F495203

General Info

Members Datasets Scaffolds Average Seq Length
1650 538 1636 102

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100398971|Ga0070683_1003989712
Length 122
Sequence MIELDHLTLAHFIGLGTILFCISVAGLFINRKNVIVLLMAIELMLLAVNMNFVAFSRFLGDVSGQIFVFFILTVAAAESAIGLAILVVLFRNRATINVGEIDTLRGQASGRPNESERKNATA

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221586 Lysobacter sp. Root667 Isolate Unclassified
5 2643221593 Lysobacter sp. Root690 Isolate Unclassified
6 2643221612 Lysobacter sp. Root76 Isolate Unclassified
7 2643221695 Lysobacter sp. Root494 Isolate Unclassified
8 2643221720 Lysobacter sp. Root916 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2643221728 Lysobacter sp. Root983 Isolate Unclassified
11 2919513703 Luteimonas sp. 3794 Isolate Unclassified
12 2919675420 Luteimonas terrae 4099 Isolate Unclassified
13 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
14 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
111 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
141 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
158 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
159 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
160 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
161 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
162 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
169 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
170 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
186 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
262 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
263 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
268 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
269 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
270 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
273 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
274 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
275 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
276 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
277 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
278 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
279 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
280 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
281 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
282 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
283 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
284 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
285 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
286 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
287 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
288 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
289 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
290 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
291 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
292 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
293 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
294 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
295 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
296 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
297 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
298 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
299 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
300 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
301 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
304 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
305 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
306 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
309 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
310 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
312 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
313 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
314 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
315 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
319 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
320 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
321 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
322 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
323 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
324 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
325 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
326 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
327 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
328 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
329 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
330 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
331 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
332 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
333 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
334 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
335 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
336 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
337 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
338 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
339 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
340 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
341 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
342 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
343 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
344 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
345 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
346 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
347 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
348 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
349 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
350 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
351 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
352 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
353 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
354 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
355 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
356 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
357 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
358 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
359 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
360 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
361 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
362 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
363 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
364 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
368 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
369 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
370 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
373 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
374 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
375 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
376 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
377 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
378 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
379 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
380 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
388 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
389 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
390 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
391 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
392 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
393 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
394 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
395 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
396 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
400 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
407 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
408 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
413 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
418 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
423 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
424 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
425 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
426 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
427 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
428 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
429 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
430 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
431 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
432 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
433 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
434 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
435 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
455 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
456 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
457 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
477 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
478 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
479 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
480 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
481 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
482 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
483 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
484 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
485 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
486 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
487 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
488 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
489 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
490 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
491 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
492 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
493 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
494 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
495 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
496 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
497 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
498 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
499 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
500 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
501 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
502 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
503 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
504 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
505 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
506 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
507 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
508 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
509 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
510 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
511 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
512 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
513 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
515 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
516 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
517 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
518 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
519 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
520 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
521 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
522 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
523 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
524 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
525 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
526 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
527 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
528 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
529 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
530 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
531 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
532 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
535 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
537 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
538 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.97
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0.12
Rhizoplane 3.7
Rhizosphere 78.36
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000470 3300001979 Bacteria 17336
2 JGI24740J21852_10100918 3300001979 Bacteria 735
3 JGI24739J22299_10000039 3300001989 Bacteria 36051
4 JGI24739J22299_10108011 3300001989 Bacteria 836
5 JGI24737J22298_10000773 3300001990 Bacteria 11314
6 JGI24737J22298_10007009 3300001990 Bacteria 3821
7 JGI24737J22298_10007226 3300001990 Bacteria 3756
8 JGI24735J21928_10010500 3300002067 Bacteria 2951
9 JGI24735J21928_10017289 3300002067 Bacteria 2231
10 JGI24744J21845_10109725 3300002077 Bacteria 512
11 JGI25156J39149_1000822 3300002705 Bacteria 15751
12 JGI25156J39149_1001275 3300002705 Bacteria 10926
13 JGI25156J39149_1010679 3300002705 Bacteria 2139
14 JGI25162J39368_1000732 3300002737 Bacteria 22514
15 JGI25154J39366_1003192 3300002738 Bacteria 3610
16 JGI25154J39366_1003368 3300002738 Bacteria 3386
17 JGI25157J39369_1000656 3300002741 Bacteria 19144
18 JGI25157J39369_1000792 3300002741 Bacteria 16143
19 JGI25157J39369_1001513 3300002741 Bacteria 8468
20 JGI25157J39369_1002022 3300002741 Bacteria 5868
21 JGI25157J39369_1002091 3300002741 Bacteria 5656
22 JGI25163J39215_1000172 3300002771 Bacteria 25403
23 JGI25164J39214_1000085 3300002772 Bacteria 92776
24 JGI25164J39214_1000243 3300002772 Bacteria 41571
25 JGI25164J39214_1000994 3300002772 Bacteria 8914
26 JGI25164J39214_1000995 3300002772 Bacteria 8901
27 JGI25164J39214_1004811 3300002772 Bacteria 1517
28 JGI25152J39213_1032881 3300002773 Bacteria 784
29 Ga0006759J45824_1122819 3300003163 Bacteria 612
30 JGI25151J46595_10089409 3300003187 Bacteria 863
31 JGI25165J46597_1000058 3300003214 Bacteria 212833
32 JGI25165J46597_1000090 3300003214 Bacteria 168833
33 JGI25165J46597_1001824 3300003214 Bacteria 8914
34 JGI25165J46597_1006457 3300003214 Bacteria 2078
35 JGI25153J46596_10131115 3300003215 Bacteria 555
36 rootH2_10015394 3300003320 Bacteria 4836
37 Ga0006562J51391_1026821 3300003578 Bacteria 13803
38 Ga0006562J51391_1026824 3300003578 Bacteria 3380
39 JGI25404J52841_10136760 3300003659 Bacteria 519
40 Ga0055538_1002456 3300003751 Bacteria 2710
41 Ga0055539_1000434 3300003752 Bacteria 14786
42 Ga0055533_1000734 3300003756 Bacteria 10594
43 Ga0055533_1001197 3300003756 Bacteria 7268
44 Ga0055525_1000097 3300003759 Bacteria 137371
45 Ga0055527_1000198 3300003760 Bacteria 39703
46 Ga0055527_1000581 3300003760 Bacteria 11933
47 Ga0055535_1000034 3300003761 Bacteria 181954
48 Ga0055535_1001535 3300003761 Bacteria 11334
49 Ga0055535_1001554 3300003761 Bacteria 11198
50 Ga0055535_1001777 3300003761 Bacteria 9499
51 Ga0055535_1003057 3300003761 Bacteria 5068
52 Ga0055535_1007979 3300003761 Bacteria 1959
53 Ga0055542_1000441 3300003762 Bacteria 39703
54 Ga0055542_1001261 3300003762 Bacteria 13798
55 Ga0055542_1001412 3300003762 Bacteria 12090
56 Ga0055542_1001429 3300003762 Bacteria 11933
57 Ga0055542_1002987 3300003762 Bacteria 4933
58 Ga0055542_1002988 3300003762 Bacteria 4932
59 Ga0055529_1000206 3300003763 Bacteria 78192
60 Ga0055529_1000870 3300003763 Bacteria 17327
61 Ga0055529_1001132 3300003763 Bacteria 11360
62 Ga0055529_1001145 3300003763 Bacteria 11198
63 Ga0055529_1035198 3300003763 Bacteria 611
64 Ga0055526_1000021 3300003771 Bacteria 180007
65 Ga0055526_1007069 3300003771 Bacteria 5932
66 Ga0055537_1000186 3300003773 Bacteria 46462
67 Ga0055524_1000062 3300003775 Bacteria 135238
68 Ga0055536_1039212 3300003781 Bacteria 1140
69 Ga0055536_1059790 3300003781 Bacteria 794
70 Ga0055534_1000052 3300003784 Bacteria 91095
71 Ga0055534_1004464 3300003784 Bacteria 4047
72 Ga0055528_1000009 3300003790 Bacteria 224150
73 Ga0055530_10009161 3300003791 Bacteria 3845
74 Ga0055540_1027462 3300003792 Bacteria 1361
75 Ga0055540_1099154 3300003792 Bacteria 544
76 Ga0055531_10003386 3300003794 Bacteria 10187
77 Ga0055531_10024760 3300003794 Bacteria 2201
78 Ga0065165_1006432 3300005262 Bacteria 6162
79 Ga0070658_10003054 3300005327 Bacteria 13838
80 Ga0070658_10506690 3300005327 Bacteria 1043
81 Ga0070658_10616842 3300005327 Bacteria 940
82 Ga0070658_10852760 3300005327 Bacteria 792
83 Ga0070658_10922143 3300005327 Bacteria 759
84 Ga0070676_10208880 3300005328 Bacteria 1284
85 Ga0070676_10216960 3300005328 Bacteria 1262
86 Ga0070676_10311370 3300005328 Bacteria 1071
87 Ga0070676_10379102 3300005328 Bacteria 979
88 Ga0070676_10575862 3300005328 Bacteria 809
89 Ga0070683_100318735 3300005329 Bacteria 1479
90 Ga0070683_100398971 3300005329 Bacteria 1312
91 Ga0070683_100541837 3300005329 Bacteria 1113
92 Ga0070690_100411184 3300005330 Bacteria 996
93 Ga0070690_101494143 3300005330 Bacteria 546
94 Ga0070670_100068818 3300005331 Bacteria 3039
95 Ga0070670_100141643 3300005331 Bacteria 2080
96 Ga0070670_100156846 3300005331 Bacteria 1972
97 Ga0070670_100375681 3300005331 Bacteria 1252
98 Ga0070670_100419130 3300005331 Bacteria 1183
99 Ga0070670_100942112 3300005331 Bacteria 784
100 Ga0070670_101118738 3300005331 Bacteria 719
101 Ga0070670_101565348 3300005331 Bacteria 606
102 Ga0068869_100047959 3300005334 Bacteria 3087
103 Ga0068869_100128761 3300005334 Bacteria 1944
104 Ga0070666_10000003 3300005335 Bacteria 463666
105 Ga0070666_10001186 3300005335 Bacteria 15774
106 Ga0070666_10070889 3300005335 Bacteria 2371
107 Ga0070666_10089151 3300005335 Bacteria 2116
108 Ga0070666_10107381 3300005335 Bacteria 1928
109 Ga0070680_101125684 3300005336 Bacteria 678
110 Ga0070680_101335632 3300005336 Bacteria 621
111 Ga0070680_101515888 3300005336 Bacteria 581
112 Ga0070682_100058779 3300005337 Bacteria 2425
113 Ga0070682_100316697 3300005337 Bacteria 1150
114 Ga0070682_101584440 3300005337 Bacteria 566
115 Ga0068868_100035150 3300005338 Bacteria 3872
116 Ga0068868_100166786 3300005338 Bacteria 1822
117 Ga0068868_100201592 3300005338 Bacteria 1659
118 Ga0068868_100355987 3300005338 Bacteria 1255
119 Ga0068868_100724207 3300005338 Bacteria 892
120 Ga0070660_100133313 3300005339 Bacteria 1989
121 Ga0070660_100252028 3300005339 Bacteria 1440
122 Ga0070660_100878421 3300005339 Bacteria 755
123 Ga0070660_101438456 3300005339 Bacteria 586
124 Ga0070689_100236971 3300005340 Bacteria 1502
125 Ga0070689_100812744 3300005340 Bacteria 823
126 Ga0070691_10017095 3300005341 Bacteria 3338
127 Ga0070687_100645345 3300005343 Bacteria 733
128 Ga0070661_100017074 3300005344 Bacteria 5144
129 Ga0070661_100018867 3300005344 Bacteria 4910
130 Ga0070661_100057112 3300005344 Bacteria 2860
131 Ga0070661_100083093 3300005344 Bacteria 2365
132 Ga0070661_100109495 3300005344 Bacteria 2061
133 Ga0070661_100259293 3300005344 Bacteria 1344
134 Ga0070661_100735824 3300005344 Bacteria 806
135 Ga0070692_10001200 3300005345 Bacteria 9184
136 Ga0070668_100027029 3300005347 Bacteria 4355
137 Ga0070668_100029601 3300005347 Bacteria 4159
138 Ga0070668_100037989 3300005347 Bacteria 3678
139 Ga0070668_100286427 3300005347 Bacteria 1377
140 Ga0070668_100701499 3300005347 Bacteria 893
141 Ga0070668_100853455 3300005347 Bacteria 812
142 Ga0070669_100556490 3300005353 Bacteria 957
143 Ga0070669_100801015 3300005353 Bacteria 801
144 Ga0070669_101688788 3300005353 Bacteria 552
145 Ga0070675_100075966 3300005354 Bacteria 2794
146 Ga0070675_100508634 3300005354 Bacteria 1086
147 Ga0070671_100140699 3300005355 Bacteria 2036
148 Ga0070671_101007524 3300005355 Bacteria 730
149 Ga0070671_101306999 3300005355 Bacteria 640
150 Ga0070671_102088059 3300005355 Bacteria 505
151 Ga0070674_100381466 3300005356 Bacteria 1147
152 Ga0070673_100118935 3300005364 Bacteria 2201
153 Ga0070673_100121644 3300005364 Bacteria 2178
154 Ga0070673_101658429 3300005364 Bacteria 605
155 Ga0070688_100662342 3300005365 Bacteria 805
156 Ga0070659_100295472 3300005366 Bacteria 1350
157 Ga0070659_100720786 3300005366 Bacteria 863
158 Ga0070659_101252060 3300005366 Bacteria 657
159 Ga0070667_100000084 3300005367 Bacteria 118027
160 Ga0070667_100014298 3300005367 Bacteria 6557
161 Ga0070667_100016481 3300005367 Bacteria 6115
162 Ga0070667_100111163 3300005367 Bacteria 2376
163 Ga0070667_100116610 3300005367 Bacteria 2319
164 Ga0070667_100166891 3300005367 Bacteria 1942
165 Ga0070667_100258183 3300005367 Bacteria 1559
166 Ga0070667_100380143 3300005367 Bacteria 1283
167 Ga0070667_100491248 3300005367 Bacteria 1125
168 Ga0070667_100518659 3300005367 Bacteria 1093
169 Ga0070667_100568992 3300005367 Bacteria 1042
170 Ga0070667_100569730 3300005367 Bacteria 1042
171 Ga0070667_100673927 3300005367 Bacteria 956
172 Ga0070667_100714646 3300005367 Bacteria 928
173 Ga0070667_101745029 3300005367 Bacteria 586
174 Ga0070667_101865706 3300005367 Bacteria 566
175 Ga0070709_10610281 3300005434 Bacteria 841
176 Ga0070714_100092322 3300005435 Bacteria 2653
177 Ga0070714_100233190 3300005435 Bacteria 1696
178 Ga0070714_100712286 3300005435 Bacteria 969
179 Ga0070713_100000401 3300005436 Bacteria 27829
180 Ga0070713_101546112 3300005436 Bacteria 644
181 Ga0070711_100847092 3300005439 Bacteria 778
182 Ga0070711_100949692 3300005439 Bacteria 736
183 Ga0070711_101627140 3300005439 Bacteria 565
184 Ga0070711_102041554 3300005439 Bacteria 504
185 Ga0070663_100000327 3300005455 Bacteria 24677
186 Ga0070663_100019945 3300005455 Bacteria 4428
187 Ga0070663_100099652 3300005455 Bacteria 2166
188 Ga0070663_100153698 3300005455 Bacteria 1767
189 Ga0070663_100166357 3300005455 Bacteria 1701
190 Ga0070663_101025064 3300005455 Bacteria 718
191 Ga0070663_101230109 3300005455 Bacteria 659
192 Ga0070678_100025334 3300005456 Bacteria 3988
193 Ga0070678_100082189 3300005456 Bacteria 2445
194 Ga0070678_100802964 3300005456 Bacteria 854
195 Ga0070678_102049207 3300005456 Bacteria 542
196 Ga0070662_100201437 3300005457 Bacteria 1580
197 Ga0070662_100324011 3300005457 Bacteria 1257
198 Ga0070662_100451123 3300005457 Bacteria 1067
199 Ga0070662_100458096 3300005457 Bacteria 1059
200 Ga0070662_100907941 3300005457 Bacteria 752
201 Ga0070662_101204415 3300005457 Bacteria 651
202 Ga0070681_10169047 3300005458 Bacteria 2108
203 Ga0070681_10367131 3300005458 Bacteria 1350
204 Ga0070681_10507270 3300005458 Bacteria 1119
205 Ga0068867_100151954 3300005459 Bacteria 1819
206 Ga0068867_100167454 3300005459 Bacteria 1738
207 Ga0068867_100205089 3300005459 Bacteria 1580
208 Ga0068867_100822787 3300005459 Bacteria 830
209 Ga0068867_101160619 3300005459 Bacteria 708
210 Ga0070685_10005887 3300005466 Bacteria 6239
211 Ga0070685_10659667 3300005466 Bacteria 759
212 Ga0070685_11298692 3300005466 Bacteria 556
213 Ga0070699_100813160 3300005518 Bacteria 855
214 Ga0070679_100193143 3300005530 Bacteria 2004
215 Ga0070679_102188816 3300005530 Bacteria 503
216 Ga0068853_100002704 3300005539 Bacteria 13374
217 Ga0068853_100065726 3300005539 Bacteria 3147
218 Ga0068853_100077969 3300005539 Bacteria 2895
219 Ga0068853_100243932 3300005539 Bacteria 1647
220 Ga0068853_100384322 3300005539 Bacteria 1311
221 Ga0068853_100597911 3300005539 Bacteria 1047
222 Ga0068853_100663150 3300005539 Bacteria 993
223 Ga0068853_100673498 3300005539 Bacteria 986
224 Ga0068853_101016012 3300005539 Bacteria 798
225 Ga0068853_101072473 3300005539 Bacteria 776
226 Ga0068853_101419858 3300005539 Bacteria 671
227 Ga0070672_100268324 3300005543 Bacteria 1440
228 Ga0070672_100274735 3300005543 Bacteria 1423
229 Ga0070696_100026415 3300005546 Bacteria 3950
230 Ga0070696_101086134 3300005546 Bacteria 672
231 Ga0070693_100084649 3300005547 Bacteria 1898
232 Ga0070693_100188355 3300005547 Bacteria 1333
233 Ga0070693_100258338 3300005547 Bacteria 1157
234 Ga0070693_100864475 3300005547 Bacteria 675
235 Ga0070665_100000249 3300005548 Bacteria 89011
236 Ga0070665_100012690 3300005548 Bacteria 8486
237 Ga0070665_100022171 3300005548 Bacteria 6389
238 Ga0070665_100056231 3300005548 Bacteria 3945
