga0207657_10042401 | |||
| 2180 | Ga0207657_10124247 | |||
| 2181 | Ga0207657_10663718 | |||
| 2182 | Ga0207649_10250247 | |||
| 2183 | Ga0207652_10200952 | |||
| 2184 | Ga0207652_10391561 | |||
| 2185 | Ga0207681_10280630 | |||
| 2186 | Ga0207694_10000134 | |||
| 2187 | Ga0207694_10018077 | |||
| 2188 | Ga0207650_10006480 | |||
| 2189 | Ga0207650_10356241 | |||
| 2190 | Ga0207650_10656616 | |||
| 2191 | Ga0207659_10062440 | |||
| 2192 | Ga0207659_10110192 | |||
| 2193 | Ga0207659_10165245 | |||
| 2194 | Ga0207659_10166988 | |||
| 2195 | Ga0207687_10021001 | |||
| 2196 | Ga0207687_10076758 | |||
| 2197 | Ga0207687_10117251 | |||
| 2198 | Ga0207700_10006387 | |||
| 2199 | Ga0207700_10025306 | |||
| 2200 | Ga0207700_10211906 | |||
| 2201 | Ga0207700_10309784 | |||
| 2202 | Ga0207700_10386625 | |||
| 2203 | Ga0207700_10409095 | |||
| 2204 | Ga0207700_10422184 | |||
| 2205 | Ga0207700_10604217 | |||
| 2206 | Ga0207664_10008339 | |||
| 2207 | Ga0207664_10051200 | |||
| 2208 | Ga0207664_10125084 | |||
| 2209 | Ga0207664_10539369 | |||
| 2210 | Ga0207664_10598778 | |||
| 2211 | Ga0207644_10009052 | |||
| 2212 | Ga0207644_10010871 | |||
| 2213 | Ga0207644_10235234 | |||
| 2214 | Ga0207644_10792522 | |||
| 2215 | Ga0207706_10025374 | |||
| 2216 | Ga0207706_10105930 | |||
| 2217 | Ga0207706_10387884 | |||
| 2218 | Ga0207686_10075811 | |||
| 2219 | Ga0207709_10242467 | |||
| 2220 | Ga0207709_10313806 | |||
| 2221 | Ga0207670_10032892 | |||
| 2222 | Ga0207670_10264080 | |||
| 2223 | Ga0207669_10146654 | |||
| 2224 | Ga0207669_10534670 | |||
| 2225 | Ga0207665_10010001 | |||
| 2226 | Ga0207665_10014958 | |||
| 2227 | Ga0207665_10167266 | |||
| 2228 | Ga0207665_10233958 | |||
| 2229 | Ga0207665_10545099 | |||
| 2230 | Ga0207691_10000698 | |||
| 2231 | Ga0207691_10357503 | |||
| 2232 | Ga0207691_10407572 | |||
| 2233 | Ga0207691_10776048 | |||
| 2234 | Ga0207711_10017689 | |||
| 2235 | Ga0207661_10004454 | |||
| 2236 | Ga0207661_10025602 | |||
| 2237 | Ga0207661_10240481 | |||
| 2238 | Ga0207679_10123560 | |||
| 2239 | Ga0207679_10572923 | |||
| 2240 | Ga0207667_10008395 | |||
| 2241 | Ga0207667_10062284 | |||
| 2242 | Ga0207667_10098987 | |||
| 2243 | Ga0207667_10244331 | |||
| 2244 | Ga0207651_10179912 | |||
| 2245 | Ga0207712_10290484 | |||
| 2246 | Ga0207712_10490877 | |||
| 2247 | Ga0207668_10144482 | |||
| 2248 | Ga0207668_10394476 | |||
| 2249 | Ga0207640_10011779 | |||
| 2250 | Ga0207640_10032524 | |||
| 2251 | Ga0207640_10513349 | |||
| 2252 | Ga0207658_10047097 | |||
| 2253 | Ga0207658_10432628 | |||
| 2254 | Ga0207658_10504302 | |||
| 2255 | Ga0207677_10123528 | |||
| 2256 | Ga0207677_10146925 | |||
| 2257 | Ga0207703_10002506 | |||
| 2258 | Ga0207703_10089825 | |||
| 2259 | Ga0207703_10097235 | |||
| 2260 | Ga0207703_10125220 | |||
| 2261 | Ga0207703_10364295 | |||
| 2262 | Ga0207703_10552775 | |||
| 2263 | Ga0207703_10683644 | |||
| 2264 | Ga0207639_10028198 | |||
| 2265 | Ga0207639_10063368 | |||
| 2266 | Ga0207639_10152276 | |||
| 2267 | Ga0207639_10160206 | |||
| 2268 | Ga0207639_10451595 | |||
| 2269 | Ga0207678_10023360 | |||
| 2270 | Ga0207678_10040710 | |||
| 2271 | Ga0207678_10263659 | |||
| 2272 | Ga0207678_10266186 | |||
| 2273 | Ga0207678_10441853 | |||
| 2274 | Ga0207678_10565382 | |||
| 2275 | Ga0207708_10505868 | |||
| 2276 | Ga0207708_10970513 | |||
| 2277 | Ga0207702_10000041 | |||
| 2278 | Ga0207702_10000180 | |||
| 2279 | Ga0207702_10008051 | |||
| 2280 | Ga0207641_10791698 | |||
| 2281 | Ga0207648_10135849 | |||
| 2282 | Ga0207648_10175136 | |||
| 2283 | Ga0207648_10478752 | |||
| 2284 | Ga0207648_10894958 | |||
| 2285 | Ga0207676_10024491 | |||
| 2286 | Ga0207676_10066448 | |||
| 2287 | Ga0207676_10264901 | |||
| 2288 | Ga0207674_10001084 | |||
| 2289 | Ga0207674_10004586 | |||
| 2290 | Ga0207674_10046856 | |||
| 2291 | Ga0207674_10276058 | |||
| 2292 | Ga0207674_10753848 | |||
| 2293 | Ga0207675_100029542 | |||
| 2294 | Ga0207675_100236585 | |||
| 2295 | Ga0207675_100395269 | |||
| 2296 | Ga0207675_100400597 | |||
| 2297 | Ga0207683_10025663 | |||
| 2298 | Ga0207683_10047657 | |||
| 2299 | Ga0207683_10223487 | |||
| 2300 | Ga0207683_10715959 | |||
| 2301 | Ga0207683_10751715 | |||
| 2302 | Ga0207698_10158401 | |||
| 2303 | Ga0207698_10615903 | |||
| 2304 | Ga0207698_10632251 | |||
| 2305 | Ga0209389_1000090 | |||
| 2306 | Ga0209389_1000119 | |||
| 2307 | Ga0209371_1009241 | |||
| 2308 | Ga0209589_1000010 | |||
| 2309 | Ga0209489_100011 | |||
| 2310 | Ga0209489_100385 | |||
| 2311 | Ga0209700_100013 | |||
| 2312 | Ga0209970_1000101 | |||
| 2313 | Ga0209588_1054177 | |||
| 2314 | Ga0209813_10001497 | |||
| 2315 | Ga0209813_10066346 | |||
| 2316 | Ga0265355_1000790 | |||
| 2317 | Ga0268266_10005802 | |||
| 2318 | Ga0268266_10055170 | |||
