F495023

General Info

Members Datasets Scaffolds Average Seq Length
1606 400 1585 279

Family's Representative Sequence

Representative Sequence 3300002077|JGI24744J21845_10001768|JGI24744J21845_100017683
Length 318
Sequence MYARVYVMEQVVGDSVCAAVADGGGGDNGRLTRRPMNLLGRPVGLDQPLFLIAGPCVVESEELQLRTAEQLKAITGRLGIHFIFKSSFDKANRSSDQSYRGPGIDEGLRVLEKVVAEVGVPVLTDVHDIPQIAAXXXXVDVLQTPAFLARQTDFIHAVAASGKPINIKKAQFMAPQDMKNVVDKARGAAQAAGVNEETIMVCERGASFGYNNLVSDMRSLAIMRETGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAAVATGIAGLFMETHPDPASARSDGPNAWPLDRMEGLLETLVELDRLVKQRGFEERTL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
14 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
15 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
16 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
17 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
18 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
19 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
146 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
224 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
225 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
248 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
251 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
252 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
253 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
254 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
255 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
271 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
272 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
275 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
276 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
279 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
280 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
283 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
284 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
285 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
295 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
301 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
302 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
303 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
304 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
307 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
314 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
315 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
316 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
317 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
330 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
363 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
367 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
368 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
369 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
370 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
374 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
375 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
376 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
387 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
388 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
389 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
390 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
394 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
395 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
396 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
400 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.06
Isolates 1.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 1.43
Nodule 0.12
Rhizoplane 3.61
Rhizosphere 90.22
Stem 0
Stem Tuber 0.06
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2334788 2162886007 Bacteria 75171
2 SwRhRL2b_contig_688890 2162886007 Bacteria 18649
3 JGI24736J21556_1002025 3300001904 Bacteria 3605
4 JGI24741J21665_1006827 3300001915 Bacteria 2260
5 JGI24741J21665_1008590 3300001915 Bacteria 1920
6 JGI24741J21665_1009991 3300001915 Bacteria 1719
7 JGI24741J21665_1016976 3300001915 Bacteria 1181
8 JGI24752J21851_1000307 3300001976 Bacteria 6837
9 JGI24740J21852_10000510 3300001979 Bacteria 16678
10 JGI24740J21852_10004342 3300001979 Bacteria 6105
11 JGI24740J21852_10007917 3300001979 Bacteria 4284
12 JGI24740J21852_10019466 3300001979 Bacteria 2390
13 JGI24740J21852_10028967 3300001979 Bacteria 1823
14 JGI24740J21852_10034798 3300001979 Bacteria 1582
15 JGI24740J21852_10056642 3300001979 Bacteria 1098
16 JGI24739J22299_10003379 3300001989 Bacteria 6090
17 JGI24739J22299_10006699 3300001989 Bacteria 4338
18 JGI24739J22299_10011416 3300001989 Bacteria 3280
19 JGI24739J22299_10016194 3300001989 Bacteria 2701
20 JGI24739J22299_10017712 3300001989 Bacteria 2567
21 JGI24739J22299_10018339 3300001989 Bacteria 2516
22 JGI24739J22299_10025599 3300001989 Bacteria 2075
23 JGI24737J22298_10000494 3300001990 Bacteria 13696
24 JGI24737J22298_10001763 3300001990 Bacteria 7739
25 JGI24737J22298_10003795 3300001990 Bacteria 5314
26 JGI24737J22298_10005497 3300001990 Bacteria 4372
27 JGI24737J22298_10012773 3300001990 Bacteria 2738
28 JGI24737J22298_10034662 3300001990 Bacteria 1564
29 JGI24735J21928_10004079 3300002067 Bacteria 4929
30 JGI24735J21928_10005053 3300002067 Bacteria 4390
31 JGI24735J21928_10007347 3300002067 Bacteria 3596
32 JGI24735J21928_10007986 3300002067 Bacteria 3437
33 JGI24735J21928_10019572 3300002067 Bacteria 2080
34 JGI24735J21928_10035048 3300002067 Bacteria 1478
35 JGI24735J21928_10038309 3300002067 Bacteria 1404
36 JGI24735J21928_10043173 3300002067 Bacteria 1312
37 JGI24735J21928_10067908 3300002067 Bacteria 1022
38 JGI24738J21930_10002391 3300002075 Bacteria 4927
39 JGI24738J21930_10002718 3300002075 Bacteria 4554
40 JGI24744J21845_10001768 3300002077 Bacteria 4335
41 JGI24034J26672_10004300 3300002239 Bacteria 2013
42 JGI25162J39368_1001576 3300002737 Bacteria 11624
43 JGI25165J46597_1001950 3300003214 Bacteria 8118
44 rootL2_10214738 3300003322 Bacteria 1238
45 Ga0055542_1008997 3300003762 Bacteria 1910
46 Ga0065704_10000277 3300005289 Bacteria 104842
47 Ga0065704_10070166 3300005289 Bacteria 176609
48 Ga0065712_10245083 3300005290 Bacteria 974
49 Ga0065715_10123978 3300005293 Bacteria 2165
50 Ga0065715_10174748 3300005293 Bacteria 1520
51 Ga0065707_10088012 3300005295 Bacteria 4813
52 Ga0065707_10131361 3300005295 Bacteria 1914
53 Ga0070658_10000346 3300005327 Bacteria 40223
54 Ga0070658_10001292 3300005327 Bacteria 21377
55 Ga0070658_10004662 3300005327 Bacteria 11154
56 Ga0070658_10006783 3300005327 Bacteria 9264
57 Ga0070658_10009576 3300005327 Bacteria 7777
58 Ga0070658_10022658 3300005327 Bacteria 5040
59 Ga0070658_10028612 3300005327 Bacteria 4475
60 Ga0070658_10029286 3300005327 Bacteria 4423
61 Ga0070658_10029812 3300005327 Bacteria 4383
62 Ga0070658_10030911 3300005327 Bacteria 4301
63 Ga0070658_10048778 3300005327 Bacteria 3429
64 Ga0070658_10050618 3300005327 Bacteria 3367
65 Ga0070658_10056061 3300005327 Bacteria 3202
66 Ga0070658_10070155 3300005327 Bacteria 2868
67 Ga0070658_10299189 3300005327 Bacteria 1372
68 Ga0070658_10318288 3300005327 Bacteria 1328
69 Ga0070658_10333576 3300005327 Bacteria 1296
70 Ga0070676_10003358 3300005328 Bacteria 8329
71 Ga0070676_10015499 3300005328 Bacteria 4205
72 Ga0070676_10037177 3300005328 Bacteria 2807
73 Ga0070676_10094351 3300005328 Bacteria 1838
74 Ga0070676_10216913 3300005328 Bacteria 1262
75 Ga0070683_100002527 3300005329 Bacteria 14584
76 Ga0070683_100013626 3300005329 Bacteria 7097
77 Ga0070683_100055757 3300005329 Bacteria 3668
78 Ga0070690_100003836 3300005330 Bacteria 8277
79 Ga0070690_100004850 3300005330 Bacteria 7511
80 Ga0070690_100015145 3300005330 Bacteria 4593
81 Ga0070690_100081775 3300005330 Bacteria 2114
82 Ga0070690_100256974 3300005330 Bacteria 1238
83 Ga0070670_100000215 3300005331 Bacteria 53387
84 Ga0070670_100002629 3300005331 Bacteria 14839
85 Ga0070670_100010219 3300005331 Bacteria 8009
86 Ga0070670_100012404 3300005331 Bacteria 7292
87 Ga0070670_100012723 3300005331 Bacteria 7201
88 Ga0070670_100021381 3300005331 Bacteria 5566
89 Ga0070670_100035052 3300005331 Bacteria 4319
90 Ga0070670_100040860 3300005331 Bacteria 3986
91 Ga0070670_100070918 3300005331 Bacteria 2991