239 Ga0070665_100259943 3300005548 Bacteria 1737
240 Ga0070665_100543687 3300005548 Bacteria 1174
241 Ga0070665_100821504 3300005548 Bacteria 942
242 Ga0070665_101151931 3300005548 Bacteria 786
243 Ga0070665_101263570 3300005548 Bacteria 749
244 Ga0070665_101603595 3300005548 Bacteria 659
245 Ga0070665_101749902 3300005548 Bacteria 628
246 Ga0068855_100042228 3300005563 Bacteria 5403
247 Ga0068855_100060595 3300005563 Bacteria 4425
248 Ga0068855_100074780 3300005563 Bacteria 3934
249 Ga0068855_100082771 3300005563 Bacteria 3719
250 Ga0068855_100093629 3300005563 Bacteria 3465
251 Ga0068855_100122346 3300005563 Bacteria 2977
252 Ga0068855_100221989 3300005563 Bacteria 2118
253 Ga0068855_100257604 3300005563 Bacteria 1944
254 Ga0068855_100306227 3300005563 Bacteria 1759
255 Ga0068855_100349227 3300005563 Bacteria 1630
256 Ga0068855_100379456 3300005563 Bacteria 1552
257 Ga0068855_100519186 3300005563 Bacteria 1292
258 Ga0068855_101070197 3300005563 Bacteria 844
259 Ga0068855_101672526 3300005563 Bacteria 650
260 Ga0070664_100066498 3300005564 Bacteria 3078
261 Ga0070664_100159884 3300005564 Bacteria 1993
262 Ga0070664_100410070 3300005564 Bacteria 1240
263 Ga0068857_100000551 3300005577 Bacteria 27318
264 Ga0068857_100148913 3300005577 Bacteria 2119
265 Ga0068857_100208283 3300005577 Bacteria 1784
266 Ga0068857_100225783 3300005577 Bacteria 1711
267 Ga0068857_100636914 3300005577 Bacteria 1010
268 Ga0068857_101718814 3300005577 Bacteria 613
269 Ga0068857_102066812 3300005577 Bacteria 559
270 Ga0068854_100000634 3300005578 Bacteria 20800
271 Ga0068854_100028199 3300005578 Bacteria 3877
272 Ga0068854_100095505 3300005578 Bacteria 2219
273 Ga0068854_100134375 3300005578 Bacteria 1892
274 Ga0068854_100345216 3300005578 Bacteria 1217
275 Ga0068854_100463767 3300005578 Bacteria 1060
276 Ga0068854_100562606 3300005578 Bacteria 969
277 Ga0068856_100000245 3300005614 Bacteria 59235
278 Ga0068856_100015179 3300005614 Bacteria 7440
279 Ga0068856_100034861 3300005614 Bacteria 4931
280 Ga0068856_100252731 3300005614 Bacteria 1778
281 Ga0068856_100372684 3300005614 Bacteria 1446
282 Ga0068856_100452730 3300005614 Bacteria 1304
283 Ga0068856_100734895 3300005614 Bacteria 1007
284 Ga0068856_100735744 3300005614 Bacteria 1006
285 Ga0068856_100761240 3300005614 Bacteria 988
286 Ga0068856_100774353 3300005614 Bacteria 979
287 Ga0068856_101836171 3300005614 Bacteria 617
288 Ga0068852_100038365 3300005616 Bacteria 4025
289 Ga0068852_100118481 3300005616 Bacteria 2419
290 Ga0068852_100166563 3300005616 Bacteria 2062
291 Ga0068852_100502344 3300005616 Bacteria 1207
292 Ga0068852_100531430 3300005616 Bacteria 1174
293 Ga0068852_100662612 3300005616 Bacteria 1052
294 Ga0068852_100761451 3300005616 Bacteria 981
295 Ga0068852_101026213 3300005616 Bacteria 844
296 Ga0068852_101128034 3300005616 Bacteria 805
297 Ga0068852_101410680 3300005616 Bacteria 719
298 Ga0068852_102722405 3300005616 Bacteria 513
299 Ga0068859_100001367 3300005617 Bacteria 24845
300 Ga0068859_100261639 3300005617 Bacteria 1821
301 Ga0068859_100797998 3300005617 Bacteria 1032
302 Ga0068859_100906336 3300005617 Bacteria 966
303 Ga0068859_100972630 3300005617 Bacteria 932
304 Ga0068864_100238138 3300005618 Bacteria 1685
305 Ga0068864_100388209 3300005618 Bacteria 1325
306 Ga0068864_100399545 3300005618 Bacteria 1306
307 Ga0068864_100585219 3300005618 Bacteria 1082
308 Ga0068866_10935768 3300005718 Bacteria 612
309 Ga0068861_100300737 3300005719 Bacteria 1390
310 Ga0068861_100927172 3300005719 Bacteria 827
311 Ga0068851_10002343 3300005834 Bacteria 8336
312 Ga0068851_10176390 3300005834 Bacteria 1182
313 Ga0068851_10221766 3300005834 Bacteria 1063
314 Ga0068851_10484571 3300005834 Bacteria 740
315 Ga0068870_10669774 3300005840 Bacteria 713
316 Ga0068863_100005779 3300005841 Bacteria 12127
317 Ga0068863_100015026 3300005841 Bacteria 7437
318 Ga0068863_100039049 3300005841 Bacteria 4517
319 Ga0068863_100090495 3300005841 Bacteria 2901
320 Ga0068863_100171415 3300005841 Bacteria 2082
321 Ga0068863_101228510 3300005841 Bacteria 755
322 Ga0068863_101273389 3300005841 Bacteria 742
323 Ga0068863_101684782 3300005841 Bacteria 644
324 Ga0068858_100002098 3300005842 Bacteria 20252
325 Ga0068858_100087159 3300005842 Bacteria 2904
326 Ga0068858_100514926 3300005842 Bacteria 1157
327 Ga0068858_102317411 3300005842 Bacteria 531
328 Ga0068860_100002623 3300005843 Bacteria 18693
329 Ga0068860_100125858 3300005843 Bacteria 2456
330 Ga0068860_100153813 3300005843 Bacteria 2216
331 Ga0068860_100231301 3300005843 Bacteria 1796
332 Ga0068860_100306934 3300005843 Bacteria 1556
333 Ga0068860_100798786 3300005843 Bacteria 957
334 Ga0068860_101747859 3300005843 Bacteria 644
335 Ga0068862_100000941 3300005844 Bacteria 28057
336 Ga0068862_100839203 3300005844 Bacteria 900
337 Ga0081455_10094355 3300005937 Bacteria 2417
338 Ga0081455_10541744 3300005937 Bacteria 772
339 Ga0081540_1001118 3300005983 Bacteria 23746
340 Ga0075365_10573912 3300006038 Bacteria 798
341 Ga0075364_10603065 3300006051 Unclassified 750
342 Ga0070716_101083873 3300006173 Bacteria 638
343 Ga0070712_100695102 3300006175 Bacteria 867
344 Ga0070712_101210084 3300006175 Bacteria 657
345 Ga0075367_10334613 3300006178 Unclassified 955
346 Ga0075366_10904500 3300006195 Bacteria 550
347 Ga0097621_100128744 3300006237 Bacteria 2152
348 Ga0097621_100250600 3300006237 Bacteria 1550
349 Ga0097621_100445794 3300006237 Bacteria 1165
350 Ga0097621_100463893 3300006237 Bacteria 1143
351 Ga0097621_101384646 3300006237 Bacteria 666
352 Ga0068871_100038080 3300006358 Bacteria 3837
353 Ga0068871_100111371 3300006358 Bacteria 2302
354 Ga0068871_100169544 3300006358 Bacteria 1870
355 Ga0068871_100362746 3300006358 Bacteria 1283
356 Ga0068871_100383698 3300006358 Bacteria 1248
357 Ga0068871_101410630 3300006358 Bacteria 657
358 Ga0068871_101446288 3300006358 Bacteria 649
359 Ga0075431_100702404 3300006847 Bacteria 989
360 Ga0075434_101493858 3300006871 Bacteria 685
361 Ga0068865_100003492 3300006881 Bacteria 9421
362 Ga0068865_100018704 3300006881 Bacteria 4475
363 Ga0068865_100196150 3300006881 Bacteria 1565
364 Ga0068865_100213578 3300006881 Bacteria 1505
365 Ga0068865_100758994 3300006881 Bacteria 834
366 Ga0068865_101901953 3300006881 Bacteria 539
367 Ga0075436_100124884 3300006914 Bacteria 1803
368 Ga0097620_100001367 3300006931 Bacteria 24845
369 Ga0097620_100261640 3300006931 Bacteria 1821
370 Ga0097620_100798097 3300006931 Bacteria 1032
371 Ga0097620_100906622 3300006931 Bacteria 966
372 Ga0097620_100972635 3300006931 Bacteria 932
373 Ga0099826_10169391 3300006948 Bacteria 1228
374 Ga0105240_10000627 3300009093 Bacteria 65150
375 Ga0105240_10098926 3300009093 Bacteria 3551
376 Ga0105240_10123497 3300009093 Bacteria 3115
377 Ga0105240_10213925 3300009093 Bacteria 2250
378 Ga0105240_10309393 3300009093 Bacteria 1805
379 Ga0105240_10335124 3300009093 Bacteria 1720
380 Ga0105240_10431908 3300009093 Bacteria 1478
381 Ga0105240_10559067 3300009093 Bacteria 1265
382 Ga0105240_10760555 3300009093 Bacteria 1053
383 Ga0105240_10760556 3300009093 Bacteria 1053
384 Ga0105240_11558216 3300009093 Bacteria 692
385 Ga0111539_11813593 3300009094 Bacteria 707
386 Ga0105245_10261611 3300009098 Bacteria 1684
387 Ga0105245_10331048 3300009098 Bacteria 1503
388 Ga0105245_10624776 3300009098 Bacteria 1106
389 Ga0105245_11467698 3300009098 Bacteria 733
390 Ga0105247_10053155 3300009101 Bacteria 2498
391 Ga0105247_10196742 3300009101 Bacteria 1352
392 Ga0105243_10674006 3300009148 Bacteria 1005
393 Ga0105243_12070627 3300009148 Bacteria 604
394 Ga0105241_10050532 3300009174 Bacteria 3169
395 Ga0105241_10104348 3300009174 Bacteria 2258
396 Ga0105241_10122703 3300009174 Bacteria 2094
397 Ga0105241_10295120 3300009174 Bacteria 1389
398 Ga0105241_10354005 3300009174 Bacteria 1276
399 Ga0105241_10622816 3300009174 Bacteria 977
400 Ga0105241_10701426 3300009174 Bacteria 924
401 Ga0105241_10864665 3300009174 Bacteria 837
402 Ga0105241_11223866 3300009174 Bacteria 712
403 Ga0105241_11551149 3300009174 Bacteria 639
404 Ga0105241_11704536 3300009174 Bacteria 612
405 Ga0105241_11788613 3300009174 Bacteria 599
406 Ga0105242_10025509 3300009176 Bacteria 4678
407 Ga0105242_10076451 3300009176 Bacteria 2791
408 Ga0105242_10312729 3300009176 Bacteria 1438
409 Ga0105242_10374891 3300009176 Bacteria 1321
410 Ga0105242_10978358 3300009176 Bacteria 852
411 Ga0105242_11022674 3300009176 Bacteria 835
412 Ga0105248_10000418 3300009177 Bacteria 48728
413 Ga0105248_10076122 3300009177 Bacteria 3772
414 Ga0105248_10326174 3300009177 Bacteria 1729
415 Ga0105248_10451960 3300009177 Bacteria 1448
416 Ga0105248_10843000 3300009177 Bacteria 1035
417 Ga0105237_10000272 3300009545 Bacteria 72718
418 Ga0105237_10006138 3300009545 Bacteria 13433
419 Ga0105237_10026547 3300009545 Bacteria 5919
420 Ga0105237_10031065 3300009545 Bacteria 5418
421 Ga0105237_10147981 3300009545 Bacteria 2344
422 Ga0105237_10245121 3300009545 Bacteria 1793
423 Ga0105237_10352560 3300009545 Bacteria 1476
424 Ga0105237_10525259 3300009545 Bacteria 1190
425 Ga0105237_10573499 3300009545 Bacteria 1135
426 Ga0105237_10659941 3300009545 Bacteria 1053
427 Ga0105237_10659942 3300009545 Bacteria 1053
428 Ga0105237_10706116 3300009545 Bacteria 1015
429 Ga0105237_10980829 3300009545 Bacteria 852
430 Ga0105237_11112211 3300009545 Bacteria 797
431 Ga0105237_11264886 3300009545 Bacteria 744
432 Ga0105237_11359290 3300009545 Bacteria 717
433 Ga0105237_11790736 3300009545 Bacteria 622
434 Ga0105238_10000920 3300009551 Bacteria 30091
435 Ga0105238_10002036 3300009551 Bacteria 20417
436 Ga0105238_10043470 3300009551 Bacteria 4546
437 Ga0105238_10060458 3300009551 Bacteria 3793
438 Ga0105238_10119920 3300009551 Bacteria 2610
439 Ga0105238_10127655 3300009551 Bacteria 2522
440 Ga0105238_10176228 3300009551 Bacteria 2115
441 Ga0105238_10176250 3300009551 Bacteria 2115
442 Ga0105238_10199227 3300009551 Bacteria 1978
443 Ga0105238_11015940 3300009551 Bacteria 850
444 Ga0105238_11210731 3300009551 Bacteria 780
445 Ga0105238_11362851 3300009551 Bacteria 736
446 Ga0105238_12579614 3300009551 Bacteria 544
447 Ga0105249_10000195 3300009553 Bacteria 69709
448 Ga0105249_10027675 3300009553 Bacteria 5116
449 Ga0105249_10216336 3300009553 Bacteria 1883
450 Ga0105249_10356663 3300009553 Bacteria 1483
451 Ga0105249_11155462 3300009553 Bacteria 845
452 Ga0105148_101049 3300009978 Bacteria 1972
453 Ga0105239_10000044 3300010375 Bacteria 187680
454 Ga0105239_10002892 3300010375 Bacteria 21455
455 Ga0105239_10006627 3300010375 Bacteria 13407
456 Ga0105239_10032059 3300010375 Bacteria 5775
457 Ga0105239_10100612 3300010375 Bacteria 3197
458 Ga0105239_10130571 3300010375 Bacteria 2794
459 Ga0105239_10170468 3300010375 Bacteria 2434
460 Ga0105239_10225035 3300010375 Bacteria 2104
461 Ga0105239_10416289 3300010375 Bacteria 1522
462 Ga0105239_10539534 3300010375 Bacteria 1328
463 Ga0105239_10661316 3300010375 Bacteria 1193
464 Ga0105239_11091601 3300010375 Bacteria 918
465 Ga0105239_11337868 3300010375 Bacteria 826
466 Ga0105239_11344595 3300010375 Bacteria 824
467 Ga0105239_12980888 3300010375 Bacteria 552
468 Ga0105246_10341529 3300011119 Bacteria 1224
469 Ga0105246_10840462 3300011119 Bacteria 818
470 Ga0105246_11919937 3300011119 Bacteria 569
471 Ga0157343_1015133 3300012488 Bacteria 641
472 Ga0157314_1013756 3300012500 Bacteria 744
473 Ga0157373_10121166 3300013100 Bacteria 1838
474 Ga0157373_10337468 3300013100 Bacteria 1074
475 Ga0157371_10011946 3300013102 Bacteria 6659
476 Ga0157371_10210003 3300013102 Bacteria 1397
477 Ga0157371_10802598 3300013102 Bacteria 709
478 Ga0157370_10007966 3300013104 Bacteria 11479
479 Ga0157370_10021865 3300013104 Bacteria 6371
480 Ga0157370_10030429 3300013104 Bacteria 5289
481 Ga0157370_10049266 3300013104 Bacteria 4032
482 Ga0157370_10113933 3300013104 Bacteria 2526
483 Ga0157370_10114393 3300013104 Bacteria 2521
484 Ga0157370_10359121 3300013104 Bacteria 1343
485 Ga0157370_10406772 3300013104 Bacteria 1252
486 Ga0157370_10620345 3300013104 Bacteria 989
487 Ga0157370_10745667 3300013104 Bacteria 892
488 Ga0157370_10769083 3300013104 Bacteria 877
489 Ga0157370_11072838 3300013104 Bacteria 728
490 Ga0157370_11495738 3300013104 Bacteria 607
491 Ga0157370_11870415 3300013104 Bacteria 538
492 Ga0157369_10000329 3300013105 Bacteria 63484
493 Ga0157369_10000604 3300013105 Bacteria 46765
494 Ga0157369_10009635 3300013105 Bacteria 11046
495 Ga0157369_10010381 3300013105 Bacteria 10617
496 Ga0157369_10023388 3300013105 Bacteria 6882
497 Ga0157369_10403660 3300013105 Bacteria 1418
498 Ga0157369_10417095 3300013105 Bacteria 1392
499 Ga0157369_10629502 3300013105 Bacteria 1107
500 Ga0157369_10852514 3300013105 Bacteria 935
501 Ga0157369_10857160 3300013105 Bacteria 932
502 Ga0157369_11972512 3300013105 Bacteria 592
503 Ga0157374_10279686 3300013296 Bacteria 1647
504 Ga0157374_10303991 3300013296 Bacteria 1578
505 Ga0157374_10435621 3300013296 Bacteria 1311
506 Ga0157374_10859562 3300013296 Bacteria 924
507 Ga0157374_10921159 3300013296 Bacteria 892
508 Ga0157374_11029757 3300013296 Bacteria 843
509 Ga0157374_12054846 3300013296 Bacteria 598
510 Ga0157378_10001163 3300013297 Bacteria 23938
511 Ga0157378_10036782 3300013297 Bacteria 4332
512 Ga0157378_10460056 3300013297 Bacteria 1264
513 Ga0157378_11489034 3300013297 Bacteria 721
514 Ga0163162_10002333 3300013306 Bacteria 17809
515 Ga0163162_10022472 3300013306 Bacteria 6214
516 Ga0163162_10039066 3300013306 Bacteria 4739
517 Ga0163162_11562272 3300013306 Bacteria 752
518 Ga0163162_12242717 3300013306 Bacteria 627
519 Ga0157372_10023320 3300013307 Bacteria 6708
520 Ga0157372_10023763 3300013307 Bacteria 6649
521 Ga0157372_10038916 3300013307 Bacteria 5249
522 Ga0157372_10072331 3300013307 Bacteria 3886
523 Ga0157372_10082841 3300013307 Bacteria 3632
524 Ga0157372_10189213 3300013307 Bacteria 2384
525 Ga0157372_10206533 3300013307 Bacteria 2276
526 Ga0157372_10375352 3300013307 Bacteria 1657
527 Ga0157372_10431261 3300013307 Bacteria 1536
528 Ga0157372_10779366 3300013307 Bacteria 1111
529 Ga0157372_11383829 3300013307 Bacteria 811
530 Ga0157375_10013024 3300013308 Bacteria 7390
531 Ga0157375_10064653 3300013308 Bacteria 3643
532 Ga0157375_10167400 3300013308 Bacteria 2343
533 Ga0157375_10896503 3300013308 Bacteria 1031
534 Ga0163163_10000754 3300014325 Bacteria 27527
535 Ga0163163_10239681 3300014325 Bacteria 1863
536 Ga0163163_10241793 3300014325 Bacteria 1855
537 Ga0163163_11931750 3300014325 Bacteria 650
538 Ga0157380_12656551 3300014326 Bacteria 567
539 Ga0182008_10066759 3300014497 Bacteria 1770
540 Ga0182008_10166729 3300014497 Bacteria 1110
541 Ga0182008_10389459 3300014497 Bacteria 746
542 Ga0157377_10969725 3300014745 Bacteria 641
543 Ga0157379_10188376 3300014968 Bacteria 1865
544 Ga0157379_10360209 3300014968 Bacteria 1333
545 Ga0157376_10002106 3300014969 Bacteria 13384
546 Ga0157376_10673001 3300014969 Bacteria 1037
547 Ga0157376_11211577 3300014969 Bacteria 783
548 Ga0182006_1013034 3300015261 Bacteria 3621
549 Ga0182007_10034657 3300015262 Bacteria 1704
550 Ga0182007_10207051 3300015262 Bacteria 688
551 Ga0182007_10221888 3300015262 Bacteria 668
552 Ga0182005_1051168 3300015265 Bacteria 1123
553 Ga0183369_1008 3300015685 Bacteria 346514
554 Ga0183368_1003 3300015687 Bacteria 1276390
555 Ga0183360_10001 3300015689 Bacteria 3943671
556 Ga0163161_10331938 3300017792 Bacteria 1204
557 Ga0163161_11073987 3300017792 Bacteria 691
558 Ga0206356_11373589 3300020070 Bacteria 1638
559 Ga0206354_10531980 3300020081 Bacteria 1185
560 Ga0206353_10211211 3300020082 Bacteria 860
561 Ga0154015_1010693 3300020610 Bacteria 1120
562 Ga0213872_10006100 3300021361 Bacteria 6099
563 Ga0209435_102375 3300025206 Bacteria 2214
564 Ga0209435_102791 3300025206 Bacteria 2023
565 Ga0209760_100371 3300025207 Bacteria 11904
566 Ga0209784_100016 3300025224 Bacteria 481036
567 Ga0209566_101455 3300025225 Bacteria 6871
568 Ga0209674_100012 3300025226 Bacteria 950162
569 Ga0209674_100322 3300025226 Bacteria 30565
570 Ga0209674_100347 3300025226 Bacteria 26865
571 Ga0209674_101036 3300025226 Bacteria 8447
572 Ga0209672_100007 3300025228 Bacteria 959482
573 Ga0209672_100078 3300025228 Bacteria 156926
574 Ga0209672_100389 3300025228 Bacteria 26663
575 Ga0209672_100559 3300025228 Bacteria 19837
576 Ga0209672_105497 3300025228 Bacteria 2164
577 Ga0209147_112175 3300025229 Bacteria 931
578 Ga0209563_100079 3300025230 Bacteria 203017
579 Ga0207427_100033 3300025231 Bacteria 338459
580 Ga0207427_100188 3300025231 Bacteria 63213
581 Ga0207427_100402 3300025231 Bacteria 25407
582 Ga0207427_100594 3300025231 Bacteria 18110
583 Ga0207427_102610 3300025231 Bacteria 4622
584 Ga0209437_100012 3300025233 Bacteria 792625
585 Ga0209437_100020 3300025233 Bacteria 656374
586 Ga0209437_100105 3300025233 Bacteria 220034
587 Ga0209437_100192 3300025233 Bacteria 122888
588 Ga0209437_100537 3300025233 Bacteria 26234
589 Ga0209437_101513 3300025233 Bacteria 5500
590 Ga0209258_100012 3300025242 Bacteria 825544
591 Ga0209258_100046 3300025242 Bacteria 369794
592 Ga0209258_100095 3300025242 Bacteria 223270
593 Ga0209258_100238 3300025242 Bacteria 102043
594 Ga0209258_100765 3300025242 Bacteria 19864
595 Ga0209258_101311 3300025242 Bacteria 9204
596 Ga0209258_101904 3300025242 Bacteria 6196
597 Ga0209258_121959 3300025242 Bacteria 656
598 Ga0207425_1001752 3300025245 Bacteria 8476
599 Ga0209646_1001514 3300025246 Bacteria 6161
600 Ga0209646_1001913 3300025246 Bacteria 5063
601 Ga0209646_1001986 3300025246 Bacteria 4915
602 Ga0209026_1000012 3300025250 Bacteria 480426
603 Ga0209026_1000105 3300025250 Bacteria 150738
604 Ga0209026_1000278 3300025250 Bacteria 59676
605 Ga0209026_1000285 3300025250 Bacteria 58221
606 Ga0209026_1000335 3300025250 Bacteria 45678
607 Ga0209026_1030371 3300025250 Bacteria 803
608 Ga0209026_1033302 3300025250 Bacteria 760
609 Ga0209677_103018 3300025253 Bacteria 5800
610 Ga0209148_1000001 3300025254 Bacteria 2545271
611 Ga0209148_1000005 3300025254 Bacteria 1806504
612 Ga0209148_1000014 3300025254 Bacteria 925277
613 Ga0209148_1000039 3300025254 Bacteria 482479
614 Ga0209148_1000087 3300025254 Bacteria 260905
615 Ga0209148_1000098 3300025254 Bacteria 233172
616 Ga0209148_1025941 3300025254 Bacteria 914
617 Ga0209759_1000356 3300025256 Bacteria 59211
618 Ga0209759_1000460 3300025256 Bacteria 46256
619 Ga0209759_1000536 3300025256 Bacteria 39942
620 Ga0209759_1000912 3300025256 Bacteria 21915
621 Ga0209759_1023568 3300025256 Bacteria 1352
622 Ga0209129_1002063 3300025258 Bacteria 10356
623 Ga0209129_1003433 3300025258 Bacteria 6893
624 Ga0209233_1000002 3300025261 Bacteria 2501366
625 Ga0209233_1000020 3300025261 Bacteria 798224
626 Ga0209233_1000080 3300025261 Bacteria 338459
627 Ga0209233_1000370 3300025261 Bacteria 40063
628 Ga0209233_1060127 3300025261 Bacteria 736
629 Ga0209565_1000048 3300025263 Bacteria 224961
630 Ga0209455_1000010 3300025272 Bacteria 959482
631 Ga0209455_1000034 3300025272 Bacteria 483129
632 Ga0209455_1000039 3300025272 Bacteria 437734
633 Ga0209455_1000126 3300025272 Bacteria 165771
634 Ga0209455_1000310 3300025272 Bacteria 49825
635 Ga0209455_1016170 3300025272 Bacteria 1613
636 Ga0209673_1000001 3300025273 Bacteria 3176258
637 Ga0209673_1018372 3300025273 Bacteria 2544
638 Ga0209673_1095729 3300025273 Bacteria 648
639 Ga0209130_1002842 3300025284 Bacteria 8029
640 Ga0209675_1000045 3300025291 Bacteria 225750
641 Ga0209675_1036559 3300025291 Bacteria 1111
642 Ga0209676_1006754 3300025292 Bacteria 5578
643 Ga0209025_1000005 3300025294 Bacteria 1272149
644 Ga0209025_1006351 3300025294 Bacteria 9208
645 Ga0209025_1013061 3300025294 Bacteria 5253
646 Ga0209025_1040960 3300025294 Bacteria 1993
647 Ga0209564_1000001 3300025295 Bacteria 3176258
648 Ga0209564_1039988 3300025295 Bacteria 1280
649 Ga0209758_1000535 3300025297 Bacteria 60513
650 Ga0209758_1009118 3300025297 Bacteria 6254
651 Ga0209758_1012999 3300025297 Bacteria 4591
652 Ga0209050_1001247 3300025298 Bacteria 29383
653 Ga0209256_1000002 3300025299 Bacteria 1906740
654 Ga0209256_1004565 3300025299 Bacteria 8591
655 Ga0209256_1039654 3300025299 Bacteria 1209
656 Ga0207426_1006400 3300025302 Bacteria 5131
657 Ga0207426_1138574 3300025302 Bacteria 581
658 Ga0209051_1014949 3300025303 Bacteria 3598
659 Ga0209051_1019027 3300025303 Bacteria 3013
660 Ga0209051_1031421 3300025303 Bacteria 2043
661 Ga0209257_1000217 3300025304 Bacteria 136049
662 Ga0209257_1016898 3300025304 Bacteria 2913
663 Ga0209257_1041047 3300025304 Bacteria 1375
664 Ga0209257_1107616 3300025304 Bacteria 670
665 Ga0207697_10114964 3300025315 Bacteria 1154
666 Ga0207656_10001733 3300025321 Bacteria 7257
667 Ga0207656_10028858 3300025321 Bacteria 2281
668 Ga0207656_10062176 3300025321 Bacteria 1640
669 Ga0207656_10175900 3300025321 Bacteria 1025
670 Ga0207656_10696310 3300025321 Bacteria 520
671 Ga0207682_10277748 3300025893 Bacteria 783
672 Ga0207692_10138951 3300025898 Bacteria 1380
673 Ga0207710_10020591 3300025900 Bacteria 2821
674 Ga0207680_10000006 3300025903 Bacteria 635950
675 Ga0207680_10001267 3300025903 Bacteria 11957
676 Ga0207680_10053739 3300025903 Bacteria 2419
677 Ga0207680_10224992 3300025903 Bacteria 1288
678 Ga0207680_10394596 3300025903 Bacteria 977
679 Ga0207680_10540156 3300025903 Bacteria 832
680 Ga0207647_10000111 3300025904 Bacteria 62900
681 Ga0207647_10000138 3300025904 Bacteria 57656
682 Ga0207647_10000859 3300025904 Bacteria 23543
683 Ga0207647_10018916 3300025904 Bacteria 4642
684 Ga0207647_10091644 3300025904 Bacteria 1812
685 Ga0207647_10308961 3300025904 Bacteria 899
686 Ga0207647_10323271 3300025904 Bacteria 876
687 Ga0207699_10193317 3300025906 Bacteria 1374
688 Ga0207645_10038319 3300025907 Bacteria 3074
689 Ga0207645_10192165 3300025907 Bacteria 1342
690 Ga0207645_10229743 3300025907 Bacteria 1224
691 Ga0207645_10350588 3300025907 Bacteria 988
692 Ga0207645_10753167 3300025907 Bacteria 662
693 Ga0207643_10178438 3300025908 Bacteria 1284
694 Ga0207705_10000798 3300025909 Bacteria 25879
695 Ga0207705_10009804 3300025909 Bacteria 6971
696 Ga0207654_10004940 3300025911 Bacteria 6748
697 Ga0207654_10027457 3300025911 Bacteria 3094
698 Ga0207654_10044512 3300025911 Bacteria 2522
699 Ga0207654_10073004 3300025911 Bacteria 2044
700 Ga0207654_10074909 3300025911 Bacteria 2021
701 Ga0207654_10348119 3300025911 Bacteria 1020
702 Ga0207654_11388909 3300025911 Bacteria 512
703 Ga0207707_10064913 3300025912 Bacteria 3179
704 Ga0207695_10000033 3300025913 Bacteria 507477
705 Ga0207695_10000811 3300025913 Bacteria 58170
706 Ga0207695_10002522 3300025913 Bacteria 26898
707 Ga0207695_10003038 3300025913 Bacteria 24050
708 Ga0207695_10009508 3300025913 Bacteria 12022
709 Ga0207695_10010778 3300025913 Bacteria 11147
710 Ga0207695_10015564 3300025913 Bacteria 8948
711 Ga0207695_10048491 3300025913 Bacteria 4485
712 Ga0207695_10073143 3300025913 Bacteria 3494
713 Ga0207695_10372772 3300025913 Bacteria 1314
714 Ga0207695_10518226 3300025913 Bacteria 1074
715 Ga0207695_10645359 3300025913 Bacteria 940
716 Ga0207671_10000020 3300025914 Bacteria 309636
717 Ga0207671_10000116 3300025914 Bacteria 122775
718 Ga0207671_10001713 3300025914 Bacteria 24767
719 Ga0207671_10012021 3300025914 Bacteria 6992
720 Ga0207671_10012358 3300025914 Bacteria 6869
721 Ga0207671_10076983 3300025914 Bacteria 2497
722 Ga0207671_10169216 3300025914 Bacteria 1696
723 Ga0207671_10315292 3300025914 Bacteria 1237
724 Ga0207671_10469545 3300025914 Bacteria 1003
725 Ga0207671_10640721 3300025914 Bacteria 846
726 Ga0207671_11105187 3300025914 Bacteria 623
727 Ga0207671_11324007 3300025914 Bacteria 560
728 Ga0207693_10275388 3300025915 Bacteria 1319
729 Ga0207663_10124228 3300025916 Bacteria 1772
730 Ga0207660_10839858 3300025917 Bacteria 750
731 Ga0207660_11339242 3300025917 Bacteria 581
732 Ga0207657_10007879 3300025919 Bacteria 10870
733 Ga0207657_10348016 3300025919 Bacteria 1169
734 Ga0207657_11127448 3300025919 Bacteria 599
735 Ga0207649_10007346 3300025920 Bacteria 5996
736 Ga0207649_10012095 3300025920 Bacteria 4777
737 Ga0207649_10450764 3300025920 Bacteria 971
738 Ga0207649_10484754 3300025920 Bacteria 938
739 Ga0207649_10505985 3300025920 Bacteria 919
740 Ga0207649_10593840 3300025920 Bacteria 851