| 2319 | Ga0268266_10528405 | |||
| 2320 | Ga0268266_10623795 | |||
| 2321 | Ga0268266_10645702 | |||
| 2322 | Ga0268266_10748518 | |||
| 2323 | Ga0268265_10046489 | |||
| 2324 | Ga0268265_10084689 | |||
| 2325 | Ga0268265_10148699 | |||
| 2326 | Ga0268265_10263512 | |||
| 2327 | Ga0268265_11018659 | |||
| 2328 | Ga0268264_10000093 | |||
| 2329 | Ga0268264_10100469 | |||
| 2330 | Ga0268264_10154241 | |||
| 2331 | Ga0265337_1002785 | |||
| 2332 | Ga0265326_10001368 | |||
| 2333 | Ga0265319_1002644 | |||
| 2334 | Ga0265334_10013730 | |||
| 2335 | Ga0265318_10005911 | |||
| 2336 | Ga0265323_10004952 | |||
| 2337 | Ga0265322_10005073 | |||
| 2338 | Ga0265336_10000169 | |||
| 2339 | Ga0307517_10003969 | |||
| 2340 | Ga0307515_10000040 | |||
| 2341 | Ga0307515_10000433 | |||
| 2342 | Ga0265338_10000624 | |||
| 2343 | Ga0265324_10005252 | |||
| 2344 | Ga0268256_1009760 | |||
| 2345 | Ga0307511_10000022 | |||
| 2346 | Ga0307511_10000448 | |||
| 2347 | Ga0307511_10155467 | |||
| 2348 | Ga0307512_10177664 | |||
| 2349 | Ga0265763_1000840 | |||
| 2350 | Ga0265770_1000728 | |||
| 2351 | Ga0265765_1020014 | |||
| 2352 | Ga0265773_1003679 | |||
| 2353 | Ga0265760_10000431 | |||
| 2354 | Ga0265330_10106670 | |||
| 2355 | Ga0265332_10145336 | |||
| 2356 | Ga0265320_10049671 | |||
| 2357 | Ga0265320_10217099 | |||
| 2358 | Ga0265325_10003656 | |||
| 2359 | Ga0265325_10025892 | |||
| 2360 | Ga0265329_10020107 | |||
| 2361 | Ga0265340_10011120 | |||
| 2362 | Ga0265340_10042738 | |||
| 2363 | Ga0265340_10044657 | |||
| 2364 | Ga0265340_10150268 | |||
| 2365 | Ga0265339_10000158 | |||
| 2366 | Ga0265339_10151289 | |||
| 2367 | Ga0265327_10001335 | |||
| 2368 | Ga0265316_10126964 | |||
| 2369 | Ga0265316_10292396 | |||
| 2370 | Ga0265316_10610113 | |||
| 2371 | Ga0307513_10032139 | |||
| 2372 | Ga0307513_10077494 | |||
| 2373 | Ga0307513_10217751 | |||
| 2374 | Ga0307513_10568487 | |||
| 2375 | Ga0307509_10000003 | |||
| 2376 | Ga0307509_10131732 | |||
| 2377 | Ga0307509_10141543 | |||
| 2378 | Ga0307509_10380853 | |||
| 2379 | Ga0307408_100040215 | |||
| 2380 | Ga0265313_10000426 | |||
| 2381 | Ga0265313_10013755 | |||
| 2382 | Ga0307508_10000501 | |||
| 2383 | Ga0307514_10000662 | |||
| 2384 | Ga0307514_10001541 | |||
| 2385 | Ga0265314_10012027 | |||
| 2386 | Ga0265314_10172596 | |||
| 2387 | Ga0265314_10183498 | |||
| 2388 | Ga0265342_10034197 | |||
| 2389 | Ga0265342_10053047 | |||
| 2390 | Ga0307516_10006301 | |||
| 2391 | Ga0307516_10057831 | |||
| 2392 | Ga0307516_10436154 | |||
| 2393 | Ga0307413_10193843 | |||
| 2394 | Ga0307406_10322270 | |||
| 2395 | Ga0307406_10607269 | |||
| 2396 | Ga0307406_10959092 | |||
| 2397 | Ga0307406_10998288 | |||
| 2398 | Ga0307412_10549067 | |||
| 2399 | Ga0307409_100257156 | |||
| 2400 | Ga0307416_100230868 | |||
| 2401 | Ga0307411_10088379 | |||
| 2402 | Ga0307415_100173160 | |||
| 2403 | Ga0307415_100322348 | |||
| 2404 | Ga0307507_10026407 | |||
| 2405 | Ga0307507_10099921 | |||
| 2406 | Ga0307510_10049005 | |||
| 2407 | Ga0307510_10081087 | |||
| 2408 | Ga0316214_1008501 | |||
| 2409 | Ga0373938_0003935 | |||
| 2410 | Ga0373926_0094914 | |||
| 2411 | Ga0373926_0128461 | |||
| 2412 | Ga0373926_0160634 | |||
| 2413 | Ga0373934_0003996 | |||
| 2414 | Ga0373934_0199755 | |||
| 2415 | Ga0373944_0032747 | |||
| 2416 | Ga0373944_0106958 | |||
| 2417 | Ga0373949_0030173 | |||
| 2418 | Ga0373923_0000165 | |||
| 2419 | Ga0373923_0004503 | |||
| 2420 | Ga0373923_0018585 | |||
| 2421 | Ga0373923_0121252 | |||
| 2422 | Ga0373932_0146480 | |||
| 2423 | Ga0373936_0011221 | |||
| 2424 | Ga0373936_0015552 | |||
| 2425 | Ga0373936_0101340 | |||
| 2426 | Ga0373945_0060670 | |||
| 2427 | Ga0373953_0001078 | |||
| 2428 | Ga0373953_0104995 | |||
| 2429 | Ga0373954_0000260 | |||
| 2430 | Ga0373954_0005989 | |||
| 2431 | Ga0373954_0009341 | |||
| 2432 | Ga0373956_0001075 | |||
| 2433 | Ga0373957_0002893 | |||
| 2434 | Ga0373957_0003647 | |||
| 2435 | Ga0373957_0008300 | |||
| 2436 | Ga0373960_0162529 | |||
| 2437 | Ga0373946_0062775 | |||
| 2438 | Ga0373946_0098579 | |||
| 2439 | Ga0373946_0326325 | |||
| 2440 | Ga0373955_0001777 | |||
| 2441 | Ga0373955_0008401 | |||
| 2442 | Ga0316574_0128357 | |||
| 2443 | Ga0373924_0001923 | |||
| 2444 | Ga0373924_0006876 | |||
| 2445 | Ga0373931_0091988 | |||
| 2446 | Ga0373935_0000353 | |||
| 2447 | Ga0373935_0005100 | |||
| 2448 | Ga0373935_0008475 | |||
| 2449 | Ga0373935_0014443 | |||
| 2450 | Ga0373935_0055839 | |||
| 2451 | Ga0373927_0001254 | |||
| 2452 | Ga0373927_0008448 | |||
| 2453 | Ga0373927_0114331 | |||
| 2454 | Ga0373927_0215731 | |||
| 2455 | Ga0373927_0447223 | |||
| 2456 | Ga0373933_0004010 | |||
| 2457 | Ga0373933_0045081 | |||
| 2458 | Ga0373933_0244233 | |||
| 2459 | Ga0373947_0012509 | |||
| 2460 | Ga0373947_0030732 | |||