92 Ga0070670_100077725 3300005331 Bacteria 2851
93 Ga0070670_100125702 3300005331 Bacteria 2213
94 Ga0070670_100144090 3300005331 Bacteria 2061
95 Ga0070670_100188654 3300005331 Bacteria 1790
96 Ga0070670_100208852 3300005331 Bacteria 1697
97 Ga0070670_100302369 3300005331 Bacteria 1400
98 Ga0070670_100396988 3300005331 Bacteria 1217
99 Ga0070670_100405859 3300005331 Bacteria 1203
100 Ga0070677_10005554 3300005333 Bacteria 4159
101 Ga0070677_10241618 3300005333 Bacteria 892
102 Ga0068869_100000736 3300005334 Bacteria 18613
103 Ga0068869_100119573 3300005334 Bacteria 2013
104 Ga0068869_100270401 3300005334 Bacteria 1363
105 Ga0068869_100372044 3300005334 Bacteria 1169
106 Ga0070666_10000003 3300005335 Bacteria 463666
107 Ga0070666_10001026 3300005335 Bacteria 17116
108 Ga0070666_10002276 3300005335 Bacteria 11606
109 Ga0070666_10004347 3300005335 Bacteria 8628
110 Ga0070666_10020001 3300005335 Bacteria 4325
111 Ga0070666_10046797 3300005335 Bacteria 2903
112 Ga0070666_10206030 3300005335 Bacteria 1384
113 Ga0070666_10297876 3300005335 Bacteria 1148
114 Ga0070680_100041126 3300005336 Bacteria 3747
115 Ga0070680_100041285 3300005336 Bacteria 3740
116 Ga0070680_100094473 3300005336 Bacteria 2478
117 Ga0070680_100382841 3300005336 Bacteria 1198
118 Ga0070680_100556201 3300005336 Bacteria 983
119 Ga0068868_100000916 3300005338 Bacteria 20057
120 Ga0068868_100002996 3300005338 Bacteria 11738
121 Ga0068868_100234436 3300005338 Bacteria 1540
122 Ga0068868_100665272 3300005338 Bacteria 928
123 Ga0070660_100000061 3300005339 Bacteria 63766
124 Ga0070660_100002355 3300005339 Bacteria 12985
125 Ga0070660_100007051 3300005339 Bacteria 7808
126 Ga0070660_100008743 3300005339 Bacteria 7092
127 Ga0070660_100028245 3300005339 Bacteria 4195
128 Ga0070660_100041906 3300005339 Bacteria 3492
129 Ga0070660_100051068 3300005339 Bacteria 3183
130 Ga0070660_100067753 3300005339 Bacteria 2781
131 Ga0070660_100086870 3300005339 Bacteria 2461
132 Ga0070660_100503693 3300005339 Bacteria 1007
133 Ga0070689_100027730 3300005340 Bacteria 4272
134 Ga0070687_100095397 3300005343 Bacteria 1654
135 Ga0070661_100000484 3300005344 Bacteria 30418
136 Ga0070661_100016626 3300005344 Bacteria 5204
137 Ga0070661_100027230 3300005344 Bacteria 4115
138 Ga0070661_100035410 3300005344 Bacteria 3625
139 Ga0070661_100042833 3300005344 Bacteria 3306
140 Ga0070661_100078160 3300005344 Bacteria 2440
141 Ga0070661_100141614 3300005344 Bacteria 1813
142 Ga0070661_100213759 3300005344 Bacteria 1477
143 Ga0070661_100256285 3300005344 Bacteria 1351
144 Ga0070661_100278924 3300005344 Bacteria 1296
145 Ga0070661_100303694 3300005344 Bacteria 1243
146 Ga0070661_100355981 3300005344 Bacteria 1149
147 Ga0070692_10011390 3300005345 Bacteria 4080
148 Ga0070692_10042128 3300005345 Bacteria 2343
149 Ga0070692_10166504 3300005345 Bacteria 1267
150 Ga0070668_100000060 3300005347 Bacteria 67693
151 Ga0070668_100005937 3300005347 Bacteria 9050
152 Ga0070668_100009237 3300005347 Bacteria 7311
153 Ga0070668_100015747 3300005347 Bacteria 5658
154 Ga0070668_100024560 3300005347 Bacteria 4567
155 Ga0070668_100118574 3300005347 Bacteria 2113
156 Ga0070668_100338998 3300005347 Bacteria 1270
157 Ga0070669_100000039 3300005353 Bacteria 135033
158 Ga0070669_100000801 3300005353 Bacteria 22859
159 Ga0070669_100013522 3300005353 Bacteria 5801
160 Ga0070669_100105752 3300005353 Bacteria 2129
161 Ga0070669_100126703 3300005353 Bacteria 1954
162 Ga0070669_100297271 3300005353 Bacteria 1298
163 Ga0070675_100002767 3300005354 Bacteria 13188
164 Ga0070675_100014360 3300005354 Bacteria 6245
165 Ga0070675_100015009 3300005354 Bacteria 6117
166 Ga0070675_100096808 3300005354 Bacteria 2480
167 Ga0070675_100111533 3300005354 Bacteria 2315
168 Ga0070675_100152911 3300005354 Bacteria 1979
169 Ga0070671_100000619 3300005355 Bacteria 25424
170 Ga0070671_100000773 3300005355 Bacteria 22941
171 Ga0070671_100001089 3300005355 Bacteria 20114
172 Ga0070671_100003527 3300005355 Bacteria 12224
173 Ga0070671_100006541 3300005355 Bacteria 9317
174 Ga0070671_100008998 3300005355 Bacteria 8013
175 Ga0070671_100009026 3300005355 Bacteria 8000
176 Ga0070671_100030434 3300005355 Bacteria 4454
177 Ga0070671_100075157 3300005355 Bacteria 2822
178 Ga0070671_100082437 3300005355 Bacteria 2689
179 Ga0070671_100108550 3300005355 Bacteria 2330
180 Ga0070671_100158038 3300005355 Bacteria 1916
181 Ga0070671_100174711 3300005355 Bacteria 1817
182 Ga0070671_100231109 3300005355 Bacteria 1569
183 Ga0070671_100250990 3300005355 Bacteria 1503
184 Ga0070671_100257118 3300005355 Bacteria 1484
185 Ga0070671_100391816 3300005355 Bacteria 1188
186 Ga0070671_100514301 3300005355 Bacteria 1030
187 Ga0070671_100570677 3300005355 Bacteria 976
188 Ga0070674_100006000 3300005356 Bacteria 7062
189 Ga0070674_100011808 3300005356 Bacteria 5332
190 Ga0070674_100014053 3300005356 Bacteria 4969
191 Ga0070674_100023891 3300005356 Bacteria 3963
192 Ga0070674_100106261 3300005356 Bacteria 2054
193 Ga0070674_100253924 3300005356 Bacteria 1382
194 Ga0070673_100014389 3300005364 Bacteria 5507
195 Ga0070673_100092197 3300005364 Bacteria 2478
196 Ga0070673_100384427 3300005364 Bacteria 1252
197 Ga0070673_100403605 3300005364 Bacteria 1223
198 Ga0070659_100000951 3300005366 Bacteria 21297
199 Ga0070659_100005070 3300005366 Bacteria 9440
200 Ga0070659_100007590 3300005366 Bacteria 7884
201 Ga0070659_100014237 3300005366 Bacteria 5938
202 Ga0070659_100022542 3300005366 Bacteria 4808
203 Ga0070659_100048570 3300005366 Bacteria 3334
204 Ga0070659_100049220 3300005366 Bacteria 3313
205 Ga0070659_100071857 3300005366 Bacteria 2753
206 Ga0070659_100080375 3300005366 Bacteria 2603
207 Ga0070659_100146194 3300005366 Bacteria 1926
208 Ga0070659_100190742 3300005366 Bacteria 1684
209 Ga0070659_100202262 3300005366 Bacteria 1635
210 Ga0070659_100204957 3300005366 Bacteria 1624
211 Ga0070659_100216876 3300005366 Bacteria 1578
212 Ga0070667_100000311 3300005367 Bacteria 54491
213 Ga0070667_100000426 3300005367 Bacteria 44558
214 Ga0070667_100000719 3300005367 Bacteria 31865
215 Ga0070667_100001187 3300005367 Bacteria 23675
216 Ga0070667_100002027 3300005367 Bacteria 17934
217 Ga0070667_100016267 3300005367 Bacteria 6152
218 Ga0070667_100016770 3300005367 Bacteria 6061
219 Ga0070667_100023131 3300005367 Bacteria 5155
220 Ga0070667_100025767 3300005367 Bacteria 4891
221 Ga0070667_100039178 3300005367 Bacteria 3971
222 Ga0070667_100101494 3300005367 Bacteria 2485
223 Ga0070667_100114419 3300005367 Bacteria 2342
224 Ga0070667_100170448 3300005367 Bacteria 1921
225 Ga0070667_100257829 3300005367 Bacteria 1560
226 Ga0070667_100294973 3300005367 Bacteria 1459
227 Ga0070667_100314193 3300005367 Bacteria 1413
228 Ga0070667_100497516 3300005367 Bacteria 1117
229 Ga0070709_10011673 3300005434 Bacteria 4903
230 Ga0070709_10042690 3300005434 Bacteria 2801
231 Ga0070714_100070859 3300005435 Bacteria 3013
232 Ga0070714_100157555 3300005435 Bacteria 2051
233 Ga0070713_100008425 3300005436 Bacteria 7310
234 Ga0070710_10033748 3300005437 Bacteria 2781
235 Ga0070711_100044480 3300005439 Bacteria 3014
236 Ga0070700_100053911 3300005441 Bacteria 2511
237 Ga0070700_100162921 3300005441 Bacteria 1537
238 Ga0070694_100001709 3300005444 Bacteria 12934
239 Ga0070708_100386250 3300005445 Bacteria 1320
240 Ga0070663_100001512 3300005455 Bacteria 12784
241 Ga0070663_100003374 3300005455 Bacteria 9216
242 Ga0070663_100007544 3300005455 Bacteria 6628
243 Ga0070663_100011047 3300005455 Bacteria 5653
244 Ga0070663_100018361 3300005455 Bacteria 4584
245 Ga0070663_100032863 3300005455 Bacteria 3580
246 Ga0070663_100153681 3300005455 Bacteria 1767
247 Ga0070663_100385118 3300005455 Bacteria 1143
248 Ga0070663_100456063 3300005455 Bacteria 1055
249 Ga0070678_100005924 3300005456 Bacteria 7110
250 Ga0070678_100013063 3300005456 Bacteria 5190
251 Ga0070678_100027755 3300005456 Bacteria 3848
252 Ga0070678_100046844 3300005456 Bacteria 3103
253 Ga0070678_100085640 3300005456 Bacteria 2402
254 Ga0070678_100135069 3300005456 Bacteria 1966
255 Ga0070678_100269377 3300005456 Bacteria 1436
256 Ga0070678_100497442 3300005456 Bacteria 1075
257 Ga0070662_100000219 3300005457 Bacteria 33617
258 Ga0070662_100001600 3300005457 Bacteria 13979
259 Ga0070662_100002610 3300005457 Bacteria 11118