741 Ga0207652_10735412 3300025921 Bacteria 879
742 Ga0207652_11109887 3300025921 Bacteria 691
743 Ga0207652_11361130 3300025921 Bacteria 613
744 Ga0207681_10321259 3300025923 Bacteria 1231
745 Ga0207681_11587823 3300025923 Bacteria 548
746 Ga0207694_10000298 3300025924 Bacteria 46766
747 Ga0207694_10000613 3300025924 Bacteria 32386
748 Ga0207694_10002589 3300025924 Bacteria 14673
749 Ga0207694_10017252 3300025924 Bacteria 5456
750 Ga0207694_10052522 3300025924 Bacteria 3159
751 Ga0207694_10076987 3300025924 Bacteria 2613
752 Ga0207694_10097903 3300025924 Bacteria 2321
753 Ga0207694_10188934 3300025924 Bacteria 1673
754 Ga0207694_10199790 3300025924 Bacteria 1626
755 Ga0207694_10285197 3300025924 Bacteria 1357
756 Ga0207694_10588990 3300025924 Bacteria 935
757 Ga0207694_10590678 3300025924 Bacteria 934
758 Ga0207694_10770357 3300025924 Bacteria 812
759 Ga0207650_10095582 3300025925 Bacteria 2278
760 Ga0207650_10318005 3300025925 Bacteria 1274
761 Ga0207650_10778652 3300025925 Bacteria 810
762 Ga0207650_11085080 3300025925 Bacteria 681
763 Ga0207650_11300762 3300025925 Bacteria 619
764 Ga0207659_10532511 3300025926 Bacteria 997
765 Ga0207687_10096129 3300025927 Bacteria 2170
766 Ga0207687_10363853 3300025927 Bacteria 1181
767 Ga0207700_10002543 3300025928 Bacteria 10470
768 Ga0207700_11025090 3300025928 Bacteria 738
769 Ga0207700_11074043 3300025928 Bacteria 720
770 Ga0207664_10002383 3300025929 Bacteria 12426
771 Ga0207664_10007284 3300025929 Bacteria 7672
772 Ga0207664_10213080 3300025929 Bacteria 1672
773 Ga0207664_10737564 3300025929 Bacteria 886
774 Ga0207644_10001304 3300025931 Bacteria 16036
775 Ga0207644_10016173 3300025931 Bacteria 5019
776 Ga0207644_11766530 3300025931 Bacteria 518
777 Ga0207690_10000967 3300025932 Bacteria 18375
778 Ga0207690_10093111 3300025932 Bacteria 2134
779 Ga0207706_10002270 3300025933 Bacteria 18770
780 Ga0207706_10077003 3300025933 Bacteria 2934
781 Ga0207706_10385216 3300025933 Bacteria 1216
782 Ga0207706_10533820 3300025933 Bacteria 1011
783 Ga0207686_10010245 3300025934 Bacteria 5100
784 Ga0207670_10192556 3300025936 Bacteria 1544
785 Ga0207669_11965142 3300025937 Bacteria 500
786 Ga0207704_10103961 3300025938 Bacteria 1901
787 Ga0207704_10211891 3300025938 Bacteria 1427
788 Ga0207704_10215845 3300025938 Bacteria 1416
789 Ga0207704_10480609 3300025938 Bacteria 997
790 Ga0207704_11852747 3300025938 Bacteria 519
791 Ga0207665_11491561 3300025939 Bacteria 537
792 Ga0207665_11641398 3300025939 Bacteria 509
793 Ga0207691_10024143 3300025940 Bacteria 5718
794 Ga0207691_10038895 3300025940 Bacteria 4402
795 Ga0207691_10116249 3300025940 Bacteria 2374
796 Ga0207691_10417304 3300025940 Bacteria 1144
797 Ga0207711_10000503 3300025941 Bacteria 40349
798 Ga0207711_10125299 3300025941 Bacteria 2297
799 Ga0207711_10185512 3300025941 Bacteria 1893
800 Ga0207711_10473892 3300025941 Bacteria 1166
801 Ga0207711_10671405 3300025941 Bacteria 967
802 Ga0207711_11369556 3300025941 Bacteria 650
803 Ga0207711_11654523 3300025941 Bacteria 583
804 Ga0207689_10077296 3300025942 Bacteria 2736
805 Ga0207689_10529262 3300025942 Bacteria 989
806 Ga0207661_10834126 3300025944 Bacteria 849
807 Ga0207661_11215245 3300025944 Bacteria 693
808 Ga0207679_10652056 3300025945 Bacteria 952
809 Ga0207667_10001535 3300025949 Bacteria 29037
810 Ga0207667_10001609 3300025949 Bacteria 28404
811 Ga0207667_10006791 3300025949 Bacteria 13820
812 Ga0207667_10019505 3300025949 Bacteria 7567
813 Ga0207667_10026092 3300025949 Bacteria 6389
814 Ga0207667_10037914 3300025949 Bacteria 5150
815 Ga0207667_10059529 3300025949 Bacteria 4000
816 Ga0207667_10261566 3300025949 Bacteria 1769
817 Ga0207667_10304225 3300025949 Bacteria 1629
818 Ga0207667_10591522 3300025949 Bacteria 1119
819 Ga0207667_10774748 3300025949 Bacteria 957
820 Ga0207667_10931147 3300025949 Bacteria 859
821 Ga0207667_11323449 3300025949 Bacteria 696
822 Ga0207651_10195419 3300025960 Bacteria 1617
823 Ga0207651_10493390 3300025960 Bacteria 1057
824 Ga0207651_11539128 3300025960 Bacteria 599
825 Ga0207712_10000277 3300025961 Bacteria 48990
826 Ga0207712_10000477 3300025961 Bacteria 33669
827 Ga0207712_10147728 3300025961 Bacteria 1812
828 Ga0207668_10011169 3300025972 Bacteria 5450
829 Ga0207668_10019520 3300025972 Bacteria 4288
830 Ga0207668_10075249 3300025972 Bacteria 2427
831 Ga0207668_10286079 3300025972 Bacteria 1354
832 Ga0207668_10626346 3300025972 Bacteria 939
833 Ga0207668_10746716 3300025972 Bacteria 863
834 Ga0207640_10002403 3300025981 Bacteria 10021
835 Ga0207640_10015095 3300025981 Bacteria 4464
836 Ga0207640_10016040 3300025981 Bacteria 4348
837 Ga0207640_10069799 3300025981 Bacteria 2361
838 Ga0207640_10148784 3300025981 Bacteria 1717
839 Ga0207640_10155151 3300025981 Bacteria 1687
840 Ga0207640_10461418 3300025981 Bacteria 1049
841 Ga0207640_11348161 3300025981 Bacteria 638
842 Ga0207658_10000286 3300025986 Bacteria 52832
843 Ga0207658_10007375 3300025986 Bacteria 7498
844 Ga0207658_10053046 3300025986 Bacteria 2994
845 Ga0207658_10058890 3300025986 Bacteria 2860
846 Ga0207658_10064327 3300025986 Bacteria 2751
847 Ga0207658_10101859 3300025986 Bacteria 2251
848 Ga0207658_10485862 3300025986 Bacteria 1098
849 Ga0207658_11119123 3300025986 Bacteria 719
850 Ga0207658_11657165 3300025986 Bacteria 584
851 Ga0207658_12078998 3300025986 Bacteria 516
852 Ga0207677_10159632 3300026023 Bacteria 1750
853 Ga0207677_10179200 3300026023 Bacteria 1665
854 Ga0207677_10237178 3300026023 Bacteria 1473
855 Ga0207677_10241627 3300026023 Bacteria 1461
856 Ga0207703_10002250 3300026035 Bacteria 16865
857 Ga0207703_10046054 3300026035 Bacteria 3511
858 Ga0207703_10204383 3300026035 Bacteria 1757
859 Ga0207703_10478331 3300026035 Bacteria 1167
860 Ga0207703_10752524 3300026035 Bacteria 928
861 Ga0207639_10000985 3300026041 Bacteria 19385
862 Ga0207639_10006532 3300026041 Bacteria 7931
863 Ga0207639_10008937 3300026041 Bacteria 6895
864 Ga0207639_10017968 3300026041 Bacteria 5017
865 Ga0207639_10049869 3300026041 Bacteria 3176
866 Ga0207639_10056089 3300026041 Bacteria 3018
867 Ga0207639_10056123 3300026041 Bacteria 3017
868 Ga0207639_10269372 3300026041 Bacteria 1493
869 Ga0207639_10274797 3300026041 Bacteria 1479
870 Ga0207639_10441838 3300026041 Bacteria 1179
871 Ga0207639_10584979 3300026041 Bacteria 1028
872 Ga0207639_11384434 3300026041 Bacteria 660
873 Ga0207678_10001305 3300026067 Bacteria 23111
874 Ga0207678_10004417 3300026067 Bacteria 12652
875 Ga0207678_10010903 3300026067 Bacteria 7985
876 Ga0207678_10030009 3300026067 Bacteria 4746
877 Ga0207678_10101872 3300026067 Bacteria 2451
878 Ga0207678_10159552 3300026067 Bacteria 1926
879 Ga0207678_10174807 3300026067 Bacteria 1834
880 Ga0207678_10200544 3300026067 Bacteria 1706
881 Ga0207678_10987390 3300026067 Bacteria 745
882 Ga0207678_11912761 3300026067 Bacteria 517
883 Ga0207702_10000236 3300026078 Bacteria 63978
884 Ga0207702_10010360 3300026078 Bacteria 7808
885 Ga0207702_10015281 3300026078 Bacteria 6364
886 Ga0207702_10072033 3300026078 Bacteria 2977
887 Ga0207702_10096660 3300026078 Bacteria 2598
888 Ga0207702_10331866 3300026078 Bacteria 1451
889 Ga0207702_10457507 3300026078 Bacteria 1239
890 Ga0207702_10553413 3300026078 Bacteria 1126
891 Ga0207702_10563356 3300026078 Bacteria 1115
892 Ga0207702_10815717 3300026078 Bacteria 923
893 Ga0207702_11499820 3300026078 Bacteria 668
894 Ga0207641_10010609 3300026088 Bacteria 7559
895 Ga0207641_10020369 3300026088 Bacteria 5447
896 Ga0207641_10131445 3300026088 Bacteria 2248
897 Ga0207641_10229076 3300026088 Bacteria 1726
898 Ga0207641_10291827 3300026088 Bacteria 1537
899 Ga0207641_10900498 3300026088 Bacteria 878
900 Ga0207641_11225622 3300026088 Bacteria 750
901 Ga0207648_10012324 3300026089 Bacteria 8004
902 Ga0207648_10117053 3300026089 Bacteria 2342
903 Ga0207648_10184374 3300026089 Bacteria 1848
904 Ga0207648_10253652 3300026089 Bacteria 1568
905 Ga0207648_11073968 3300026089 Bacteria 755
906 Ga0207648_11828247 3300026089 Bacteria 569
907 Ga0207676_10014128 3300026095 Bacteria 5736
908 Ga0207676_10815964 3300026095 Bacteria 911
909 Ga0207674_10011044 3300026116 Bacteria 10156
910 Ga0207674_10086156 3300026116 Bacteria 3136
911 Ga0207674_10218763 3300026116 Bacteria 1853
912 Ga0207674_10416222 3300026116 Bacteria 1298
913 Ga0207674_10613119 3300026116 Bacteria 1051
914 Ga0207674_10874354 3300026116 Bacteria 866
915 Ga0207674_10927205 3300026116 Bacteria 839
916 Ga0207675_100196738 3300026118 Bacteria 1935
917 Ga0207675_100212013 3300026118 Bacteria 1863
918 Ga0207675_100319070 3300026118 Bacteria 1516
919 Ga0207675_100627521 3300026118 Bacteria 1079
920 Ga0207675_100684184 3300026118 Bacteria 1034
921 Ga0207675_100831982 3300026118 Bacteria 937
922 Ga0207683_10048759 3300026121 Bacteria 3707
923 Ga0207683_10068547 3300026121 Bacteria 3132
924 Ga0207683_11623353 3300026121 Bacteria 596
925 Ga0207698_10002901 3300026142 Bacteria 10253
926 Ga0207698_10020428 3300026142 Bacteria 4558
927 Ga0207698_10035977 3300026142 Bacteria 3629
928 Ga0207698_10096916 3300026142 Bacteria 2432
929 Ga0207698_10293017 3300026142 Bacteria 1511
930 Ga0207698_10438167 3300026142 Bacteria 1258
931 Ga0207698_10608010 3300026142 Bacteria 1078
932 Ga0207698_10984711 3300026142 Bacteria 853
933 Ga0207698_11159987 3300026142 Bacteria 786
934 Ga0207698_12602308 3300026142 Bacteria 515
935 Ga0209282_1166348 3300027666 Bacteria 1049
936 Ga0265354_1001101 3300028016 Bacteria 4147
937 Ga0265357_1005008 3300028023 Bacteria 1213
938 Ga0268266_10000001 3300028379 Bacteria 4040580
939 Ga0268266_10000006 3300028379 Bacteria 1410021
940 Ga0268266_10000021 3300028379 Bacteria 522453
941 Ga0268266_10038420 3300028379 Bacteria 4075
942 Ga0268266_10126426 3300028379 Bacteria 2282
943 Ga0268266_10624948 3300028379 Bacteria 1036
944 Ga0268266_11777700 3300028379 Bacteria 591
945 Ga0268266_11825168 3300028379 Bacteria 582
946 Ga0268265_10000705 3300028380 Bacteria 32878
947 Ga0268265_10671110 3300028380 Bacteria 998
948 Ga0268264_10011847 3300028381 Bacteria 7185
949 Ga0268264_10014826 3300028381 Bacteria 6402
950 Ga0268264_10052860 3300028381 Bacteria 3388
951 Ga0268264_10450780 3300028381 Bacteria 1246
952 Ga0268264_10769172 3300028381 Bacteria 960
953 Ga0307517_10339098 3300028786 Bacteria 822
954 Ga0307517_10354081 3300028786 Bacteria 796
955 Ga0307515_10160864 3300028794 Bacteria 2291
956 Ga0307515_10203513 3300028794 Bacteria 1848
957 Ga0265338_10340845 3300028800 Bacteria 1080
958 Ga0265770_1000647 3300030878 Bacteria 4832
959 Ga0265760_10016048 3300031090 Bacteria 2148
960 Ga0265760_10227465 3300031090 Bacteria 638
961 Ga0265332_10000014 3300031238 Bacteria 249035
962 Ga0265328_10006973 3300031239 Bacteria 4741
963 Ga0265339_10126686 3300031249 Bacteria 1309
964 Ga0265331_10008554 3300031250 Bacteria 5814
965 Ga0265327_10000133 3300031251 Bacteria 163887
966 Ga0265327_10057675 3300031251 Bacteria 1997
967 Ga0265327_10176840 3300031251 Bacteria 978
968 Ga0307513_10013810 3300031456 Bacteria 9901
969 Ga0307513_10315870 3300031456 Bacteria 1322
970 Ga0307513_10615359 3300031456 Bacteria 795
971 Ga0307509_10799411 3300031507 Bacteria 608
972 Ga0307408_100186114 3300031548 Bacteria 1669
973 Ga0307408_100401588 3300031548 Bacteria 1177
974 Ga0307408_101265687 3300031548 Bacteria 690
975 Ga0307508_10058708 3300031616 Bacteria 3404
976 Ga0307508_10157395 3300031616 Bacteria 1876
977 Ga0307508_10395627 3300031616 Bacteria 973
978 Ga0316575_10018091 3300031665 Bacteria 2683
979 Ga0316575_10041535 3300031665 Bacteria 1819
980 Ga0316575_10264420 3300031665 Bacteria 723
981 Ga0316579_10048118 3300031691 Bacteria 1992
982 Ga0316576_10013894 3300031727 Bacteria 5366
983 Ga0316576_10177082 3300031727 Bacteria 1609
984 Ga0316578_10024244 3300031728 Bacteria 3402
985 Ga0316578_10640072 3300031728 Bacteria 621
986 Ga0307516_10019050 3300031730 Bacteria 7119
987 Ga0307516_10089609 3300031730 Bacteria 2906
988 Ga0307516_10152544 3300031730 Bacteria 2069
989 Ga0307516_10512331 3300031730 Bacteria 854
990 Ga0316577_10027318 3300031733 Bacteria 3182
991 Ga0307413_10146940 3300031824 Bacteria 1637
992 Ga0307413_10547360 3300031824 Bacteria 938
993 Ga0307413_11084950 3300031824 Bacteria 691
994 Ga0307413_11312917 3300031824 Bacteria 633
995 Ga0307410_10081792 3300031852 Bacteria 2270
996 Ga0307410_10727488 3300031852 Bacteria 838
997 Ga0307410_11439453 3300031852 Bacteria 606
998 Ga0307410_11848036 3300031852 Bacteria 537
999 Ga0307406_10007341 3300031901 Bacteria 6110
1000 Ga0307406_10228302 3300031901 Bacteria 1388
1001 Ga0307406_10697107 3300031901 Bacteria 847
1002 Ga0307407_10122594 3300031903 Bacteria 1650
1003 Ga0307407_10795982 3300031903 Bacteria 719
1004 Ga0307412_10017785 3300031911 Bacteria 4260
1005 Ga0307412_10073645 3300031911 Bacteria 2337
1006 Ga0307412_10108346 3300031911 Bacteria 1979
1007 Ga0307412_11264630 3300031911 Bacteria 663
1008 Ga0307409_100357217 3300031995 Bacteria 1381
1009 Ga0307409_101913936 3300031995 Bacteria 622
1010 Ga0307416_100594499 3300032002 Bacteria 1185
1011 Ga0307416_103550834 3300032002 Unclassified 522
1012 Ga0307414_10001343 3300032004 Bacteria 12716
1013 Ga0307414_10001931 3300032004 Bacteria 10728
1014 Ga0307414_10218311 3300032004 Bacteria 1563
1015 Ga0307414_10292332 3300032004 Bacteria 1374
1016 Ga0307414_10647718 3300032004 Bacteria 952
1017 Ga0307414_11016815 3300032004 Bacteria 763
1018 Ga0307411_10161813 3300032005 Bacteria 1677
1019 Ga0307411_10190249 3300032005 Bacteria 1566
1020 Ga0307411_10288321 3300032005 Bacteria 1310
1021 Ga0307415_100410422 3300032126 Bacteria 1159
1022 Ga0316583_10003935 3300032133 Bacteria 5277
1023 Ga0316580_10008155 3300032139 Bacteria 3135
1024 Ga0307510_10005227 3300033180 Bacteria 15430
1025 Ga0373959_0122785 3300034820 Bacteria 636
1026 Ga0373934_0134767 3300035086 Bacteria 1008
1027 Ga0373946_0202653 3300035171 Bacteria 951
1028 Ga0316574_0125565 3300035398 Bacteria 1649
1029 Ga0316574_0177539 3300035398 Bacteria 1370
1030 Ga0316574_0335179 3300035398 Bacteria 959
1031 Ga0316574_0439550 3300035398 Bacteria 818
1032 Ga0316574_0595268 3300035398 Bacteria 684
1033 Ga0373927_0601176 3300035695 Bacteria 727
1034 Ga0373927_0758943 3300035695 Bacteria 641
1035 Ga0373933_0359882 3300035724 Bacteria 946
1036 Ga0373947_0452000 3300035725 Bacteria 870
1037 Ga0373937_0006210 3300036401 Bacteria 10295
1038 Ga0373937_0101909 3300036401 Bacteria 2665
1039 Ga0373937_0864054 3300036401 Bacteria 853
1040 Ga0316582_0002013 3300036647 Bacteria 9334
1041 Ga0316582_0007984 3300036647 Bacteria 5663
1042 Ga0316582_0042210 3300036647 Bacteria 2856
1043 Ga0316582_0393451 3300036647 Bacteria 955
1044 Ga0316584_0002192 3300036712 Bacteria 12239
1045 Ga0373925_1217269 3300037068 Bacteria 619
1046 Ga0395899_0000133 3300037312 Bacteria 114879
1047 Ga0395899_0016504 3300037312 Bacteria 5632
1048 Ga0395899_0042325 3300037312 Bacteria 3401
1049 Ga0395899_0057173 3300037312 Bacteria 2880
1050 Ga0395899_0073593 3300037312 Bacteria 2497
1051 Ga0395899_0288128 3300037312 Bacteria 1115
1052 Ga0395900_0000051 3300037418 Bacteria 224228
1053 Ga0395900_0000061 3300037418 Bacteria 202483
1054 Ga0395900_0114528 3300037418 Bacteria 2767
1055 Ga0395900_0219392 3300037418 Bacteria 1917
1056 Ga0395900_0338283 3300037418 Bacteria 1481
1057 Ga0395898_0000034 3300037466 Bacteria 356745
1058 Ga0395898_0000197 3300037466 Bacteria 155187
1059 Ga0395898_0007788 3300037466 Bacteria 11368
1060 Ga0395898_0011319 3300037466 Bacteria 9274
1061 Ga0395898_0014517 3300037466 Bacteria 8088
1062 Ga0395898_0179719 3300037466 Bacteria 2022
1063 Ga0395898_0669998 3300037466 Bacteria 980
1064 Ga0395898_0777540 3300037466 Bacteria 898
1065 Ga0395905_0000306 3300037471 Bacteria 71299
1066 Ga0395905_0140120 3300037471 Bacteria 2275
1067 Ga0395905_0340379 3300037471 Bacteria 1391
1068 Ga0395905_0537682 3300037471 Bacteria 1069
1069 Ga0395905_1138998 3300037471 Bacteria 683
1070 Ga0316581_0006306 3300037588 Bacteria 3131
1071 Ga0395901_0003676 3300038443 Bacteria 15470
1072 Ga0395901_0009076 3300038443 Bacteria 10066
1073 Ga0395901_0727221 3300038443 Bacteria 988
1074 Ga0395901_1854495 3300038443 Bacteria 551
1075 Ga0395901_1938550 3300038443 Bacteria 536
1076 Ga0436361_0190082 3300039447 Bacteria 1654
1077 Ga0436361_0521891 3300039447 Bacteria 6247
1078 Ga0436363_0368017 3300039450 Bacteria 536
1079 Ga0439436_0000008 3300041404 Bacteria 112977
1080 Ga0439436_0015857 3300041404 Bacteria 2264
1081 Ga0439436_0022021 3300041404 Bacteria 1889
1082 Ga0439436_0024041 3300041404 Bacteria 1800
1083 Ga0439436_0063701 3300041404 Bacteria 1030
1084 Ga0439436_0077543 3300041404 Bacteria 925
1085 Ga0439447_007836 3300041407 Bacteria 3351
1086 Ga0439466_0229527 3300041411 Bacteria 563
1087 Ga0439465_0008559 3300041413 Bacteria 3228
1088 Ga0439465_0012695 3300041413 Bacteria 2634
1089 Ga0439465_0029794 3300041413 Bacteria 1734
1090 Ga0439465_0255027 3300041413 Bacteria 649
1091 Ga0451787_760046 3300041441 Bacteria 1243
1092 Ga0451789_0480807 3300041443 Bacteria 858
1093 Ga0451789_0594797 3300041443 Bacteria 824
1094 Ga0451789_1201078 3300041443 Bacteria 567
1095 Ga0451789_1206445 3300041443 Bacteria 1241
1096 Ga0451791_1110733 3300041451 Bacteria 1550
1097 Ga0451793_0136894 3300041452 Bacteria 843
1098 Ga0451793_1283171 3300041452 Bacteria 931
1099 Ga0451793_1723166 3300041452 Bacteria 1593
1100 Ga0451797_0719793 3300041453 Bacteria 545
1101 Ga0451797_0839044 3300041453 Bacteria 609
1102 Ga0451795_1164357 3300041456 Bacteria 886
1103 Ga0451795_1565558 3300041456 Bacteria 678
1104 Ga0451798_0160268 3300041458 Bacteria 699
1105 Ga0451800_0410448 3300041459 Bacteria 847
1106 Ga0451800_0506376 3300041459 Bacteria 827
1107 Ga0451800_1459324 3300041459 Bacteria 827
1108 Ga0451802_0744649 3300041460 Bacteria 1293
1109 Ga0451802_1852954 3300041460 Bacteria 759
1110 Ga0451804_0003308 3300041463 Bacteria 613
1111 Ga0451804_0340235 3300041463 Bacteria 997
1112 Ga0451807_1507964 3300041486 Bacteria 1203
1113 Ga0451807_1589376 3300041486 Bacteria 572
1114 Ga0451807_1924293 3300041486 Bacteria 1644
1115 Ga0451807_2135600 3300041486 Bacteria 1308
1116 Ga0451807_2735494 3300041486 Bacteria 1433
1117 Ga0451833_0532987 3300041491 Bacteria 618
1118 Ga0451833_0951430 3300041491 Bacteria 898
1119 Ga0451835_0367031 3300041492 Bacteria 593
1120 Ga0451837_0103295 3300041494 Bacteria 975
1121 Ga0451837_0244838 3300041494 Bacteria 1684
1122 Ga0451837_1610330 3300041494 Bacteria 1102
1123 Ga0451841_1138043 3300041498 Bacteria 830
1124 Ga0451849_0244638 3300041505 Bacteria 666
1125 Ga0451849_0355062 3300041505 Bacteria 917
1126 Ga0451849_1085578 3300041505 Bacteria 617
1127 Ga0451851_0574422 3300041507 Bacteria 655
1128 Ga0451843_0007405 3300041509 Bacteria 854
1129 Ga0451843_0905268 3300041509 Bacteria 1864
1130 Ga0451843_1073184 3300041509 Bacteria 818
1131 Ga0451843_1682121 3300041509 Bacteria 1737
1132 Ga0451853_1071901 3300041512 Bacteria 763
1133 Ga0451853_2123261 3300041512 Bacteria 612
1134 Ga0451853_2493278 3300041512 Bacteria 977
1135 Ga0451853_2583559 3300041512 Bacteria 528
1136 Ga0451853_2935955 3300041512 Bacteria 2135
1137 Ga0451853_3209840 3300041512 Bacteria 556
1138 Ga0439431_0011423 3300041997 Bacteria 2029
1139 Ga0439433_0014340 3300041999 Bacteria 1745
1140 Ga0439445_0027544 3300042004 Bacteria 1460
1141 Ga0439445_0029548 3300042004 Bacteria 1417
1142 Ga0439445_0101561 3300042004 Bacteria 816
1143 Ga0439449_0004432 3300042007 Bacteria 5415
1144 Ga0439449_0005563 3300042007 Bacteria 4823
1145 Ga0439449_0011023 3300042007 Bacteria 3409
1146 Ga0439449_0011092 3300042007 Bacteria 3396
1147 Ga0439449_0017334 3300042007 Bacteria 2704
1148 Ga0439449_0041485 3300042007 Bacteria 1711
1149 Ga0439449_0078816 3300042007 Bacteria 1215
1150 Ga0439449_0304020 3300042007 Bacteria 602
1151 Ga0439452_078748 3300042010 Bacteria 720
1152 Ga0439457_045877 3300042014 Bacteria 977
1153 Ga0439462_0058894 3300042015 Bacteria 1038
1154 Ga0439462_0089731 3300042015 Bacteria 843
1155 Ga0439462_0095941 3300042015 Bacteria 815
1156 Ga0439446_0177495 3300042156 Bacteria 711
1157 Ga0439458_0131439 3300042157 Bacteria 663
1158 Ga0450908_002779 3300042184 Bacteria 3407
1159 Ga0439434_0147624 3300042435 Bacteria 777
1160 Ga0439459_0006149 3300042438 Bacteria 1993
1161 Ga0439459_0085371 3300042438 Bacteria 751
1162 Ga0451577_0149158 3300042876 Bacteria 2103
1163 Ga0451577_0501910 3300042876 Bacteria 1101
1164 Ga0466969_0001457 3300044656 Bacteria 12729
1165 Ga0466969_0039210 3300044656 Bacteria 2380
1166 Ga0466969_0055973 3300044656 Bacteria 1927
1167 Ga0466972_0000555 3300044658 Bacteria 18278
1168 Ga0466972_0043049 3300044658 Bacteria 2193
1169 Ga0466982_0000026 3300044672 Bacteria 64525
1170 Ga0466982_0004003 3300044672 Bacteria 6560
1171 Ga0466965_0001099 3300044683 Bacteria 10536
1172 Ga0466965_0046974 3300044683 Bacteria 2137
1173 Ga0466966_0005830 3300044684 Bacteria 8119
1174 Ga0466966_0012407 3300044684 Bacteria 5645
1175 Ga0466966_0695670 3300044684 Bacteria 612
1176 Ga0466961_0010278 3300044693 Bacteria 5964
1177 Ga0466961_0035544 3300044693 Bacteria 3199
1178 Ga0466961_0118349 3300044693 Bacteria 1664
1179 Ga0466961_0127822 3300044693 Bacteria 1593
1180 Ga0466964_0011285 3300044706 Bacteria 3375
1181 Ga0466964_0130651 3300044706 Bacteria 1143
1182 Ga0453684_0001089 3300044712 Bacteria 85906
1183 Ga0453684_0144356 3300044712 Bacteria 2837
1184 Ga0466971_0001957 3300044719 Bacteria 8716
1185 Ga0466971_0068841 3300044719 Bacteria 1605
1186 Ga0466971_0103735 3300044719 Bacteria 1308
1187 Ga0466971_0257274 3300044719 Bacteria 833
1188 Ga0466968_0003504 3300044735 Bacteria 5803
1189 Ga0466968_0004304 3300044735 Bacteria 5316
1190 Ga0466970_0000637 3300044765 Bacteria 17240
1191 Ga0466970_0006813 3300044765 Bacteria 5719
1192 Ga0466970_0043358 3300044765 Bacteria 2393
1193 Ga0466970_0098456 3300044765 Bacteria 1591
1194 Ga0466970_0516756 3300044765 Bacteria 688
1195 Ga0466957_0005542 3300044842 Bacteria 7089
1196 Ga0466957_0030562 3300044842 Bacteria 3216
1197 Ga0466957_0351074 3300044842 Bacteria 1001
1198 Ga0466957_0611920 3300044842 Bacteria 763
1199 Ga0466957_0784745 3300044842 Bacteria 676
1200 Ga0466960_0009574 3300044901 Bacteria 3998
1201 Ga0466960_0243814 3300044901 Bacteria 996
1202 Ga0466959_0019992 3300045049 Bacteria 4927
1203 Ga0466959_0022705 3300045049 Bacteria 4639
1204 Ga0466959_0156385 3300045049 Bacteria 1604
1205 Ga0451576_0000201 3300045051 Bacteria 150175
1206 Ga0451576_0505280 3300045051 Bacteria 1270
1207 Ga0466958_0014964 3300045836 Bacteria 4437
1208 Ga0466958_0119060 3300045836 Bacteria 1652
1209 Ga0466967_0182733 3300045976 Bacteria 1979
1210 Ga0466967_0437907 3300045976 Bacteria 1276
1211 Ga0466967_0796184 3300045976 Bacteria 938
1212 Ga0495617_000424 3300046452 Bacteria 22988
1213 Ga0495629_0048970 3300046459 Bacteria 2963
1214 Ga0495638_0000146 3300046460 Bacteria 111558
1215 Ga0495638_0001668 3300046460 Bacteria 19645
1216 Ga0495638_0001669 3300046460 Bacteria 19642
1217 Ga0495638_0073075 3300046460 Bacteria 2094
1218 Ga0495638_0172342 3300046460 Bacteria 1240
1219 Ga0495641_0031745 3300046461 Bacteria 2521
1220 Ga0495651_0414840 3300046462 Bacteria 876
1221 Ga0495650_0002509 3300046471 Bacteria 14702
1222 Ga0495650_0006285 3300046471 Bacteria 7435
1223 Ga0495580_0145919 3300046472 Bacteria 1640
1224 Ga0495582_0029608 3300046473 Bacteria 3005
1225 Ga0495664_0204018 3300046477 Bacteria 1198
1226 Ga0495584_0258950 3300046491 Bacteria 884
1227 Ga0495585_0004990 3300046492 Bacteria 8485
1228 Ga0495607_0001360 3300046501 Bacteria 21785
1229 Ga0495607_0015098 3300046501 Bacteria 5015
1230 Ga0495583_0016180 3300046506 Bacteria 4020
1231 Ga0495606_0001823 3300046507 Bacteria 27025
1232 Ga0495606_0009315 3300046507 Bacteria 8323
1233 Ga0495606_0112071 3300046507 Bacteria 1644
1234 Ga0495610_0007268 3300046512 Bacteria 7420
1235 Ga0495610_0218642 3300046512 Bacteria 770
1236 Ga0495616_0000400 3300046513 Bacteria 33359
1237 Ga0495620_0111880 3300046515 Bacteria 1081
1238 Ga0495630_0084401 3300046517 Bacteria 2398
1239 Ga0495630_0301731 3300046517 Bacteria 1224
1240 Ga0495631_0003067 3300046518 Bacteria 9224
1241 Ga0495631_0004987 3300046518 Bacteria 6997
1242 Ga0495632_0000004 3300046519 Bacteria 381372
1243 Ga0495632_0006481 3300046519 Bacteria 7517
1244 Ga0495637_0081900 3300046520 Bacteria 1285