| 2461 | Ga0373947_0294280 | |||
| 2462 | Ga0373947_0785591 | |||
| 2463 | Ga0373937_0083363 | |||
| 2464 | Ga0373937_0147496 | |||
| 2465 | Ga0373937_0961177 | |||
| 2466 | Ga0373925_0003844 | |||
| 2467 | Ga0373925_0008725 | |||
| 2468 | Ga0373925_0134855 | |||
| 2469 | Ga0373925_0315611 | |||
| 2470 | Ga0395900_0036595 | |||
| 2471 | Ga0395900_0390946 | |||
| 2472 | Ga0395898_0012280 | |||
| 2473 | Ga0395898_0020773 | |||
| 2474 | Ga0395898_0031282 | |||
| 2475 | Ga0395905_0005034 | |||
| 2476 | Ga0395905_0125094 | |||
| 2477 | Ga0436364_0101562 | |||
| 2478 | Ga0436364_0214101 | |||
| 2479 | Ga0436364_0814306 | |||
| 2480 | Ga0395901_0042972 | |||
| 2481 | Ga0395901_0077854 | |||
| 2482 | Ga0395901_0430844 | |||
| 2483 | Ga0436365_0751202 | |||
| 2484 | Ga0436365_0757494 | |||
| 2485 | Ga0436365_1050534 | |||
| 2486 | Ga0436365_1113004 | |||
| 2487 | Ga0436365_1316409 | |||
| 2488 | Ga0436365_1377083 | |||
| 2489 | Ga0436365_1732811 | |||
| 2490 | Ga0436365_1915185 | |||
| 2491 | Ga0436360_0362794 | |||
| 2492 | Ga0436360_0674534 | |||
| 2493 | Ga0436361_0774376 | |||
| 2494 | Ga0436363_0472452 | |||
| 2495 | Ga0436363_0486884 | |||
| 2496 | Ga0436363_0823763 | |||
| 2497 | Ga0436362_0713937 | |||
| 2498 | Ga0451793_0637898 | |||
| 2499 | Ga0451800_0317729 | |||
| 2500 | Ga0451807_0379786 | |||
| 2501 | Ga0451837_0000079 | |||
| 2502 | Ga0450890_002431 | |||
| 2503 | Ga0439446_0030138 | |||
| 2504 | Ga0451577_0831056 | |||
| 2505 | Ga0466972_0000090 | |||
| 2506 | Ga0466972_0022537 | |||
| 2507 | Ga0466972_0174536 | |||
| 2508 | Ga0466966_0002487 | |||
| 2509 | Ga0466966_0288628 | |||
| 2510 | Ga0466961_0000081 | |||
| 2511 | Ga0466963_0059425 | |||
| 2512 | Ga0466963_0103431 | |||
| 2513 | Ga0466964_0140411 | |||
| 2514 | Ga0466971_0085562 | |||
| 2515 | Ga0466957_0045181 | |||
| 2516 | Ga0466959_0033379 | |||
| 2517 | Ga0466967_0299724 | |||
| 2518 | Ga0466967_0397999 | |||
| 2519 | Ga0466967_0479546 | |||
| 2520 | Ga0466967_0784865 | |||
| 2521 | Ga0495592_0003370 | |||
| 2522 | Ga0495592_0027243 | |||
| 2523 | Ga0495592_0068885 | |||
| 2524 | Ga0495592_0165805 | |||
| 2525 | Ga0495592_0166031 | |||
| 2526 | Ga0495603_0009474 | |||
| 2527 | Ga0495603_0135893 | |||
| 2528 | Ga0495603_0139253 | |||
| 2529 | Ga0495590_0041795 | |||
| 2530 | Ga0495590_0089197 | |||
| 2531 | Ga0495590_0098789 | |||
| 2532 | Ga0495629_0000226 | |||
| 2533 | Ga0495629_0018660 | |||
| 2534 | Ga0495629_0036628 | |||
| 2535 | Ga0495629_0156541 | |||
| 2536 | Ga0495629_0243497 | |||
| 2537 | Ga0495638_0010518 | |||
| 2538 | Ga0495638_0012364 | |||
| 2539 | Ga0495638_0135238 | |||
| 2540 | Ga0495638_0231151 | |||
| 2541 | Ga0495641_0001402 | |||
| 2542 | Ga0495641_0022355 | |||
| 2543 | Ga0495641_0075719 | |||
| 2544 | Ga0495651_0011108 | |||
| 2545 | Ga0495651_0012131 | |||
| 2546 | Ga0495651_0013785 | |||
| 2547 | Ga0495651_0019499 | |||
| 2548 | Ga0495651_0021122 | |||
| 2549 | Ga0495653_0125116 | |||
| 2550 | Ga0495653_0199815 | |||
| 2551 | Ga0495653_0350629 | |||
| 2552 | Ga0495650_0121346 | |||
| 2553 | Ga0495650_0123108 | |||
| 2554 | Ga0495580_0019535 | |||
| 2555 | Ga0495580_0024592 | |||
| 2556 | Ga0495582_0000106 | |||
| 2557 | Ga0495605_0097459 | |||
| 2558 | Ga0495605_0114083 | |||
| 2559 | Ga0495639_0000170 | |||
| 2560 | Ga0495639_0014214 | |||
| 2561 | Ga0495639_0121414 | |||
| 2562 | Ga0495662_0000901 | |||
| 2563 | Ga0495662_0060425 | |||
| 2564 | Ga0495664_0017874 | |||
| 2565 | Ga0495664_0019572 | |||
| 2566 | Ga0495664_0020424 | |||
| 2567 | Ga0495664_0195945 | |||
| 2568 | Ga0495584_0097453 | |||
| 2569 | Ga0495584_0121322 | |||
| 2570 | Ga0495584_0175040 | |||
| 2571 | Ga0495584_0259743 | |||
| 2572 | Ga0495585_0060023 | |||
| 2573 | Ga0495585_0172338 | |||
| 2574 | Ga0495594_0000410 | |||
| 2575 | Ga0495594_0071925 | |||
| 2576 | Ga0495594_0103711 | |||
| 2577 | Ga0495594_0185809 | |||
| 2578 | Ga0495594_0202371 | |||
| 2579 | Ga0495606_0039928 | |||
| 2580 | Ga0495606_0126209 | |||
| 2581 | Ga0495606_0131462 | |||
| 2582 | Ga0495608_0010478 | |||
| 2583 | Ga0495608_0039371 | |||
| 2584 | Ga0495608_0117029 | |||
| 2585 | Ga0495608_0266059 | |||
| 2586 | Ga0495616_0053102 | |||
| 2587 | Ga0495618_0198968 | |||
| 2588 | Ga0495618_0240578 | |||
| 2589 | Ga0495628_0034766 | |||
| 2590 | Ga0495628_0048266 | |||
| 2591 | Ga0495628_0062339 | |||
| 2592 | Ga0495628_0065885 | |||
| 2593 | Ga0495628_0124504 | |||
| 2594 | Ga0495628_0142482 | |||
| 2595 | Ga0495628_0252540 | |||
| 2596 | Ga0495630_0002054 | |||
| 2597 | Ga0495630_0003128 | |||
| 2598 | Ga0495631_0129242 | |||
| 2599 | Ga0495632_0041192 | |||
| 2600 | Ga0495643_0020565 | |||
| 2601 | Ga0495643_0309441 | |||
| 2602 | Ga0495648_0312185 | |||
| 2603 | Ga0495666_0034381 | |||
| 2604 | Ga0495642_0041494 | |||