260 Ga0070662_100007973 3300005457 Bacteria 6890
261 Ga0070662_100027175 3300005457 Bacteria 3969
262 Ga0070662_100058479 3300005457 Bacteria 2805
263 Ga0070662_100071655 3300005457 Bacteria 2556
264 Ga0070662_100082238 3300005457 Bacteria 2401
265 Ga0070662_100087549 3300005457 Bacteria 2332
266 Ga0070662_100089743 3300005457 Bacteria 2306
267 Ga0070662_100109439 3300005457 Bacteria 2103
268 Ga0070662_100112432 3300005457 Bacteria 2076
269 Ga0070662_100152521 3300005457 Bacteria 1800
270 Ga0070662_100168012 3300005457 Bacteria 1720
271 Ga0070662_100202988 3300005457 Bacteria 1574
272 Ga0070662_100228458 3300005457 Bacteria 1488
273 Ga0070662_100371354 3300005457 Bacteria 1175
274 Ga0070662_100374107 3300005457 Bacteria 1171
275 Ga0070681_10004426 3300005458 Bacteria 13380
276 Ga0070681_10007969 3300005458 Bacteria 10368
277 Ga0070681_10055825 3300005458 Bacteria 3931
278 Ga0068867_100004301 3300005459 Bacteria 10024
279 Ga0068867_100005403 3300005459 Bacteria 9037
280 Ga0068867_100006326 3300005459 Bacteria 8377
281 Ga0068867_100011025 3300005459 Bacteria 6374
282 Ga0068867_100017468 3300005459 Bacteria 5096
283 Ga0068867_100071006 3300005459 Bacteria 2604
284 Ga0068867_100116336 3300005459 Bacteria 2060
285 Ga0068867_100429558 3300005459 Bacteria 1121
286 Ga0070706_100024683 3300005467 Bacteria 5534
287 Ga0070706_100138568 3300005467 Unclassified 2271
288 Ga0070707_100000959 3300005468 Bacteria 28639
289 Ga0070707_100436354 3300005468 Bacteria 1270
290 Ga0070699_100115885 3300005518 Bacteria 2354
291 Ga0070679_100027894 3300005530 Bacteria 5563
292 Ga0070679_100031283 3300005530 Bacteria 5257
293 Ga0070679_100062984 3300005530 Bacteria 3697
294 Ga0070679_100155236 3300005530 Bacteria 2264
295 Ga0070679_100192364 3300005530 Bacteria 2009
296 Ga0070679_100200596 3300005530 Bacteria 1961
297 Ga0070684_100007162 3300005535 Bacteria 8666
298 Ga0070684_100045979 3300005535 Bacteria 3782
299 Ga0068853_100000981 3300005539 Bacteria 20086
300 Ga0068853_100008986 3300005539 Bacteria 8048
301 Ga0068853_100018144 3300005539 Bacteria 5819
302 Ga0068853_100028474 3300005539 Bacteria 4699
303 Ga0068853_100030851 3300005539 Bacteria 4529
304 Ga0068853_100038256 3300005539 Bacteria 4085
305 Ga0068853_100059234 3300005539 Bacteria 3308
306 Ga0068853_100083430 3300005539 Bacteria 2800
307 Ga0068853_100088568 3300005539 Bacteria 2717
308 Ga0068853_100105203 3300005539 Bacteria 2500
309 Ga0068853_100446769 3300005539 Bacteria 1216
310 Ga0070672_100002866 3300005543 Bacteria 11079
311 Ga0070672_100005662 3300005543 Bacteria 8317
312 Ga0070672_100028839 3300005543 Bacteria 4156
313 Ga0070672_100035121 3300005543 Bacteria 3809
314 Ga0070672_100053474 3300005543 Bacteria 3157
315 Ga0070672_100077767 3300005543 Bacteria 2654
316 Ga0070672_100134435 3300005543 Bacteria 2036
317 Ga0070672_100166931 3300005543 Bacteria 1829
318 Ga0070672_100208143 3300005543 Bacteria 1637
319 Ga0070672_100237596 3300005543 Bacteria 1532
320 Ga0070696_100053019 3300005546 Bacteria 2822
321 Ga0070693_100005998 3300005547 Bacteria 5876
322 Ga0070693_100247166 3300005547 Bacteria 1181
323 Ga0070665_100000820 3300005548 Bacteria 40672
324 Ga0070665_100001414 3300005548 Bacteria 28192
325 Ga0070665_100002948 3300005548 Bacteria 18391
326 Ga0070665_100008161 3300005548 Bacteria 10600
327 Ga0070665_100010033 3300005548 Bacteria 9581
328 Ga0070665_100011572 3300005548 Bacteria 8921
329 Ga0070665_100021498 3300005548 Bacteria 6487
330 Ga0070665_100028966 3300005548 Bacteria 5574
331 Ga0070665_100029427 3300005548 Bacteria 5529
332 Ga0070665_100040818 3300005548 Bacteria 4664
333 Ga0070665_100086627 3300005548 Bacteria 3137
334 Ga0070665_100148488 3300005548 Bacteria 2347
335 Ga0070665_100152752 3300005548 Bacteria 2311
336 Ga0070665_100183971 3300005548 Bacteria 2090
337 Ga0068855_100000213 3300005563 Bacteria 73664
338 Ga0068855_100000318 3300005563 Bacteria 60020
339 Ga0068855_100000521 3300005563 Bacteria 47220
340 Ga0068855_100002532 3300005563 Bacteria 22527
341 Ga0068855_100023893 3300005563 Bacteria 7320
342 Ga0068855_100036195 3300005563 Bacteria 5877
343 Ga0068855_100123502 3300005563 Bacteria 2962
344 Ga0068855_100260587 3300005563 Bacteria 1931
345 Ga0068855_100284869 3300005563 Bacteria 1834
346 Ga0068855_100645099 3300005563 Bacteria 1138
347 Ga0068855_100692868 3300005563 Bacteria 1091
348 Ga0070664_100000968 3300005564 Bacteria 22475
349 Ga0070664_100001709 3300005564 Bacteria 17580
350 Ga0070664_100009914 3300005564 Bacteria 7722
351 Ga0070664_100049031 3300005564 Bacteria 3571
352 Ga0070664_100055882 3300005564 Bacteria 3354
353 Ga0070664_100076647 3300005564 Bacteria 2874
354 Ga0070664_100100110 3300005564 Bacteria 2519
355 Ga0070664_100152006 3300005564 Bacteria 2044
356 Ga0070664_100164141 3300005564 Bacteria 1967
357 Ga0070664_100197576 3300005564 Bacteria 1793
358 Ga0070664_100551193 3300005564 Bacteria 1066
359 Ga0068857_100004716 3300005577 Bacteria 11550
360 Ga0068857_100005165 3300005577 Bacteria 11100
361 Ga0068857_100014492 3300005577 Bacteria 6876
362 Ga0068857_100038979 3300005577 Bacteria 4207
363 Ga0068857_100045888 3300005577 Bacteria 3877
364 Ga0068857_100093063 3300005577 Bacteria 2699
365 Ga0068857_100093704 3300005577 Bacteria 2689
366 Ga0068857_100143881 3300005577 Bacteria 2156
367 Ga0068857_100286460 3300005577 Bacteria 1516
368 Ga0068854_100000305 3300005578 Bacteria 32355
369 Ga0068854_100003189 3300005578 Bacteria 10236
370 Ga0068854_100006279 3300005578 Bacteria 7555
371 Ga0068854_100024106 3300005578 Bacteria 4163
372 Ga0068854_100029377 3300005578 Bacteria 3805
373 Ga0068854_100030143 3300005578 Bacteria 3761
374 Ga0068854_100040802 3300005578 Bacteria 3276
375 Ga0068854_100060734 3300005578 Bacteria 2736
376 Ga0068854_100121159 3300005578 Bacteria 1986
377 Ga0068854_100148454 3300005578 Bacteria 1805
378 Ga0068856_100001632 3300005614 Bacteria 23502
379 Ga0068856_100025064 3300005614 Bacteria 5812
380 Ga0068856_100101998 3300005614 Bacteria 2862
381 Ga0068856_100150554 3300005614 Bacteria 2336
382 Ga0068856_100212485 3300005614 Bacteria 1950
383 Ga0068856_100280407 3300005614 Bacteria 1683
384 Ga0068852_100002104 3300005616 Bacteria 13614
385 Ga0068852_100020813 3300005616 Bacteria 5220
386 Ga0068852_100039096 3300005616 Bacteria 3992
387 Ga0068852_100052813 3300005616 Bacteria 3495
388 Ga0068852_100083537 3300005616 Bacteria 2840
389 Ga0068852_100284708 3300005616 Bacteria 1595
390 Ga0068852_100292679 3300005616 Bacteria 1573
391 Ga0068852_100302945 3300005616 Bacteria 1547
392 Ga0068852_100311771 3300005616 Bacteria 1526
393 Ga0068852_100423509 3300005616 Bacteria 1313
394 Ga0068859_100005841 3300005617 Bacteria 12496
395 Ga0068859_100006378 3300005617 Bacteria 11966
396 Ga0068859_100029513 3300005617 Bacteria 5503
397 Ga0068859_100031030 3300005617 Bacteria 5364
398 Ga0068859_100040182 3300005617 Bacteria 4696
399 Ga0068859_100045069 3300005617 Bacteria 4431
400 Ga0068859_100051254 3300005617 Bacteria 4148
401 Ga0068859_100058999 3300005617 Bacteria 3866
402 Ga0068859_100162427 3300005617 Bacteria 2313
403 Ga0068864_100000080 3300005618 Bacteria 102508
404 Ga0068864_100001030 3300005618 Bacteria 23336
405 Ga0068864_100004698 3300005618 Bacteria 11198
406 Ga0068864_100007742 3300005618 Bacteria 8852
407 Ga0068864_100038916 3300005618 Bacteria 4063
408 Ga0068864_100093056 3300005618 Bacteria 2662
409 Ga0068864_100454406 3300005618 Bacteria 1225
410 Ga0068866_10006755 3300005718 Bacteria 4784
411 Ga0068866_10069840 3300005718 Bacteria 1852
412 Ga0068866_10114689 3300005718 Bacteria 1509
413 Ga0068866_10166889 3300005718 Bacteria 1289
414 Ga0068861_100102730 3300005719 Bacteria 2276
415 Ga0068861_100149658 3300005719 Bacteria 1914
416 Ga0068851_10016688 3300005834 Bacteria 3518
417 Ga0068851_10036307 3300005834 Bacteria 2467
418 Ga0068870_10037909 3300005840 Bacteria 2487
419 Ga0068870_10053192 3300005840 Bacteria 2149
420 Ga0068863_100000001 3300005841 Bacteria 581116
421 Ga0068863_100000087 3300005841 Bacteria 102508
422 Ga0068863_100002281 3300005841 Bacteria 19065
423 Ga0068863_100003965 3300005841 Bacteria 14619
424 Ga0068863_100004857 3300005841 Bacteria 13244
425 Ga0068863_100006844 3300005841 Bacteria 11176
426 Ga0068863_100008188 3300005841 Bacteria 10212
427 Ga0068863_100010376 3300005841 Bacteria 9051