1245 Ga0495643_0111285 3300046522 Bacteria 1392
1246 Ga0495643_0147056 3300046522 Bacteria 1170
1247 Ga0495648_0069715 3300046524 Bacteria 2045
1248 Ga0495663_0000892 3300046525 Bacteria 10053
1249 Ga0495665_0036191 3300046531 Bacteria 2635
1250 Ga0495609_0013644 3300046538 Bacteria 3834
1251 Ga0495645_0654105 3300046543 Bacteria 642
1252 Ga0495622_0011411 3300046557 Bacteria 4105
1253 Ga0495622_0418385 3300046557 Bacteria 576
1254 Ga0495633_0283714 3300046558 Bacteria 753
1255 Ga0495656_0006219 3300046615 Bacteria 4177
1256 Ga0495668_0004286 3300046616 Bacteria 10228
1257 Ga0495668_0133484 3300046616 Bacteria 1359
1258 Ga0495611_0000001 3300046648 Bacteria 2628469
1259 Ga0495625_0000001 3300046660 Bacteria 1641829
1260 Ga0495625_0108723 3300046660 Bacteria 1897
1261 Ga0495625_0655523 3300046660 Bacteria 624
1262 Ga0495635_0550182 3300046663 Bacteria 757
1263 Ga0495635_1015615 3300046663 Bacteria 527
1264 Ga0495661_0004892 3300046665 Bacteria 9592
1265 Ga0495657_0090211 3300046675 Bacteria 1968
1266 Ga0495657_0819728 3300046675 Bacteria 531
1267 Ga0495599_0178684 3300046678 Bacteria 1309
1268 Ga0495646_0405921 3300046680 Bacteria 708
1269 Ga0495647_0004669 3300046681 Bacteria 4464
1270 Ga0495658_0004687 3300046683 Bacteria 6725
1271 Ga0495658_0277291 3300046683 Bacteria 1058
1272 Ga0495670_0009378 3300046691 Bacteria 4811
1273 Ga0495670_0079774 3300046691 Bacteria 1666
1274 Ga0495670_0285950 3300046691 Bacteria 882
1275 Ga0495671_0004084 3300046692 Bacteria 8806
1276 Ga0495671_0128936 3300046692 Bacteria 1233
1277 Ga0495649_0000218 3300046694 Bacteria 50633
1278 Ga0495649_0078862 3300046694 Bacteria 1762
1279 Ga0495589_0000236 3300046794 Bacteria 46053
1280 Ga0495600_0159578 3300046809 Bacteria 1458
1281 Ga0495660_0000792 3300046810 Bacteria 23696
1282 Ga0495660_0001210 3300046810 Bacteria 18055
1283 Ga0495636_0003683 3300047318 Bacteria 5959
1284 Ga0495674_0439601 3300047319 Bacteria 1049
1285 Ga0495680_0209275 3300047322 Bacteria 1397
1286 Ga0495683_0001237 3300047323 Bacteria 17374
1287 Ga0495679_000004 3300047446 Bacteria 748056
1288 Ga0495673_0000294 3300047469 Bacteria 67042
1289 Ga0495673_0000670 3300047469 Bacteria 33730
1290 Ga0495684_0065836 3300047471 Bacteria 2755
1291 Ga0495686_0000017 3300047472 Bacteria 435554
1292 Ga0495686_0002339 3300047472 Bacteria 18107
1293 Ga0495686_0327251 3300047472 Bacteria 838
1294 Ga0495614_0660955 3300048089 Bacteria 504
1295 Ga0496100_0019061 3300048903 Bacteria 4085
1296 Ga0496100_0145854 3300048903 Bacteria 1683
1297 Ga0496100_0985182 3300048903 Bacteria 663
1298 Ga0496101_0031070 3300048904 Bacteria 3751
1299 Ga0496101_0048869 3300048904 Bacteria 3041
1300 Ga0496102_0226685 3300048905 Bacteria 1762
1301 Ga0496102_0298877 3300048905 Bacteria 1517
1302 Ga0496103_0997285 3300048906 Bacteria 522
1303 Ga0496104_0000011 3300048907 Bacteria 459358
1304 Ga0496104_0058290 3300048907 Bacteria 3655
1305 Ga0496105_0000015 3300048908 Bacteria 218758
1306 Ga0496105_0002678 3300048908 Bacteria 12978
1307 Ga0496105_0216774 3300048908 Bacteria 1559
1308 Ga0496105_0869095 3300048908 Bacteria 681
1309 Ga0496105_1253327 3300048908 Bacteria 543
1310 Ga0496106_0005633 3300048909 Bacteria 9268
1311 Ga0496106_0099345 3300048909 Bacteria 2256
1312 Ga0496106_0345914 3300048909 Bacteria 1194
1313 Ga0496106_0450830 3300048909 Bacteria 1033
1314 Ga0496107_0361760 3300048910 Bacteria 1080
1315 Ga0496107_0621966 3300048910 Bacteria 797
1316 Ga0496108_0655326 3300048911 Bacteria 912
1317 Ga0496109_0076379 3300048912 Bacteria 3081
1318 Ga0496109_0954675 3300048912 Bacteria 795
1319 Ga0496111_0514662 3300048914 Bacteria 880
1320 Ga0496112_0096940 3300048915 Bacteria 2919
1321 Ga0496112_1306029 3300048915 Bacteria 641
1322 Ga0496113_0003563 3300048916 Bacteria 9337
1323 Ga0496113_0032634 3300048916 Bacteria 3784
1324 Ga0496113_1471177 3300048916 Bacteria 526
1325 Ga0496114_0267913 3300048917 Bacteria 1505
1326 Ga0496114_1501167 3300048917 Bacteria 562
1327 Ga0496115_0000275 3300048918 Bacteria 45169
1328 Ga0496115_0110062 3300048918 Bacteria 2263
1329 Ga0496115_0825272 3300048918 Bacteria 720
1330 Ga0496116_0050219 3300048919 Bacteria 2781
1331 Ga0496116_0057217 3300048919 Bacteria 2551
1332 Ga0496116_0107805 3300048919 Bacteria 1646
1333 Ga0496117_0011886 3300048920 Bacteria 7744
1334 Ga0496117_0028477 3300048920 Bacteria 4325
1335 Ga0496117_0098806 3300048920 Bacteria 1854
1336 Ga0496118_0001213 3300048921 Bacteria 39638
1337 Ga0496118_0003656 3300048921 Bacteria 19100
1338 Ga0496118_0008630 3300048921 Bacteria 10483
1339 Ga0496118_0048646 3300048921 Bacteria 3271
1340 Ga0496118_0054037 3300048921 Bacteria 3046
1341 Ga0496118_0112067 3300048921 Bacteria 1807
1342 Ga0496119_0001455 3300048922 Bacteria 28402
1343 Ga0496119_0047502 3300048922 Bacteria 2670
1344 Ga0496119_0270371 3300048922 Bacteria 849
1345 Ga0496120_0002097 3300048923 Bacteria 21371
1346 Ga0496120_0017747 3300048923 Bacteria 4602
1347 Ga0496121_0000045 3300048924 Bacteria 336130
1348 Ga0496121_0007647 3300048924 Bacteria 12982
1349 Ga0496121_0011769 3300048924 Bacteria 9649
1350 Ga0496121_0024451 3300048924 Bacteria 5775
1351 Ga0496121_0140784 3300048924 Bacteria 1790
1352 Ga0496121_0232401 3300048924 Bacteria 1290
1353 Ga0496121_0266427 3300048924 Bacteria 1180
1354 Ga0496121_0290300 3300048924 Bacteria 1114
1355 Ga0496122_0000440 3300048925 Bacteria 87364
1356 Ga0496122_0024941 3300048925 Bacteria 5218
1357 Ga0496122_0145393 3300048925 Bacteria 1474
1358 Ga0496122_0148068 3300048925 Bacteria 1455
1359 Ga0496122_0345376 3300048925 Bacteria 779
1360 Ga0496122_0360743 3300048925 Bacteria 754
1361 Ga0496123_0009708 3300048926 Bacteria 8625
1362 Ga0496123_0028799 3300048926 Bacteria 4104
1363 Ga0496123_0039503 3300048926 Bacteria 3300
1364 Ga0496123_0108679 3300048926 Bacteria 1591
1365 Ga0496123_0131222 3300048926 Bacteria 1387
1366 Ga0496124_0053164 3300048927 Bacteria 3435
1367 Ga0496124_0147051 3300048927 Bacteria 1853
1368 Ga0496125_0000149 3300048928 Bacteria 154223
1369 Ga0496125_0003559 3300048928 Bacteria 18765
1370 Ga0496125_0049218 3300048928 Bacteria 3505
1371 Ga0496125_0100187 3300048928 Bacteria 2137
1372 Ga0496125_0178110 3300048928 Bacteria 1420
1373 Ga0496126_0007818 3300048929 Bacteria 11656
1374 Ga0496126_0013267 3300048929 Bacteria 8396
1375 Ga0496126_0052512 3300048929 Bacteria 3703
1376 Ga0496126_0206149 3300048929 Bacteria 1657
1377 Ga0496126_0316301 3300048929 Bacteria 1284
1378 Ga0496126_0461445 3300048929 Bacteria 1021
1379 Ga0496126_0531690 3300048929 Bacteria 935
1380 Ga0501308_021341 3300049128 Bacteria 813
1381 Ga0495678_001023 3300049459 Bacteria 23732
1382 Ga0495678_041423 3300049459 Bacteria 1843
1383 Ga0495682_0048783 3300049460 Bacteria 1543
1384 Ga0495682_0061647 3300049460 Bacteria 1353
1385 Ga0501290_061479 3300049513 Bacteria 606
1386 Ga0501312_092391 3300049528 Bacteria 560
1387 Ga0501320_037209 3300049536 Bacteria 626
1388 Ga0501324_043447 3300049540 Bacteria 518
1389 Ga0501336_026609 3300049552 Bacteria 552
1390 Ga0501031_0101788 3300049568 Bacteria 1874
1391 Ga0501031_0235743 3300049568 Bacteria 1190
1392 Ga0501032_0002397 3300049569 Bacteria 14606
1393 Ga0501032_0049264 3300049569 Bacteria 2841
1394 Ga0501032_0070741 3300049569 Bacteria 2326
1395 Ga0501032_0203255 3300049569 Bacteria 1293
1396 Ga0501032_0217392 3300049569 Bacteria 1244
1397 Ga0501032_0874462 3300049569 Bacteria 566
1398 Ga0501033_0000632 3300049570 Bacteria 32512
1399 Ga0501033_0001720 3300049570 Bacteria 19154
1400 Ga0501033_0024689 3300049570 Bacteria 4532
1401 Ga0501033_0117429 3300049570 Bacteria 1932
1402 Ga0501033_0124122 3300049570 Bacteria 1872
1403 Ga0501033_0135168 3300049570 Bacteria 1784
1404 Ga0501033_0157089 3300049570 Bacteria 1638
1405 Ga0501033_0219572 3300049570 Bacteria 1353
1406 Ga0501033_0413091 3300049570 Bacteria 940
1407 Ga0501033_0628946 3300049570 Bacteria 734
1408 Ga0501034_0002437 3300049571 Bacteria 22445
1409 Ga0501034_0002902 3300049571 Bacteria 19931
1410 Ga0501034_0015349 3300049571 Bacteria 7871
1411 Ga0501034_0027193 3300049571 Bacteria 5819
1412 Ga0501034_0125418 3300049571 Bacteria 2553
1413 Ga0501034_0506505 3300049571 Bacteria 1120
1414 Ga0501034_0517410 3300049571 Bacteria 1105
1415 Ga0501034_0612744 3300049571 Bacteria 993
1416 Ga0501036_0009385 3300049572 Bacteria 8049
1417 Ga0501036_0012706 3300049572 Bacteria 6986
1418 Ga0501036_0093648 3300049572 Bacteria 2538
1419 Ga0501036_0197746 3300049572 Bacteria 1691
1420 Ga0501036_0221807 3300049572 Bacteria 1587
1421 Ga0501036_0354262 3300049572 Bacteria 1226
1422 Ga0501036_0807349 3300049572 Bacteria 772
1423 Ga0501037_0001300 3300049573 Bacteria 18362
1424 Ga0501037_0103023 3300049573 Bacteria 2058
1425 Ga0501037_0153572 3300049573 Bacteria 1644
1426 Ga0501037_0170990 3300049573 Bacteria 1544
1427 Ga0501037_0322920 3300049573 Bacteria 1068
1428 Ga0501037_0485949 3300049573 Bacteria 839
1429 Ga0501037_0651938 3300049573 Bacteria 703
1430 Ga0501038_0008023 3300049574 Bacteria 9725
1431 Ga0501038_0033953 3300049574 Bacteria 4488
1432 Ga0501038_0364928 3300049574 Bacteria 1122
1433 Ga0501038_0377437 3300049574 Bacteria 1100
1434 Ga0501038_0661769 3300049574 Bacteria 785
1435 Ga0501038_1027355 3300049574 Bacteria 604
1436 Ga0501039_0009363 3300049575 Bacteria 7465
1437 Ga0501039_0033279 3300049575 Bacteria 3976
1438 Ga0501039_0108130 3300049575 Bacteria 2173
1439 Ga0501039_0111301 3300049575 Bacteria 2140
1440 Ga0501039_0144763 3300049575 Bacteria 1867
1441 Ga0501039_1116322 3300049575 Bacteria 611
1442 Ga0501039_1561525 3300049575 Bacteria 507
1443 Ga0501040_0035524 3300049576 Bacteria 3380
1444 Ga0501040_0100818 3300049576 Bacteria 2014
1445 Ga0501041_0797888 3300049577 Bacteria 605
1446 Ga0501042_0025128 3300049578 Bacteria 4183
1447 Ga0501042_0221535 3300049578 Bacteria 1364
1448 Ga0501043_0001641 3300049579 Bacteria 19430
1449 Ga0501043_0005218 3300049579 Bacteria 10516
1450 Ga0501043_0012916 3300049579 Bacteria 6526
1451 Ga0501043_0104925 3300049579 Bacteria 2221
1452 Ga0501043_0133837 3300049579 Bacteria 1942
1453 Ga0501043_0357269 3300049579 Bacteria 1109
1454 Ga0501043_0587268 3300049579 Bacteria 824
1455 Ga0501043_0684301 3300049579 Bacteria 750
1456 Ga0501046_0009415 3300049580 Bacteria 8443
1457 Ga0501046_0037617 3300049580 Bacteria 3888
1458 Ga0501046_0053750 3300049580 Bacteria 3170
1459 Ga0501046_0088513 3300049580 Bacteria 2384
1460 Ga0501046_0151662 3300049580 Bacteria 1748
1461 Ga0501046_0187324 3300049580 Bacteria 1545
1462 Ga0501046_0237737 3300049580 Bacteria 1344
1463 Ga0501046_0254713 3300049580 Bacteria 1291
1464 Ga0501046_0414233 3300049580 Bacteria 972
1465 Ga0501046_0901862 3300049580 Bacteria 616
1466 Ga0501046_1257857 3300049580 Bacteria 507
1467 Ga0501047_0002573 3300049581 Bacteria 17317
1468 Ga0501047_0009259 3300049581 Bacteria 9300
1469 Ga0501047_0018810 3300049581 Bacteria 6626
1470 Ga0501047_0029549 3300049581 Bacteria 5284
1471 Ga0501047_0073773 3300049581 Bacteria 3285
1472 Ga0501047_0092889 3300049581 Bacteria 2896
1473 Ga0501047_0328782 3300049581 Bacteria 1367
1474 Ga0501047_0401208 3300049581 Bacteria 1204
1475 Ga0501047_0433185 3300049581 Bacteria 1145
1476 Ga0501047_0531502 3300049581 Bacteria 1001
1477 Ga0501047_0662514 3300049581 Bacteria 862
1478 Ga0501047_0858780 3300049581 Bacteria 721
1479 Ga0501047_1367132 3300049581 Bacteria 523
1480 Ga0501048_0026442 3300049582 Bacteria 4225
1481 Ga0501048_0076244 3300049582 Bacteria 2366
1482 Ga0501048_0274276 3300049582 Bacteria 1199
1483 Ga0501048_0315708 3300049582 Bacteria 1113
1484 Ga0501048_0586179 3300049582 Bacteria 800
1485 Ga0501067_0006199 3300049583 Bacteria 6629
1486 Ga0501067_0014755 3300049583 Bacteria 4322
1487 Ga0501068_0131777 3300049584 Bacteria 1563
1488 Ga0501068_0143933 3300049584 Bacteria 1495
1489 Ga0501069_0006685 3300049585 Bacteria 6038
1490 Ga0501069_0066085 3300049585 Bacteria 2022
1491 Ga0501069_0348860 3300049585 Bacteria 872
1492 Ga0501070_0002131 3300049586 Bacteria 17372
1493 Ga0501070_0010864 3300049586 Bacteria 7691
1494 Ga0501070_0013751 3300049586 Bacteria 6817
1495 Ga0501070_0033092 3300049586 Bacteria 4324
1496 Ga0501070_0087275 3300049586 Bacteria 2582
1497 Ga0501070_0123868 3300049586 Bacteria 2136
1498 Ga0501070_0224590 3300049586 Bacteria 1539
1499 Ga0501071_0028649 3300049587 Bacteria 3926
1500 Ga0501071_0031884 3300049587 Bacteria 3739
1501 Ga0501071_0118792 3300049587 Bacteria 1959
1502 Ga0501071_0820344 3300049587 Bacteria 717
1503 Ga0501072_0003391 3300049588 Bacteria 11986
1504 Ga0501072_0027150 3300049588 Bacteria 4467
1505 Ga0501073_0001213 3300049589 Bacteria 18787
1506 Ga0501073_0002194 3300049589 Bacteria 14603
1507 Ga0501073_0008870 3300049589 Bacteria 7435
1508 Ga0501073_0347496 3300049589 Bacteria 1024
1509 Ga0501073_0386775 3300049589 Bacteria 966
1510 Ga0501073_0547597 3300049589 Bacteria 799
1511 Ga0501073_0787524 3300049589 Bacteria 655
1512 Ga0501073_0814274 3300049589 Bacteria 643
1513 Ga0501074_0031338 3300049590 Bacteria 3852
1514 Ga0501074_0033188 3300049590 Bacteria 3740
1515 Ga0501074_0087103 3300049590 Bacteria 2237
1516 Ga0501074_0096715 3300049590 Bacteria 2114
1517 Ga0501074_0119475 3300049590 Bacteria 1884
1518 Ga0501074_0190732 3300049590 Bacteria 1461
1519 Ga0501074_0282753 3300049590 Bacteria 1179
1520 Ga0501074_0699488 3300049590 Bacteria 715
1521 Ga0501075_0003076 3300049591 Bacteria 11147
1522 Ga0501075_0104738 3300049591 Bacteria 2150
1523 Ga0501076_0001078 3300049592 Bacteria 17938
1524 Ga0501076_0420680 3300049592 Bacteria 1099
1525 Ga0501077_0026740 3300049593 Bacteria 3663
1526 Ga0501206_021096 3300049653 Bacteria 929
1527 Ga0501216_158951 3300049660 Bacteria 541
1528 Ga0501217_096638 3300049661 Bacteria 835
1529 Ga0501223_031766 3300049663 Bacteria 1027
1530 Ga0501224_040125 3300049664 Bacteria 708
1531 Ga0501247_053981 3300049677 Bacteria 603
1532 Ga0501249_019448 3300049679 Bacteria 1475
1533 Ga0501250_004457 3300049680 Bacteria 1394
1534 Ga0501252_006724 3300049682 Bacteria 1286
1535 Ga0501252_086169 3300049682 Bacteria 526
1536 Ga0501253_112865 3300049683 Bacteria 650
1537 Ga0501258_040070 3300049687 Bacteria 623
1538 Ga0501259_104530 3300049688 Bacteria 654
1539 Ga0501225_0006481 3300049705 Bacteria 3417
1540 Ga0501225_0083207 3300049705 Bacteria 921
1541 Ga0501079_0097356 3300049741 Bacteria 2281
1542 Ga0501079_0125221 3300049741 Bacteria 1999
1543 Ga0501079_0224507 3300049741 Bacteria 1467
1544 Ga0501079_0241097 3300049741 Bacteria 1412
1545 Ga0501079_0411511 3300049741 Bacteria 1061
1546 Ga0501079_0547118 3300049741 Bacteria 910
1547 Ga0501079_0999878 3300049741 Bacteria 659
1548 Ga0501080_0000791 3300049742 Bacteria 25821
1549 Ga0501080_0001319 3300049742 Bacteria 20660
1550 Ga0501080_0006958 3300049742 Bacteria 10203
1551 Ga0501080_0009707 3300049742 Bacteria 8789
1552 Ga0501080_0018776 3300049742 Bacteria 6400
1553 Ga0501080_0085197 3300049742 Bacteria 2936
1554 Ga0501080_0140553 3300049742 Bacteria 2232
1555 Ga0501080_0145790 3300049742 Bacteria 2188
1556 Ga0501080_0208236 3300049742 Bacteria 1793
1557 Ga0501080_0486833 3300049742 Bacteria 1103
1558 Ga0501080_0632213 3300049742 Bacteria 948
1559 Ga0501080_0849750 3300049742 Bacteria 798
1560 Ga0501081_0008596 3300049743 Bacteria 6636
1561 Ga0501083_0001078 3300049744 Bacteria 18217
1562 Ga0501083_0181210 3300049744 Bacteria 1375
1563 Ga0501263_039215 3300049760 Bacteria 692
1564 Ga0501264_033208 3300049761 Bacteria 602
1565 Ga0501266_003367 3300049763 Bacteria 1989
1566 Ga0501266_022659 3300049763 Bacteria 864
1567 Ga0501268_092644 3300049765 Bacteria 638
1568 Ga0501268_178276 3300049765 Bacteria 505
1569 Ga0501270_162154 3300049767 Bacteria 517
1570 Ga0501271_032041 3300049768 Bacteria 654
1571 Ga0501272_022957 3300049769 Bacteria 758
1572 Ga0501275_085427 3300049772 Bacteria 517
1573 Ga0501279_035089 3300049775 Bacteria 754
1574 Ga0501035_0013600 3300049822 Bacteria 7508
1575 Ga0501035_0027477 3300049822 Bacteria 5200
1576 Ga0501035_0041694 3300049822 Bacteria 4144
1577 Ga0501035_0098449 3300049822 Bacteria 2567
1578 Ga0501035_0252247 3300049822 Bacteria 1498
1579 Ga0501035_0275414 3300049822 Bacteria 1423
1580 Ga0501035_0317572 3300049822 Bacteria 1309
1581 Ga0501035_0545206 3300049822 Bacteria 950
1582 Ga0501035_0744110 3300049822 Bacteria 787
1583 Ga0501044_0016694 3300049823 Bacteria 7882
1584 Ga0501044_0033968 3300049823 Bacteria 5354
1585 Ga0501044_0061827 3300049823 Bacteria 3830
1586 Ga0501044_0110003 3300049823 Bacteria 2764
1587 Ga0501044_0117045 3300049823 Bacteria 2669
1588 Ga0501044_0119037 3300049823 Bacteria 2643
1589 Ga0501044_0403816 3300049823 Bacteria 1278
1590 Ga0501044_0546658 3300049823 Bacteria 1056
1591 Ga0501044_0575223 3300049823 Bacteria 1021
1592 Ga0501044_0702328 3300049823 Bacteria 897
1593 Ga0501044_1369044 3300049823 Bacteria 573
1594 Ga0501044_1614495 3300049823 Bacteria 513
1595 Ga0501045_0040200 3300049824 Bacteria 3404
1596 Ga0501045_0287400 3300049824 Bacteria 1224
1597 Ga0501045_0635430 3300049824 Bacteria 789
1598 Ga0501045_0766648 3300049824 Bacteria 711
1599 nmdc:mga00v17_54986_c1 3300050491 Bacteria 2430
1600 nmdc:mga00v17_69221_c1 3300050491 Bacteria 2184
1601 nmdc:mga06z11_578199_c1 3300050494 Unclassified 683
1602 nmdc:mga07m45_410003_c1 3300050496 Unclassified 786
1603 nmdc:mga07m45_842111_c1 3300050496 Bacteria 525
1604 nmdc:mga06r32_1434109_c1 3300050510 Bacteria 632
1605 nmdc:mga08x19_286436_c1 3300050514 Bacteria 1142
1606 Ga0495612_0353400 3300053078 Bacteria 664
1607 Ga0500610_0004715 3300053079 Bacteria 5468
1608 Ga0500643_000075 3300053087 Bacteria 111465
1609 Ga0500643_003396 3300053087 Bacteria 7696
1610 Ga0500583_0527191 3300053092 Bacteria 552
1611 Ga0500583_0562674 3300053092 Bacteria 528
1612 Ga0500651_0003714 3300053093 Bacteria 8408
1613 Ga0500566_0093620 3300053094 Bacteria 1657
1614 Ga0500555_000207 3300053103 Bacteria 27494
1615 Ga0500556_0383168 3300053104 Bacteria 541
1616 Ga0500597_002583 3300053120 Bacteria 5080
1617 Ga0500614_017765 3300053123 Bacteria 1611
1618 Ga0500568_0001907 3300053139 Bacteria 12824
1619 Ga0500620_083778 3300053155 Bacteria 1107
1620 Ga0500645_001593 3300053730 Bacteria 11275
1621 Ga0501084_0176857 3300054114 Bacteria 1801
1622 Ga0501084_0192523 3300054114 Bacteria 1720
1623 Ga0501084_0246743 3300054114 Bacteria 1507
1624 Ga0501084_0339736 3300054114 Bacteria 1268
1625 Ga0501084_0903412 3300054114 Bacteria 743
1626 Ga0587083_0264676 3300059505 Bacteria 517
1627 Ga0501082_0001359 3300060353 Bacteria 21512
1628 Ga0501082_0005033 3300060353 Bacteria 11528
1629 Ga0501082_0086117 3300060353 Bacteria 2710
1630 Ga0501082_0211950 3300060353 Bacteria 1685
1631 Ga0466962_0005761 3300061719 Bacteria 5951
1632 Ga0466962_0005882 3300061719 Bacteria 5892
1633 Ga0466962_0008347 3300061719 Bacteria 4964
1634 Ga0466962_0335946 3300061719 Bacteria 751
1635 Ga0530510_0006308 3300061734 Bacteria 8249
1636 Ga0530510_0123358 3300061734 Bacteria 1903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003163 Ga0006759J45824_1122819 Ga0006759J45824_11228192 100
2 3300006051 Ga0075364_10603065 Ga0075364_106030652 100
3 3300006178 Ga0075367_10334613 Ga0075367_103346132 100
4 3300021361 Ga0213872_10006100 Ga0213872_100061002 100
5 3300031665 Ga0316575_10264420 Ga0316575_102644202 100
6 3300035398 Ga0316574_0335179 Ga0316574_0335179_154_456 100
7 3300039447 Ga0436361_0521891 Ga0436361_0521891_5737_6039 100
8 3300050494 nmdc:mga06z11_578199_c1 nmdc:mga06z11_578199_c1_137_442 100
9 3300001979 JGI24740J21852_10000470 JGI24740J21852_100004709 101
10 3300001979 JGI24740J21852_10100918 JGI24740J21852_101009182 101
11 3300001989 JGI24739J22299_10000039 JGI24739J22299_100000392 101
12 3300001989 JGI24739J22299_10108011 JGI24739J22299_101080111 101
13 3300001990 JGI24737J22298_10000773 JGI24737J22298_100007732 101
14 3300001990 JGI24737J22298_10007009 JGI24737J22298_100070092 101
15 3300001990 JGI24737J22298_10007226 JGI24737J22298_100072265 101
16 3300002067 JGI24735J21928_10010500 JGI24735J21928_100105002 101
17 3300002067 JGI24735J21928_10017289 JGI24735J21928_100172892 101
18 3300002077 JGI24744J21845_10109725 JGI24744J21845_101097251 101
19 3300002705 JGI25156J39149_1000822 JGI25156J39149_100082218 101
20 3300002705 JGI25156J39149_1001275 JGI25156J39149_100127512 101
21 3300002705 JGI25156J39149_1010679 JGI25156J39149_10106791 101
22 3300002737 JGI25162J39368_1000732 JGI25162J39368_100073226 101
23 3300002738 JGI25154J39366_1003192 JGI25154J39366_10031925 101
24 3300002738 JGI25154J39366_1003368 JGI25154J39366_10033685 101
25 3300002741 JGI25157J39369_1000656 JGI25157J39369_100065614 101
26 3300002741 JGI25157J39369_1000792 JGI25157J39369_10007927 101
27 3300002741 JGI25157J39369_1001513 JGI25157J39369_10015138 101
28 3300002741 JGI25157J39369_1002022 JGI25157J39369_10020222 101
29 3300002741 JGI25157J39369_1002091 JGI25157J39369_10020912 101
30 3300002771 JGI25163J39215_1000172 JGI25163J39215_100017219 101
31 3300002772 JGI25164J39214_1000085 JGI25164J39214_100008526 101
32 3300002772 JGI25164J39214_1000243 JGI25164J39214_100024337 101
33 3300002772 JGI25164J39214_1000994 JGI25164J39214_10009946 101
34 3300002772 JGI25164J39214_1000995 JGI25164J39214_10009956 101
35 3300002772 JGI25164J39214_1004811 JGI25164J39214_10048111 101
36 3300002773 JGI25152J39213_1032881 JGI25152J39213_10328812 101
37 3300003187 JGI25151J46595_10089409 JGI25151J46595_100894092 101
38 3300003214 JGI25165J46597_1000058 JGI25165J46597_1000058214 101
39 3300003214 JGI25165J46597_1000090 JGI25165J46597_1000090103 101
40 3300003214 JGI25165J46597_1001824 JGI25165J46597_10018246 101
41 3300003214 JGI25165J46597_1006457 JGI25165J46597_10064571 101
42 3300003215 JGI25153J46596_10131115 JGI25153J46596_101311151 101
43 3300003320 rootH2_10015394 rootH2_100153946 101
44 3300003578 Ga0006562J51391_1026821 Ga0006562J51391_102682114 101
45 3300003578 Ga0006562J51391_1026824 Ga0006562J51391_10268242 101
46 3300003659 JGI25404J52841_10136760 JGI25404J52841_101367601 101
47 3300003751 Ga0055538_1002456 Ga0055538_10024562 101
48 3300003752 Ga0055539_1000434 Ga0055539_10004348 101
49 3300003756 Ga0055533_1000734 Ga0055533_10007342 101
50 3300003756 Ga0055533_1001197 Ga0055533_10011975 101
51 3300003759 Ga0055525_1000097 Ga0055525_100009769 101
52 3300003760 Ga0055527_1000198 Ga0055527_10001984 101
53 3300003760 Ga0055527_1000581 Ga0055527_10005817 101
54 3300003761 Ga0055535_1000034 Ga0055535_10000342 101
55 3300003761 Ga0055535_1001535 Ga0055535_10015356 101
56 3300003761 Ga0055535_1001554 Ga0055535_10015544 101
57 3300003761 Ga0055535_1001777 Ga0055535_10017774 101
58 3300003761 Ga0055535_1003057 Ga0055535_10030574 101
59 3300003761 Ga0055535_1007979 Ga0055535_10079793 101
60 3300003762 Ga0055542_1000441 Ga0055542_10004414 101
61 3300003762 Ga0055542_1001261 Ga0055542_10012619 101
62 3300003762 Ga0055542_1001412 Ga0055542_10014128 101
63 3300003762 Ga0055542_1001429 Ga0055542_10014297 101
64 3300003762 Ga0055542_1002987 Ga0055542_10029875 101
65 3300003762 Ga0055542_1002988 Ga0055542_10029885 101
66 3300003763 Ga0055529_1000206 Ga0055529_100020639 101
67 3300003763 Ga0055529_1000870 Ga0055529_10008708 101
68 3300003763 Ga0055529_1001132 Ga0055529_10011324 101
69 3300003763 Ga0055529_1001145 Ga0055529_10011456 101
70 3300003763 Ga0055529_1035198 Ga0055529_10351982 101
71 3300003771 Ga0055526_1000021 Ga0055526_100002179 101
72 3300003771 Ga0055526_1007069 Ga0055526_10070694 101
73 3300003773 Ga0055537_1000186 Ga0055537_100018627 101
74 3300003775 Ga0055524_1000062 Ga0055524_100006284 101
75 3300003781 Ga0055536_1039212 Ga0055536_10392121 101
76 3300003781 Ga0055536_1059790 Ga0055536_10597901 101
77 3300003784 Ga0055534_1000052 Ga0055534_10000524 101
78 3300003784 Ga0055534_1004464 Ga0055534_10044644 101
79 3300003790 Ga0055528_1000009 Ga0055528_100000979 101
80 3300003791 Ga0055530_10009161 Ga0055530_100091613 101
81 3300003792 Ga0055540_1027462 Ga0055540_10274622 101
82 3300003792 Ga0055540_1099154 Ga0055540_10991542 101
83 3300003794 Ga0055531_10003386 Ga0055531_100033867 101
84 3300003794 Ga0055531_10024760 Ga0055531_100247602 101
85 3300005262 Ga0065165_1006432 Ga0065165_10064326 101
86 3300005327 Ga0070658_10003054 Ga0070658_100030544 101
87 3300005327 Ga0070658_10506690 Ga0070658_105066902 101