| 2605 | Ga0495652_0024980 | |||
| 2606 | Ga0495652_0075447 | |||
| 2607 | Ga0495652_0090736 | |||
| 2608 | Ga0495652_0128952 | |||
| 2609 | Ga0495652_0238843 | |||
| 2610 | Ga0495652_0266349 | |||
| 2611 | Ga0495652_0460694 | |||
| 2612 | Ga0495665_0001435 | |||
| 2613 | Ga0495665_0021219 | |||
| 2614 | Ga0495665_0025497 | |||
| 2615 | Ga0495665_0174022 | |||
| 2616 | Ga0495640_0001153 | |||
| 2617 | Ga0495640_0014225 | |||
| 2618 | Ga0495640_0021578 | |||
| 2619 | Ga0495640_0028306 | |||
| 2620 | Ga0495640_0043972 | |||
| 2621 | Ga0495640_0061392 | |||
| 2622 | Ga0495640_0091895 | |||
| 2623 | Ga0495586_0006037 | |||
| 2624 | Ga0495586_0089167 | |||
| 2625 | Ga0495586_0307023 | |||
| 2626 | Ga0495587_0044282 | |||
| 2627 | Ga0495587_0165677 | |||
| 2628 | Ga0495621_0025902 | |||
| 2629 | Ga0495597_0073434 | |||
| 2630 | Ga0495597_0145087 | |||
| 2631 | Ga0495645_0007549 | |||
| 2632 | Ga0495645_0010186 | |||
| 2633 | Ga0495645_0012442 | |||
| 2634 | Ga0495645_0035959 | |||
| 2635 | Ga0495645_0055187 | |||
| 2636 | Ga0495622_0002206 | |||
| 2637 | Ga0495622_0086870 | |||
| 2638 | Ga0495622_0300562 | |||
| 2639 | Ga0495633_0123301 | |||
| 2640 | Ga0495667_0021690 | |||
| 2641 | Ga0495667_0044847 | |||
| 2642 | Ga0495667_0055246 | |||
| 2643 | Ga0495656_0059118 | |||
| 2644 | Ga0495656_0092628 | |||
| 2645 | Ga0495656_0412453 | |||
| 2646 | Ga0495668_0234909 | |||
| 2647 | Ga0495668_0239031 | |||
| 2648 | Ga0495634_0001983 | |||
| 2649 | Ga0495634_0151465 | |||
| 2650 | Ga0495634_0220325 | |||
| 2651 | Ga0495634_0270931 | |||
| 2652 | Ga0495625_0035865 | |||
| 2653 | Ga0495625_0142804 | |||
| 2654 | Ga0495625_0433559 | |||
| 2655 | Ga0495635_0000551 | |||
| 2656 | Ga0495635_0000794 | |||
| 2657 | Ga0495635_0011793 | |||
| 2658 | Ga0495635_0117210 | |||
| 2659 | Ga0495635_0118079 | |||
| 2660 | Ga0495635_0154987 | |||
| 2661 | Ga0495659_0010438 | |||
| 2662 | Ga0495659_0107646 | |||
| 2663 | Ga0495661_0113850 | |||
| 2664 | Ga0495657_0001697 | |||
| 2665 | Ga0495657_0010679 | |||
| 2666 | Ga0495657_0014502 | |||
| 2667 | Ga0495599_0000991 | |||
| 2668 | Ga0495599_0001294 | |||
| 2669 | Ga0495599_0005248 | |||
| 2670 | Ga0495599_0048745 | |||
| 2671 | Ga0495599_0445237 | |||
| 2672 | Ga0495623_0008013 | |||
| 2673 | Ga0495623_0075818 | |||
| 2674 | Ga0495646_0018652 | |||
| 2675 | Ga0495646_0155273 | |||
| 2676 | Ga0495646_0318109 | |||
| 2677 | Ga0495647_0000487 | |||
| 2678 | Ga0495647_0058022 | |||
| 2679 | Ga0495647_0059450 | |||
| 2680 | Ga0495658_0018960 | |||
| 2681 | Ga0495669_0038533 | |||
| 2682 | Ga0495613_0009914 | |||
| 2683 | Ga0495613_0012442 | |||
| 2684 | Ga0495613_0024790 | |||
| 2685 | Ga0495613_0039795 | |||
| 2686 | Ga0495613_0287016 | |||
| 2687 | Ga0495613_0292150 | |||
| 2688 | Ga0495624_0009177 | |||
| 2689 | Ga0495624_0074184 | |||
| 2690 | Ga0495624_0103271 | |||
| 2691 | Ga0495624_0161541 | |||
| 2692 | Ga0495624_0224829 | |||
| 2693 | Ga0495624_0466601 | |||
| 2694 | Ga0495649_0004829 | |||
| 2695 | Ga0495600_0044747 | |||
| 2696 | Ga0495600_0106410 | |||
| 2697 | Ga0495600_0336289 | |||
| 2698 | Ga0495600_0427951 | |||
| 2699 | Ga0495660_0190467 | |||
| 2700 | Ga0495581_0000010 | |||
| 2701 | Ga0495581_0014969 | |||
| 2702 | Ga0495581_0024470 | |||
| 2703 | Ga0495604_0003777 | |||
| 2704 | Ga0495604_0010950 | |||
| 2705 | Ga0495604_0037419 | |||
| 2706 | Ga0495604_0047723 | |||
| 2707 | Ga0495604_0172676 | |||
| 2708 | Ga0495636_0240436 | |||
| 2709 | Ga0495674_0000082 | |||
| 2710 | Ga0495674_0001491 | |||
| 2711 | Ga0495674_0036604 | |||
| 2712 | Ga0495674_0073409 | |||
| 2713 | Ga0495674_0206208 | |||
| 2714 | Ga0495672_0022035 | |||
| 2715 | Ga0495672_0114834 | |||
| 2716 | Ga0495676_0114381 | |||
| 2717 | Ga0495676_0130801 | |||
| 2718 | Ga0495680_0002698 | |||
| 2719 | Ga0495680_0014505 | |||
| 2720 | Ga0495680_0173431 | |||
| 2721 | Ga0495680_0296230 | |||
| 2722 | Ga0495680_0399496 | |||
| 2723 | Ga0495683_0083409 | |||
| 2724 | Ga0495687_041243 | |||
| 2725 | Ga0495687_044725 | |||
| 2726 | Ga0495675_0004242 | |||
| 2727 | Ga0495675_0039121 | |||
| 2728 | Ga0495679_066436 | |||
| 2729 | Ga0495673_0108674 | |||
| 2730 | Ga0495684_0004100 | |||
| 2731 | Ga0495684_0023587 | |||
| 2732 | Ga0495684_0050325 | |||
| 2733 | Ga0495684_0060049 | |||
| 2734 | Ga0495686_0062203 | |||
| 2735 | Ga0495593_0000986 | |||
| 2736 | Ga0495593_0071820 | |||
| 2737 | Ga0495615_0060495 | |||
| 2738 | Ga0496100_0004736 | |||
| 2739 | Ga0496100_0131686 | |||
| 2740 | Ga0496100_0166632 | |||
| 2741 | Ga0496100_0639256 | |||
| 2742 | Ga0496101_0043827 | |||
| 2743 | Ga0496101_0146555 | |||
| 2744 | Ga0496101_0156660 | |||
| 2745 | Ga0496102_0094756 | |||
| 2746 | Ga0496102_0156122 | |||
| 2747 | Ga0496102_0221798 | |||
| 2748 | Ga0496102_0303013 | |||
| 2749 | Ga0496102_0313425 | |||