428 Ga0068863_100148037 3300005841 Bacteria 2246
429 Ga0068863_100277638 3300005841 Bacteria 1623
430 Ga0068858_100000640 3300005842 Bacteria 36414
431 Ga0068858_100003609 3300005842 Bacteria 15310
432 Ga0068858_100005629 3300005842 Bacteria 12250
433 Ga0068858_100006391 3300005842 Bacteria 11484
434 Ga0068858_100020002 3300005842 Bacteria 6261
435 Ga0068858_100026604 3300005842 Bacteria 5374
436 Ga0068858_100045039 3300005842 Bacteria 4088
437 Ga0068858_100303090 3300005842 Bacteria 1525
438 Ga0068858_100328231 3300005842 Bacteria 1463
439 Ga0068860_100000063 3300005843 Bacteria 189519
440 Ga0068860_100004665 3300005843 Bacteria 13989
441 Ga0068860_100006919 3300005843 Bacteria 11366
442 Ga0068860_100010469 3300005843 Bacteria 9168
443 Ga0068860_100019783 3300005843 Bacteria 6527
444 Ga0068860_100026751 3300005843 Bacteria 5559
445 Ga0068860_100042895 3300005843 Bacteria 4317
446 Ga0068860_100198246 3300005843 Bacteria 1945
447 Ga0068860_100322917 3300005843 Bacteria 1515
448 Ga0068862_100000101 3300005844 Bacteria 102508
449 Ga0068862_100010866 3300005844 Bacteria 7517
450 Ga0068862_100016220 3300005844 Bacteria 6198
451 Ga0068862_100018240 3300005844 Bacteria 5842
452 Ga0068862_100019444 3300005844 Bacteria 5669
453 Ga0068862_100070296 3300005844 Bacteria 3022
454 Ga0068862_100102414 3300005844 Bacteria 2506
455 Ga0068862_100102783 3300005844 Bacteria 2502
456 Ga0068862_100111639 3300005844 Bacteria 2400
457 Ga0068862_100138006 3300005844 Bacteria 2162
458 Ga0081455_10000049 3300005937 Bacteria 126459
459 Ga0081539_10046157 3300005985 Bacteria 2499
460 Ga0070717_10104913 3300006028 Bacteria 2405
461 Ga0070717_10631559 3300006028 Bacteria 972
462 Ga0070712_100084343 3300006175 Bacteria 2310
463 Ga0070712_100490843 3300006175 Bacteria 1028
464 Ga0097621_100015274 3300006237 Bacteria 5774
465 Ga0097621_100056087 3300006237 Bacteria 3218
466 Ga0097621_100079006 3300006237 Bacteria 2734
467 Ga0097621_100148176 3300006237 Bacteria 2011
468 Ga0097621_100175494 3300006237 Bacteria 1849
469 Ga0097621_100593006 3300006237 Bacteria 1012
470 Ga0075370_10111389 3300006353 Bacteria 1590
471 Ga0068871_100012038 3300006358 Bacteria 6366
472 Ga0068871_100017874 3300006358 Bacteria 5376
473 Ga0068871_100020727 3300006358 Bacteria 5040
474 Ga0068871_100184331 3300006358 Bacteria 1795
475 Ga0068871_100223985 3300006358 Bacteria 1630
476 Ga0075428_100729151 3300006844 Bacteria 1055
477 Ga0075434_100157772 3300006871 Bacteria 2288
478 Ga0068865_100007803 3300006881 Bacteria 6602
479 Ga0068865_100009141 3300006881 Bacteria 6133
480 Ga0068865_100029311 3300006881 Bacteria 3650
481 Ga0068865_100122431 3300006881 Bacteria 1936
482 Ga0068865_100332470 3300006881 Bacteria 1225
483 Ga0097620_100005841 3300006931 Bacteria 12496
484 Ga0097620_100006378 3300006931 Bacteria 11966
485 Ga0097620_100029513 3300006931 Bacteria 5503
486 Ga0097620_100031028 3300006931 Bacteria 5364
487 Ga0097620_100040181 3300006931 Bacteria 4696
488 Ga0097620_100045071 3300006931 Bacteria 4431
489 Ga0097620_100051254 3300006931 Bacteria 4148
490 Ga0097620_100059000 3300006931 Bacteria 3866
491 Ga0097620_100162414 3300006931 Bacteria 2313
492 Ga0075435_100380311 3300007076 Bacteria 1213
493 Ga0105251_10000248 3300009011 Bacteria 54567
494 Ga0105250_10003029 3300009092 Bacteria 8121
495 Ga0105250_10012130 3300009092 Bacteria 3565
496 Ga0105240_10012857 3300009093 Bacteria 11532
497 Ga0105240_10076090 3300009093 Bacteria 4139
498 Ga0105240_10231794 3300009093 Bacteria 2145
499 Ga0111539_10032274 3300009094 Bacteria 6360
500 Ga0111539_10229351 3300009094 Bacteria 2162
501 Ga0105245_10005132 3300009098 Bacteria 11506
502 Ga0105245_10048946 3300009098 Bacteria 3783
503 Ga0105245_10058155 3300009098 Bacteria 3479
504 Ga0105245_10115296 3300009098 Bacteria 2503
505 Ga0105245_10170761 3300009098 Bacteria 2071
506 Ga0105245_10430114 3300009098 Bacteria 1325
507 Ga0105247_10010992 3300009101 Bacteria 5464
508 Ga0105247_10013032 3300009101 Bacteria 4985
509 Ga0105247_10050241 3300009101 Bacteria 2565
510 Ga0114129_10327341 3300009147 Bacteria 2035
511 Ga0105243_10019063 3300009148 Bacteria 5202
512 Ga0105243_10034579 3300009148 Bacteria 3914
513 Ga0105243_10164162 3300009148 Bacteria 1918
514 Ga0105243_10362337 3300009148 Bacteria 1335
515 Ga0105241_10031750 3300009174 Bacteria 3955
516 Ga0105241_10124992 3300009174 Bacteria 2076
517 Ga0105241_10192205 3300009174 Bacteria 1700
518 Ga0105241_10215072 3300009174 Bacteria 1612
519 Ga0105242_10004511 3300009176 Bacteria 10810
520 Ga0105242_10079123 3300009176 Bacteria 2745
521 Ga0105242_10110316 3300009176 Bacteria 2344
522 Ga0105242_10340836 3300009176 Bacteria 1381
523 Ga0105248_10000029 3300009177 Bacteria 223366
524 Ga0105248_10002250 3300009177 Bacteria 21374
525 Ga0105248_10002307 3300009177 Bacteria 21143
526 Ga0105248_10002781 3300009177 Bacteria 19453
527 Ga0105248_10006178 3300009177 Bacteria 13129
528 Ga0105248_10036669 3300009177 Bacteria 5484
529 Ga0105248_10139697 3300009177 Bacteria 2733
530 Ga0105248_10271286 3300009177 Bacteria 1910
531 Ga0105248_10314815 3300009177 Bacteria 1763
532 Ga0105248_10315269 3300009177 Bacteria 1761
533 Ga0105248_10928122 3300009177 Bacteria 983
534 Ga0105248_10936614 3300009177 Bacteria 978
535 Ga0105237_10044899 3300009545 Bacteria 4449
536 Ga0105237_10110227 3300009545 Bacteria 2744
537 Ga0105237_10161427 3300009545 Bacteria 2240
538 Ga0105238_10001867 3300009551 Bacteria 21119
539 Ga0105238_10043720 3300009551 Bacteria 4532
540 Ga0105238_10051853 3300009551 Bacteria 4125
541 Ga0105238_10078488 3300009551 Bacteria 3291
542 Ga0105238_10091345 3300009551 Bacteria 3032
543 Ga0105238_10152378 3300009551 Bacteria 2287
544 Ga0105249_10000024 3300009553 Bacteria 232947
545 Ga0105249_10002467 3300009553 Bacteria 16034
546 Ga0105249_10004337 3300009553 Bacteria 12270
547 Ga0105249_10004830 3300009553 Bacteria 11634
548 Ga0105249_10014202 3300009553 Bacteria 7041
549 Ga0105249_10136781 3300009553 Bacteria 2345
550 Ga0105239_10000073 3300010375 Bacteria 140771
551 Ga0105239_10033368 3300010375 Bacteria 5654
552 Ga0105239_10075351 3300010375 Bacteria 3710
553 Ga0105239_10079188 3300010375 Bacteria 3616
554 Ga0105239_10190805 3300010375 Bacteria 2294
555 Ga0105239_10542246 3300010375 Bacteria 1324
556 Ga0105246_10022279 3300011119 Bacteria 4086
557 Ga0105246_10173911 3300011119 Bacteria 1652
558 Ga0105246_10197172 3300011119 Bacteria 1563
559 Ga0105246_10332686 3300011119 Bacteria 1238
560 Ga0157373_10006582 3300013100 Bacteria 8665
561 Ga0157373_10020484 3300013100 Bacteria 4806
562 Ga0157373_10025278 3300013100 Bacteria 4297
563 Ga0157373_10026230 3300013100 Bacteria 4211
564 Ga0157373_10027801 3300013100 Bacteria 4080
565 Ga0157373_10043186 3300013100 Bacteria 3220
566 Ga0157373_10049531 3300013100 Bacteria 2994
567 Ga0157373_10066690 3300013100 Bacteria 2545
568 Ga0157373_10076624 3300013100 Bacteria 2359
569 Ga0157373_10163160 3300013100 Bacteria 1568
570 Ga0157371_10000458 3300013102 Bacteria 50035
571 Ga0157371_10001382 3300013102 Bacteria 25447
572 Ga0157371_10013321 3300013102 Bacteria 6253
573 Ga0157371_10149178 3300013102 Bacteria 1667
574 Ga0157371_10295730 3300013102 Bacteria 1172
575 Ga0157371_10427211 3300013102 Bacteria 972
576 Ga0157371_10452648 3300013102 Bacteria 944
577 Ga0157370_10002797 3300013104 Bacteria 20845
578 Ga0157370_10019615 3300013104 Bacteria 6773
579 Ga0157370_10041443 3300013104 Bacteria 4441
580 Ga0157370_10049730 3300013104 Bacteria 4011
581 Ga0157370_10222562 3300013104 Bacteria 1748
582 Ga0157370_10548379 3300013104 Bacteria 1060
583 Ga0157369_10017309 3300013105 Bacteria 8102
584 Ga0157369_10130557 3300013105 Bacteria 2663
585 Ga0157369_10361188 3300013105 Bacteria 1508
586 Ga0157374_10084593 3300013296 Bacteria 3015
587 Ga0157374_10237560 3300013296 Bacteria 1791
588 Ga0157374_10324720 3300013296 Bacteria 1526
589 Ga0157374_10505298 3300013296 Bacteria 1214
590 Ga0157378_10006254 3300013297 Bacteria 10428
591 Ga0157378_10024372 3300013297 Bacteria 5323
592 Ga0157378_10029068 3300013297 Bacteria 4879
593 Ga0157378_10069363 3300013297 Bacteria 3162
594 Ga0157378_10151667 3300013297 Bacteria 2160
595 Ga0163162_10000236 3300013306 Bacteria 50620
596 Ga0163162_10004280 3300013306 Bacteria 13735