88 3300005327 Ga0070658_10616842 Ga0070658_106168422 101
89 3300005327 Ga0070658_10852760 Ga0070658_108527602 101
90 3300005327 Ga0070658_10922143 Ga0070658_109221432 101
91 3300005328 Ga0070676_10208880 Ga0070676_102088802 101
92 3300005328 Ga0070676_10216960 Ga0070676_102169602 101
93 3300005328 Ga0070676_10311370 Ga0070676_103113702 101
94 3300005328 Ga0070676_10379102 Ga0070676_103791022 101
95 3300005328 Ga0070676_10575862 Ga0070676_105758622 101
96 3300005329 Ga0070683_100318735 Ga0070683_1003187353 101
97 3300005329 Ga0070683_100398971 Ga0070683_1003989712 101
98 3300005329 Ga0070683_100541837 Ga0070683_1005418372 101
99 3300005330 Ga0070690_100411184 Ga0070690_1004111841 101
100 3300005330 Ga0070690_101494143 Ga0070690_1014941431 101
101 3300005331 Ga0070670_100068818 Ga0070670_1000688182 101
102 3300005331 Ga0070670_100141643 Ga0070670_1001416432 101
103 3300005331 Ga0070670_100156846 Ga0070670_1001568463 101
104 3300005331 Ga0070670_100375681 Ga0070670_1003756812 101
105 3300005331 Ga0070670_100419130 Ga0070670_1004191302 101
106 3300005331 Ga0070670_100942112 Ga0070670_1009421122 101
107 3300005331 Ga0070670_101118738 Ga0070670_1011187382 101
108 3300005331 Ga0070670_101565348 Ga0070670_1015653481 101
109 3300005334 Ga0068869_100047959 Ga0068869_1000479593 101
110 3300005334 Ga0068869_100128761 Ga0068869_1001287612 101
111 3300005335 Ga0070666_10000003 Ga0070666_10000003195 101
112 3300005335 Ga0070666_10001186 Ga0070666_100011866 101
113 3300005335 Ga0070666_10070889 Ga0070666_100708893 101
114 3300005335 Ga0070666_10089151 Ga0070666_100891513 101
115 3300005335 Ga0070666_10107381 Ga0070666_101073813 101
116 3300005336 Ga0070680_101125684 Ga0070680_1011256841 101
117 3300005336 Ga0070680_101335632 Ga0070680_1013356321 101
118 3300005336 Ga0070680_101515888 Ga0070680_1015158881 101
119 3300005337 Ga0070682_100058779 Ga0070682_1000587793 101
120 3300005337 Ga0070682_100316697 Ga0070682_1003166972 101
121 3300005337 Ga0070682_101584440 Ga0070682_1015844401 101
122 3300005338 Ga0068868_100035150 Ga0068868_1000351506 101
123 3300005338 Ga0068868_100166786 Ga0068868_1001667862 101
124 3300005338 Ga0068868_100201592 Ga0068868_1002015922 101
125 3300005338 Ga0068868_100355987 Ga0068868_1003559872 101
126 3300005338 Ga0068868_100724207 Ga0068868_1007242072 101
127 3300005339 Ga0070660_100133313 Ga0070660_1001333132 101
128 3300005339 Ga0070660_100252028 Ga0070660_1002520282 101
129 3300005339 Ga0070660_100878421 Ga0070660_1008784212 101
130 3300005339 Ga0070660_101438456 Ga0070660_1014384562 101
131 3300005340 Ga0070689_100236971 Ga0070689_1002369711 101
132 3300005340 Ga0070689_100812744 Ga0070689_1008127442 101
133 3300005341 Ga0070691_10017095 Ga0070691_100170952 101
134 3300005343 Ga0070687_100645345 Ga0070687_1006453451 101
135 3300005344 Ga0070661_100017074 Ga0070661_1000170744 101
136 3300005344 Ga0070661_100018867 Ga0070661_1000188674 101
137 3300005344 Ga0070661_100057112 Ga0070661_1000571122 101
138 3300005344 Ga0070661_100083093 Ga0070661_1000830934 101
139 3300005344 Ga0070661_100109495 Ga0070661_1001094952 101
140 3300005344 Ga0070661_100259293 Ga0070661_1002592932 101
141 3300005344 Ga0070661_100735824 Ga0070661_1007358242 101
142 3300005345 Ga0070692_10001200 Ga0070692_100012007 101
143 3300005347 Ga0070668_100027029 Ga0070668_1000270295 101
144 3300005347 Ga0070668_100029601 Ga0070668_1000296012 101
145 3300005347 Ga0070668_100037989 Ga0070668_1000379892 101
146 3300005347 Ga0070668_100286427 Ga0070668_1002864272 101
147 3300005347 Ga0070668_100701499 Ga0070668_1007014992 101
148 3300005347 Ga0070668_100853455 Ga0070668_1008534551 101
149 3300005353 Ga0070669_100556490 Ga0070669_1005564902 101
150 3300005353 Ga0070669_100801015 Ga0070669_1008010152 101
151 3300005353 Ga0070669_101688788 Ga0070669_1016887881 101
152 3300005354 Ga0070675_100075966 Ga0070675_1000759662 101
153 3300005354 Ga0070675_100508634 Ga0070675_1005086342 101
154 3300005355 Ga0070671_100140699 Ga0070671_1001406992 101
155 3300005355 Ga0070671_101007524 Ga0070671_1010075241 101
156 3300005355 Ga0070671_101306999 Ga0070671_1013069992 101
157 3300005355 Ga0070671_102088059 Ga0070671_1020880591 101
158 3300005356 Ga0070674_100381466 Ga0070674_1003814662 101
159 3300005364 Ga0070673_100118935 Ga0070673_1001189353 101
160 3300005364 Ga0070673_100121644 Ga0070673_1001216444 101
161 3300005364 Ga0070673_101658429 Ga0070673_1016584292 101
162 3300005365 Ga0070688_100662342 Ga0070688_1006623422 101
163 3300005366 Ga0070659_100295472 Ga0070659_1002954723 101
164 3300005366 Ga0070659_100720786 Ga0070659_1007207862 101
165 3300005366 Ga0070659_101252060 Ga0070659_1012520602 101
166 3300005367 Ga0070667_100000084 Ga0070667_1000000846 101
167 3300005367 Ga0070667_100014298 Ga0070667_1000142982 101
168 3300005367 Ga0070667_100016481 Ga0070667_1000164816 101
169 3300005367 Ga0070667_100111163 Ga0070667_1001111633 101
170 3300005367 Ga0070667_100116610 Ga0070667_1001166102 101
171 3300005367 Ga0070667_100166891 Ga0070667_1001668913 101
172 3300005367 Ga0070667_100258183 Ga0070667_1002581832 101
173 3300005367 Ga0070667_100380143 Ga0070667_1003801433 101
174 3300005367 Ga0070667_100491248 Ga0070667_1004912482 101
175 3300005367 Ga0070667_100518659 Ga0070667_1005186592 101
176 3300005367 Ga0070667_100568992 Ga0070667_1005689922 101
177 3300005367 Ga0070667_100569730 Ga0070667_1005697302 101
178 3300005367 Ga0070667_100673927 Ga0070667_1006739271 101
179 3300005367 Ga0070667_100714646 Ga0070667_1007146462 101
180 3300005367 Ga0070667_101745029 Ga0070667_1017450292 101
181 3300005367 Ga0070667_101865706 Ga0070667_1018657061 101
182 3300005434 Ga0070709_10610281 Ga0070709_106102812 101
183 3300005435 Ga0070714_100092322 Ga0070714_1000923224 101
184 3300005435 Ga0070714_100233190 Ga0070714_1002331902 101
185 3300005435 Ga0070714_100712286 Ga0070714_1007122862 101
186 3300005436 Ga0070713_100000401 Ga0070713_10000040120 101
187 3300005436 Ga0070713_101546112 Ga0070713_1015461122 101
188 3300005439 Ga0070711_100847092 Ga0070711_1008470922 101
189 3300005439 Ga0070711_100949692 Ga0070711_1009496921 101
190 3300005439 Ga0070711_101627140 Ga0070711_1016271402 101
191 3300005439 Ga0070711_102041554 Ga0070711_1020415541 101
192 3300005455 Ga0070663_100000327 Ga0070663_1000003279 101
193 3300005455 Ga0070663_100019945 Ga0070663_1000199453 101
194 3300005455 Ga0070663_100099652 Ga0070663_1000996522 101
195 3300005455 Ga0070663_100153698 Ga0070663_1001536982 101
196 3300005455 Ga0070663_100166357 Ga0070663_1001663572 101
197 3300005455 Ga0070663_101025064 Ga0070663_1010250642 101
198 3300005455 Ga0070663_101230109 Ga0070663_1012301092 101
199 3300005456 Ga0070678_100025334 Ga0070678_1000253343 101
200 3300005456 Ga0070678_100082189 Ga0070678_1000821891 101
201 3300005456 Ga0070678_100802964 Ga0070678_1008029642 101
202 3300005456 Ga0070678_102049207 Ga0070678_1020492072 101
203 3300005457 Ga0070662_100201437 Ga0070662_1002014372 101
204 3300005457 Ga0070662_100324011 Ga0070662_1003240112 101
205 3300005457 Ga0070662_100451123 Ga0070662_1004511232 101
206 3300005457 Ga0070662_100458096 Ga0070662_1004580962 101
207 3300005457 Ga0070662_100907941 Ga0070662_1009079411 101
208 3300005457 Ga0070662_101204415 Ga0070662_1012044151 101
209 3300005458 Ga0070681_10169047 Ga0070681_101690472 101
210 3300005458 Ga0070681_10367131 Ga0070681_103671312 101
211 3300005458 Ga0070681_10507270 Ga0070681_105072702 101
212 3300005459 Ga0068867_100151954 Ga0068867_1001519542 101
213 3300005459 Ga0068867_100167454 Ga0068867_1001674542 101
214 3300005459 Ga0068867_100205089 Ga0068867_1002050893 101
215 3300005459 Ga0068867_100822787 Ga0068867_1008227872 101
216 3300005459 Ga0068867_101160619 Ga0068867_1011606191 101
217 3300005466 Ga0070685_10005887 Ga0070685_100058875 101
218 3300005466 Ga0070685_10659667 Ga0070685_106596672 101
219 3300005466 Ga0070685_11298692 Ga0070685_112986922 101
220 3300005518 Ga0070699_100813160 Ga0070699_1008131602 101
221 3300005530 Ga0070679_100193143 Ga0070679_1001931432 101
222 3300005530 Ga0070679_102188816 Ga0070679_1021888161 101
223 3300005539 Ga0068853_100002704 Ga0068853_1000027044 101
224 3300005539 Ga0068853_100065726 Ga0068853_1000657262 101
225 3300005539 Ga0068853_100077969 Ga0068853_1000779692 101
226 3300005539 Ga0068853_100243932 Ga0068853_1002439323 101
227 3300005539 Ga0068853_100384322 Ga0068853_1003843222 101
228 3300005539 Ga0068853_100597911 Ga0068853_1005979112 101
229 3300005539 Ga0068853_100663150 Ga0068853_1006631502 101
230 3300005539 Ga0068853_100673498 Ga0068853_1006734982 101
231 3300005539 Ga0068853_101016012 Ga0068853_1010160122 101
232 3300005539 Ga0068853_101072473 Ga0068853_1010724732 101
233 3300005539 Ga0068853_101419858 Ga0068853_1014198581 101
234 3300005543 Ga0070672_100268324 Ga0070672_1002683243 101
235 3300005543 Ga0070672_100274735 Ga0070672_1002747352 101
236 3300005546 Ga0070696_100026415 Ga0070696_1000264153 101
237 3300005546 Ga0070696_101086134 Ga0070696_1010861342 101
238 3300005547 Ga0070693_100084649 Ga0070693_1000846494 101
239 3300005547 Ga0070693_100188355 Ga0070693_1001883552 101
240 3300005547 Ga0070693_100258338 Ga0070693_1002583382 101
241 3300005547 Ga0070693_100864475 Ga0070693_1008644752 101
242 3300005548 Ga0070665_100000249 Ga0070665_10000024925 101
243 3300005548 Ga0070665_100012690 Ga0070665_1000126906 101
244 3300005548 Ga0070665_100022171 Ga0070665_1000221715 101
245 3300005548 Ga0070665_100056231 Ga0070665_1000562313 101
246 3300005548 Ga0070665_100259943 Ga0070665_1002599432 101
247 3300005548 Ga0070665_100543687 Ga0070665_1005436871 101
248 3300005548 Ga0070665_100821504 Ga0070665_1008215042 101
249 3300005548 Ga0070665_101151931 Ga0070665_1011519312 101
250 3300005548 Ga0070665_101263570 Ga0070665_1012635702 101
251 3300005548 Ga0070665_101603595 Ga0070665_1016035952 101
252 3300005548 Ga0070665_101749902 Ga0070665_1017499021 101
253 3300005563 Ga0068855_100042228 Ga0068855_1000422285 101
254 3300005563 Ga0068855_100060595 Ga0068855_1000605953 101
255 3300005563 Ga0068855_100074780 Ga0068855_1000747802 101
256 3300005563 Ga0068855_100082771 Ga0068855_1000827713 101
257 3300005563 Ga0068855_100093629 Ga0068855_1000936293 101
258 3300005563 Ga0068855_100122346 Ga0068855_1001223462 101
259 3300005563 Ga0068855_100221989 Ga0068855_1002219894 101
260 3300005563 Ga0068855_100257604 Ga0068855_1002576042 101
261 3300005563 Ga0068855_100306227 Ga0068855_1003062272 101
262 3300005563 Ga0068855_100349227 Ga0068855_1003492272 101
263 3300005563 Ga0068855_100379456 Ga0068855_1003794562 101
264 3300005563 Ga0068855_100519186 Ga0068855_1005191862 101
265 3300005563 Ga0068855_101070197 Ga0068855_1010701972 101
266 3300005563 Ga0068855_101672526 Ga0068855_1016725261 101
267 3300005564 Ga0070664_100066498 Ga0070664_1000664984 101
268 3300005564 Ga0070664_100159884 Ga0070664_1001598845 101
269 3300005564 Ga0070664_100410070 Ga0070664_1004100702 101
270 3300005577 Ga0068857_100000551 Ga0068857_10000055126 101
271 3300005577 Ga0068857_100148913 Ga0068857_1001489132 101
272 3300005577 Ga0068857_100208283 Ga0068857_1002082832 101
273 3300005577 Ga0068857_100225783 Ga0068857_1002257833 101
274 3300005577 Ga0068857_100636914 Ga0068857_1006369142 101
275 3300005577 Ga0068857_101718814 Ga0068857_1017188142 101
276 3300005577 Ga0068857_102066812 Ga0068857_1020668122 101
277 3300005578 Ga0068854_100000634 Ga0068854_10000063421 101
278 3300005578 Ga0068854_100028199 Ga0068854_1000281994 101
279 3300005578 Ga0068854_100095505 Ga0068854_1000955053 101
280 3300005578 Ga0068854_100134375 Ga0068854_1001343754 101
281 3300005578 Ga0068854_100345216 Ga0068854_1003452162 101
282 3300005578 Ga0068854_100463767 Ga0068854_1004637672 101
283 3300005578 Ga0068854_100562606 Ga0068854_1005626062 101
284 3300005614 Ga0068856_100000245 Ga0068856_1000002453 101
285 3300005614 Ga0068856_100015179 Ga0068856_1000151795 101
286 3300005614 Ga0068856_100034861 Ga0068856_1000348614 101
287 3300005614 Ga0068856_100252731 Ga0068856_1002527312 101
288 3300005614 Ga0068856_100372684 Ga0068856_1003726842 101
289 3300005614 Ga0068856_100452730 Ga0068856_1004527302 101
290 3300005614 Ga0068856_100734895 Ga0068856_1007348952 101
291 3300005614 Ga0068856_100735744 Ga0068856_1007357442 101
292 3300005614 Ga0068856_100761240 Ga0068856_1007612402 101
293 3300005614 Ga0068856_100774353 Ga0068856_1007743532 101
294 3300005614 Ga0068856_101836171 Ga0068856_1018361711 101
295 3300005616 Ga0068852_100038365 Ga0068852_1000383653 101
296 3300005616 Ga0068852_100118481 Ga0068852_1001184812 101
297 3300005616 Ga0068852_100166563 Ga0068852_1001665632 101
298 3300005616 Ga0068852_100502344 Ga0068852_1005023442 101
299 3300005616 Ga0068852_100531430 Ga0068852_1005314302 101
300 3300005616 Ga0068852_100662612 Ga0068852_1006626122 101
301 3300005616 Ga0068852_100761451 Ga0068852_1007614512 101
302 3300005616 Ga0068852_101026213 Ga0068852_1010262132 101
303 3300005616 Ga0068852_101128034 Ga0068852_1011280341 101
304 3300005616 Ga0068852_101410680 Ga0068852_1014106802 101
305 3300005616 Ga0068852_102722405 Ga0068852_1027224051 101
306 3300005617 Ga0068859_100001367 Ga0068859_10000136720 101
307 3300005617 Ga0068859_100261639 Ga0068859_1002616392 101
308 3300005617 Ga0068859_100797998 Ga0068859_1007979982 101
309 3300005617 Ga0068859_100906336 Ga0068859_1009063362 101
310 3300005617 Ga0068859_100972630 Ga0068859_1009726302 101
311 3300005618 Ga0068864_100238138 Ga0068864_1002381383 101
312 3300005618 Ga0068864_100388209 Ga0068864_1003882091 101
313 3300005618 Ga0068864_100399545 Ga0068864_1003995452 101
314 3300005618 Ga0068864_100585219 Ga0068864_1005852192 101
315 3300005718 Ga0068866_10935768 Ga0068866_109357681 101
316 3300005719 Ga0068861_100300737 Ga0068861_1003007372 101
317 3300005719 Ga0068861_100927172 Ga0068861_1009271722 101
318 3300005834 Ga0068851_10002343 Ga0068851_100023434 101
319 3300005834 Ga0068851_10176390 Ga0068851_101763902 101
320 3300005834 Ga0068851_10221766 Ga0068851_102217662 101
321 3300005834 Ga0068851_10484571 Ga0068851_104845711 101
322 3300005840 Ga0068870_10669774 Ga0068870_106697742 101
323 3300005841 Ga0068863_100005779 Ga0068863_10000577911 101
324 3300005841 Ga0068863_100015026 Ga0068863_1000150268 101
325 3300005841 Ga0068863_100039049 Ga0068863_1000390494 101
326 3300005841 Ga0068863_100090495 Ga0068863_1000904953 101
327 3300005841 Ga0068863_100171415 Ga0068863_1001714152 101
328 3300005841 Ga0068863_101228510 Ga0068863_1012285101 101
329 3300005841 Ga0068863_101273389 Ga0068863_1012733892 101
330 3300005841 Ga0068863_101684782 Ga0068863_1016847822 101
331 3300005842 Ga0068858_100002098 Ga0068858_10000209819 101
332 3300005842 Ga0068858_100087159 Ga0068858_1000871594 101
333 3300005842 Ga0068858_100514926 Ga0068858_1005149262 101
334 3300005842 Ga0068858_102317411 Ga0068858_1023174112 101
335 3300005843 Ga0068860_100002623 Ga0068860_1000026236 101
336 3300005843 Ga0068860_100125858 Ga0068860_1001258584 101
337 3300005843 Ga0068860_100153813 Ga0068860_1001538134 101
338 3300005843 Ga0068860_100231301 Ga0068860_1002313012 101
339 3300005843 Ga0068860_100306934 Ga0068860_1003069342 101
340 3300005843 Ga0068860_100798786 Ga0068860_1007987862 101
341 3300005843 Ga0068860_101747859 Ga0068860_1017478592 101
342 3300005844 Ga0068862_100000941 Ga0068862_10000094126 101
343 3300005844 Ga0068862_100839203 Ga0068862_1008392032 101
344 3300005937 Ga0081455_10094355 Ga0081455_100943552 101
345 3300005937 Ga0081455_10541744 Ga0081455_105417442 101
346 3300005983 Ga0081540_1001118 Ga0081540_100111815 101
347 3300006038 Ga0075365_10573912 Ga0075365_105739122 101
348 3300006173 Ga0070716_101083873 Ga0070716_1010838732 101
349 3300006175 Ga0070712_100695102 Ga0070712_1006951022 101
350 3300006175 Ga0070712_101210084 Ga0070712_1012100841 101
351 3300006195 Ga0075366_10904500 Ga0075366_109045002 101
352 3300006237 Ga0097621_100128744 Ga0097621_1001287443 101
353 3300006237 Ga0097621_100250600 Ga0097621_1002506002 101
354 3300006237 Ga0097621_100445794 Ga0097621_1004457942 101
355 3300006237 Ga0097621_100463893 Ga0097621_1004638932 101
356 3300006237 Ga0097621_101384646 Ga0097621_1013846462 101
357 3300006358 Ga0068871_100038080 Ga0068871_1000380805 101
358 3300006358 Ga0068871_100111371 Ga0068871_1001113712 101
359 3300006358 Ga0068871_100169544 Ga0068871_1001695443 101
360 3300006358 Ga0068871_100362746 Ga0068871_1003627463 101
361 3300006358 Ga0068871_100383698 Ga0068871_1003836982 101
362 3300006358 Ga0068871_101410630 Ga0068871_1014106302 101
363 3300006358 Ga0068871_101446288 Ga0068871_1014462883 101
364 3300006847 Ga0075431_100702404 Ga0075431_1007024042 101
365 3300006871 Ga0075434_101493858 Ga0075434_1014938582 101
366 3300006881 Ga0068865_100003492 Ga0068865_1000034926 101
367 3300006881 Ga0068865_100018704 Ga0068865_1000187045 101
368 3300006881 Ga0068865_100196150 Ga0068865_1001961502 101
369 3300006881 Ga0068865_100213578 Ga0068865_1002135783 101
370 3300006881 Ga0068865_100758994 Ga0068865_1007589942 101
371 3300006881 Ga0068865_101901953 Ga0068865_1019019532 101
372 3300006914 Ga0075436_100124884 Ga0075436_1001248842 101
373 3300006931 Ga0097620_100001367 Ga0097620_10000136720 101
374 3300006931 Ga0097620_100261640 Ga0097620_1002616402 101
375 3300006931 Ga0097620_100798097 Ga0097620_1007980972 101
376 3300006931 Ga0097620_100906622 Ga0097620_1009066222 101
377 3300006931 Ga0097620_100972635 Ga0097620_1009726352 101
378 3300006948 Ga0099826_10169391 Ga0099826_101693912 101
379 3300009093 Ga0105240_10000627 Ga0105240_1000062725 101
380 3300009093 Ga0105240_10098926 Ga0105240_100989262 101
381 3300009093 Ga0105240_10123497 Ga0105240_101234974 101
382 3300009093 Ga0105240_10213925 Ga0105240_102139252 101
383 3300009093 Ga0105240_10309393 Ga0105240_103093932 101
384 3300009093 Ga0105240_10335124 Ga0105240_103351242 101
385 3300009093 Ga0105240_10431908 Ga0105240_104319083 101
386 3300009093 Ga0105240_10559067 Ga0105240_105590672 101
387 3300009093 Ga0105240_10760555 Ga0105240_107605552 101
388 3300009093 Ga0105240_10760556 Ga0105240_107605562 101
389 3300009093 Ga0105240_11558216 Ga0105240_115582162 101
390 3300009094 Ga0111539_11813593 Ga0111539_118135931 101
391 3300009098 Ga0105245_10261611 Ga0105245_102616112 101
392 3300009098 Ga0105245_10331048 Ga0105245_103310482 101
393 3300009098 Ga0105245_10624776 Ga0105245_106247762 101
394 3300009098 Ga0105245_11467698 Ga0105245_114676981 101
395 3300009101 Ga0105247_10053155 Ga0105247_100531552 101
396 3300009101 Ga0105247_10196742 Ga0105247_101967422 101
397 3300009148 Ga0105243_10674006 Ga0105243_106740062 101
398 3300009148 Ga0105243_12070627 Ga0105243_120706271 101
399 3300009174 Ga0105241_10050532 Ga0105241_100505324 101
400 3300009174 Ga0105241_10104348 Ga0105241_101043484 101
401 3300009174 Ga0105241_10122703 Ga0105241_101227032 101
402 3300009174 Ga0105241_10295120 Ga0105241_102951201 101
403 3300009174 Ga0105241_10354005 Ga0105241_103540052 101
404 3300009174 Ga0105241_10622816 Ga0105241_106228162 101
405 3300009174 Ga0105241_10701426 Ga0105241_107014262 101
406 3300009174 Ga0105241_10864665 Ga0105241_108646652 101
407 3300009174 Ga0105241_11223866 Ga0105241_112238662 101
408 3300009174 Ga0105241_11551149 Ga0105241_115511492 101
409 3300009174 Ga0105241_11704536 Ga0105241_117045362 101
410 3300009174 Ga0105241_11788613 Ga0105241_117886132 101
411 3300009176 Ga0105242_10025509 Ga0105242_100255096 101
412 3300009176 Ga0105242_10076451 Ga0105242_100764514 101
413 3300009176 Ga0105242_10312729 Ga0105242_103127292 101
414 3300009176 Ga0105242_10374891 Ga0105242_103748913 101
415 3300009176 Ga0105242_10978358 Ga0105242_109783582 101
416 3300009176 Ga0105242_11022674 Ga0105242_110226742 101
417 3300009177 Ga0105248_10000418 Ga0105248_1000041845 101
418 3300009177 Ga0105248_10076122 Ga0105248_100761222 101
419 3300009177 Ga0105248_10326174 Ga0105248_103261744 101
420 3300009177 Ga0105248_10451960 Ga0105248_104519602 101
421 3300009177 Ga0105248_10843000 Ga0105248_108430002 101
422 3300009545 Ga0105237_10000272 Ga0105237_100002728 101
423 3300009545 Ga0105237_10006138 Ga0105237_100061389 101
424 3300009545 Ga0105237_10026547 Ga0105237_100265474 101
425 3300009545 Ga0105237_10031065 Ga0105237_100310653 101
426 3300009545 Ga0105237_10147981 Ga0105237_101479811 101
427 3300009545 Ga0105237_10245121 Ga0105237_102451212 101
428 3300009545 Ga0105237_10352560 Ga0105237_103525602 101
429 3300009545 Ga0105237_10525259 Ga0105237_105252592 101
430 3300009545 Ga0105237_10573499 Ga0105237_105734992 101
431 3300009545 Ga0105237_10659941 Ga0105237_106599412 101
432 3300009545 Ga0105237_10659942 Ga0105237_106599422 101
433 3300009545 Ga0105237_10706116 Ga0105237_107061161 101
434 3300009545 Ga0105237_10980829 Ga0105237_109808292 101
435 3300009545 Ga0105237_11112211 Ga0105237_111122112 101
436 3300009545 Ga0105237_11264886 Ga0105237_112648862 101
437 3300009545 Ga0105237_11359290 Ga0105237_113592902 101
438 3300009545 Ga0105237_11790736 Ga0105237_117907361 101
439 3300009551 Ga0105238_10000920 Ga0105238_1000092026 101
440 3300009551 Ga0105238_10002036 Ga0105238_1000203613 101
441 3300009551 Ga0105238_10043470 Ga0105238_100434702 101
442 3300009551 Ga0105238_10060458 Ga0105238_100604584 101
443 3300009551 Ga0105238_10119920 Ga0105238_101199202 101
444 3300009551 Ga0105238_10127655 Ga0105238_101276552 101
445 3300009551 Ga0105238_10176228 Ga0105238_101762284 101
446 3300009551 Ga0105238_10176250 Ga0105238_101762503 101
447 3300009551 Ga0105238_10199227 Ga0105238_101992272 101
448 3300009551 Ga0105238_11015940 Ga0105238_110159402 101
449 3300009551 Ga0105238_11210731 Ga0105238_112107312 101
450 3300009551 Ga0105238_11362851 Ga0105238_113628511 101
451 3300009551 Ga0105238_12579614 Ga0105238_125796141 101
452 3300009553 Ga0105249_10000195 Ga0105249_1000019518 101
453 3300009553 Ga0105249_10027675 Ga0105249_100276755 101
454 3300009553 Ga0105249_10216336 Ga0105249_102163362 101
455 3300009553 Ga0105249_10356663 Ga0105249_103566632 101
456 3300009553 Ga0105249_11155462 Ga0105249_111554622 101
457 3300009978 Ga0105148_101049 Ga0105148_1010492 101
458 3300010375 Ga0105239_10000044 Ga0105239_1000004412 101
459 3300010375 Ga0105239_10002892 Ga0105239_1000289219 101
460 3300010375 Ga0105239_10006627 Ga0105239_1000662714 101
461 3300010375 Ga0105239_10032059 Ga0105239_100320593 101
462 3300010375 Ga0105239_10100612 Ga0105239_101006122 101
463 3300010375 Ga0105239_10130571 Ga0105239_101305714 101
464 3300010375 Ga0105239_10170468 Ga0105239_101704682 101
465 3300010375 Ga0105239_10225035 Ga0105239_102250352 101
466 3300010375 Ga0105239_10416289 Ga0105239_104162892 101
467 3300010375 Ga0105239_10539534 Ga0105239_105395342 101
468 3300010375 Ga0105239_10661316 Ga0105239_106613162 101
469 3300010375 Ga0105239_11091601 Ga0105239_110916012 101
470 3300010375 Ga0105239_11337868 Ga0105239_113378681 101
471 3300010375 Ga0105239_11344595 Ga0105239_113445952 101
472 3300010375 Ga0105239_12980888 Ga0105239_129808881 101
473 3300011119 Ga0105246_10341529 Ga0105246_103415292 101
474 3300011119 Ga0105246_10840462 Ga0105246_108404621 101
475 3300011119 Ga0105246_11919937 Ga0105246_119199372 101
476 3300012488 Ga0157343_1015133 Ga0157343_10151332 101
477 3300012500 Ga0157314_1013756 Ga0157314_10137561 101
478 3300013100 Ga0157373_10121166 Ga0157373_101211662 101
479 3300013100 Ga0157373_10337468 Ga0157373_103374683 101
480 3300013102 Ga0157371_10011946 Ga0157371_100119465 101
481 3300013102 Ga0157371_10210003 Ga0157371_102100032 101
482 3300013102 Ga0157371_10802598 Ga0157371_108025981 101
483 3300013104 Ga0157370_10007966 Ga0157370_100079663 101
484 3300013104 Ga0157370_10021865 Ga0157370_100218652 101
485 3300013104 Ga0157370_10030429 Ga0157370_100304293 101
486 3300013104 Ga0157370_10049266 Ga0157370_100492662 101
487 3300013104 Ga0157370_10113933 Ga0157370_101139332 101
488 3300013104 Ga0157370_10114393 Ga0157370_101143932 101
489 3300013104 Ga0157370_10359121 Ga0157370_103591212 101
490 3300013104 Ga0157370_10406772 Ga0157370_104067722 101
491 3300013104 Ga0157370_10620345 Ga0157370_106203452 101
492 3300013104 Ga0157370_10745667 Ga0157370_107456672 101
493 3300013104 Ga0157370_10769083 Ga0157370_107690832 101
494 3300013104 Ga0157370_11072838 Ga0157370_110728382 101
495 3300013104 Ga0157370_11495738 Ga0157370_114957382 101