| 2750 | Ga0496102_0321875 | |||
| 2751 | Ga0496102_1156005 | |||
| 2752 | Ga0496103_0107858 | |||
| 2753 | Ga0496103_0241844 | |||
| 2754 | Ga0496104_0012536 | |||
| 2755 | Ga0496104_0041518 | |||
| 2756 | Ga0496104_0074952 | |||
| 2757 | Ga0496104_0094161 | |||
| 2758 | Ga0496104_0121347 | |||
| 2759 | Ga0496104_0169645 | |||
| 2760 | Ga0496104_0228325 | |||
| 2761 | Ga0496104_0672697 | |||
| 2762 | Ga0496105_0003866 | |||
| 2763 | Ga0496105_0031344 | |||
| 2764 | Ga0496105_0167629 | |||
| 2765 | Ga0496105_0464855 | |||
| 2766 | Ga0496106_0002192 | |||
| 2767 | Ga0496106_0007842 | |||
| 2768 | Ga0496106_0117538 | |||
| 2769 | Ga0496106_0146330 | |||
| 2770 | Ga0496106_0551945 | |||
| 2771 | Ga0496106_0819991 | |||
| 2772 | Ga0496107_0006208 | |||
| 2773 | Ga0496107_0070725 | |||
| 2774 | Ga0496107_0085807 | |||
| 2775 | Ga0496107_0094596 | |||
| 2776 | Ga0496108_0033321 | |||
| 2777 | Ga0496108_0046989 | |||
| 2778 | Ga0496108_0176014 | |||
| 2779 | Ga0496108_0314549 | |||
| 2780 | Ga0496108_0414491 | |||
| 2781 | Ga0496108_0512203 | |||
| 2782 | Ga0496108_0787428 | |||
| 2783 | Ga0496109_0000958 | |||
| 2784 | Ga0496109_0080371 | |||
| 2785 | Ga0496109_0170853 | |||
| 2786 | Ga0496109_0274367 | |||
| 2787 | Ga0496109_0793725 | |||
| 2788 | Ga0496110_0024058 | |||
| 2789 | Ga0496111_0026562 | |||
| 2790 | Ga0496111_0054052 | |||
| 2791 | Ga0496111_0077043 | |||
| 2792 | Ga0496111_0095184 | |||
| 2793 | Ga0496112_0008372 | |||
| 2794 | Ga0496112_0024283 | |||
| 2795 | Ga0496112_0030971 | |||
| 2796 | Ga0496112_0090356 | |||
| 2797 | Ga0496112_0236383 | |||
| 2798 | Ga0496112_0273390 | |||
| 2799 | Ga0496112_0632997 | |||
| 2800 | Ga0496113_0009951 | |||
| 2801 | Ga0496113_0016793 | |||
| 2802 | Ga0496113_0024585 | |||
| 2803 | Ga0496113_0057462 | |||
| 2804 | Ga0496113_0289787 | |||
| 2805 | Ga0496113_0735865 | |||
| 2806 | Ga0496114_0042126 | |||
| 2807 | Ga0496114_0102072 | |||
| 2808 | Ga0496115_0157497 | |||
| 2809 | Ga0496115_0529526 | |||
| 2810 | Ga0496117_0040854 | |||
| 2811 | Ga0496117_0102683 | |||
| 2812 | Ga0496118_0021563 | |||
| 2813 | Ga0496118_0023025 | |||
| 2814 | Ga0496119_0013564 | |||
| 2815 | Ga0496119_0052365 | |||
| 2816 | Ga0496119_0224084 | |||
| 2817 | Ga0496119_0228825 | |||
| 2818 | Ga0496119_0272337 | |||
| 2819 | Ga0496120_0034276 | |||
| 2820 | Ga0496121_0000461 | |||
| 2821 | Ga0496121_0000476 | |||
| 2822 | Ga0496121_0005046 | |||
| 2823 | Ga0496121_0006583 | |||
| 2824 | Ga0496121_0112781 | |||
| 2825 | Ga0496121_0160194 | |||
| 2826 | Ga0496121_0182896 | |||
| 2827 | Ga0496121_0510984 | |||
| 2828 | Ga0496122_0133344 | |||
| 2829 | Ga0496124_0007605 | |||
| 2830 | Ga0496124_0036185 | |||
| 2831 | Ga0496125_0119465 | |||
| 2832 | Ga0496125_0149755 | |||
| 2833 | Ga0496125_0217837 | |||
| 2834 | Ga0496125_0296277 | |||
| 2835 | Ga0496126_0004139 | |||
| 2836 | Ga0496126_0011296 | |||
| 2837 | Ga0496126_0014548 | |||
| 2838 | Ga0496126_0024714 | |||
| 2839 | Ga0496126_0097468 | |||
| 2840 | Ga0496126_0097534 | |||
| 2841 | Ga0496126_0125191 | |||
| 2842 | Ga0496126_0323320 | |||
| 2843 | Ga0496126_0353480 | |||
| 2844 | Ga0496126_0367643 | |||
| 2845 | Ga0496126_0805463 | |||
| 2846 | Ga0495678_135213 | |||
| 2847 | Ga0501031_0575769 | |||
| 2848 | Ga0501032_0001484 | |||
| 2849 | Ga0501032_0004833 | |||
| 2850 | Ga0501033_0002476 | |||
| 2851 | Ga0501033_0009580 | |||
| 2852 | Ga0501034_0000955 | |||
| 2853 | Ga0501034_0006672 | |||
| 2854 | Ga0501036_0001778 | |||
| 2855 | Ga0501036_0302526 | |||
| 2856 | Ga0501037_0000374 | |||
| 2857 | Ga0501037_0004631 | |||
| 2858 | Ga0501038_0013942 | |||
| 2859 | Ga0501038_0053706 | |||
| 2860 | Ga0501039_0013178 | |||
| 2861 | Ga0501039_0030505 | |||
| 2862 | Ga0501041_0057297 | |||
| 2863 | Ga0501041_0255008 | |||
| 2864 | Ga0501041_0456195 | |||
| 2865 | Ga0501043_0000932 | |||
| 2866 | Ga0501043_0012177 | |||
| 2867 | Ga0501046_0020537 | |||
| 2868 | Ga0501046_0030167 | |||
| 2869 | Ga0501047_0003152 | |||
| 2870 | Ga0501047_0050929 | |||
| 2871 | Ga0501048_0022290 | |||
| 2872 | Ga0501048_0317315 | |||
| 2873 | Ga0501068_0019232 | |||
| 2874 | Ga0501068_0244784 | |||
| 2875 | Ga0501069_0029303 | |||
| 2876 | Ga0501070_0032912 | |||
| 2877 | Ga0501070_0129945 | |||
| 2878 | Ga0501070_0981546 | |||
| 2879 | Ga0501071_0286668 | |||
| 2880 | Ga0501071_0314336 | |||
| 2881 | Ga0501071_0579914 | |||
| 2882 | Ga0501072_0008393 | |||
| 2883 | Ga0501073_0002378 | |||
| 2884 | Ga0501074_0054841 | |||
| 2885 | Ga0501074_0119673 | |||
| 2886 | Ga0501075_0011346 | |||
| 2887 | Ga0501076_0556463 | |||
| 2888 | Ga0501079_0013407 | |||
| 2889 | Ga0501079_0015285 | |||
| 2890 | Ga0501080_0002661 | |||
| 2891 | Ga0501080_0043997 | |||
| 2892 | Ga0501080_0136654 | |||
| 2893 | Ga0501081_0001519 | |||