597 Ga0163162_10006810 3300013306 Bacteria 11086
598 Ga0163162_10011046 3300013306 Bacteria 8797
599 Ga0163162_10031373 3300013306 Bacteria 5271
600 Ga0163162_10031503 3300013306 Bacteria 5260
601 Ga0163162_10070176 3300013306 Bacteria 3555
602 Ga0163162_10075705 3300013306 Bacteria 3426
603 Ga0163162_10413489 3300013306 Bacteria 1481
604 Ga0163162_10566021 3300013306 Bacteria 1264
605 Ga0163162_10727798 3300013306 Bacteria 1113
606 Ga0157372_10020920 3300013307 Bacteria 7062
607 Ga0157372_10041579 3300013307 Bacteria 5083
608 Ga0157372_10060836 3300013307 Bacteria 4226
609 Ga0157372_10061988 3300013307 Bacteria 4188
610 Ga0157372_10155616 3300013307 Bacteria 2640
611 Ga0157372_10179235 3300013307 Bacteria 2453
612 Ga0157372_10180772 3300013307 Bacteria 2442
613 Ga0157372_10205378 3300013307 Bacteria 2283
614 Ga0157372_10209810 3300013307 Bacteria 2257
615 Ga0157372_10778988 3300013307 Bacteria 1112
616 Ga0157372_10792219 3300013307 Bacteria 1101
617 Ga0157375_10008048 3300013308 Bacteria 9225
618 Ga0157375_10081138 3300013308 Bacteria 3283
619 Ga0157375_10084118 3300013308 Bacteria 3229
620 Ga0157375_10107059 3300013308 Bacteria 2889
621 Ga0157375_10403669 3300013308 Bacteria 1533
622 Ga0157375_10580044 3300013308 Bacteria 1282
623 Ga0157375_10632127 3300013308 Bacteria 1228
624 Ga0157375_10672693 3300013308 Bacteria 1190
625 Ga0157375_10888356 3300013308 Bacteria 1036
626 Ga0163163_10000486 3300014325 Bacteria 35941
627 Ga0163163_10001185 3300014325 Bacteria 22098
628 Ga0163163_10012757 3300014325 Bacteria 7666
629 Ga0163163_10022986 3300014325 Bacteria 5911
630 Ga0163163_10395114 3300014325 Bacteria 1441
631 Ga0157380_10005490 3300014326 Bacteria 8860
632 Ga0157380_10141637 3300014326 Bacteria 2067
633 Ga0157380_10286323 3300014326 Bacteria 1510
634 Ga0157380_10512905 3300014326 Bacteria 1168
635 Ga0157377_10025880 3300014745 Bacteria 3133
636 Ga0157377_10087173 3300014745 Bacteria 1837
637 Ga0157379_10018945 3300014968 Bacteria 6075
638 Ga0157379_10031344 3300014968 Bacteria 4736
639 Ga0157379_10044790 3300014968 Bacteria 3949
640 Ga0157379_10052629 3300014968 Bacteria 3637
641 Ga0157379_10279636 3300014968 Bacteria 1519
642 Ga0157379_10576732 3300014968 Bacteria 1048
643 Ga0157376_10001808 3300014969 Bacteria 14227
644 Ga0163161_10022718 3300017792 Bacteria 4418
645 Ga0163161_10037732 3300017792 Bacteria 3464
646 Ga0213876_10097071 3300021384 Bacteria 1561
647 Ga0213875_10020131 3300021388 Bacteria 3201
648 Ga0228710_1006963 3300022740 Bacteria 16897
649 Ga0209437_100248 3300025233 Bacteria 86351
650 Ga0209148_1000112 3300025254 Bacteria 197101
651 Ga0209233_1000241 3300025261 Bacteria 90643
652 Ga0207697_10000246 3300025315 Bacteria 29770
653 Ga0207697_10003191 3300025315 Bacteria 8157
654 Ga0207697_10014993 3300025315 Bacteria 3207
655 Ga0207697_10086245 3300025315 Bacteria 1327
656 Ga0207656_10002352 3300025321 Bacteria 6351
657 Ga0207656_10059795 3300025321 Bacteria 1669
658 Ga0207656_10102569 3300025321 Bacteria 1313
659 Ga0207696_1004421 3300025711 Bacteria 6063
660 Ga0207696_1008638 3300025711 Bacteria 3871
661 Ga0207713_1001621 3300025735 Bacteria 17530
662 Ga0207713_1008424 3300025735 Bacteria 5944
663 Ga0207713_1053799 3300025735 Bacteria 1583
664 Ga0207682_10002359 3300025893 Bacteria 8512
665 Ga0207682_10004235 3300025893 Bacteria 6061
666 Ga0207682_10014123 3300025893 Bacteria 3112
667 Ga0207682_10076455 3300025893 Bacteria 1427
668 Ga0207692_10082900 3300025898 Bacteria 1719
669 Ga0207642_10238754 3300025899 Bacteria 1025
670 Ga0207688_10002836 3300025901 Bacteria 9419
671 Ga0207688_10119334 3300025901 Bacteria 1538
672 Ga0207688_10135246 3300025901 Bacteria 1447
673 Ga0207680_10000006 3300025903 Bacteria 635950
674 Ga0207680_10002124 3300025903 Bacteria 9277
675 Ga0207680_10034205 3300025903 Bacteria 2906
676 Ga0207680_10322023 3300025903 Bacteria 1081
677 Ga0207647_10000857 3300025904 Bacteria 23599
678 Ga0207647_10006623 3300025904 Bacteria 8416
679 Ga0207647_10009598 3300025904 Bacteria 6869
680 Ga0207647_10042088 3300025904 Bacteria 2868
681 Ga0207647_10050587 3300025904 Bacteria 2572
682 Ga0207647_10058366 3300025904 Bacteria 2363
683 Ga0207647_10064261 3300025904 Bacteria 2231
684 Ga0207647_10107077 3300025904 Bacteria 1655
685 Ga0207647_10108330 3300025904 Bacteria 1643
686 Ga0207699_10012730 3300025906 Bacteria 4284
687 Ga0207645_10001990 3300025907 Bacteria 16426
688 Ga0207645_10004977 3300025907 Bacteria 9736
689 Ga0207645_10059073 3300025907 Bacteria 2449
690 Ga0207645_10092732 3300025907 Bacteria 1943
691 Ga0207645_10115524 3300025907 Bacteria 1740
692 Ga0207645_10157160 3300025907 Bacteria 1486
693 Ga0207643_10017984 3300025908 Bacteria 3871
694 Ga0207705_10000014 3300025909 Bacteria 434286
695 Ga0207705_10000131 3300025909 Bacteria 81639
696 Ga0207705_10001170 3300025909 Bacteria 21351
697 Ga0207705_10001383 3300025909 Bacteria 19378
698 Ga0207705_10001949 3300025909 Bacteria 16132
699 Ga0207705_10005934 3300025909 Bacteria 9086
700 Ga0207705_10006298 3300025909 Bacteria 8809
701 Ga0207705_10014989 3300025909 Bacteria 5573
702 Ga0207705_10023036 3300025909 Bacteria 4442
703 Ga0207705_10025868 3300025909 Bacteria 4188
704 Ga0207705_10026848 3300025909 Bacteria 4104
705 Ga0207705_10040574 3300025909 Bacteria 3339
706 Ga0207705_10044981 3300025909 Bacteria 3173
707 Ga0207705_10232378 3300025909 Bacteria 1403
708 Ga0207705_10294640 3300025909 Bacteria 1243
709 Ga0207705_10349257 3300025909 Bacteria 1139
710 Ga0207707_10029535 3300025912 Bacteria 4794
711 Ga0207707_10051694 3300025912 Bacteria 3579
712 Ga0207707_10063189 3300025912 Bacteria 3222
713 Ga0207707_10067207 3300025912 Bacteria 3122
714 Ga0207707_10093841 3300025912 Bacteria 2622
715 Ga0207707_10237103 3300025912 Bacteria 1587
716 Ga0207695_10035048 3300025913 Bacteria 5447
717 Ga0207695_10110438 3300025913 Bacteria 2730
718 Ga0207695_10188493 3300025913 Bacteria 1981
719 Ga0207695_10213331 3300025913 Bacteria 1840
720 Ga0207671_10011024 3300025914 Bacteria 7400
721 Ga0207693_10034254 3300025915 Bacteria 4007
722 Ga0207660_10005969 3300025917 Bacteria 7908
723 Ga0207660_10172314 3300025917 Bacteria 1676
724 Ga0207660_10208045 3300025917 Bacteria 1531
725 Ga0207660_10335387 3300025917 Bacteria 1210
726 Ga0207662_10012396 3300025918 Bacteria 4746
727 Ga0207662_10114392 3300025918 Bacteria 1686
728 Ga0207657_10000181 3300025919 Bacteria 65099
729 Ga0207657_10001053 3300025919 Bacteria 29241
730 Ga0207657_10002754 3300025919 Bacteria 18921
731 Ga0207657_10004300 3300025919 Bacteria 15090
732 Ga0207657_10007378 3300025919 Bacteria 11280
733 Ga0207657_10008345 3300025919 Bacteria 10525
734 Ga0207657_10009307 3300025919 Bacteria 9893
735 Ga0207657_10013461 3300025919 Bacteria 8023
736 Ga0207657_10018700 3300025919 Bacteria 6603
737 Ga0207657_10032636 3300025919 Bacteria 4702
738 Ga0207657_10033269 3300025919 Bacteria 4649
739 Ga0207657_10081741 3300025919 Bacteria 2713
740 Ga0207657_10101765 3300025919 Bacteria 2384
741 Ga0207657_10251102 3300025919 Bacteria 1410
742 Ga0207657_10304218 3300025919 Bacteria 1263
743 Ga0207649_10001865 3300025920 Bacteria 12032
744 Ga0207649_10033738 3300025920 Bacteria 3061
745 Ga0207649_10042008 3300025920 Bacteria 2787
746 Ga0207649_10055965 3300025920 Bacteria 2461
747 Ga0207649_10067345 3300025920 Bacteria 2273
748 Ga0207649_10079631 3300025920 Bacteria 2117
749 Ga0207649_10134868 3300025920 Bacteria 1682
750 Ga0207649_10146139 3300025920 Bacteria 1623
751 Ga0207649_10183569 3300025920 Bacteria 1466
752 Ga0207649_10231759 3300025920 Bacteria 1321
753 Ga0207649_10243886 3300025920 Bacteria 1291
754 Ga0207649_10307175 3300025920 Bacteria 1161
755 Ga0207652_10008168 3300025921 Bacteria 8405
756 Ga0207652_10018191 3300025921 Bacteria 5760
757 Ga0207652_10103002 3300025921 Bacteria 2523
758 Ga0207652_10221233 3300025921 Bacteria 1706
759 Ga0207652_10272523 3300025921 Bacteria 1527
760 Ga0207652_10328695 3300025921 Bacteria 1380
761 Ga0207646_10081132 3300025922 Bacteria 2900
762 Ga0207681_10000144 3300025923 Bacteria 59200
763 Ga0207681_10000165 3300025923 Bacteria 54569
764 Ga0207681_10023302 3300025923 Bacteria 3958
765 Ga0207681_10027718 3300025923 Bacteria 3665
766 Ga0207681_10075460 3300025923 Bacteria 2365
767 Ga0207681_10438777 3300025923 Bacteria 1060
768 Ga0207681_10564245 3300025923 Bacteria 938