496 3300013104 Ga0157370_11870415 Ga0157370_118704152 101
497 3300013105 Ga0157369_10000329 Ga0157369_1000032948 101
498 3300013105 Ga0157369_10000604 Ga0157369_1000060441 101
499 3300013105 Ga0157369_10009635 Ga0157369_100096352 101
500 3300013105 Ga0157369_10010381 Ga0157369_100103817 101
501 3300013105 Ga0157369_10023388 Ga0157369_100233885 101
502 3300013105 Ga0157369_10403660 Ga0157369_104036602 101
503 3300013105 Ga0157369_10417095 Ga0157369_104170952 101
504 3300013105 Ga0157369_10629502 Ga0157369_106295022 101
505 3300013105 Ga0157369_10852514 Ga0157369_108525142 101
506 3300013105 Ga0157369_10857160 Ga0157369_108571602 101
507 3300013105 Ga0157369_11972512 Ga0157369_119725122 101
508 3300013296 Ga0157374_10279686 Ga0157374_102796862 101
509 3300013296 Ga0157374_10303991 Ga0157374_103039913 101
510 3300013296 Ga0157374_10435621 Ga0157374_104356212 101
511 3300013296 Ga0157374_10859562 Ga0157374_108595622 101
512 3300013296 Ga0157374_10921159 Ga0157374_109211592 101
513 3300013296 Ga0157374_11029757 Ga0157374_110297572 101
514 3300013296 Ga0157374_12054846 Ga0157374_120548461 101
515 3300013297 Ga0157378_10001163 Ga0157378_100011635 101
516 3300013297 Ga0157378_10036782 Ga0157378_100367822 101
517 3300013297 Ga0157378_10460056 Ga0157378_104600562 101
518 3300013297 Ga0157378_11489034 Ga0157378_114890342 101
519 3300013306 Ga0163162_10002333 Ga0163162_100023335 101
520 3300013306 Ga0163162_10022472 Ga0163162_100224725 101
521 3300013306 Ga0163162_10039066 Ga0163162_100390665 101
522 3300013306 Ga0163162_11562272 Ga0163162_115622722 101
523 3300013306 Ga0163162_12242717 Ga0163162_122427172 101
524 3300013307 Ga0157372_10023320 Ga0157372_100233202 101
525 3300013307 Ga0157372_10023763 Ga0157372_100237632 101
526 3300013307 Ga0157372_10038916 Ga0157372_100389164 101
527 3300013307 Ga0157372_10072331 Ga0157372_100723313 101
528 3300013307 Ga0157372_10082841 Ga0157372_100828413 101
529 3300013307 Ga0157372_10189213 Ga0157372_101892132 101
530 3300013307 Ga0157372_10206533 Ga0157372_102065332 101
531 3300013307 Ga0157372_10375352 Ga0157372_103753522 101
532 3300013307 Ga0157372_10431261 Ga0157372_104312612 101
533 3300013307 Ga0157372_10779366 Ga0157372_107793662 101
534 3300013307 Ga0157372_11383829 Ga0157372_113838292 101
535 3300013308 Ga0157375_10013024 Ga0157375_100130245 101
536 3300013308 Ga0157375_10064653 Ga0157375_100646534 101
537 3300013308 Ga0157375_10167400 Ga0157375_101674001 101
538 3300013308 Ga0157375_10896503 Ga0157375_108965032 101
539 3300014325 Ga0163163_10000754 Ga0163163_100007546 101
540 3300014325 Ga0163163_10239681 Ga0163163_102396811 101
541 3300014325 Ga0163163_10241793 Ga0163163_102417932 101
542 3300014325 Ga0163163_11931750 Ga0163163_119317502 101
543 3300014326 Ga0157380_12656551 Ga0157380_126565512 101
544 3300014497 Ga0182008_10066759 Ga0182008_100667592 101
545 3300014497 Ga0182008_10166729 Ga0182008_101667292 101
546 3300014497 Ga0182008_10389459 Ga0182008_103894592 101
547 3300014745 Ga0157377_10969725 Ga0157377_109697252 101
548 3300014968 Ga0157379_10188376 Ga0157379_101883764 101
549 3300014968 Ga0157379_10360209 Ga0157379_103602091 101
550 3300014969 Ga0157376_10002106 Ga0157376_100021063 101
551 3300014969 Ga0157376_10673001 Ga0157376_106730012 101
552 3300014969 Ga0157376_11211577 Ga0157376_112115772 101
553 3300015261 Ga0182006_1013034 Ga0182006_10130342 101
554 3300015262 Ga0182007_10034657 Ga0182007_100346572 101
555 3300015262 Ga0182007_10207051 Ga0182007_102070512 101
556 3300015262 Ga0182007_10221888 Ga0182007_102218881 101
557 3300015265 Ga0182005_1051168 Ga0182005_10511682 101
558 3300015685 Ga0183369_1008 Ga0183369_1008195 101
559 3300015687 Ga0183368_1003 Ga0183368_10031060 101
560 3300015689 Ga0183360_10001 Ga0183360_100011188 101
561 3300017792 Ga0163161_10331938 Ga0163161_103319382 101
562 3300017792 Ga0163161_11073987 Ga0163161_110739872 101
563 3300020070 Ga0206356_11373589 Ga0206356_113735892 101
564 3300020081 Ga0206354_10531980 Ga0206354_105319802 101
565 3300020082 Ga0206353_10211211 Ga0206353_102112112 101
566 3300020610 Ga0154015_1010693 Ga0154015_10106932 101
567 3300025206 Ga0209435_102375 Ga0209435_1023752 101
568 3300025206 Ga0209435_102791 Ga0209435_1027913 101
569 3300025207 Ga0209760_100371 Ga0209760_1003718 101
570 3300025224 Ga0209784_100016 Ga0209784_100016451 101
571 3300025225 Ga0209566_101455 Ga0209566_1014556 101
572 3300025226 Ga0209674_100012 Ga0209674_100012806 101
573 3300025226 Ga0209674_100322 Ga0209674_1003225 101
574 3300025226 Ga0209674_100347 Ga0209674_10034712 101
575 3300025226 Ga0209674_101036 Ga0209674_1010362 101
576 3300025228 Ga0209672_100007 Ga0209672_100007203 101
577 3300025228 Ga0209672_100078 Ga0209672_10007851 101
578 3300025228 Ga0209672_100389 Ga0209672_10038920 101
579 3300025228 Ga0209672_100559 Ga0209672_10055915 101
580 3300025228 Ga0209672_105497 Ga0209672_1054974 101
581 3300025229 Ga0209147_112175 Ga0209147_1121752 101
582 3300025230 Ga0209563_100079 Ga0209563_10007968 101
583 3300025231 Ga0207427_100033 Ga0207427_100033249 101
584 3300025231 Ga0207427_100188 Ga0207427_10018821 101
585 3300025231 Ga0207427_100402 Ga0207427_1004026 101
586 3300025231 Ga0207427_100594 Ga0207427_1005946 101
587 3300025231 Ga0207427_102610 Ga0207427_1026105 101
588 3300025233 Ga0209437_100012 Ga0209437_100012280 101
589 3300025233 Ga0209437_100020 Ga0209437_100020120 101
590 3300025233 Ga0209437_100105 Ga0209437_100105148 101
591 3300025233 Ga0209437_100192 Ga0209437_10019235 101
592 3300025233 Ga0209437_100537 Ga0209437_1005377 101
593 3300025233 Ga0209437_101513 Ga0209437_1015132 101
594 3300025242 Ga0209258_100012 Ga0209258_100012651 101
595 3300025242 Ga0209258_100046 Ga0209258_100046134 101
596 3300025242 Ga0209258_100095 Ga0209258_100095196 101
597 3300025242 Ga0209258_100238 Ga0209258_10023866 101
598 3300025242 Ga0209258_100765 Ga0209258_10076512 101
599 3300025242 Ga0209258_101311 Ga0209258_1013119 101
600 3300025242 Ga0209258_101904 Ga0209258_1019046 101
601 3300025242 Ga0209258_121959 Ga0209258_1219592 101
602 3300025245 Ga0207425_1001752 Ga0207425_10017524 101
603 3300025246 Ga0209646_1001514 Ga0209646_10015145 101
604 3300025246 Ga0209646_1001913 Ga0209646_10019133 101
605 3300025246 Ga0209646_1001986 Ga0209646_10019865 101
606 3300025250 Ga0209026_1000012 Ga0209026_100001235 101
607 3300025250 Ga0209026_1000105 Ga0209026_10001055 101
608 3300025250 Ga0209026_1000278 Ga0209026_100027844 101
609 3300025250 Ga0209026_1000285 Ga0209026_100028523 101
610 3300025250 Ga0209026_1000335 Ga0209026_100033535 101
611 3300025250 Ga0209026_1030371 Ga0209026_10303712 101
612 3300025250 Ga0209026_1033302 Ga0209026_10333022 101
613 3300025253 Ga0209677_103018 Ga0209677_1030185 101
614 3300025254 Ga0209148_1000001 Ga0209148_10000011722 101
615 3300025254 Ga0209148_1000005 Ga0209148_1000005638 101
616 3300025254 Ga0209148_1000014 Ga0209148_10000145 101
617 3300025254 Ga0209148_1000039 Ga0209148_1000039408 101
618 3300025254 Ga0209148_1000087 Ga0209148_1000087209 101
619 3300025254 Ga0209148_1000098 Ga0209148_10000985 101
620 3300025254 Ga0209148_1025941 Ga0209148_10259411 101
621 3300025256 Ga0209759_1000356 Ga0209759_10003568 101
622 3300025256 Ga0209759_1000460 Ga0209759_100046012 101
623 3300025256 Ga0209759_1000536 Ga0209759_100053632 101
624 3300025256 Ga0209759_1000912 Ga0209759_10009128 101
625 3300025256 Ga0209759_1023568 Ga0209759_10235682 101
626 3300025258 Ga0209129_1002063 Ga0209129_10020632 101
627 3300025258 Ga0209129_1003433 Ga0209129_10034336 101
628 3300025261 Ga0209233_1000002 Ga0209233_1000002510 101
629 3300025261 Ga0209233_1000020 Ga0209233_1000020505 101
630 3300025261 Ga0209233_1000080 Ga0209233_1000080249 101
631 3300025261 Ga0209233_1000370 Ga0209233_10003706 101
632 3300025261 Ga0209233_1060127 Ga0209233_10601272 101
633 3300025263 Ga0209565_1000048 Ga0209565_100004879 101
634 3300025272 Ga0209455_1000010 Ga0209455_1000010203 101
635 3300025272 Ga0209455_1000034 Ga0209455_1000034409 101
636 3300025272 Ga0209455_1000039 Ga0209455_1000039457 101
637 3300025272 Ga0209455_1000126 Ga0209455_1000126109 101
638 3300025272 Ga0209455_1000310 Ga0209455_100031037 101
639 3300025272 Ga0209455_1016170 Ga0209455_10161702 101
640 3300025273 Ga0209673_1000001 Ga0209673_10000012614 101
641 3300025273 Ga0209673_1018372 Ga0209673_10183722 101
642 3300025273 Ga0209673_1095729 Ga0209673_10957292 101
643 3300025284 Ga0209130_1002842 Ga0209130_10028427 101
644 3300025291 Ga0209675_1000045 Ga0209675_100004586 101
645 3300025291 Ga0209675_1036559 Ga0209675_10365592 101
646 3300025292 Ga0209676_1006754 Ga0209676_10067545 101
647 3300025294 Ga0209025_1000005 Ga0209025_1000005444 101
648 3300025294 Ga0209025_1006351 Ga0209025_10063514 101
649 3300025294 Ga0209025_1013061 Ga0209025_10130615 101
650 3300025294 Ga0209025_1040960 Ga0209025_10409602 101
651 3300025295 Ga0209564_1000001 Ga0209564_100000179 101
652 3300025295 Ga0209564_1039988 Ga0209564_10399882 101
653 3300025297 Ga0209758_1000535 Ga0209758_10005356 101
654 3300025297 Ga0209758_1009118 Ga0209758_10091185 101
655 3300025297 Ga0209758_1012999 Ga0209758_10129993 101
656 3300025298 Ga0209050_1001247 Ga0209050_100124723 101
657 3300025299 Ga0209256_1000002 Ga0209256_10000021472 101
658 3300025299 Ga0209256_1004565 Ga0209256_10045658 101
659 3300025299 Ga0209256_1039654 Ga0209256_10396542 101
660 3300025302 Ga0207426_1006400 Ga0207426_10064003 101
661 3300025302 Ga0207426_1138574 Ga0207426_11385741 101
662 3300025303 Ga0209051_1014949 Ga0209051_10149492 101
663 3300025303 Ga0209051_1019027 Ga0209051_10190272 101
664 3300025303 Ga0209051_1031421 Ga0209051_10314212 101
665 3300025304 Ga0209257_1000217 Ga0209257_100021715 101
666 3300025304 Ga0209257_1016898 Ga0209257_10168984 101
667 3300025304 Ga0209257_1041047 Ga0209257_10410471 101
668 3300025304 Ga0209257_1107616 Ga0209257_11076162 101
669 3300025315 Ga0207697_10114964 Ga0207697_101149642 101
670 3300025321 Ga0207656_10001733 Ga0207656_100017334 101
671 3300025321 Ga0207656_10028858 Ga0207656_100288582 101
672 3300025321 Ga0207656_10062176 Ga0207656_100621764 101
673 3300025321 Ga0207656_10175900 Ga0207656_101759001 101
674 3300025321 Ga0207656_10696310 Ga0207656_106963102 101
675 3300025893 Ga0207682_10277748 Ga0207682_102777483 101
676 3300025898 Ga0207692_10138951 Ga0207692_101389512 101
677 3300025900 Ga0207710_10020591 Ga0207710_100205912 101
678 3300025903 Ga0207680_10000006 Ga0207680_10000006341 101
679 3300025903 Ga0207680_10001267 Ga0207680_100012674 101
680 3300025903 Ga0207680_10053739 Ga0207680_100537393 101
681 3300025903 Ga0207680_10224992 Ga0207680_102249922 101
682 3300025903 Ga0207680_10394596 Ga0207680_103945962 101
683 3300025903 Ga0207680_10540156 Ga0207680_105401562 101
684 3300025904 Ga0207647_10000111 Ga0207647_100001117 101
685 3300025904 Ga0207647_10000138 Ga0207647_1000013836 101
686 3300025904 Ga0207647_10000859 Ga0207647_1000085916 101
687 3300025904 Ga0207647_10018916 Ga0207647_100189162 101
688 3300025904 Ga0207647_10091644 Ga0207647_100916443 101
689 3300025904 Ga0207647_10308961 Ga0207647_103089612 101
690 3300025904 Ga0207647_10323271 Ga0207647_103232712 101
691 3300025906 Ga0207699_10193317 Ga0207699_101933172 101
692 3300025907 Ga0207645_10038319 Ga0207645_100383195 101
693 3300025907 Ga0207645_10192165 Ga0207645_101921652 101
694 3300025907 Ga0207645_10229743 Ga0207645_102297433 101
695 3300025907 Ga0207645_10350588 Ga0207645_103505882 101
696 3300025907 Ga0207645_10753167 Ga0207645_107531671 101
697 3300025908 Ga0207643_10178438 Ga0207643_101784382 101
698 3300025909 Ga0207705_10000798 Ga0207705_100007984 101
699 3300025909 Ga0207705_10009804 Ga0207705_100098044 101
700 3300025911 Ga0207654_10004940 Ga0207654_100049406 101
701 3300025911 Ga0207654_10027457 Ga0207654_100274572 101
702 3300025911 Ga0207654_10044512 Ga0207654_100445124 101
703 3300025911 Ga0207654_10073004 Ga0207654_100730042 101
704 3300025911 Ga0207654_10074909 Ga0207654_100749093 101
705 3300025911 Ga0207654_10348119 Ga0207654_103481192 101
706 3300025911 Ga0207654_11388909 Ga0207654_113889092 101
707 3300025912 Ga0207707_10064913 Ga0207707_100649134 101
708 3300025913 Ga0207695_10000033 Ga0207695_10000033130 101
709 3300025913 Ga0207695_10000811 Ga0207695_1000081143 101
710 3300025913 Ga0207695_10002522 Ga0207695_1000252210 101
711 3300025913 Ga0207695_10003038 Ga0207695_1000303825 101
712 3300025913 Ga0207695_10009508 Ga0207695_100095088 101
713 3300025913 Ga0207695_10010778 Ga0207695_100107782 101
714 3300025913 Ga0207695_10015564 Ga0207695_100155645 101
715 3300025913 Ga0207695_10048491 Ga0207695_100484914 101
716 3300025913 Ga0207695_10073143 Ga0207695_100731432 101
717 3300025913 Ga0207695_10372772 Ga0207695_103727722 101
718 3300025913 Ga0207695_10518226 Ga0207695_105182262 101
719 3300025913 Ga0207695_10645359 Ga0207695_106453592 101
720 3300025914 Ga0207671_10000020 Ga0207671_10000020299 101
721 3300025914 Ga0207671_10000116 Ga0207671_10000116115 101
722 3300025914 Ga0207671_10001713 Ga0207671_1000171314 101
723 3300025914 Ga0207671_10012021 Ga0207671_100120217 101
724 3300025914 Ga0207671_10012358 Ga0207671_100123584 101
725 3300025914 Ga0207671_10076983 Ga0207671_100769832 101
726 3300025914 Ga0207671_10169216 Ga0207671_101692161 101
727 3300025914 Ga0207671_10315292 Ga0207671_103152922 101
728 3300025914 Ga0207671_10469545 Ga0207671_104695452 101
729 3300025914 Ga0207671_10640721 Ga0207671_106407211 101
730 3300025914 Ga0207671_11105187 Ga0207671_111051872 101
731 3300025914 Ga0207671_11324007 Ga0207671_113240071 101
732 3300025915 Ga0207693_10275388 Ga0207693_102753882 101
733 3300025916 Ga0207663_10124228 Ga0207663_101242282 101
734 3300025917 Ga0207660_10839858 Ga0207660_108398582 101
735 3300025917 Ga0207660_11339242 Ga0207660_113392421 101
736 3300025919 Ga0207657_10007879 Ga0207657_100078792 101
737 3300025919 Ga0207657_10348016 Ga0207657_103480162 101
738 3300025919 Ga0207657_11127448 Ga0207657_111274482 101
739 3300025920 Ga0207649_10007346 Ga0207649_100073465 101
740 3300025920 Ga0207649_10012095 Ga0207649_100120953 101
741 3300025920 Ga0207649_10450764 Ga0207649_104507642 101
742 3300025920 Ga0207649_10484754 Ga0207649_104847542 101
743 3300025920 Ga0207649_10505985 Ga0207649_105059852 101
744 3300025920 Ga0207649_10593840 Ga0207649_105938402 101
745 3300025921 Ga0207652_10735412 Ga0207652_107354122 101
746 3300025921 Ga0207652_11109887 Ga0207652_111098871 101
747 3300025921 Ga0207652_11361130 Ga0207652_113611301 101
748 3300025923 Ga0207681_10321259 Ga0207681_103212592 101
749 3300025923 Ga0207681_11587823 Ga0207681_115878232 101
750 3300025924 Ga0207694_10000298 Ga0207694_1000029840 101
751 3300025924 Ga0207694_10000613 Ga0207694_1000061312 101
752 3300025924 Ga0207694_10002589 Ga0207694_100025897 101
753 3300025924 Ga0207694_10017252 Ga0207694_100172523 101
754 3300025924 Ga0207694_10052522 Ga0207694_100525225 101
755 3300025924 Ga0207694_10076987 Ga0207694_100769872 101
756 3300025924 Ga0207694_10097903 Ga0207694_100979032 101
757 3300025924 Ga0207694_10188934 Ga0207694_101889342 101
758 3300025924 Ga0207694_10199790 Ga0207694_101997902 101
759 3300025924 Ga0207694_10285197 Ga0207694_102851971 101
760 3300025924 Ga0207694_10588990 Ga0207694_105889902 101
761 3300025924 Ga0207694_10590678 Ga0207694_105906782 101
762 3300025924 Ga0207694_10770357 Ga0207694_107703572 101
763 3300025925 Ga0207650_10095582 Ga0207650_100955822 101
764 3300025925 Ga0207650_10318005 Ga0207650_103180052 101
765 3300025925 Ga0207650_10778652 Ga0207650_107786522 101
766 3300025925 Ga0207650_11085080 Ga0207650_110850802 101
767 3300025925 Ga0207650_11300762 Ga0207650_113007621 101
768 3300025926 Ga0207659_10532511 Ga0207659_105325112 101
769 3300025927 Ga0207687_10096129 Ga0207687_100961292 101
770 3300025927 Ga0207687_10363853 Ga0207687_103638532 101
771 3300025928 Ga0207700_10002543 Ga0207700_100025432 101
772 3300025928 Ga0207700_11025090 Ga0207700_110250902 101
773 3300025928 Ga0207700_11074043 Ga0207700_110740432 101
774 3300025929 Ga0207664_10002383 Ga0207664_100023835 101
775 3300025929 Ga0207664_10007284 Ga0207664_100072844 101
776 3300025929 Ga0207664_10213080 Ga0207664_102130802 101
777 3300025929 Ga0207664_10737564 Ga0207664_107375642 101
778 3300025931 Ga0207644_10001304 Ga0207644_100013045 101
779 3300025931 Ga0207644_10016173 Ga0207644_100161732 101
780 3300025931 Ga0207644_11766530 Ga0207644_117665301 101
781 3300025932 Ga0207690_10000967 Ga0207690_100009677 101
782 3300025932 Ga0207690_10093111 Ga0207690_100931113 101
783 3300025933 Ga0207706_10002270 Ga0207706_100022705 101
784 3300025933 Ga0207706_10077003 Ga0207706_100770032 101
785 3300025933 Ga0207706_10385216 Ga0207706_103852162 101
786 3300025933 Ga0207706_10533820 Ga0207706_105338202 101
787 3300025934 Ga0207686_10010245 Ga0207686_100102452 101
788 3300025936 Ga0207670_10192556 Ga0207670_101925563 101
789 3300025937 Ga0207669_11965142 Ga0207669_119651421 101
790 3300025938 Ga0207704_10103961 Ga0207704_101039612 101
791 3300025938 Ga0207704_10211891 Ga0207704_102118912 101
792 3300025938 Ga0207704_10215845 Ga0207704_102158452 101
793 3300025938 Ga0207704_10480609 Ga0207704_104806092 101
794 3300025938 Ga0207704_11852747 Ga0207704_118527471 101
795 3300025939 Ga0207665_11491561 Ga0207665_114915612 101
796 3300025939 Ga0207665_11641398 Ga0207665_116413981 101
797 3300025940 Ga0207691_10024143 Ga0207691_100241435 101
798 3300025940 Ga0207691_10038895 Ga0207691_100388953 101
799 3300025940 Ga0207691_10116249 Ga0207691_101162492 101
800 3300025940 Ga0207691_10417304 Ga0207691_104173043 101
801 3300025941 Ga0207711_10000503 Ga0207711_100005032 101
802 3300025941 Ga0207711_10125299 Ga0207711_101252992 101
803 3300025941 Ga0207711_10185512 Ga0207711_101855122 101
804 3300025941 Ga0207711_10473892 Ga0207711_104738922 101
805 3300025941 Ga0207711_10671405 Ga0207711_106714052 101
806 3300025941 Ga0207711_11369556 Ga0207711_113695562 101
807 3300025941 Ga0207711_11654523 Ga0207711_116545231 101
808 3300025942 Ga0207689_10077296 Ga0207689_100772963 101
809 3300025942 Ga0207689_10529262 Ga0207689_105292622 101
810 3300025944 Ga0207661_10834126 Ga0207661_108341262 101
811 3300025944 Ga0207661_11215245 Ga0207661_112152451 101
812 3300025945 Ga0207679_10652056 Ga0207679_106520561 101
813 3300025949 Ga0207667_10001535 Ga0207667_1000153526 101
814 3300025949 Ga0207667_10001609 Ga0207667_1000160929 101
815 3300025949 Ga0207667_10006791 Ga0207667_100067912 101
816 3300025949 Ga0207667_10019505 Ga0207667_100195054 101
817 3300025949 Ga0207667_10026092 Ga0207667_100260922 101
818 3300025949 Ga0207667_10037914 Ga0207667_100379143 101
819 3300025949 Ga0207667_10059529 Ga0207667_100595295 101
820 3300025949 Ga0207667_10261566 Ga0207667_102615662 101
821 3300025949 Ga0207667_10304225 Ga0207667_103042252 101
822 3300025949 Ga0207667_10591522 Ga0207667_105915222 101
823 3300025949 Ga0207667_10774748 Ga0207667_107747482 101
824 3300025949 Ga0207667_10931147 Ga0207667_109311472 101
825 3300025949 Ga0207667_11323449 Ga0207667_113234492 101
826 3300025960 Ga0207651_10195419 Ga0207651_101954192 101
827 3300025960 Ga0207651_10493390 Ga0207651_104933903 101
828 3300025960 Ga0207651_11539128 Ga0207651_115391282 101
829 3300025961 Ga0207712_10000277 Ga0207712_1000027717 101
830 3300025961 Ga0207712_10000477 Ga0207712_1000047731 101
831 3300025961 Ga0207712_10147728 Ga0207712_101477282 101
832 3300025972 Ga0207668_10011169 Ga0207668_100111693 101
833 3300025972 Ga0207668_10019520 Ga0207668_100195202 101
834 3300025972 Ga0207668_10075249 Ga0207668_100752492 101
835 3300025972 Ga0207668_10286079 Ga0207668_102860792 101
836 3300025972 Ga0207668_10626346 Ga0207668_106263462 101
837 3300025972 Ga0207668_10746716 Ga0207668_107467162 101
838 3300025981 Ga0207640_10002403 Ga0207640_100024032 101
839 3300025981 Ga0207640_10015095 Ga0207640_100150953 101
840 3300025981 Ga0207640_10016040 Ga0207640_100160405 101
841 3300025981 Ga0207640_10069799 Ga0207640_100697994 101
842 3300025981 Ga0207640_10148784 Ga0207640_101487843 101
843 3300025981 Ga0207640_10155151 Ga0207640_101551513 101
844 3300025981 Ga0207640_10461418 Ga0207640_104614182 101
845 3300025981 Ga0207640_11348161 Ga0207640_113481611 101
846 3300025986 Ga0207658_10000286 Ga0207658_1000028639 101
847 3300025986 Ga0207658_10007375 Ga0207658_100073752 101
848 3300025986 Ga0207658_10053046 Ga0207658_100530465 101
849 3300025986 Ga0207658_10058890 Ga0207658_100588902 101
850 3300025986 Ga0207658_10064327 Ga0207658_100643272 101
851 3300025986 Ga0207658_10101859 Ga0207658_101018594 101
852 3300025986 Ga0207658_10485862 Ga0207658_104858622 101
853 3300025986 Ga0207658_11119123 Ga0207658_111191232 101
854 3300025986 Ga0207658_11657165 Ga0207658_116571652 101
855 3300025986 Ga0207658_12078998 Ga0207658_120789982 101
856 3300026023 Ga0207677_10159632 Ga0207677_101596322 101
857 3300026023 Ga0207677_10179200 Ga0207677_101792002 101
858 3300026023 Ga0207677_10237178 Ga0207677_102371783 101
859 3300026023 Ga0207677_10241627 Ga0207677_102416272 101
860 3300026035 Ga0207703_10002250 Ga0207703_100022507 101
861 3300026035 Ga0207703_10046054 Ga0207703_100460542 101
862 3300026035 Ga0207703_10204383 Ga0207703_102043832 101
863 3300026035 Ga0207703_10478331 Ga0207703_104783312 101
864 3300026035 Ga0207703_10752524 Ga0207703_107525242 101
865 3300026041 Ga0207639_10000985 Ga0207639_1000098518 101
866 3300026041 Ga0207639_10006532 Ga0207639_100065322 101
867 3300026041 Ga0207639_10008937 Ga0207639_100089374 101
868 3300026041 Ga0207639_10017968 Ga0207639_100179683 101
869 3300026041 Ga0207639_10049869 Ga0207639_100498693 101
870 3300026041 Ga0207639_10056089 Ga0207639_100560892 101
871 3300026041 Ga0207639_10056123 Ga0207639_100561232 101
872 3300026041 Ga0207639_10269372 Ga0207639_102693723 101
873 3300026041 Ga0207639_10274797 Ga0207639_102747973 101
874 3300026041 Ga0207639_10441838 Ga0207639_104418382 101
875 3300026041 Ga0207639_10584979 Ga0207639_105849792 101
876 3300026041 Ga0207639_11384434 Ga0207639_113844342 101
877 3300026067 Ga0207678_10001305 Ga0207678_1000130528 101
878 3300026067 Ga0207678_10004417 Ga0207678_100044174 101
879 3300026067 Ga0207678_10010903 Ga0207678_100109037 101
880 3300026067 Ga0207678_10030009 Ga0207678_100300093 101
881 3300026067 Ga0207678_10101872 Ga0207678_101018724 101
882 3300026067 Ga0207678_10159552 Ga0207678_101595522 101
883 3300026067 Ga0207678_10174807 Ga0207678_101748073 101
884 3300026067 Ga0207678_10200544 Ga0207678_102005443 101
885 3300026067 Ga0207678_10987390 Ga0207678_109873902 101
886 3300026067 Ga0207678_11912761 Ga0207678_119127611 101
887 3300026078 Ga0207702_10000236 Ga0207702_1000023650 101
888 3300026078 Ga0207702_10010360 Ga0207702_100103603 101
889 3300026078 Ga0207702_10015281 Ga0207702_100152816 101
890 3300026078 Ga0207702_10072033 Ga0207702_100720335 101
891 3300026078 Ga0207702_10096660 Ga0207702_100966602 101
892 3300026078 Ga0207702_10331866 Ga0207702_103318662 101
893 3300026078 Ga0207702_10457507 Ga0207702_104575072 101
894 3300026078 Ga0207702_10553413 Ga0207702_105534132 101
895 3300026078 Ga0207702_10563356 Ga0207702_105633562 101
896 3300026078 Ga0207702_10815717 Ga0207702_108157172 101
897 3300026078 Ga0207702_11499820 Ga0207702_114998202 101
898 3300026088 Ga0207641_10010609 Ga0207641_100106098 101
899 3300026088 Ga0207641_10020369 Ga0207641_100203692 101
900 3300026088 Ga0207641_10131445 Ga0207641_101314452 101
901 3300026088 Ga0207641_10229076 Ga0207641_102290763 101
902 3300026088 Ga0207641_10291827 Ga0207641_102918273 101
903 3300026088 Ga0207641_10900498 Ga0207641_109004982 101
904 3300026088 Ga0207641_11225622 Ga0207641_112256222 101
905 3300026089 Ga0207648_10012324 Ga0207648_100123242 101
906 3300026089 Ga0207648_10117053 Ga0207648_101170533 101
907 3300026089 Ga0207648_10184374 Ga0207648_101843743 101
908 3300026089 Ga0207648_10253652 Ga0207648_102536522 101
909 3300026089 Ga0207648_11073968 Ga0207648_110739682 101
910 3300026089 Ga0207648_11828247 Ga0207648_118282472 101
911 3300026095 Ga0207676_10014128 Ga0207676_100141282 101
912 3300026095 Ga0207676_10815964 Ga0207676_108159642 101
913 3300026116 Ga0207674_10011044 Ga0207674_100110444 101
914 3300026116 Ga0207674_10086156 Ga0207674_100861562 101