| 2894 | Ga0501081_0821944 | |||
| 2895 | Ga0501083_0078315 | |||
| 2896 | Ga0501083_0096022 | |||
| 2897 | Ga0501083_0151019 | |||
| 2898 | Ga0501035_0038248 | |||
| 2899 | Ga0501035_0430917 | |||
| 2900 | Ga0501044_0000315 | |||
| 2901 | Ga0501044_0039486 | |||
| 2902 | Ga0501044_0041106 | |||
| 2903 | Ga0501044_0103974 | |||
| 2904 | Ga0501044_1161440 | |||
| 2905 | Ga0501045_0069136 | |||
| 2906 | nmdc:mga03683_129219_c1 | |||
| 2907 | nmdc:mga03683_28017_c2 | |||
| 2908 | nmdc:mga03683_284384_c1 | |||
| 2909 | nmdc:mga03683_47499_c1 | |||
| 2910 | nmdc:mga03683_48622_c1 | |||
| 2911 | nmdc:mga03683_81960_c1 | |||
| 2912 | nmdc:mga03683_88489_c1 | |||
| 2913 | nmdc:mga03n38_34354_c1 | |||
| 2914 | nmdc:mga03n38_371785_c1 | |||
| 2915 | nmdc:mga03n38_89347_c1 | |||
| 2916 | nmdc:mga03n38_9411_c1 | |||
| 2917 | nmdc:mga00v17_137207_c1 | |||
| 2918 | nmdc:mga00v17_189332_c1 | |||
| 2919 | nmdc:mga00v17_311526_c1 | |||
| 2920 | nmdc:mga00v17_399062_c1 | |||
| 2921 | nmdc:mga00v17_64127_c1 | |||
| 2922 | nmdc:mga0yw44_14964_c1 | |||
| 2923 | nmdc:mga0yw44_404972_c1 | |||
| 2924 | nmdc:mga0yw44_431629_c1 | |||
| 2925 | nmdc:mga0yw44_50039_c1 | |||
| 2926 | nmdc:mga0yw44_61226_c1 | |||
| 2927 | nmdc:mga0yw44_63502_c1 | |||
| 2928 | nmdc:mga0yw44_646546_c1 | |||
| 2929 | nmdc:mga0k408_131832_c1 | |||
| 2930 | nmdc:mga0k408_141786_c1 | |||
| 2931 | nmdc:mga0k408_185742_c1 | |||
| 2932 | nmdc:mga0k408_224347_c1 | |||
| 2933 | nmdc:mga0k408_25826_c1 | |||
| 2934 | nmdc:mga0k408_35346_c1 | |||
| 2935 | nmdc:mga0k408_38466_c2 | |||
| 2936 | nmdc:mga0k408_38889_c1 | |||
| 2937 | nmdc:mga0k408_52488_c1 | |||
| 2938 | nmdc:mga0k408_5474_c1 | |||
| 2939 | nmdc:mga0k408_72072_c1 | |||
| 2940 | nmdc:mga06z11_115797_c1 | |||
| 2941 | nmdc:mga06z11_117534_c1 | |||
| 2942 | nmdc:mga06z11_117607_c1 | |||
| 2943 | nmdc:mga06z11_224978_c1 | |||
| 2944 | nmdc:mga06z11_307641_c1 | |||
| 2945 | nmdc:mga06z11_327381_c1 | |||
| 2946 | nmdc:mga06z11_48647_c1 | |||
| 2947 | nmdc:mga06z11_515372_c1 | |||
| 2948 | nmdc:mga04h51_3096_c1 | |||
| 2949 | nmdc:mga04h51_4452_c1 | |||
| 2950 | nmdc:mga04h51_46049_c1 | |||
| 2951 | nmdc:mga04h51_79306_c1 | |||
| 2952 | nmdc:mga07m45_109775_c1 | |||
| 2953 | nmdc:mga07m45_113357_c1 | |||
| 2954 | nmdc:mga07m45_151879_c1 | |||
| 2955 | nmdc:mga07m45_152399_c1 | |||
| 2956 | nmdc:mga07m45_157768_c1 | |||
| 2957 | nmdc:mga07m45_170535_c1 | |||
| 2958 | nmdc:mga07m45_186013_c1 | |||
| 2959 | nmdc:mga07m45_278720_c1 | |||
| 2960 | nmdc:mga07m45_29312_c1 | |||
| 2961 | nmdc:mga07m45_36869_c1 | |||
| 2962 | nmdc:mga07m45_457628_c1 | |||
| 2963 | nmdc:mga07m45_56539_c1 | |||
| 2964 | nmdc:mga05p37_306830_c1 | |||
| 2965 | nmdc:mga09592_192242_c1 | |||
| 2966 | nmdc:mga09592_37295_c1 | |||
| 2967 | nmdc:mga0qj67_21919_c1 | |||
| 2968 | nmdc:mga0qj67_221_c1 | |||
| 2969 | nmdc:mga06r32_1124255_c1 | |||
| 2970 | nmdc:mga06r32_20596_c1 | |||
| 2971 | nmdc:mga06r32_6177_c1 | |||
| 2972 | nmdc:mga06r32_93225_c1 | |||
| 2973 | nmdc:mga06r32_9721_c1 | |||
| 2974 | nmdc:mga08y16_661709_c1 | |||
| 2975 | nmdc:mga0n895_178880_c1 | |||
| 2976 | nmdc:mga0n895_289793_c1 | |||
| 2977 | nmdc:mga0rr50_562965_c1 | |||
| 2978 | nmdc:mga0rr50_73454_c1 | |||
| 2979 | nmdc:mga0rr50_93385_c2 | |||
| 2980 | nmdc:mga08x19_339798_c1 | |||
| 2981 | nmdc:mga08x19_61833_c1 | |||
| 2982 | nmdc:mga0a205_537113_c1 | |||
| 2983 | nmdc:mga0sz30_103612_c1 | |||
| 2984 | nmdc:mga0sz30_21351_c2 | |||
| 2985 | nmdc:mga0sz30_40305_c1 | |||
| 2986 | nmdc:mga0sz30_7895_c2 | |||
| 2987 | Ga0495601_0004169 | |||
| 2988 | Ga0495601_0031180 | |||
| 2989 | Ga0495601_0130804 | |||
| 2990 | Ga0495601_0145255 | |||
| 2991 | Ga0495601_0279227 | |||
| 2992 | Ga0495612_0007486 | |||
| 2993 | Ga0495612_0057089 | |||
| 2994 | Ga0495612_0108673 | |||
| 2995 | Ga0500610_0187823 | |||
| 2996 | Ga0500635_0002501 | |||
| 2997 | Ga0495655_0167879 | |||
| 2998 | Ga0495595_0002260 | |||
| 2999 | Ga0495619_0081533 | |||
| 3000 | Ga0495619_0091836 | |||
| 3001 | Ga0495619_0212192 | |||
| 3002 | Ga0495619_0310818 | |||
| 3003 | Ga0495619_0325119 | |||
| 3004 | Ga0500578_0220309 | |||
| 3005 | Ga0500578_0230641 | |||
| 3006 | Ga0500643_000057 | |||
| 3007 | Ga0500643_052426 | |||
| 3008 | Ga0500644_0028954 | |||
| 3009 | Ga0500646_0000154 | |||
| 3010 | Ga0500647_0006967 | |||
| 3011 | Ga0500647_0193329 | |||
| 3012 | Ga0500647_0246304 | |||
| 3013 | Ga0500583_0046075 | |||
| 3014 | Ga0500583_0090817 | |||
| 3015 | Ga0500583_0099743 | |||
| 3016 | Ga0500583_0119966 | |||
| 3017 | Ga0500651_0073476 | |||
| 3018 | Ga0500651_0144897 | |||
| 3019 | Ga0500566_0001040 | |||
| 3020 | Ga0500566_0021628 | |||
| 3021 | Ga0500566_0305228 | |||
| 3022 | Ga0500640_001081 | |||
| 3023 | Ga0500641_0064918 | |||
| 3024 | Ga0500641_0096832 | |||