769 Ga0207694_10001181 3300025924 Bacteria 22601
770 Ga0207694_10006910 3300025924 Bacteria 8614
771 Ga0207694_10065590 3300025924 Bacteria 2831
772 Ga0207694_10067313 3300025924 Bacteria 2796
773 Ga0207694_10224236 3300025924 Bacteria 1534
774 Ga0207650_10000261 3300025925 Bacteria 56610
775 Ga0207650_10002113 3300025925 Bacteria 13881
776 Ga0207650_10009693 3300025925 Bacteria 6584
777 Ga0207650_10042981 3300025925 Bacteria 3315
778 Ga0207650_10071140 3300025925 Bacteria 2616
779 Ga0207650_10085126 3300025925 Bacteria 2404
780 Ga0207650_10096046 3300025925 Bacteria 2273
781 Ga0207650_10145066 3300025925 Bacteria 1869
782 Ga0207650_10216654 3300025925 Bacteria 1539
783 Ga0207650_10262052 3300025925 Bacteria 1402
784 Ga0207650_10280270 3300025925 Bacteria 1357
785 Ga0207650_10287416 3300025925 Bacteria 1340
786 Ga0207650_10347058 3300025925 Bacteria 1220
787 Ga0207650_10364159 3300025925 Bacteria 1191
788 Ga0207659_10005777 3300025926 Bacteria 7540
789 Ga0207659_10117903 3300025926 Bacteria 2029
790 Ga0207659_10567969 3300025926 Bacteria 965
791 Ga0207687_10041239 3300025927 Bacteria 3168
792 Ga0207687_10115714 3300025927 Bacteria 1998
793 Ga0207700_10057657 3300025928 Bacteria 2930
794 Ga0207664_10014169 3300025929 Bacteria 5750
795 Ga0207664_10114716 3300025929 Bacteria 2245
796 Ga0207664_10318852 3300025929 Bacteria 1371
797 Ga0207644_10000012 3300025931 Bacteria 186652
798 Ga0207644_10001127 3300025931 Bacteria 17116
799 Ga0207644_10021715 3300025931 Bacteria 4377
800 Ga0207644_10024537 3300025931 Bacteria 4141
801 Ga0207644_10028462 3300025931 Bacteria 3869
802 Ga0207644_10045508 3300025931 Bacteria 3122
803 Ga0207644_10079073 3300025931 Bacteria 2425
804 Ga0207644_10137064 3300025931 Bacteria 1880
805 Ga0207644_10161327 3300025931 Bacteria 1743
806 Ga0207644_10229762 3300025931 Bacteria 1474
807 Ga0207644_10301540 3300025931 Bacteria 1291
808 Ga0207690_10001504 3300025932 Bacteria 14569
809 Ga0207690_10002175 3300025932 Bacteria 11956
810 Ga0207690_10006599 3300025932 Bacteria 6872
811 Ga0207690_10008161 3300025932 Bacteria 6215
812 Ga0207690_10009287 3300025932 Bacteria 5844
813 Ga0207690_10020816 3300025932 Bacteria 4059
814 Ga0207690_10036014 3300025932 Bacteria 3202
815 Ga0207690_10042864 3300025932 Bacteria 2975
816 Ga0207690_10104737 3300025932 Bacteria 2027
817 Ga0207690_10110368 3300025932 Bacteria 1980
818 Ga0207690_10246173 3300025932 Bacteria 1379
819 Ga0207690_10341999 3300025932 Bacteria 1181
820 Ga0207706_10000143 3300025933 Bacteria 77680
821 Ga0207706_10000782 3300025933 Bacteria 32972
822 Ga0207706_10003940 3300025933 Bacteria 14068
823 Ga0207706_10012729 3300025933 Bacteria 7658
824 Ga0207706_10015530 3300025933 Bacteria 6880
825 Ga0207706_10018790 3300025933 Bacteria 6217
826 Ga0207706_10019344 3300025933 Bacteria 6125
827 Ga0207706_10019976 3300025933 Bacteria 6020
828 Ga0207706_10023922 3300025933 Bacteria 5480
829 Ga0207706_10043950 3300025933 Bacteria 3959
830 Ga0207706_10048860 3300025933 Bacteria 3741
831 Ga0207706_10124592 3300025933 Bacteria 2267
832 Ga0207706_10133138 3300025933 Bacteria 2186
833 Ga0207706_10348212 3300025933 Bacteria 1288
834 Ga0207686_10025415 3300025934 Bacteria 3444
835 Ga0207686_10248801 3300025934 Bacteria 1298
836 Ga0207709_10017667 3300025935 Bacteria 3984
837 Ga0207709_10233076 3300025935 Bacteria 1335
838 Ga0207669_10001146 3300025937 Bacteria 11310
839 Ga0207669_10002845 3300025937 Bacteria 7419
840 Ga0207669_10004373 3300025937 Bacteria 6212
841 Ga0207669_10006738 3300025937 Bacteria 5272
842 Ga0207669_10082671 3300025937 Bacteria 2062
843 Ga0207669_10455108 3300025937 Bacteria 1015
844 Ga0207704_10024353 3300025938 Bacteria 3281
845 Ga0207704_10095134 3300025938 Bacteria 1969
846 Ga0207691_10002229 3300025940 Bacteria 18967
847 Ga0207691_10002373 3300025940 Bacteria 18448
848 Ga0207691_10005303 3300025940 Bacteria 12441
849 Ga0207691_10009242 3300025940 Bacteria 9459
850 Ga0207691_10013146 3300025940 Bacteria 7925
851 Ga0207691_10046274 3300025940 Bacteria 3999
852 Ga0207691_10061342 3300025940 Bacteria 3416
853 Ga0207691_10068436 3300025940 Bacteria 3208
854 Ga0207691_10076796 3300025940 Bacteria 3010
855 Ga0207691_10142485 3300025940 Bacteria 2111
856 Ga0207691_10163917 3300025940 Bacteria 1948
857 Ga0207711_10000004 3300025941 Bacteria 870636
858 Ga0207711_10001346 3300025941 Bacteria 23189
859 Ga0207711_10010120 3300025941 Bacteria 7835
860 Ga0207711_10018522 3300025941 Bacteria 5789
861 Ga0207711_10021813 3300025941 Bacteria 5349
862 Ga0207711_10043198 3300025941 Bacteria 3844
863 Ga0207711_10053063 3300025941 Bacteria 3477
864 Ga0207711_10147366 3300025941 Bacteria 2121
865 Ga0207689_10000665 3300025942 Bacteria 32784
866 Ga0207689_10004224 3300025942 Bacteria 13061
867 Ga0207689_10095664 3300025942 Bacteria 2439
868 Ga0207661_10003391 3300025944 Bacteria 11058
869 Ga0207661_10006246 3300025944 Bacteria 8426
870 Ga0207661_10208306 3300025944 Bacteria 1722
871 Ga0207679_10001455 3300025945 Bacteria 14860
872 Ga0207679_10002000 3300025945 Bacteria 12653
873 Ga0207679_10018158 3300025945 Bacteria 4707
874 Ga0207679_10048447 3300025945 Bacteria 3094
875 Ga0207679_10099108 3300025945 Bacteria 2274
876 Ga0207679_10123652 3300025945 Bacteria 2064
877 Ga0207679_10125468 3300025945 Bacteria 2051
878 Ga0207679_10132251 3300025945 Bacteria 2003
879 Ga0207679_10196378 3300025945 Bacteria 1682
880 Ga0207679_10314109 3300025945 Bacteria 1355
881 Ga0207667_10000007 3300025949 Bacteria 630590
882 Ga0207667_10000586 3300025949 Bacteria 47384
883 Ga0207667_10002477 3300025949 Bacteria 23008
884 Ga0207667_10003727 3300025949 Bacteria 18794
885 Ga0207667_10032356 3300025949 Bacteria 5637
886 Ga0207667_10056836 3300025949 Bacteria 4108
887 Ga0207667_10128501 3300025949 Bacteria 2610
888 Ga0207667_10140224 3300025949 Bacteria 2489
889 Ga0207667_10201258 3300025949 Bacteria 2043
890 Ga0207667_10298950 3300025949 Bacteria 1644
891 Ga0207651_10009980 3300025960 Bacteria 5234
892 Ga0207651_10012586 3300025960 Bacteria 4796
893 Ga0207651_10048916 3300025960 Bacteria 2861
894 Ga0207651_10131387 3300025960 Bacteria 1917
895 Ga0207651_10490945 3300025960 Bacteria 1060
896 Ga0207712_10000034 3300025961 Bacteria 202320
897 Ga0207712_10000566 3300025961 Bacteria 29904
898 Ga0207712_10024343 3300025961 Bacteria 4008
899 Ga0207712_10164512 3300025961 Bacteria 1727
900 Ga0207668_10000056 3300025972 Bacteria 93913
901 Ga0207668_10000559 3300025972 Bacteria 23334
902 Ga0207668_10003038 3300025972 Bacteria 9840
903 Ga0207668_10003063 3300025972 Bacteria 9800
904 Ga0207668_10030859 3300025972 Bacteria 3525
905 Ga0207668_10031037 3300025972 Bacteria 3516
906 Ga0207668_10124432 3300025972 Bacteria 1958
907 Ga0207640_10000253 3300025981 Bacteria 36380
908 Ga0207640_10002766 3300025981 Bacteria 9391
909 Ga0207640_10005579 3300025981 Bacteria 6861
910 Ga0207640_10007992 3300025981 Bacteria 5843
911 Ga0207640_10010192 3300025981 Bacteria 5283
912 Ga0207640_10017297 3300025981 Bacteria 4217
913 Ga0207640_10035191 3300025981 Bacteria 3132
914 Ga0207640_10053846 3300025981 Bacteria 2628
915 Ga0207640_10133581 3300025981 Bacteria 1797
916 Ga0207640_10312010 3300025981 Bacteria 1248
917 Ga0207658_10000216 3300025986 Bacteria 60563
918 Ga0207658_10000239 3300025986 Bacteria 57662
919 Ga0207658_10000343 3300025986 Bacteria 46090
920 Ga0207658_10000444 3300025986 Bacteria 38999
921 Ga0207658_10000967 3300025986 Bacteria 23707
922 Ga0207658_10007597 3300025986 Bacteria 7386
923 Ga0207658_10022705 3300025986 Bacteria 4370
924 Ga0207658_10023093 3300025986 Bacteria 4337
925 Ga0207658_10024781 3300025986 Bacteria 4198
926 Ga0207658_10149044 3300025986 Bacteria 1903
927 Ga0207658_10217721 3300025986 Bacteria 1604
928 Ga0207658_10227254 3300025986 Bacteria 1573
929 Ga0207677_10002262 3300026023 Bacteria 10104
930 Ga0207677_10016517 3300026023 Bacteria 4375
931 Ga0207677_10072946 3300026023 Bacteria 2429
932 Ga0207703_10002300 3300026035 Bacteria 16667
933 Ga0207703_10003318 3300026035 Bacteria 13514
934 Ga0207703_10011785 3300026035 Bacteria 6805
935 Ga0207703_10040753 3300026035 Bacteria 3718
936 Ga0207703_10245738 3300026035 Bacteria 1611
937 Ga0207639_10000444 3300026041 Bacteria 28699
938 Ga0207639_10000866 3300026041 Bacteria 20550
939 Ga0207639_10006681 3300026041 Bacteria 7847