915 3300026116 Ga0207674_10218763 Ga0207674_102187633 101
916 3300026116 Ga0207674_10416222 Ga0207674_104162222 101
917 3300026116 Ga0207674_10613119 Ga0207674_106131192 101
918 3300026116 Ga0207674_10874354 Ga0207674_108743542 101
919 3300026116 Ga0207674_10927205 Ga0207674_109272052 101
920 3300026118 Ga0207675_100196738 Ga0207675_1001967382 101
921 3300026118 Ga0207675_100212013 Ga0207675_1002120132 101
922 3300026118 Ga0207675_100319070 Ga0207675_1003190702 101
923 3300026118 Ga0207675_100627521 Ga0207675_1006275212 101
924 3300026118 Ga0207675_100684184 Ga0207675_1006841841 101
925 3300026118 Ga0207675_100831982 Ga0207675_1008319822 101
926 3300026121 Ga0207683_10048759 Ga0207683_100487593 101
927 3300026121 Ga0207683_10068547 Ga0207683_100685473 101
928 3300026121 Ga0207683_11623353 Ga0207683_116233532 101
929 3300026142 Ga0207698_10002901 Ga0207698_100029018 101
930 3300026142 Ga0207698_10020428 Ga0207698_100204284 101
931 3300026142 Ga0207698_10035977 Ga0207698_100359772 101
932 3300026142 Ga0207698_10096916 Ga0207698_100969162 101
933 3300026142 Ga0207698_10293017 Ga0207698_102930172 101
934 3300026142 Ga0207698_10438167 Ga0207698_104381672 101
935 3300026142 Ga0207698_10608010 Ga0207698_106080102 101
936 3300026142 Ga0207698_10984711 Ga0207698_109847112 101
937 3300026142 Ga0207698_11159987 Ga0207698_111599871 101
938 3300026142 Ga0207698_12602308 Ga0207698_126023082 101
939 3300027666 Ga0209282_1166348 Ga0209282_11663482 101
940 3300028016 Ga0265354_1001101 Ga0265354_10011012 101
941 3300028023 Ga0265357_1005008 Ga0265357_10050082 101
942 3300028379 Ga0268266_10000001 Ga0268266_100000013044 101
943 3300028379 Ga0268266_10000006 Ga0268266_10000006211 101
944 3300028379 Ga0268266_10000021 Ga0268266_10000021483 101
945 3300028379 Ga0268266_10038420 Ga0268266_100384204 101
946 3300028379 Ga0268266_10126426 Ga0268266_101264262 101
947 3300028379 Ga0268266_10624948 Ga0268266_106249482 101
948 3300028379 Ga0268266_11777700 Ga0268266_117777002 101
949 3300028379 Ga0268266_11825168 Ga0268266_118251681 101
950 3300028380 Ga0268265_10000705 Ga0268265_1000070526 101
951 3300028380 Ga0268265_10671110 Ga0268265_106711102 101
952 3300028381 Ga0268264_10011847 Ga0268264_100118472 101
953 3300028381 Ga0268264_10014826 Ga0268264_100148262 101
954 3300028381 Ga0268264_10052860 Ga0268264_100528602 101
955 3300028381 Ga0268264_10450780 Ga0268264_104507802 101
956 3300028381 Ga0268264_10769172 Ga0268264_107691722 101
957 3300028786 Ga0307517_10339098 Ga0307517_103390982 101
958 3300028786 Ga0307517_10354081 Ga0307517_103540812 101
959 3300028794 Ga0307515_10160864 Ga0307515_101608642 101
960 3300028794 Ga0307515_10203513 Ga0307515_102035134 101
961 3300028800 Ga0265338_10340845 Ga0265338_103408452 101
962 3300030878 Ga0265770_1000647 Ga0265770_10006475 101
963 3300031090 Ga0265760_10016048 Ga0265760_100160483 101
964 3300031090 Ga0265760_10227465 Ga0265760_102274652 101
965 3300031238 Ga0265332_10000014 Ga0265332_1000001485 101
966 3300031239 Ga0265328_10006973 Ga0265328_100069735 101
967 3300031249 Ga0265339_10126686 Ga0265339_101266863 101
968 3300031250 Ga0265331_10008554 Ga0265331_100085542 101
969 3300031251 Ga0265327_10000133 Ga0265327_1000013379 101
970 3300031251 Ga0265327_10057675 Ga0265327_100576753 101
971 3300031251 Ga0265327_10176840 Ga0265327_101768402 101
972 3300031456 Ga0307513_10013810 Ga0307513_100138102 101
973 3300031456 Ga0307513_10315870 Ga0307513_103158702 101
974 3300031456 Ga0307513_10615359 Ga0307513_106153592 101
975 3300031507 Ga0307509_10799411 Ga0307509_107994112 101
976 3300031548 Ga0307408_100186114 Ga0307408_1001861142 101
977 3300031548 Ga0307408_100401588 Ga0307408_1004015882 101
978 3300031548 Ga0307408_101265687 Ga0307408_1012656872 101
979 3300031616 Ga0307508_10058708 Ga0307508_100587082 101
980 3300031616 Ga0307508_10157395 Ga0307508_101573953 101
981 3300031616 Ga0307508_10395627 Ga0307508_103956272 101
982 3300031665 Ga0316575_10018091 Ga0316575_100180913 101
983 3300031665 Ga0316575_10041535 Ga0316575_100415353 101
984 3300031691 Ga0316579_10048118 Ga0316579_100481182 101
985 3300031727 Ga0316576_10013894 Ga0316576_100138942 101
986 3300031727 Ga0316576_10177082 Ga0316576_101770822 101
987 3300031728 Ga0316578_10024244 Ga0316578_100242442 101
988 3300031728 Ga0316578_10640072 Ga0316578_106400722 101
989 3300031730 Ga0307516_10019050 Ga0307516_100190502 101
990 3300031730 Ga0307516_10089609 Ga0307516_100896092 101
991 3300031730 Ga0307516_10152544 Ga0307516_101525442 101
992 3300031730 Ga0307516_10512331 Ga0307516_105123312 101
993 3300031733 Ga0316577_10027318 Ga0316577_100273184 101
994 3300031824 Ga0307413_10146940 Ga0307413_101469404 101
995 3300031824 Ga0307413_10547360 Ga0307413_105473602 101
996 3300031824 Ga0307413_11084950 Ga0307413_110849502 101
997 3300031824 Ga0307413_11312917 Ga0307413_113129171 101
998 3300031852 Ga0307410_10081792 Ga0307410_100817924 101
999 3300031852 Ga0307410_10727488 Ga0307410_107274882 101
1000 3300031852 Ga0307410_11439453 Ga0307410_114394532 101
1001 3300031852 Ga0307410_11848036 Ga0307410_118480361 101
1002 3300031901 Ga0307406_10007341 Ga0307406_100073412 101
1003 3300031901 Ga0307406_10228302 Ga0307406_102283023 101
1004 3300031901 Ga0307406_10697107 Ga0307406_106971072 101
1005 3300031903 Ga0307407_10122594 Ga0307407_101225943 101
1006 3300031903 Ga0307407_10795982 Ga0307407_107959821 101
1007 3300031911 Ga0307412_10017785 Ga0307412_100177854 101
1008 3300031911 Ga0307412_10073645 Ga0307412_100736452 101
1009 3300031911 Ga0307412_10108346 Ga0307412_101083464 101
1010 3300031911 Ga0307412_11264630 Ga0307412_112646301 101
1011 3300031995 Ga0307409_100357217 Ga0307409_1003572172 101
1012 3300031995 Ga0307409_101913936 Ga0307409_1019139362 101
1013 3300032002 Ga0307416_100594499 Ga0307416_1005944991 101
1014 3300032002 Ga0307416_103550834 Ga0307416_1035508342 101
1015 3300032004 Ga0307414_10001343 Ga0307414_100013439 101
1016 3300032004 Ga0307414_10001931 Ga0307414_100019314 101
1017 3300032004 Ga0307414_10218311 Ga0307414_102183113 101
1018 3300032004 Ga0307414_10292332 Ga0307414_102923322 101
1019 3300032004 Ga0307414_10647718 Ga0307414_106477182 101
1020 3300032004 Ga0307414_11016815 Ga0307414_110168152 101
1021 3300032005 Ga0307411_10161813 Ga0307411_101618133 101
1022 3300032005 Ga0307411_10190249 Ga0307411_101902492 101
1023 3300032005 Ga0307411_10288321 Ga0307411_102883212 101
1024 3300032126 Ga0307415_100410422 Ga0307415_1004104223 101
1025 3300032133 Ga0316583_10003935 Ga0316583_100039355 101
1026 3300032139 Ga0316580_10008155 Ga0316580_100081552 101
1027 3300033180 Ga0307510_10005227 Ga0307510_100052272 101
1028 3300034820 Ga0373959_0122785 Ga0373959_0122785_148_453 101
1029 3300035086 Ga0373934_0134767 Ga0373934_0134767_305_625 101
1030 3300035171 Ga0373946_0202653 Ga0373946_0202653_293_613 101
1031 3300035398 Ga0316574_0125565 Ga0316574_0125565_836_1141 101
1032 3300035398 Ga0316574_0177539 Ga0316574_0177539_298_603 101
1033 3300035398 Ga0316574_0439550 Ga0316574_0439550_465_770 101
1034 3300035398 Ga0316574_0595268 Ga0316574_0595268_121_426 101
1035 3300035695 Ga0373927_0601176 Ga0373927_0601176_103_408 101
1036 3300035695 Ga0373927_0758943 Ga0373927_0758943_229_549 101
1037 3300035724 Ga0373933_0359882 Ga0373933_0359882_516_836 101
1038 3300035725 Ga0373947_0452000 Ga0373947_0452000_203_511 101
1039 3300036401 Ga0373937_0006210 Ga0373937_0006210_175_495 101
1040 3300036401 Ga0373937_0101909 Ga0373937_0101909_2172_2486 101
1041 3300036401 Ga0373937_0864054 Ga0373937_0864054_404_721 101
1042 3300036647 Ga0316582_0002013 Ga0316582_0002013_1627_1932 101
1043 3300036647 Ga0316582_0007984 Ga0316582_0007984_1285_1590 101
1044 3300036647 Ga0316582_0042210 Ga0316582_0042210_1911_2216 101
1045 3300036647 Ga0316582_0393451 Ga0316582_0393451_308_613 101
1046 3300036712 Ga0316584_0002192 Ga0316584_0002192_3219_3524 101
1047 3300037068 Ga0373925_1217269 Ga0373925_1217269_257_571 101
1048 3300037312 Ga0395899_0000133 Ga0395899_0000133_108758_109063 101
1049 3300037312 Ga0395899_0016504 Ga0395899_0016504_4314_4637 101
1050 3300037312 Ga0395899_0042325 Ga0395899_0042325_2652_2957 101
1051 3300037312 Ga0395899_0057173 Ga0395899_0057173_1345_1650 101
1052 3300037312 Ga0395899_0073593 Ga0395899_0073593_1736_2041 101
1053 3300037312 Ga0395899_0288128 Ga0395899_0288128_656_979 101
1054 3300037418 Ga0395900_0000051 Ga0395900_0000051_7405_7710 101
1055 3300037418 Ga0395900_0000061 Ga0395900_0000061_176619_176924 101
1056 3300037418 Ga0395900_0114528 Ga0395900_0114528_525_848 101
1057 3300037418 Ga0395900_0219392 Ga0395900_0219392_1490_1795 101
1058 3300037418 Ga0395900_0338283 Ga0395900_0338283_849_1172 101
1059 3300037466 Ga0395898_0000034 Ga0395898_0000034_122051_122356 101
1060 3300037466 Ga0395898_0000197 Ga0395898_0000197_76319_76624 101
1061 3300037466 Ga0395898_0007788 Ga0395898_0007788_1736_2041 101
1062 3300037466 Ga0395898_0011319 Ga0395898_0011319_7347_7652 101
1063 3300037466 Ga0395898_0014517 Ga0395898_0014517_1320_1625 101
1064 3300037466 Ga0395898_0179719 Ga0395898_0179719_596_919 101
1065 3300037466 Ga0395898_0669998 Ga0395898_0669998_63_380 101
1066 3300037466 Ga0395898_0777540 Ga0395898_0777540_24_332 101
1067 3300037471 Ga0395905_0000306 Ga0395905_0000306_65058_65381 101
1068 3300037471 Ga0395905_0140120 Ga0395905_0140120_214_537 101
1069 3300037471 Ga0395905_0340379 Ga0395905_0340379_815_1120 101
1070 3300037471 Ga0395905_0537682 Ga0395905_0537682_531_854 101
1071 3300037471 Ga0395905_1138998 Ga0395905_1138998_46_369 101
1072 3300037588 Ga0316581_0006306 Ga0316581_0006306_1948_2253 101
1073 3300038443 Ga0395901_0003676 Ga0395901_0003676_6010_6315 101
1074 3300038443 Ga0395901_0009076 Ga0395901_0009076_7023_7346 101
1075 3300038443 Ga0395901_0727221 Ga0395901_0727221_137_442 101
1076 3300038443 Ga0395901_1854495 Ga0395901_1854495_123_440 101
1077 3300038443 Ga0395901_1938550 Ga0395901_1938550_11_316 101
1078 3300039447 Ga0436361_0190082 Ga0436361_0190082_35_340 101
1079 3300039450 Ga0436363_0368017 Ga0436363_0368017_108_413 101
1080 3300041404 Ga0439436_0000008 Ga0439436_0000008_8956_9261 101
1081 3300041404 Ga0439436_0015857 Ga0439436_0015857_446_751 101
1082 3300041404 Ga0439436_0022021 Ga0439436_0022021_406_732 101
1083 3300041404 Ga0439436_0024041 Ga0439436_0024041_1027_1353 101
1084 3300041404 Ga0439436_0063701 Ga0439436_0063701_82_405 101
1085 3300041404 Ga0439436_0077543 Ga0439436_0077543_264_569 101
1086 3300041407 Ga0439447_007836 Ga0439447_007836_2154_2480 101
1087 3300041411 Ga0439466_0229527 Ga0439466_0229527_87_410 101
1088 3300041413 Ga0439465_0008559 Ga0439465_0008559_866_1192 101
1089 3300041413 Ga0439465_0012695 Ga0439465_0012695_1825_2130 101
1090 3300041413 Ga0439465_0029794 Ga0439465_0029794_543_848 101
1091 3300041413 Ga0439465_0255027 Ga0439465_0255027_67_390 101
1092 3300041441 Ga0451787_760046 Ga0451787_760046_724_1029 101
1093 3300041443 Ga0451789_0480807 Ga0451789_0480807_278_598 101
1094 3300041443 Ga0451789_0594797 Ga0451789_0594797_354_659 101
1095 3300041443 Ga0451789_1201078 Ga0451789_1201078_142_447 101
1096 3300041443 Ga0451789_1206445 Ga0451789_1206445_184_489 101
1097 3300041451 Ga0451791_1110733 Ga0451791_1110733_892_1197 101
1098 3300041452 Ga0451793_0136894 Ga0451793_0136894_432_737 101
1099 3300041452 Ga0451793_1283171 Ga0451793_1283171_219_524 101
1100 3300041452 Ga0451793_1723166 Ga0451793_1723166_724_1029 101
1101 3300041453 Ga0451797_0719793 Ga0451797_0719793_24_329 101
1102 3300041453 Ga0451797_0839044 Ga0451797_0839044_103_408 101
1103 3300041456 Ga0451795_1164357 Ga0451795_1164357_409_714 101
1104 3300041456 Ga0451795_1565558 Ga0451795_1565558_54_359 101
1105 3300041458 Ga0451798_0160268 Ga0451798_0160268_300_605 101
1106 3300041459 Ga0451800_0410448 Ga0451800_0410448_92_397 101
1107 3300041459 Ga0451800_0506376 Ga0451800_0506376_48_353 101
1108 3300041459 Ga0451800_1459324 Ga0451800_1459324_100_420 101
1109 3300041460 Ga0451802_0744649 Ga0451802_0744649_580_885 101
1110 3300041460 Ga0451802_1852954 Ga0451802_1852954_106_411 101
1111 3300041463 Ga0451804_0003308 Ga0451804_0003308_225_530 101
1112 3300041463 Ga0451804_0340235 Ga0451804_0340235_524_832 101
1113 3300041486 Ga0451807_1507964 Ga0451807_1507964_301_606 101
1114 3300041486 Ga0451807_1589376 Ga0451807_1589376_228_533 101
1115 3300041486 Ga0451807_1924293 Ga0451807_1924293_33_338 101
1116 3300041486 Ga0451807_2135600 Ga0451807_2135600_301_606 101
1117 3300041486 Ga0451807_2735494 Ga0451807_2735494_414_719 101
1118 3300041491 Ga0451833_0532987 Ga0451833_0532987_87_392 101
1119 3300041491 Ga0451833_0951430 Ga0451833_0951430_520_825 101
1120 3300041492 Ga0451835_0367031 Ga0451835_0367031_93_398 101
1121 3300041494 Ga0451837_0103295 Ga0451837_0103295_376_699 101
1122 3300041494 Ga0451837_0244838 Ga0451837_0244838_601_924 101
1123 3300041494 Ga0451837_1610330 Ga0451837_1610330_307_630 101
1124 3300041498 Ga0451841_1138043 Ga0451841_1138043_168_473 101
1125 3300041505 Ga0451849_0244638 Ga0451849_0244638_64_375 101
1126 3300041505 Ga0451849_0355062 Ga0451849_0355062_303_608 101
1127 3300041505 Ga0451849_1085578 Ga0451849_1085578_10_333 101
1128 3300041507 Ga0451851_0574422 Ga0451851_0574422_273_578 101
1129 3300041509 Ga0451843_0007405 Ga0451843_0007405_133_438 101
1130 3300041509 Ga0451843_0905268 Ga0451843_0905268_400_705 101
1131 3300041509 Ga0451843_1073184 Ga0451843_1073184_45_368 101
1132 3300041509 Ga0451843_1682121 Ga0451843_1682121_388_711 101
1133 3300041512 Ga0451853_1071901 Ga0451853_1071901_166_471 101
1134 3300041512 Ga0451853_2123261 Ga0451853_2123261_171_497 101
1135 3300041512 Ga0451853_2493278 Ga0451853_2493278_430_735 101
1136 3300041512 Ga0451853_2583559 Ga0451853_2583559_177_482 101
1137 3300041512 Ga0451853_2935955 Ga0451853_2935955_411_716 101
1138 3300041512 Ga0451853_3209840 Ga0451853_3209840_25_330 101
1139 3300041997 Ga0439431_0011423 Ga0439431_0011423_784_1089 101
1140 3300041999 Ga0439433_0014340 Ga0439433_0014340_662_988 101
1141 3300042004 Ga0439445_0027544 Ga0439445_0027544_711_1016 101
1142 3300042004 Ga0439445_0029548 Ga0439445_0029548_184_510 101
1143 3300042004 Ga0439445_0101561 Ga0439445_0101561_319_642 101
1144 3300042007 Ga0439449_0004432 Ga0439449_0004432_3851_4174 101
1145 3300042007 Ga0439449_0005563 Ga0439449_0005563_482_787 101
1146 3300042007 Ga0439449_0011023 Ga0439449_0011023_1682_1987 101
1147 3300042007 Ga0439449_0011092 Ga0439449_0011092_2708_3031 101
1148 3300042007 Ga0439449_0017334 Ga0439449_0017334_1891_2217 101
1149 3300042007 Ga0439449_0041485 Ga0439449_0041485_230_556 101
1150 3300042007 Ga0439449_0078816 Ga0439449_0078816_424_750 101
1151 3300042007 Ga0439449_0304020 Ga0439449_0304020_164_490 101
1152 3300042010 Ga0439452_078748 Ga0439452_078748_311_634 101
1153 3300042014 Ga0439457_045877 Ga0439457_045877_302_607 101
1154 3300042015 Ga0439462_0058894 Ga0439462_0058894_696_1022 101
1155 3300042015 Ga0439462_0089731 Ga0439462_0089731_145_468 101
1156 3300042015 Ga0439462_0095941 Ga0439462_0095941_52_357 101
1157 3300042156 Ga0439446_0177495 Ga0439446_0177495_206_511 101
1158 3300042157 Ga0439458_0131439 Ga0439458_0131439_300_605 101
1159 3300042184 Ga0450908_002779 Ga0450908_002779_2583_2888 101
1160 3300042435 Ga0439434_0147624 Ga0439434_0147624_288_611 101
1161 3300042438 Ga0439459_0006149 Ga0439459_0006149_907_1212 101
1162 3300042438 Ga0439459_0085371 Ga0439459_0085371_19_324 101
1163 3300042876 Ga0451577_0149158 Ga0451577_0149158_336_644 101
1164 3300042876 Ga0451577_0501910 Ga0451577_0501910_451_756 101
1165 3300044656 Ga0466969_0001457 Ga0466969_0001457_868_1173 101
1166 3300044656 Ga0466969_0039210 Ga0466969_0039210_2029_2334 101
1167 3300044656 Ga0466969_0055973 Ga0466969_0055973_1358_1663 101
1168 3300044658 Ga0466972_0000555 Ga0466972_0000555_7392_7697 101
1169 3300044658 Ga0466972_0043049 Ga0466972_0043049_1512_1817 101
1170 3300044672 Ga0466982_0000026 Ga0466982_0000026_32858_33163 101
1171 3300044672 Ga0466982_0004003 Ga0466982_0004003_2211_2516 101
1172 3300044683 Ga0466965_0001099 Ga0466965_0001099_8002_8307 101
1173 3300044683 Ga0466965_0046974 Ga0466965_0046974_1306_1611 101
1174 3300044684 Ga0466966_0005830 Ga0466966_0005830_1870_2175 101
1175 3300044684 Ga0466966_0012407 Ga0466966_0012407_4897_5202 101
1176 3300044684 Ga0466966_0695670 Ga0466966_0695670_92_397 101
1177 3300044693 Ga0466961_0010278 Ga0466961_0010278_4608_4913 101
1178 3300044693 Ga0466961_0035544 Ga0466961_0035544_2071_2376 101
1179 3300044693 Ga0466961_0118349 Ga0466961_0118349_705_1010 101
1180 3300044693 Ga0466961_0127822 Ga0466961_0127822_481_786 101
1181 3300044706 Ga0466964_0011285 Ga0466964_0011285_2892_3197 101
1182 3300044706 Ga0466964_0130651 Ga0466964_0130651_670_975 101
1183 3300044712 Ga0453684_0001089 Ga0453684_0001089_5788_6093 101
1184 3300044712 Ga0453684_0144356 Ga0453684_0144356_443_751 101
1185 3300044719 Ga0466971_0001957 Ga0466971_0001957_133_438 101
1186 3300044719 Ga0466971_0068841 Ga0466971_0068841_377_682 101
1187 3300044719 Ga0466971_0103735 Ga0466971_0103735_489_794 101
1188 3300044719 Ga0466971_0257274 Ga0466971_0257274_144_449 101
1189 3300044735 Ga0466968_0003504 Ga0466968_0003504_1013_1318 101
1190 3300044735 Ga0466968_0004304 Ga0466968_0004304_1992_2297 101
1191 3300044765 Ga0466970_0000637 Ga0466970_0000637_8551_8856 101
1192 3300044765 Ga0466970_0006813 Ga0466970_0006813_3629_3934 101
1193 3300044765 Ga0466970_0043358 Ga0466970_0043358_811_1116 101
1194 3300044765 Ga0466970_0098456 Ga0466970_0098456_47_352 101
1195 3300044765 Ga0466970_0516756 Ga0466970_0516756_11_316 101
1196 3300044842 Ga0466957_0005542 Ga0466957_0005542_4098_4403 101
1197 3300044842 Ga0466957_0030562 Ga0466957_0030562_837_1142 101
1198 3300044842 Ga0466957_0351074 Ga0466957_0351074_304_609 101
1199 3300044842 Ga0466957_0611920 Ga0466957_0611920_406_711 101
1200 3300044842 Ga0466957_0784745 Ga0466957_0784745_314_619 101
1201 3300044901 Ga0466960_0009574 Ga0466960_0009574_1936_2241 101
1202 3300044901 Ga0466960_0243814 Ga0466960_0243814_220_525 101
1203 3300045049 Ga0466959_0019992 Ga0466959_0019992_2077_2382 101
1204 3300045049 Ga0466959_0022705 Ga0466959_0022705_3119_3424 101
1205 3300045049 Ga0466959_0156385 Ga0466959_0156385_799_1104 101
1206 3300045051 Ga0451576_0000201 Ga0451576_0000201_69983_70288 101
1207 3300045051 Ga0451576_0505280 Ga0451576_0505280_255_563 101
1208 3300045836 Ga0466958_0014964 Ga0466958_0014964_3023_3328 101
1209 3300045836 Ga0466958_0119060 Ga0466958_0119060_1033_1338 101
1210 3300045976 Ga0466967_0182733 Ga0466967_0182733_1310_1615 101
1211 3300045976 Ga0466967_0437907 Ga0466967_0437907_619_924 101
1212 3300045976 Ga0466967_0796184 Ga0466967_0796184_506_811 101
1213 3300046452 Ga0495617_000424 Ga0495617_000424_21489_21794 101
1214 3300046459 Ga0495629_0048970 Ga0495629_0048970_434_754 101
1215 3300046460 Ga0495638_0000146 Ga0495638_0000146_77448_77753 101
1216 3300046460 Ga0495638_0001668 Ga0495638_0001668_5071_5376 101
1217 3300046460 Ga0495638_0001669 Ga0495638_0001669_18116_18421 101
1218 3300046460 Ga0495638_0073075 Ga0495638_0073075_1445_1771 101
1219 3300046460 Ga0495638_0172342 Ga0495638_0172342_297_602 101
1220 3300046461 Ga0495641_0031745 Ga0495641_0031745_375_680 101
1221 3300046462 Ga0495651_0414840 Ga0495651_0414840_320_637 101
1222 3300046471 Ga0495650_0002509 Ga0495650_0002509_5372_5677 101
1223 3300046471 Ga0495650_0006285 Ga0495650_0006285_2775_3080 101
1224 3300046472 Ga0495580_0145919 Ga0495580_0145919_877_1197 101
1225 3300046473 Ga0495582_0029608 Ga0495582_0029608_1822_2142 101
1226 3300046477 Ga0495664_0204018 Ga0495664_0204018_830_1150 101
1227 3300046491 Ga0495584_0258950 Ga0495584_0258950_534_839 101
1228 3300046492 Ga0495585_0004990 Ga0495585_0004990_436_741 101
1229 3300046501 Ga0495607_0001360 Ga0495607_0001360_13038_13343 101
1230 3300046501 Ga0495607_0015098 Ga0495607_0015098_1065_1370 101
1231 3300046506 Ga0495583_0016180 Ga0495583_0016180_2038_2343 101
1232 3300046507 Ga0495606_0001823 Ga0495606_0001823_3042_3347 101
1233 3300046507 Ga0495606_0009315 Ga0495606_0009315_6060_6365 101
1234 3300046507 Ga0495606_0112071 Ga0495606_0112071_1004_1309 101
1235 3300046512 Ga0495610_0007268 Ga0495610_0007268_3101_3406 101
1236 3300046512 Ga0495610_0218642 Ga0495610_0218642_172_477 101
1237 3300046513 Ga0495616_0000400 Ga0495616_0000400_26703_27008 101
1238 3300046515 Ga0495620_0111880 Ga0495620_0111880_50_355 101
1239 3300046517 Ga0495630_0084401 Ga0495630_0084401_1159_1479 101
1240 3300046517 Ga0495630_0301731 Ga0495630_0301731_443_763 101
1241 3300046518 Ga0495631_0003067 Ga0495631_0003067_6574_6879 101
1242 3300046518 Ga0495631_0004987 Ga0495631_0004987_5366_5671 101
1243 3300046519 Ga0495632_0000004 Ga0495632_0000004_361723_362028 101
1244 3300046519 Ga0495632_0006481 Ga0495632_0006481_6781_7086 101
1245 3300046520 Ga0495637_0081900 Ga0495637_0081900_206_511 101
1246 3300046522 Ga0495643_0111285 Ga0495643_0111285_712_1017 101
1247 3300046522 Ga0495643_0147056 Ga0495643_0147056_532_837 101
1248 3300046524 Ga0495648_0069715 Ga0495648_0069715_1326_1631 101
1249 3300046525 Ga0495663_0000892 Ga0495663_0000892_8729_9034 101
1250 3300046531 Ga0495665_0036191 Ga0495665_0036191_782_1102 101
1251 3300046538 Ga0495609_0013644 Ga0495609_0013644_2882_3187 101
1252 3300046543 Ga0495645_0654105 Ga0495645_0654105_253_558 101
1253 3300046557 Ga0495622_0011411 Ga0495622_0011411_408_713 101
1254 3300046557 Ga0495622_0418385 Ga0495622_0418385_54_359 101
1255 3300046558 Ga0495633_0283714 Ga0495633_0283714_246_551 101
1256 3300046615 Ga0495656_0006219 Ga0495656_0006219_762_1088 101
1257 3300046616 Ga0495668_0004286 Ga0495668_0004286_8830_9156 101
1258 3300046616 Ga0495668_0133484 Ga0495668_0133484_576_881 101
1259 3300046648 Ga0495611_0000001 Ga0495611_0000001_1894764_1895069 101
1260 3300046660 Ga0495625_0000001 Ga0495625_0000001_20982_21287 101
1261 3300046660 Ga0495625_0108723 Ga0495625_0108723_1114_1419 101
1262 3300046660 Ga0495625_0655523 Ga0495625_0655523_186_491 101
1263 3300046663 Ga0495635_0550182 Ga0495635_0550182_254_574 101
1264 3300046663 Ga0495635_1015615 Ga0495635_1015615_109_429 101
1265 3300046665 Ga0495661_0004892 Ga0495661_0004892_1964_2269 101
1266 3300046675 Ga0495657_0090211 Ga0495657_0090211_415_732 101
1267 3300046675 Ga0495657_0819728 Ga0495657_0819728_180_500 101
1268 3300046678 Ga0495599_0178684 Ga0495599_0178684_409_726 101
1269 3300046680 Ga0495646_0405921 Ga0495646_0405921_167_487 101
1270 3300046681 Ga0495647_0004669 Ga0495647_0004669_4046_4366 101
1271 3300046683 Ga0495658_0004687 Ga0495658_0004687_2412_2732 101
1272 3300046683 Ga0495658_0277291 Ga0495658_0277291_642_947 101
1273 3300046691 Ga0495670_0009378 Ga0495670_0009378_1354_1659 101
1274 3300046691 Ga0495670_0079774 Ga0495670_0079774_508_813 101
1275 3300046691 Ga0495670_0285950 Ga0495670_0285950_400_726 101
1276 3300046692 Ga0495671_0004084 Ga0495671_0004084_2022_2327 101
1277 3300046692 Ga0495671_0128936 Ga0495671_0128936_502_807 101
1278 3300046694 Ga0495649_0000218 Ga0495649_0000218_47287_47592 101
1279 3300046694 Ga0495649_0078862 Ga0495649_0078862_593_898 101
1280 3300046794 Ga0495589_0000236 Ga0495589_0000236_2815_3120 101
1281 3300046809 Ga0495600_0159578 Ga0495600_0159578_774_1094 101
1282 3300046810 Ga0495660_0000792 Ga0495660_0000792_6010_6315 101
1283 3300046810 Ga0495660_0001210 Ga0495660_0001210_437_742 101
1284 3300047318 Ga0495636_0003683 Ga0495636_0003683_2150_2476 101
1285 3300047319 Ga0495674_0439601 Ga0495674_0439601_433_753 101
1286 3300047322 Ga0495680_0209275 Ga0495680_0209275_496_801 101
1287 3300047323 Ga0495683_0001237 Ga0495683_0001237_15503_15808 101
1288 3300047446 Ga0495679_000004 Ga0495679_000004_67544_67849 101
1289 3300047469 Ga0495673_0000294 Ga0495673_0000294_9416_9721 101
1290 3300047469 Ga0495673_0000670 Ga0495673_0000670_8373_8678 101
1291 3300047471 Ga0495684_0065836 Ga0495684_0065836_390_710 101
1292 3300047472 Ga0495686_0000017 Ga0495686_0000017_452_757 101
1293 3300047472 Ga0495686_0002339 Ga0495686_0002339_2492_2797 101
1294 3300047472 Ga0495686_0327251 Ga0495686_0327251_507_812 101
1295 3300048089 Ga0495614_0660955 Ga0495614_0660955_112_432 101
1296 3300048903 Ga0496100_0019061 Ga0496100_0019061_3287_3592 101
1297 3300048903 Ga0496100_0145854 Ga0496100_0145854_1052_1375 101