| 3025 | Ga0500641_0150649 | |||
| 3026 | Ga0500641_0283834 | |||
| 3027 | Ga0500648_221272 | |||
| 3028 | Ga0500654_183937 | |||
| 3029 | Ga0500555_003125 | |||
| 3030 | Ga0500555_043808 | |||
| 3031 | Ga0500556_0048231 | |||
| 3032 | Ga0500557_000129 | |||
| 3033 | Ga0500562_117937 | |||
| 3034 | Ga0500572_000148 | |||
| 3035 | Ga0500572_001485 | |||
| 3036 | Ga0500572_014260 | |||
| 3037 | Ga0500591_016850 | |||
| 3038 | Ga0500594_0070505 | |||
| 3039 | Ga0500595_001155 | |||
| 3040 | Ga0500595_001379 | |||
| 3041 | Ga0500595_007140 | |||
| 3042 | Ga0500595_032957 | |||
| 3043 | Ga0500595_033623 | |||
| 3044 | Ga0500595_038970 | |||
| 3045 | Ga0500608_032512 | |||
| 3046 | Ga0500608_169383 | |||
| 3047 | Ga0500614_000313 | |||
| 3048 | Ga0500621_152410 | |||
| 3049 | Ga0500642_0000180 | |||
| 3050 | Ga0500642_0010401 | |||
| 3051 | Ga0500655_028287 | |||
| 3052 | Ga0500658_0129611 | |||
| 3053 | Ga0500559_0001230 | |||
| 3054 | Ga0500559_0005930 | |||
| 3055 | Ga0500559_0024957 | |||
| 3056 | Ga0500561_0051192 | |||
| 3057 | Ga0500568_0056017 | |||
| 3058 | Ga0500568_0137232 | |||
| 3059 | Ga0500573_0107782 | |||
| 3060 | Ga0500588_0116236 | |||
| 3061 | Ga0500590_063732 | |||
| 3062 | Ga0500590_158266 | |||
| 3063 | Ga0500603_000076 | |||
| 3064 | Ga0500603_040666 | |||
| 3065 | Ga0500603_085600 | |||
| 3066 | Ga0500604_0019662 | |||
| 3067 | Ga0500604_0154966 | |||
| 3068 | Ga0500616_0000092 | |||
| 3069 | Ga0500616_0118689 | |||
| 3070 | Ga0500616_0215741 | |||
| 3071 | Ga0500620_152139 | |||
| 3072 | Ga0500622_0024890 | |||
| 3073 | Ga0500627_0023107 | |||
| 3074 | Ga0500630_005759 | |||
| 3075 | Ga0500638_017487 | |||
| 3076 | Ga0500638_036871 | |||
| 3077 | Ga0500639_000014 | |||
| 3078 | Ga0500636_0000324 | |||
| 3079 | Ga0500636_0025074 | |||
| 3080 | Ga0500636_0037661 | |||
| 3081 | Ga0500637_0000705 | |||
| 3082 | Ga0500637_0012032 | |||
| 3083 | Ga0500637_0027169 | |||
| 3084 | Ga0500637_0102004 | |||
| 3085 | Ga0500637_0179561 | |||
| 3086 | Ga0500625_002854 | |||
| 3087 | Ga0500596_000214 | |||
| 3088 | Ga0500596_004388 | |||
| 3089 | Ga0500596_006106 | |||
| 3090 | Ga0500599_002006 | |||
| 3091 | Ga0500601_000851 | |||
| 3092 | Ga0501084_0118044 | |||
| 3093 | Ga0501084_0125927 | |||
| 3094 | Ga0501084_0129718 | |||
| 3095 | Ga0500661_006724 | |||
| 3096 | Ga0500661_009700 | |||
| 3097 | Ga0587082_067466 | |||
| 3098 | Ga0587083_0107069 | |||
| 3099 | Ga0501082_0038236 | |||
| 3100 | Ga0530510_0022282 | |||
| 3101 | 2507511056 | |||
| 3102 | 2508544873 | |||
| 3103 | 2508696907 | |||
| 3104 | 2509151837 | |||
| 3105 | 2511400386 | |||
| 3106 | 2513623516 | |||
| 3107 | 2513649713 | |||
| 3108 | 2513678541 | |||
| 3109 | 2513696526 | |||
| 3110 | 2513701174 | |||
| 3111 | 2513716953 | |||
| 3112 | 2513874682 | |||
| 3113 | 2513892130 | |||
| 3114 | 2514010600 | |||
| 3115 | 2515625372 | |||
| 3116 | 2517100623 | |||
| 3117 | 2524438151 | |||
| 3118 | 2524468849 | |||
| 3119 | 2528856708 | |||
| 3120 | 2596374236 | |||
| 3121 | 2617350808 | |||
| 3122 | 2617373178 | |||
| 3123 | 2723843034 | |||
| 3124 | 2739249163 | |||
| 3125 | 2745076967 | |||
| 3126 | 2793064698 | |||
| 3127 | 2793083663 | |||
| 3128 | 2805916681 | |||
| 3129 | 2818238185 | |||
| 3130 | 2824607513 | |||
| 3131 | 2824617029 | |||
| 3132 | 2824626270 | |||
| 3133 | 2824634925 | |||
| 3134 | 2824643453 | |||
| 3135 | 2824652243 | |||
| 3136 | 2824658744 | |||
| 3137 | 2824670762 | |||
| 3138 | 2824678886 | |||
| 3139 | 2824687018 | |||
| 3140 | 2824695398 | |||
| 3141 | 2824703745 | |||
| 3142 | 2824713111 | |||
| 3143 | 2824722646 | |||
| 3144 | 2824732216 | |||
| 3145 | 2824737084 | |||
| 3146 | 2824753452 | |||
| 3147 | 2824763197 | |||
| 3148 | 2824771396 | |||
| 3149 | 2824780472 | |||
| 3150 | 2829748345 | |||
| 3151 | 2831869442 | |||
| 3152 | 2838127927 | |||
| 3153 | 2841943221 | |||
| 3154 | 2841954047 | |||
| 3155 | 2841960187 | |||
| 3156 | 2841968139 | |||
| 3157 | 2841976652 | |||
| 3158 | 2841988024 | |||
| 3159 | 2842042668 | |||
| 3160 | 2842050711 | |||
| 3161 | 2844316880 | |||
| 3162 | 2847938594 | |||
| 3163 | 2847944206 | |||
| 3164 | 2848298708 | |||
| 3165 | 2849081568 | |||
| 3166 | 2857512221 | |||
| 3167 | 2874597788 | |||
| 3168 | 2874612632 | |||
| 3169 | 2874617663 | |||
| 3170 | 2874623401 | |||
| 3171 | 2874634181 | |||
| 3172 | 2874651317 | |||
| 3173 | 2876764080 | |||
| 3174 | 2876776388 | |||
| 3175 | 2876817497 | |||
| 3176 | 2876820956 | |||
| 3177 | 2879081749 | |||
| 3178 | 2879088430 | |||
| 3179 | 2879108832 | |||
| 3180 | 2879118085 | |||
| 3181 | 2879130463 | |||
| 3182 | 2879146349 | |||
| 3183 | 2881370714 | |||
| 3184 | 2881671303 | |||
| 3185 | 2885366903 | |||
| 3186 | 2885387143 | |||
| 3187 | 2885413398 | |||
| 3188 | 2886850740 | |||