940 Ga0207639_10019480 3300026041 Bacteria 4841
941 Ga0207639_10092771 3300026041 Bacteria 2420
942 Ga0207639_10109625 3300026041 Bacteria 2247
943 Ga0207639_10160979 3300026041 Bacteria 1891
944 Ga0207639_10209751 3300026041 Bacteria 1676
945 Ga0207639_10221194 3300026041 Bacteria 1635
946 Ga0207639_10221226 3300026041 Bacteria 1635
947 Ga0207639_10240277 3300026041 Bacteria 1574
948 Ga0207639_10341486 3300026041 Bacteria 1335
949 Ga0207639_10560781 3300026041 Bacteria 1049
950 Ga0207678_10000774 3300026067 Bacteria 29166
951 Ga0207678_10001883 3300026067 Bacteria 19132
952 Ga0207678_10009002 3300026067 Bacteria 8786
953 Ga0207678_10018567 3300026067 Bacteria 6106
954 Ga0207678_10024573 3300026067 Bacteria 5263
955 Ga0207678_10035965 3300026067 Bacteria 4311
956 Ga0207678_10040551 3300026067 Bacteria 4038
957 Ga0207678_10067882 3300026067 Bacteria 3060
958 Ga0207678_10099782 3300026067 Bacteria 2480
959 Ga0207678_10099945 3300026067 Bacteria 2478
960 Ga0207678_10156896 3300026067 Bacteria 1943
961 Ga0207678_10421348 3300026067 Bacteria 1158
962 Ga0207702_10001633 3300026078 Bacteria 22174
963 Ga0207702_10058050 3300026078 Bacteria 3292
964 Ga0207702_10102102 3300026078 Bacteria 2534
965 Ga0207702_10350595 3300026078 Bacteria 1412
966 Ga0207641_10000001 3300026088 Bacteria 1180841
967 Ga0207641_10000010 3300026088 Bacteria 402193
968 Ga0207641_10000659 3300026088 Bacteria 37671
969 Ga0207641_10001414 3300026088 Bacteria 23667
970 Ga0207641_10002153 3300026088 Bacteria 18557
971 Ga0207641_10042461 3300026088 Bacteria 3815
972 Ga0207641_10116498 3300026088 Bacteria 2377
973 Ga0207641_10244677 3300026088 Bacteria 1673
974 Ga0207641_10427660 3300026088 Bacteria 1276
975 Ga0207648_10001222 3300026089 Bacteria 28812
976 Ga0207648_10004660 3300026089 Bacteria 14032
977 Ga0207648_10007531 3300026089 Bacteria 10687
978 Ga0207648_10013607 3300026089 Bacteria 7557
979 Ga0207648_10019760 3300026089 Bacteria 6079
980 Ga0207648_10048084 3300026089 Bacteria 3736
981 Ga0207648_10050544 3300026089 Bacteria 3635
982 Ga0207648_10156640 3300026089 Bacteria 2011
983 Ga0207648_10550877 3300026089 Bacteria 1059
984 Ga0207676_10000036 3300026095 Bacteria 198447
985 Ga0207676_10001085 3300026095 Bacteria 20668
986 Ga0207676_10022970 3300026095 Bacteria 4593
987 Ga0207676_10038135 3300026095 Bacteria 3665
988 Ga0207676_10075761 3300026095 Bacteria 2716
989 Ga0207674_10000347 3300026116 Bacteria 59568
990 Ga0207674_10007038 3300026116 Bacteria 13151
991 Ga0207674_10015519 3300026116 Bacteria 8367
992 Ga0207674_10016538 3300026116 Bacteria 8069
993 Ga0207674_10022183 3300026116 Bacteria 6824
994 Ga0207674_10028879 3300026116 Bacteria 5846
995 Ga0207674_10055246 3300026116 Bacteria 4038
996 Ga0207674_10113888 3300026116 Bacteria 2677
997 Ga0207674_10194749 3300026116 Bacteria 1977
998 Ga0207674_10225038 3300026116 Bacteria 1824
999 Ga0207674_10291385 3300026116 Bacteria 1581
1000 Ga0207675_100119961 3300026118 Bacteria 2488
1001 Ga0207675_100185924 3300026118 Bacteria 1991
1002 Ga0207683_10003742 3300026121 Bacteria 13201
1003 Ga0207683_10004977 3300026121 Bacteria 11426
1004 Ga0207683_10005122 3300026121 Bacteria 11250
1005 Ga0207683_10009327 3300026121 Bacteria 8360
1006 Ga0207683_10087429 3300026121 Bacteria 2772
1007 Ga0207683_10106175 3300026121 Bacteria 2511
1008 Ga0207683_10223237 3300026121 Bacteria 1717
1009 Ga0207683_10406009 3300026121 Bacteria 1254
1010 Ga0207698_10003914 3300026142 Bacteria 9019
1011 Ga0207698_10004362 3300026142 Bacteria 8613
1012 Ga0207698_10012797 3300026142 Bacteria 5508
1013 Ga0207698_10040390 3300026142 Bacteria 3466
1014 Ga0207698_10047016 3300026142 Bacteria 3265
1015 Ga0207698_10056574 3300026142 Bacteria 3029
1016 Ga0207698_10086309 3300026142 Bacteria 2552
1017 Ga0207698_10180474 3300026142 Bacteria 1869
1018 Ga0207698_10503072 3300026142 Bacteria 1179
1019 Ga0209969_1002048 3300027360 Bacteria 2779
1020 Ga0209967_1000454 3300027364 Bacteria 5389
1021 Ga0209981_1000559 3300027378 Bacteria 4744
1022 Ga0210000_1000657 3300027462 Bacteria 4762
1023 Ga0210000_1015533 3300027462 Bacteria 1147
1024 Ga0209995_1006673 3300027471 Bacteria 1855
1025 Ga0209970_1020031 3300027614 Bacteria 1129
1026 Ga0209974_10001178 3300027876 Bacteria 9337
1027 Ga0209974_10014651 3300027876 Bacteria 2607
1028 Ga0209974_10067119 3300027876 Bacteria 1220
1029 Ga0207428_10075628 3300027907 Bacteria 2638
1030 Ga0268266_10000021 3300028379 Bacteria 522453
1031 Ga0268266_10000950 3300028379 Bacteria 36937
1032 Ga0268266_10001749 3300028379 Bacteria 24846
1033 Ga0268266_10003294 3300028379 Bacteria 16233
1034 Ga0268266_10004866 3300028379 Bacteria 12739
1035 Ga0268266_10014246 3300028379 Bacteria 6838
1036 Ga0268266_10019637 3300028379 Bacteria 5758
1037 Ga0268266_10034830 3300028379 Bacteria 4283
1038 Ga0268266_10090011 3300028379 Bacteria 2689
1039 Ga0268266_10109071 3300028379 Bacteria 2450
1040 Ga0268266_10118461 3300028379 Bacteria 2354
1041 Ga0268266_10225469 3300028379 Bacteria 1724
1042 Ga0268266_10407086 3300028379 Bacteria 1287
1043 Ga0268265_10000059 3300028380 Bacteria 152531
1044 Ga0268265_10016352 3300028380 Bacteria 5095
1045 Ga0268265_10017515 3300028380 Bacteria 4945
1046 Ga0268265_10040065 3300028380 Bacteria 3457
1047 Ga0268265_10044753 3300028380 Bacteria 3298
1048 Ga0268265_10046520 3300028380 Bacteria 3244
1049 Ga0268265_10048490 3300028380 Bacteria 3188
1050 Ga0268265_10068825 3300028380 Bacteria 2747
1051 Ga0268264_10000083 3300028381 Bacteria 245366
1052 Ga0268264_10001923 3300028381 Bacteria 18729
1053 Ga0268264_10003279 3300028381 Bacteria 13994
1054 Ga0268264_10015638 3300028381 Bacteria 6215
1055 Ga0268264_10040519 3300028381 Bacteria 3848
1056 Ga0268264_10048575 3300028381 Bacteria 3530
1057 Ga0268264_10080771 3300028381 Bacteria 2777
1058 Ga0268264_10144360 3300028381 Bacteria 2126
1059 Ga0268264_10211174 3300028381 Bacteria 1782
1060 Ga0268264_10259361 3300028381 Bacteria 1618
1061 Ga0268264_10360032 3300028381 Bacteria 1387
1062 Ga0268264_10450042 3300028381 Bacteria 1247
1063 Ga0265336_10001095 3300028666 Bacteria 13067
1064 Ga0307515_10099369 3300028794 Bacteria 3534
1065 Ga0265324_10000034 3300029957 Bacteria 124255
1066 Ga0316180_1000793 3300030736 Bacteria 1325
1067 Ga0316182_1441032 3300030745 Bacteria 2542
1068 Ga0265330_10010943 3300031235 Bacteria 4262
1069 Ga0265332_10002472 3300031238 Bacteria 9407
1070 Ga0265325_10001197 3300031241 Bacteria 18482
1071 Ga0265325_10008469 3300031241 Bacteria 6067
1072 Ga0265325_10056177 3300031241 Bacteria 2011
1073 Ga0265331_10002231 3300031250 Bacteria 13263
1074 Ga0265331_10014874 3300031250 Bacteria 4127
1075 Ga0265327_10028307 3300031251 Bacteria 3208
1076 Ga0265316_10014713 3300031344 Bacteria 6871
1077 Ga0265316_10079046 3300031344 Bacteria 2524
1078 Ga0307408_100047586 3300031548 Bacteria 3072
1079 Ga0307408_100098350 3300031548 Bacteria 2224
1080 Ga0307408_100145546 3300031548 Bacteria 1865
1081 Ga0307408_100254979 3300031548 Bacteria 1449
1082 Ga0307408_100278304 3300031548 Bacteria 1392
1083 Ga0307408_100326230 3300031548 Bacteria 1295
1084 Ga0316575_10000032 3300031665 Bacteria 33845
1085 Ga0316575_10013342 3300031665 Bacteria 3068
1086 Ga0316575_10043791 3300031665 Bacteria 1775
1087 Ga0316575_10092843 3300031665 Bacteria 1223
1088 Ga0265314_10000455 3300031711 Bacteria 54619
1089 Ga0265314_10015711 3300031711 Bacteria 5998
1090 Ga0265314_10097282 3300031711 Bacteria 1902
1091 Ga0316576_10090648 3300031727 Bacteria 2277
1092 Ga0316576_10195538 3300031727 Bacteria 1524
1093 Ga0307405_10002851 3300031731 Bacteria 7771
1094 Ga0307405_10004996 3300031731 Bacteria 6340
1095 Ga0307405_10013091 3300031731 Bacteria 4416
1096 Ga0307405_10025213 3300031731 Bacteria 3409
1097 Ga0307405_10140658 3300031731 Bacteria 1682
1098 Ga0307405_10144681 3300031731 Bacteria 1663
1099 Ga0307405_10168830 3300031731 Bacteria 1558
1100 Ga0307405_10212469 3300031731 Bacteria 1413
1101 Ga0307405_10558617 3300031731 Bacteria 927
1102 Ga0307413_10002690 3300031824 Bacteria 7287
1103 Ga0307413_10015649 3300031824 Bacteria 3894
1104 Ga0307413_10024069 3300031824 Bacteria 3312
1105 Ga0307413_10041411 3300031824 Bacteria 2697
1106 Ga0307413_10112114 3300031824 Bacteria 1828
1107 Ga0307413_10133124 3300031824 Bacteria 1705