1298 3300048903 Ga0496100_0985182 Ga0496100_0985182_233_538 101
1299 3300048904 Ga0496101_0031070 Ga0496101_0031070_141_446 101
1300 3300048904 Ga0496101_0048869 Ga0496101_0048869_303_608 101
1301 3300048905 Ga0496102_0226685 Ga0496102_0226685_69_374 101
1302 3300048905 Ga0496102_0298877 Ga0496102_0298877_808_1113 101
1303 3300048906 Ga0496103_0997285 Ga0496103_0997285_150_455 101
1304 3300048907 Ga0496104_0000011 Ga0496104_0000011_354178_354498 101
1305 3300048907 Ga0496104_0058290 Ga0496104_0058290_935_1240 101
1306 3300048908 Ga0496105_0000015 Ga0496105_0000015_165344_165664 101
1307 3300048908 Ga0496105_0002678 Ga0496105_0002678_5108_5413 101
1308 3300048908 Ga0496105_0216774 Ga0496105_0216774_957_1280 101
1309 3300048908 Ga0496105_0869095 Ga0496105_0869095_160_465 101
1310 3300048908 Ga0496105_1253327 Ga0496105_1253327_64_369 101
1311 3300048909 Ga0496106_0005633 Ga0496106_0005633_8706_9011 101
1312 3300048909 Ga0496106_0099345 Ga0496106_0099345_547_852 101
1313 3300048909 Ga0496106_0345914 Ga0496106_0345914_609_914 101
1314 3300048909 Ga0496106_0450830 Ga0496106_0450830_465_770 101
1315 3300048910 Ga0496107_0361760 Ga0496107_0361760_442_747 101
1316 3300048910 Ga0496107_0621966 Ga0496107_0621966_66_371 101
1317 3300048911 Ga0496108_0655326 Ga0496108_0655326_361_666 101
1318 3300048912 Ga0496109_0076379 Ga0496109_0076379_809_1132 101
1319 3300048912 Ga0496109_0954675 Ga0496109_0954675_260_565 101
1320 3300048914 Ga0496111_0514662 Ga0496111_0514662_209_532 101
1321 3300048915 Ga0496112_0096940 Ga0496112_0096940_97_420 101
1322 3300048915 Ga0496112_1306029 Ga0496112_1306029_89_394 101
1323 3300048916 Ga0496113_0003563 Ga0496113_0003563_6680_6985 101
1324 3300048916 Ga0496113_0032634 Ga0496113_0032634_1612_1935 101
1325 3300048916 Ga0496113_1471177 Ga0496113_1471177_29_334 101
1326 3300048917 Ga0496114_0267913 Ga0496114_0267913_874_1179 101
1327 3300048917 Ga0496114_1501167 Ga0496114_1501167_25_330 101
1328 3300048918 Ga0496115_0000275 Ga0496115_0000275_6721_7026 101
1329 3300048918 Ga0496115_0110062 Ga0496115_0110062_1341_1646 101
1330 3300048918 Ga0496115_0825272 Ga0496115_0825272_190_495 101
1331 3300048919 Ga0496116_0050219 Ga0496116_0050219_1217_1522 101
1332 3300048919 Ga0496116_0057217 Ga0496116_0057217_218_523 101
1333 3300048919 Ga0496116_0107805 Ga0496116_0107805_1330_1635 101
1334 3300048920 Ga0496117_0011886 Ga0496117_0011886_2449_2754 101
1335 3300048920 Ga0496117_0028477 Ga0496117_0028477_859_1164 101
1336 3300048920 Ga0496117_0098806 Ga0496117_0098806_1197_1502 101
1337 3300048921 Ga0496118_0001213 Ga0496118_0001213_5519_5824 101
1338 3300048921 Ga0496118_0003656 Ga0496118_0003656_17997_18302 101
1339 3300048921 Ga0496118_0008630 Ga0496118_0008630_9386_9691 101
1340 3300048921 Ga0496118_0048646 Ga0496118_0048646_757_1062 101
1341 3300048921 Ga0496118_0054037 Ga0496118_0054037_1029_1334 101
1342 3300048921 Ga0496118_0112067 Ga0496118_0112067_1034_1339 101
1343 3300048922 Ga0496119_0001455 Ga0496119_0001455_6998_7303 101
1344 3300048922 Ga0496119_0047502 Ga0496119_0047502_2093_2398 101
1345 3300048922 Ga0496119_0270371 Ga0496119_0270371_148_453 101
1346 3300048923 Ga0496120_0002097 Ga0496120_0002097_14274_14579 101
1347 3300048923 Ga0496120_0017747 Ga0496120_0017747_3817_4122 101
1348 3300048924 Ga0496121_0000045 Ga0496121_0000045_157193_157498 101
1349 3300048924 Ga0496121_0007647 Ga0496121_0007647_800_1126 101
1350 3300048924 Ga0496121_0011769 Ga0496121_0011769_3441_3746 101
1351 3300048924 Ga0496121_0024451 Ga0496121_0024451_790_1095 101
1352 3300048924 Ga0496121_0140784 Ga0496121_0140784_1056_1361 101
1353 3300048924 Ga0496121_0232401 Ga0496121_0232401_963_1268 101
1354 3300048924 Ga0496121_0266427 Ga0496121_0266427_664_969 101
1355 3300048924 Ga0496121_0290300 Ga0496121_0290300_782_1087 101
1356 3300048925 Ga0496122_0000440 Ga0496122_0000440_82398_82703 101
1357 3300048925 Ga0496122_0024941 Ga0496122_0024941_3474_3779 101
1358 3300048925 Ga0496122_0145393 Ga0496122_0145393_496_801 101
1359 3300048925 Ga0496122_0148068 Ga0496122_0148068_336_641 101
1360 3300048925 Ga0496122_0345376 Ga0496122_0345376_377_682 101
1361 3300048925 Ga0496122_0360743 Ga0496122_0360743_23_328 101
1362 3300048926 Ga0496123_0009708 Ga0496123_0009708_3678_3983 101
1363 3300048926 Ga0496123_0028799 Ga0496123_0028799_1209_1514 101
1364 3300048926 Ga0496123_0039503 Ga0496123_0039503_47_352 101
1365 3300048926 Ga0496123_0108679 Ga0496123_0108679_1172_1477 101
1366 3300048926 Ga0496123_0131222 Ga0496123_0131222_413_718 101
1367 3300048927 Ga0496124_0053164 Ga0496124_0053164_2665_2970 101
1368 3300048927 Ga0496124_0147051 Ga0496124_0147051_458_763 101
1369 3300048928 Ga0496125_0000149 Ga0496125_0000149_49566_49871 101
1370 3300048928 Ga0496125_0003559 Ga0496125_0003559_529_834 101
1371 3300048928 Ga0496125_0049218 Ga0496125_0049218_2233_2538 101
1372 3300048928 Ga0496125_0100187 Ga0496125_0100187_804_1109 101
1373 3300048928 Ga0496125_0178110 Ga0496125_0178110_55_360 101
1374 3300048929 Ga0496126_0007818 Ga0496126_0007818_10857_11162 101
1375 3300048929 Ga0496126_0013267 Ga0496126_0013267_4486_4791 101
1376 3300048929 Ga0496126_0052512 Ga0496126_0052512_531_836 101
1377 3300048929 Ga0496126_0206149 Ga0496126_0206149_934_1239 101
1378 3300048929 Ga0496126_0316301 Ga0496126_0316301_637_942 101
1379 3300048929 Ga0496126_0461445 Ga0496126_0461445_206_511 101
1380 3300048929 Ga0496126_0531690 Ga0496126_0531690_367_672 101
1381 3300049128 Ga0501308_021341 Ga0501308_021341_422_745 101
1382 3300049459 Ga0495678_001023 Ga0495678_001023_5344_5649 101
1383 3300049459 Ga0495678_041423 Ga0495678_041423_168_473 101
1384 3300049460 Ga0495682_0048783 Ga0495682_0048783_179_484 101
1385 3300049460 Ga0495682_0061647 Ga0495682_0061647_154_459 101
1386 3300049513 Ga0501290_061479 Ga0501290_061479_177_488 101
1387 3300049528 Ga0501312_092391 Ga0501312_092391_215_526 101
1388 3300049536 Ga0501320_037209 Ga0501320_037209_193_516 101
1389 3300049540 Ga0501324_043447 Ga0501324_043447_160_483 101
1390 3300049552 Ga0501336_026609 Ga0501336_026609_175_498 101
1391 3300049568 Ga0501031_0101788 Ga0501031_0101788_297_602 101
1392 3300049568 Ga0501031_0235743 Ga0501031_0235743_833_1156 101
1393 3300049569 Ga0501032_0002397 Ga0501032_0002397_7235_7540 101
1394 3300049569 Ga0501032_0049264 Ga0501032_0049264_1926_2231 101
1395 3300049569 Ga0501032_0070741 Ga0501032_0070741_673_978 101
1396 3300049569 Ga0501032_0203255 Ga0501032_0203255_495_809 101
1397 3300049569 Ga0501032_0217392 Ga0501032_0217392_596_901 101
1398 3300049569 Ga0501032_0874462 Ga0501032_0874462_11_334 101
1399 3300049570 Ga0501033_0000632 Ga0501033_0000632_13738_14043 101
1400 3300049570 Ga0501033_0001720 Ga0501033_0001720_5039_5344 101
1401 3300049570 Ga0501033_0024689 Ga0501033_0024689_482_805 101
1402 3300049570 Ga0501033_0117429 Ga0501033_0117429_1017_1322 101
1403 3300049570 Ga0501033_0124122 Ga0501033_0124122_1137_1442 101
1404 3300049570 Ga0501033_0135168 Ga0501033_0135168_527_841 101
1405 3300049570 Ga0501033_0157089 Ga0501033_0157089_232_537 101
1406 3300049570 Ga0501033_0219572 Ga0501033_0219572_713_1018 101
1407 3300049570 Ga0501033_0413091 Ga0501033_0413091_198_503 101
1408 3300049570 Ga0501033_0628946 Ga0501033_0628946_398_703 101
1409 3300049571 Ga0501034_0002437 Ga0501034_0002437_7093_7407 101
1410 3300049571 Ga0501034_0002902 Ga0501034_0002902_18065_18370 101
1411 3300049571 Ga0501034_0015349 Ga0501034_0015349_459_764 101
1412 3300049571 Ga0501034_0027193 Ga0501034_0027193_4688_5002 101
1413 3300049571 Ga0501034_0125418 Ga0501034_0125418_54_359 101
1414 3300049571 Ga0501034_0506505 Ga0501034_0506505_489_803 101
1415 3300049571 Ga0501034_0517410 Ga0501034_0517410_701_1006 101
1416 3300049571 Ga0501034_0612744 Ga0501034_0612744_337_642 101
1417 3300049572 Ga0501036_0009385 Ga0501036_0009385_3581_3886 101
1418 3300049572 Ga0501036_0012706 Ga0501036_0012706_6193_6498 101
1419 3300049572 Ga0501036_0093648 Ga0501036_0093648_739_1044 101
1420 3300049572 Ga0501036_0197746 Ga0501036_0197746_935_1249 101
1421 3300049572 Ga0501036_0221807 Ga0501036_0221807_376_681 101
1422 3300049572 Ga0501036_0354262 Ga0501036_0354262_470_775 101
1423 3300049572 Ga0501036_0807349 Ga0501036_0807349_443_748 101
1424 3300049573 Ga0501037_0001300 Ga0501037_0001300_17403_17708 101
1425 3300049573 Ga0501037_0103023 Ga0501037_0103023_787_1092 101
1426 3300049573 Ga0501037_0153572 Ga0501037_0153572_496_810 101
1427 3300049573 Ga0501037_0170990 Ga0501037_0170990_945_1250 101
1428 3300049573 Ga0501037_0322920 Ga0501037_0322920_153_458 101
1429 3300049573 Ga0501037_0485949 Ga0501037_0485949_245_559 101
1430 3300049573 Ga0501037_0651938 Ga0501037_0651938_246_551 101
1431 3300049574 Ga0501038_0008023 Ga0501038_0008023_379_684 101
1432 3300049574 Ga0501038_0033953 Ga0501038_0033953_412_726 101
1433 3300049574 Ga0501038_0364928 Ga0501038_0364928_485_790 101
1434 3300049574 Ga0501038_0377437 Ga0501038_0377437_566_871 101
1435 3300049574 Ga0501038_0661769 Ga0501038_0661769_38_352 101
1436 3300049574 Ga0501038_1027355 Ga0501038_1027355_244_549 101
1437 3300049575 Ga0501039_0009363 Ga0501039_0009363_6955_7260 101
1438 3300049575 Ga0501039_0033279 Ga0501039_0033279_2866_3171 101
1439 3300049575 Ga0501039_0108130 Ga0501039_0108130_1303_1608 101
1440 3300049575 Ga0501039_0111301 Ga0501039_0111301_365_670 101
1441 3300049575 Ga0501039_0144763 Ga0501039_0144763_1104_1409 101
1442 3300049575 Ga0501039_1116322 Ga0501039_1116322_275_592 101
1443 3300049575 Ga0501039_1561525 Ga0501039_1561525_130_435 101
1444 3300049576 Ga0501040_0035524 Ga0501040_0035524_1401_1706 101
1445 3300049576 Ga0501040_0100818 Ga0501040_0100818_321_626 101
1446 3300049577 Ga0501041_0797888 Ga0501041_0797888_160_465 101
1447 3300049578 Ga0501042_0025128 Ga0501042_0025128_368_673 101
1448 3300049578 Ga0501042_0221535 Ga0501042_0221535_60_365 101
1449 3300049579 Ga0501043_0001641 Ga0501043_0001641_15574_15879 101
1450 3300049579 Ga0501043_0005218 Ga0501043_0005218_4112_4438 101
1451 3300049579 Ga0501043_0012916 Ga0501043_0012916_3234_3545 101
1452 3300049579 Ga0501043_0104925 Ga0501043_0104925_164_478 101
1453 3300049579 Ga0501043_0133837 Ga0501043_0133837_1406_1711 101
1454 3300049579 Ga0501043_0357269 Ga0501043_0357269_484_789 101
1455 3300049579 Ga0501043_0587268 Ga0501043_0587268_360_671 101
1456 3300049579 Ga0501043_0684301 Ga0501043_0684301_210_515 101
1457 3300049580 Ga0501046_0009415 Ga0501046_0009415_2038_2343 101
1458 3300049580 Ga0501046_0037617 Ga0501046_0037617_600_905 101
1459 3300049580 Ga0501046_0053750 Ga0501046_0053750_1031_1336 101
1460 3300049580 Ga0501046_0088513 Ga0501046_0088513_651_956 101
1461 3300049580 Ga0501046_0151662 Ga0501046_0151662_1308_1613 101
1462 3300049580 Ga0501046_0187324 Ga0501046_0187324_387_692 101
1463 3300049580 Ga0501046_0237737 Ga0501046_0237737_201_506 101
1464 3300049580 Ga0501046_0254713 Ga0501046_0254713_748_1053 101
1465 3300049580 Ga0501046_0414233 Ga0501046_0414233_404_715 101
1466 3300049580 Ga0501046_0901862 Ga0501046_0901862_10_315 101
1467 3300049580 Ga0501046_1257857 Ga0501046_1257857_175_486 101
1468 3300049581 Ga0501047_0002573 Ga0501047_0002573_883_1197 101
1469 3300049581 Ga0501047_0009259 Ga0501047_0009259_731_1036 101
1470 3300049581 Ga0501047_0018810 Ga0501047_0018810_2205_2516 101
1471 3300049581 Ga0501047_0029549 Ga0501047_0029549_738_1052 101
1472 3300049581 Ga0501047_0073773 Ga0501047_0073773_1100_1405 101
1473 3300049581 Ga0501047_0092889 Ga0501047_0092889_1923_2228 101
1474 3300049581 Ga0501047_0328782 Ga0501047_0328782_915_1220 101
1475 3300049581 Ga0501047_0401208 Ga0501047_0401208_361_675 101
1476 3300049581 Ga0501047_0433185 Ga0501047_0433185_512_817 101
1477 3300049581 Ga0501047_0531502 Ga0501047_0531502_246_551 101
1478 3300049581 Ga0501047_0662514 Ga0501047_0662514_46_351 101
1479 3300049581 Ga0501047_0858780 Ga0501047_0858780_88_393 101
1480 3300049581 Ga0501047_1367132 Ga0501047_1367132_22_327 101
1481 3300049582 Ga0501048_0026442 Ga0501048_0026442_259_564 101
1482 3300049582 Ga0501048_0076244 Ga0501048_0076244_1040_1345 101
1483 3300049582 Ga0501048_0274276 Ga0501048_0274276_478_783 101
1484 3300049582 Ga0501048_0315708 Ga0501048_0315708_457_762 101
1485 3300049582 Ga0501048_0586179 Ga0501048_0586179_343_648 101
1486 3300049583 Ga0501067_0006199 Ga0501067_0006199_321_626 101
1487 3300049583 Ga0501067_0014755 Ga0501067_0014755_3205_3519 101
1488 3300049584 Ga0501068_0131777 Ga0501068_0131777_423_740 101
1489 3300049584 Ga0501068_0143933 Ga0501068_0143933_1048_1353 101
1490 3300049585 Ga0501069_0006685 Ga0501069_0006685_1743_2060 101
1491 3300049585 Ga0501069_0066085 Ga0501069_0066085_1322_1627 101
1492 3300049585 Ga0501069_0348860 Ga0501069_0348860_226_537 101
1493 3300049586 Ga0501070_0002131 Ga0501070_0002131_2721_3035 101
1494 3300049586 Ga0501070_0010864 Ga0501070_0010864_1577_1891 101
1495 3300049586 Ga0501070_0013751 Ga0501070_0013751_6468_6773 101
1496 3300049586 Ga0501070_0033092 Ga0501070_0033092_448_762 101
1497 3300049586 Ga0501070_0087275 Ga0501070_0087275_1543_1848 101
1498 3300049586 Ga0501070_0123868 Ga0501070_0123868_1435_1740 101
1499 3300049586 Ga0501070_0224590 Ga0501070_0224590_550_861 101
1500 3300049587 Ga0501071_0028649 Ga0501071_0028649_2553_2858 101
1501 3300049587 Ga0501071_0031884 Ga0501071_0031884_1667_1972 101
1502 3300049587 Ga0501071_0118792 Ga0501071_0118792_664_969 101
1503 3300049587 Ga0501071_0820344 Ga0501071_0820344_187_492 101
1504 3300049588 Ga0501072_0003391 Ga0501072_0003391_11642_11959 101
1505 3300049588 Ga0501072_0027150 Ga0501072_0027150_1346_1651 101
1506 3300049589 Ga0501073_0001213 Ga0501073_0001213_3419_3733 101
1507 3300049589 Ga0501073_0002194 Ga0501073_0002194_9197_9502 101
1508 3300049589 Ga0501073_0008870 Ga0501073_0008870_245_550 101
1509 3300049589 Ga0501073_0347496 Ga0501073_0347496_179_484 101
1510 3300049589 Ga0501073_0386775 Ga0501073_0386775_594_899 101
1511 3300049589 Ga0501073_0547597 Ga0501073_0547597_150_464 101
1512 3300049589 Ga0501073_0787524 Ga0501073_0787524_57_371 101
1513 3300049589 Ga0501073_0814274 Ga0501073_0814274_271_576 101
1514 3300049590 Ga0501074_0031338 Ga0501074_0031338_926_1231 101
1515 3300049590 Ga0501074_0033188 Ga0501074_0033188_2909_3223 101
1516 3300049590 Ga0501074_0087103 Ga0501074_0087103_1230_1541 101
1517 3300049590 Ga0501074_0096715 Ga0501074_0096715_925_1230 101
1518 3300049590 Ga0501074_0119475 Ga0501074_0119475_990_1304 101
1519 3300049590 Ga0501074_0190732 Ga0501074_0190732_814_1131 101
1520 3300049590 Ga0501074_0282753 Ga0501074_0282753_226_531 101
1521 3300049590 Ga0501074_0699488 Ga0501074_0699488_153_458 101
1522 3300049591 Ga0501075_0003076 Ga0501075_0003076_1644_1949 101
1523 3300049591 Ga0501075_0104738 Ga0501075_0104738_1205_1510 101
1524 3300049592 Ga0501076_0001078 Ga0501076_0001078_592_897 101
1525 3300049592 Ga0501076_0420680 Ga0501076_0420680_229_534 101
1526 3300049593 Ga0501077_0026740 Ga0501077_0026740_2441_2746 101
1527 3300049653 Ga0501206_021096 Ga0501206_021096_441_752 101
1528 3300049660 Ga0501216_158951 Ga0501216_158951_119_430 101
1529 3300049661 Ga0501217_096638 Ga0501217_096638_265_588 101
1530 3300049663 Ga0501223_031766 Ga0501223_031766_678_1001 101
1531 3300049664 Ga0501224_040125 Ga0501224_040125_98_409 101
1532 3300049677 Ga0501247_053981 Ga0501247_053981_115_426 101
1533 3300049679 Ga0501249_019448 Ga0501249_019448_271_594 101
1534 3300049680 Ga0501250_004457 Ga0501250_004457_144_467 101
1535 3300049682 Ga0501252_006724 Ga0501252_006724_178_501 101
1536 3300049682 Ga0501252_086169 Ga0501252_086169_116_427 101
1537 3300049683 Ga0501253_112865 Ga0501253_112865_145_468 101
1538 3300049687 Ga0501258_040070 Ga0501258_040070_269_580 101
1539 3300049688 Ga0501259_104530 Ga0501259_104530_127_432 101
1540 3300049705 Ga0501225_0006481 Ga0501225_0006481_2920_3225 101
1541 3300049705 Ga0501225_0083207 Ga0501225_0083207_43_366 101
1542 3300049741 Ga0501079_0097356 Ga0501079_0097356_804_1109 101
1543 3300049741 Ga0501079_0125221 Ga0501079_0125221_842_1147 101
1544 3300049741 Ga0501079_0224507 Ga0501079_0224507_55_360 101
1545 3300049741 Ga0501079_0241097 Ga0501079_0241097_683_997 101
1546 3300049741 Ga0501079_0411511 Ga0501079_0411511_567_872 101
1547 3300049741 Ga0501079_0547118 Ga0501079_0547118_416_730 101
1548 3300049741 Ga0501079_0999878 Ga0501079_0999878_204_509 101
1549 3300049742 Ga0501080_0000791 Ga0501080_0000791_14338_14652 101
1550 3300049742 Ga0501080_0001319 Ga0501080_0001319_7945_8256 101
1551 3300049742 Ga0501080_0006958 Ga0501080_0006958_1266_1571 101
1552 3300049742 Ga0501080_0009707 Ga0501080_0009707_5750_6064 101
1553 3300049742 Ga0501080_0018776 Ga0501080_0018776_5405_5719 101
1554 3300049742 Ga0501080_0085197 Ga0501080_0085197_1507_1812 101
1555 3300049742 Ga0501080_0140553 Ga0501080_0140553_803_1108 101
1556 3300049742 Ga0501080_0145790 Ga0501080_0145790_874_1179 101
1557 3300049742 Ga0501080_0208236 Ga0501080_0208236_1082_1387 101
1558 3300049742 Ga0501080_0486833 Ga0501080_0486833_500_805 101
1559 3300049742 Ga0501080_0632213 Ga0501080_0632213_157_462 101
1560 3300049742 Ga0501080_0849750 Ga0501080_0849750_454_759 101
1561 3300049743 Ga0501081_0008596 Ga0501081_0008596_5897_6202 101
1562 3300049744 Ga0501083_0001078 Ga0501083_0001078_16612_16926 101
1563 3300049744 Ga0501083_0181210 Ga0501083_0181210_481_786 101
1564 3300049760 Ga0501263_039215 Ga0501263_039215_339_662 101
1565 3300049761 Ga0501264_033208 Ga0501264_033208_172_477 101
1566 3300049763 Ga0501266_003367 Ga0501266_003367_1612_1923 101
1567 3300049763 Ga0501266_022659 Ga0501266_022659_63_374 101
1568 3300049765 Ga0501268_092644 Ga0501268_092644_71_382 101
1569 3300049765 Ga0501268_178276 Ga0501268_178276_71_382 101
1570 3300049767 Ga0501270_162154 Ga0501270_162154_67_390 101
1571 3300049768 Ga0501271_032041 Ga0501271_032041_149_460 101
1572 3300049769 Ga0501272_022957 Ga0501272_022957_311_622 101
1573 3300049772 Ga0501275_085427 Ga0501275_085427_90_413 101
1574 3300049775 Ga0501279_035089 Ga0501279_035089_296_619 101
1575 3300049822 Ga0501035_0013600 Ga0501035_0013600_587_892 101
1576 3300049822 Ga0501035_0027477 Ga0501035_0027477_4032_4337 101
1577 3300049822 Ga0501035_0041694 Ga0501035_0041694_3308_3613 101
1578 3300049822 Ga0501035_0098449 Ga0501035_0098449_1252_1557 101
1579 3300049822 Ga0501035_0252247 Ga0501035_0252247_441_752 101
1580 3300049822 Ga0501035_0275414 Ga0501035_0275414_1006_1311 101
1581 3300049822 Ga0501035_0317572 Ga0501035_0317572_190_495 101
1582 3300049822 Ga0501035_0545206 Ga0501035_0545206_573_878 101
1583 3300049822 Ga0501035_0744110 Ga0501035_0744110_410_715 101
1584 3300049823 Ga0501044_0016694 Ga0501044_0016694_6126_6431 101
1585 3300049823 Ga0501044_0033968 Ga0501044_0033968_2316_2621 101
1586 3300049823 Ga0501044_0061827 Ga0501044_0061827_3014_3319 101
1587 3300049823 Ga0501044_0110003 Ga0501044_0110003_2035_2352 101
1588 3300049823 Ga0501044_0117045 Ga0501044_0117045_344_649 101
1589 3300049823 Ga0501044_0119037 Ga0501044_0119037_42_347 101
1590 3300049823 Ga0501044_0403816 Ga0501044_0403816_87_392 101
1591 3300049823 Ga0501044_0546658 Ga0501044_0546658_268_573 101
1592 3300049823 Ga0501044_0575223 Ga0501044_0575223_370_675 101
1593 3300049823 Ga0501044_0702328 Ga0501044_0702328_501_806 101
1594 3300049823 Ga0501044_1369044 Ga0501044_1369044_12_317 101
1595 3300049823 Ga0501044_1614495 Ga0501044_1614495_169_474 101
1596 3300049824 Ga0501045_0040200 Ga0501045_0040200_593_898 101
1597 3300049824 Ga0501045_0287400 Ga0501045_0287400_379_684 101
1598 3300049824 Ga0501045_0635430 Ga0501045_0635430_148_453 101
1599 3300049824 Ga0501045_0766648 Ga0501045_0766648_156_482 101
1600 3300050491 nmdc:mga00v17_54986_c1 nmdc:mga00v17_54986_c1_245_571 101
1601 3300050491 nmdc:mga00v17_69221_c1 nmdc:mga00v17_69221_c1_1469_1795 101
1602 3300050496 nmdc:mga07m45_410003_c1 nmdc:mga07m45_410003_c1_250_561 101
1603 3300050496 nmdc:mga07m45_842111_c1 nmdc:mga07m45_842111_c1_47_352 101
1604 3300050510 nmdc:mga06r32_1434109_c1 nmdc:mga06r32_1434109_c1_64_402 101
1605 3300050514 nmdc:mga08x19_286436_c1 nmdc:mga08x19_286436_c1_133_456 101
1606 3300053078 Ga0495612_0353400 Ga0495612_0353400_163_483 101
1607 3300053079 Ga0500610_0004715 Ga0500610_0004715_1046_1351 101
1608 3300053087 Ga0500643_000075 Ga0500643_000075_30929_31234 101
1609 3300053087 Ga0500643_003396 Ga0500643_003396_6211_6516 101
1610 3300053092 Ga0500583_0527191 Ga0500583_0527191_85_390 101
1611 3300053092 Ga0500583_0562674 Ga0500583_0562674_76_381 101
1612 3300053093 Ga0500651_0003714 Ga0500651_0003714_6589_6894 101
1613 3300053094 Ga0500566_0093620 Ga0500566_0093620_953_1273 101
1614 3300053103 Ga0500555_000207 Ga0500555_000207_7382_7687 101
1615 3300053104 Ga0500556_0383168 Ga0500556_0383168_16_321 101
1616 3300053120 Ga0500597_002583 Ga0500597_002583_4206_4511 101
1617 3300053123 Ga0500614_017765 Ga0500614_017765_656_976 101
1618 3300053139 Ga0500568_0001907 Ga0500568_0001907_4285_4590 101
1619 3300053155 Ga0500620_083778 Ga0500620_083778_514_819 101
1620 3300053730 Ga0500645_001593 Ga0500645_001593_6759_7064 101
1621 3300054114 Ga0501084_0176857 Ga0501084_0176857_1059_1364 101
1622 3300054114 Ga0501084_0192523 Ga0501084_0192523_923_1228 101
1623 3300054114 Ga0501084_0246743 Ga0501084_0246743_400_705 101
1624 3300054114 Ga0501084_0339736 Ga0501084_0339736_915_1229 101
1625 3300054114 Ga0501084_0903412 Ga0501084_0903412_408_722 101
1626 3300059505 Ga0587083_0264676 Ga0587083_0264676_117_422 101
1627 3300060353 Ga0501082_0001359 Ga0501082_0001359_12594_12899 101
1628 3300060353 Ga0501082_0005033 Ga0501082_0005033_1259_1564 101
1629 3300060353 Ga0501082_0086117 Ga0501082_0086117_1773_2078 101
1630 3300060353 Ga0501082_0211950 Ga0501082_0211950_108_425 101
1631 3300061719 Ga0466962_0005761 Ga0466962_0005761_3071_3376 101
1632 3300061719 Ga0466962_0005882 Ga0466962_0005882_5224_5529 101
1633 3300061719 Ga0466962_0008347 Ga0466962_0008347_3603_3908 101
1634 3300061719 Ga0466962_0335946 Ga0466962_0335946_56_361 101
1635 3300061734 Ga0530510_0006308 Ga0530510_0006308_2699_3004 101
1636 3300061734 Ga0530510_0123358 Ga0530510_0123358_1529_1834 101
1637 iso_pu_bacteria 2571042365 2572253579 101
1638 iso_pu_bacteria 2643221559 2643815249 101
1639 iso_pu_bacteria 2643221573 2643879288 101
1640 iso_pu_bacteria 2643221586 2643939927 101
1641 iso_pu_bacteria 2643221593 2643976213 101
1642 iso_pu_bacteria 2643221612 2644076985 101
1643 iso_pu_bacteria 2643221695 2644528914 101
1644 iso_pu_bacteria 2643221720 2644660587 101
1645 iso_pu_bacteria 2643221727 2644695299 101
1646 iso_pu_bacteria 2643221728 2644697948 101
1647 iso_pu_bacteria 2919513703 2919516104 101
1648 iso_pu_bacteria 2919675420 2919677936 101
1649 iso_pu_bacteria 2941489479 2941491121 101
1650 iso_pu_bacteria 2995948881 2995952052 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

11

106

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.8737 10 90
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.859 4 86
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.8571 4 86
6h8k-assembly1.cif.gz_L crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.8538 10 82
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.8414 4 89
ID Description Score Start End Superfamily
af_P34651_608_792_1.20.120.1900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain 0.8632 35 80 1.20.120.1900
5lnkK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8173 11 87 1.10.287.3510
2xm0A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.8157 34 73 1.20.120.10
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8003 7 100 1.10.287.3510
5xtdk00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8002 8 84 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A2E2YBK6-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.935 1 88 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.9307 4 91 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9144 9 95 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A529HMQ9-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9125 1 67 GO:0016651
GO:0030964
GO:0042773
AF-J3M8V7-F1-model_v4 NADH dehydrogenase subunit 4L 0.9098 4 84 GO:0016651
GO:0030964
GO:0042773

Feature Viewer

pLDDT pTM Quality
80.6 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map