| 3189 | 2888381492 | |||
| 3190 | 2888389155 | |||
| 3191 | 2888421894 | |||
| 3192 | 2889033666 | |||
| 3193 | 2889307571 | |||
| 3194 | 2902333107 | |||
| 3195 | 2902410190 | |||
| 3196 | 2903733930 | |||
| 3197 | 2903772030 | |||
| 3198 | 2904672668 | |||
| 3199 | 2904719262 | |||
| 3200 | 2906604546 | |||
| 3201 | 2906635208 | |||
| 3202 | 2906649115 | |||
| 3203 | 2908781634 | |||
| 3204 | 2919704348 | |||
| 3205 | 2922367031 | |||
| 3206 | 2922371156 | |||
| 3207 | 2922390189 | |||
| 3208 | 2922393526 | |||
| 3209 | 2928126604 | |||
| 3210 | 2929619543 | |||
| 3211 | 2929627987 | |||
| 3212 | 2932785867 | |||
| 3213 | 2932798346 | |||
| 3214 | 2932804142 | |||
| 3215 | 2932817240 | |||
| 3216 | 2932826729 | |||
| 3217 | 2932830912 | |||
| 3218 | 2933581463 | |||
| 3219 | 2935612713 | |||
| 3220 | 2935620980 | |||
| 3221 | 2935640053 | |||
| 3222 | 2935655165 | |||
| 3223 | 2935664046 | |||
| 3224 | 2935667108 | |||
| 3225 | 2935680252 | |||
| 3226 | 2935690238 | |||
| 3227 | 2935699674 | |||
| 3228 | 2935704864 | |||
| 3229 | 2935718065 | |||
| 3230 | 2935726785 | |||
| 3231 | 2935735554 | |||
| 3232 | 2935745175 | |||
| 3233 | 2935755249 | |||
| 3234 | 2935762234 | |||
| 3235 | 2935773611 | |||
| 3236 | 2935780169 | |||
| 3237 | 2935788484 | |||
| 3238 | 2935796640 | |||
| 3239 | 2935803734 | |||
| 3240 | 2935811652 | |||
| 3241 | 2935824202 | |||
| 3242 | 2935829536 | |||
| 3243 | 2935842502 | |||
| 3244 | 2935852651 | |||
| 3245 | 2935858787 | |||
| 3246 | 2935866815 | |||
| 3247 | 2935876946 | |||
| 3248 | 2935884052 | |||
| 3249 | 2935912197 | |||
| 3250 | 2935922410 | |||
| 3251 | 2935929226 | |||
| 3252 | 2935935857 | |||
| 3253 | 2935947423 | |||
| 3254 | 2935953482 | |||
| 3255 | 2935962009 | |||
| 3256 | 2935968508 | |||
| 3257 | 2935976692 | |||
| 3258 | 2935990691 | |||
| 3259 | 2935993414 | |||
| 3260 | 2936004309 | |||
| 3261 | 2936015456 | |||
| 3262 | 2936024090 | |||
| 3263 | 2936033105 | |||
| 3264 | 2936038234 | |||
| 3265 | 2936051198 | |||
| 3266 | 2936058576 | |||
| 3267 | 2940561470 | |||
| 3268 | 2941533660 | |||
| 3269 | 2941547385 | |||
| 3270 | 3005486150 | |||
| 3271 | 3005507091 | |||
| 3272 | 3005593053 | |||
| 3273 | 3005596509 | |||
| 3274 | 3005712579 | |||
| 3275 | 3005719638 | |||
| 3276 | 643602447 | |||
| 3277 | 8006930088 | |||
| 3278 | 8006966568 | |||
| 3279 | 8006989411 | |||
| 3280 | 8006997879 | |||
| 3281 | 8016516475 | |||
| 3282 | 8016523881 | |||
| 3283 | 8016541683 | |||
| 3284 | 8016551589 | |||
| 3285 | 8016559972 | |||
| 3286 | 8016567068 | |||
| 3287 | 8016579785 | |||
| 3288 | 8016597900 | |||
| 3289 | 8016604036 | |||
| 3290 | 8016620620 | |||
| 3291 | 8016629375 | |||
| 3292 | 8016633883 | |||
| 3293 | 8017060064 | |||
| 3294 | 8019537096 | |||
| 3295 | 8019542447 | |||
| 3296 | 8019548313 | |||
| 3297 | 8019579572 | |||
| 3298 | 8019587282 | |||
| 3299 | 8019604059 | |||
| 3300 | 8019614470 | |||
| 3301 | 8019625095 | |||
| 3302 | 8019637086 | |||
| 3303 | 8019642516 | |||
| 3304 | 8019674490 | |||
| 3305 | 8019681616 | |||
| 3306 | 8019694160 | |||
| 3307 | 8055749199 | |||
| 3308 | 8056674910 | |||
| 3309 | 8056682335 | |||
| 3310 | 8056969681 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yev-assembly2.cif.gz_A | structure of caa3-type cytochrome oxidase | 0.3296 | 25 | 151 |
| 8h0q-assembly1.cif.gz_R | structure of the grp14-27-grpr-gq complex | 0.3259 | 32 | 166 |
| 5j7y-assembly1.cif.gz_BC | architecture of loose respirasome | 0.318 | 24 | 167 |
| 6zgr-assembly1.cif.gz_A | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.3179 | 23 | 190 |
| 6hcl-assembly1.cif.gz_A | crystal structure of a mfs transporter with ligand at 2.69 angstroem resolution | 0.3144 | 23 | 191 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76198_215_409_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3623 | 4 | 193 | 1.20.1250.20 |
| af_Q55EC8_162_384_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3459 | 1 | 188 | 1.20.1250.20 |
| af_F1QQL3_14_285_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3426 | 34 | 167 | 1.20.1070.10 |
| af_Q555W6_322_550_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3401 | 23 | 190 | 1.20.1250.20 |
| af_A4I001_41_293_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.3298 | 24 | 158 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554X8U7-F1-model_v4 | Prokaryotic cytochrome b561 | 0.9769 | 4 | 195 |
GO:0016020
|
| AF-A0A653J9Z0-F1-model_v4 | Membrane protein | 0.9741 | 4 | 190 |
GO:0016020
|
| AF-A0A657B8S9-F1-model_v4 | DUF962 domain-containing protein | 0.9721 | 3 | 198 |
GO:0016020
|
| AF-A0A848G0S1-F1-model_v4 | DUF962 domain-containing protein | 0.9703 | 1 | 190 |
GO:0016020
|
| AF-A0A5E7ZP03-F1-model_v4 | Membrane protein | 0.9694 | 4 | 190 |
GO:0016020
|