1108 Ga0307413_10398562 3300031824 Bacteria 1077
1109 Ga0307413_10409926 3300031824 Bacteria 1064
1110 Ga0307410_10000697 3300031852 Bacteria 13997
1111 Ga0307410_10000804 3300031852 Bacteria 13283
1112 Ga0307410_10001364 3300031852 Bacteria 10970
1113 Ga0307410_10008085 3300031852 Bacteria 5811
1114 Ga0307410_10016234 3300031852 Bacteria 4436
1115 Ga0307410_10035061 3300031852 Bacteria 3256
1116 Ga0307410_10053311 3300031852 Bacteria 2736
1117 Ga0307410_10101728 3300031852 Bacteria 2061
1118 Ga0307410_10111612 3300031852 Bacteria 1979
1119 Ga0307410_10114749 3300031852 Bacteria 1955
1120 Ga0307410_10117562 3300031852 Bacteria 1933
1121 Ga0307410_10251925 3300031852 Bacteria 1373
1122 Ga0307406_10014377 3300031901 Bacteria 4553
1123 Ga0307406_10015068 3300031901 Bacteria 4465
1124 Ga0307406_10043819 3300031901 Bacteria 2801
1125 Ga0307406_10075409 3300031901 Bacteria 2225
1126 Ga0307406_10112341 3300031901 Bacteria 1878
1127 Ga0307406_10262522 3300031901 Bacteria 1307
1128 Ga0307407_10021781 3300031903 Bacteria 3313
1129 Ga0307407_10038679 3300031903 Bacteria 2646
1130 Ga0307407_10085186 3300031903 Bacteria 1922
1131 Ga0307407_10284123 3300031903 Bacteria 1147
1132 Ga0307412_10002603 3300031911 Bacteria 10024
1133 Ga0307412_10009423 3300031911 Bacteria 5603
1134 Ga0307412_10010038 3300031911 Bacteria 5446
1135 Ga0307412_10025472 3300031911 Bacteria 3665
1136 Ga0307412_10058014 3300031911 Bacteria 2587
1137 Ga0307412_10065102 3300031911 Bacteria 2465
1138 Ga0307412_10123293 3300031911 Bacteria 1870
1139 Ga0307412_10140762 3300031911 Bacteria 1766
1140 Ga0307412_10310006 3300031911 Bacteria 1251
1141 Ga0307409_100000935 3300031995 Bacteria 13587
1142 Ga0307409_100016171 3300031995 Bacteria 4927
1143 Ga0307409_100041395 3300031995 Bacteria 3440
1144 Ga0307409_100044321 3300031995 Bacteria 3349
1145 Ga0307409_100046960 3300031995 Bacteria 3273
1146 Ga0307409_100056449 3300031995 Bacteria 3037
1147 Ga0307409_100120135 3300031995 Bacteria 2224
1148 Ga0307409_100199359 3300031995 Bacteria 1789
1149 Ga0307409_100278546 3300031995 Bacteria 1544
1150 Ga0307409_100285461 3300031995 Bacteria 1528
1151 Ga0307409_100306395 3300031995 Bacteria 1480
1152 Ga0307409_100650341 3300031995 Bacteria 1048
1153 Ga0307416_100010035 3300032002 Bacteria 6237
1154 Ga0307416_100014257 3300032002 Bacteria 5437
1155 Ga0307416_100014367 3300032002 Bacteria 5422
1156 Ga0307416_100024296 3300032002 Bacteria 4419
1157 Ga0307416_100057735 3300032002 Bacteria 3142
1158 Ga0307416_100158528 3300032002 Bacteria 2087
1159 Ga0307416_100181399 3300032002 Bacteria 1974
1160 Ga0307416_100505050 3300032002 Bacteria 1274
1161 Ga0307414_10003237 3300032004 Bacteria 8671
1162 Ga0307414_10015198 3300032004 Bacteria 4641
1163 Ga0307414_10037025 3300032004 Bacteria 3263
1164 Ga0307414_10048127 3300032004 Bacteria 2939
1165 Ga0307414_10052399 3300032004 Bacteria 2840
1166 Ga0307414_10121647 3300032004 Bacteria 2008
1167 Ga0307414_10124425 3300032004 Bacteria 1989
1168 Ga0307414_10241522 3300032004 Bacteria 1495
1169 Ga0307414_10445556 3300032004 Bacteria 1134
1170 Ga0307414_10542439 3300032004 Bacteria 1035
1171 Ga0307411_10001280 3300032005 Bacteria 10084
1172 Ga0307411_10002581 3300032005 Bacteria 8081
1173 Ga0307411_10002763 3300032005 Bacteria 7889
1174 Ga0307411_10013055 3300032005 Bacteria 4564
1175 Ga0307411_10032713 3300032005 Bacteria 3216
1176 Ga0307411_10061547 3300032005 Bacteria 2499
1177 Ga0307411_10130433 3300032005 Bacteria 1836
1178 Ga0307411_10137379 3300032005 Bacteria 1797
1179 Ga0307411_10185196 3300032005 Bacteria 1584
1180 Ga0307411_10222872 3300032005 Bacteria 1464
1181 Ga0307411_10229719 3300032005 Bacteria 1445
1182 Ga0307415_100006043 3300032126 Bacteria 6488
1183 Ga0307415_100008943 3300032126 Bacteria 5583
1184 Ga0307415_100009323 3300032126 Bacteria 5494
1185 Ga0307415_100012933 3300032126 Bacteria 4850
1186 Ga0307415_100165571 3300032126 Bacteria 1718
1187 Ga0307415_100234936 3300032126 Bacteria 1479
1188 Ga0307415_100269365 3300032126 Bacteria 1394
1189 Ga0307415_100293719 3300032126 Bacteria 1343
1190 Ga0307415_100477456 3300032126 Bacteria 1084
1191 Ga0307415_100532337 3300032126 Bacteria 1033
1192 Ga0316583_10000448 3300032133 Bacteria 12133
1193 Ga0316583_10016234 3300032133 Bacteria 2680
1194 Ga0316583_10017114 3300032133 Bacteria 2607
1195 Ga0316593_10014409 3300032168 Bacteria 2357
1196 Ga0307510_10014110 3300033180 Bacteria 9461
1197 Ga0307510_10064550 3300033180 Bacteria 3718
1198 Ga0373934_0001489 3300035086 Bacteria 8598
1199 Ga0373934_0018133 3300035086 Bacteria 2692
1200 Ga0373951_0022131 3300035091 Bacteria 1462
1201 Ga0373954_0001519 3300035118 Bacteria 9437
1202 Ga0373954_0001895 3300035118 Bacteria 8640
1203 Ga0373956_0000015 3300035119 Bacteria 52635
1204 Ga0373957_0010494 3300035120 Bacteria 3064
1205 Ga0373960_0080568 3300035121 Bacteria 1024
1206 Ga0373943_0086436 3300035170 Bacteria 1617
1207 Ga0373946_0015802 3300035171 Bacteria 2868
1208 Ga0373955_0058383 3300035172 Bacteria 2123
1209 Ga0373955_0106145 3300035172 Bacteria 1619
1210 Ga0316574_0000632 3300035398 Bacteria 14731
1211 Ga0373931_0094209 3300035691 Bacteria 1674
1212 Ga0373933_0000194 3300035724 Bacteria 40439
1213 Ga0373937_0000182 3300036401 Bacteria 61628
1214 Ga0373937_0028802 3300036401 Bacteria 5029
1215 Ga0373937_0043741 3300036401 Bacteria 4090
1216 Ga0316582_0004691 3300036647 Bacteria 6949
1217 Ga0316582_0008317 3300036647 Bacteria 5570
1218 Ga0316582_0012361 3300036647 Bacteria 4761
1219 Ga0316582_0300241 3300036647 Bacteria 1103
1220 Ga0395899_0000548 3300037312 Bacteria 40528
1221 Ga0395899_0000759 3300037312 Bacteria 31923
1222 Ga0395899_0002320 3300037312 Bacteria 15509
1223 Ga0395899_0058962 3300037312 Bacteria 2830
1224 Ga0395899_0059781 3300037312 Bacteria 2809
1225 Ga0395899_0068267 3300037312 Bacteria 2607
1226 Ga0395899_0142474 3300037312 Bacteria 1704
1227 Ga0395899_0151766 3300037312 Bacteria 1641
1228 Ga0395899_0177806 3300037312 Bacteria 1495
1229 Ga0395900_0000036 3300037418 Bacteria 250619
1230 Ga0395900_0000130 3300037418 Bacteria 126231
1231 Ga0395900_0007644 3300037418 Bacteria 11158
1232 Ga0395900_0012943 3300037418 Bacteria 8523
1233 Ga0395900_0028632 3300037418 Bacteria 5710
1234 Ga0395900_0043360 3300037418 Bacteria 4637
1235 Ga0395900_0066496 3300037418 Bacteria 3703
1236 Ga0395900_0096909 3300037418 Bacteria 3030
1237 Ga0395900_0106953 3300037418 Bacteria 2874
1238 Ga0395900_0114356 3300037418 Bacteria 2769
1239 Ga0395900_0123675 3300037418 Bacteria 2653
1240 Ga0395900_0135467 3300037418 Bacteria 2523
1241 Ga0395900_0166320 3300037418 Bacteria 2247
1242 Ga0395900_0210441 3300037418 Bacteria 1963
1243 Ga0395900_0221769 3300037418 Bacteria 1905
1244 Ga0395900_0236819 3300037418 Bacteria 1833
1245 Ga0395900_0249920 3300037418 Bacteria 1775
1246 Ga0395900_0386958 3300037418 Bacteria 1365
1247 Ga0395898_0000274 3300037466 Bacteria 125922
1248 Ga0395898_0006106 3300037466 Bacteria 12914
1249 Ga0395898_0019937 3300037466 Bacteria 6818
1250 Ga0395898_0022022 3300037466 Bacteria 6456
1251 Ga0395898_0104650 3300037466 Bacteria 2714
1252 Ga0395898_0121056 3300037466 Bacteria 2507
1253 Ga0395898_0142056 3300037466 Bacteria 2298
1254 Ga0395898_0196155 3300037466 Bacteria 1928
1255 Ga0395898_0313214 3300037466 Bacteria 1497
1256 Ga0395898_0342595 3300037466 Bacteria 1425
1257 Ga0395905_0000006 3300037471 Bacteria 549428
1258 Ga0395905_0001816 3300037471 Bacteria 24696
1259 Ga0395905_0002188 3300037471 Bacteria 22082
1260 Ga0395905_0010405 3300037471 Bacteria 9056
1261 Ga0395905_0012104 3300037471 Bacteria 8311
1262 Ga0395905_0014935 3300037471 Bacteria 7408
1263 Ga0395905_0026955 3300037471 Bacteria 5419
1264 Ga0395905_0049828 3300037471 Bacteria 3925
1265 Ga0395905_0068873 3300037471 Bacteria 3314
1266 Ga0395905_0070601 3300037471 Bacteria 3273
1267 Ga0395905_0071055 3300037471 Bacteria 3263
1268 Ga0395905_0080218 3300037471 Bacteria 3058
1269 Ga0395905_0080253 3300037471 Bacteria 3058
1270 Ga0395905_0093682 3300037471 Bacteria 2817
1271 Ga0395905_0111295 3300037471 Bacteria 2571
1272 Ga0395905_0115057 3300037471 Bacteria 2527
1273 Ga0395905_0119587 3300037471 Bacteria 2476
1274 Ga0395905_0132676 3300037471 Bacteria 2343
1275 Ga0395905_0215317 3300037471 Bacteria 1799
1276 Ga0395905_0268130 3300037471 Bacteria 1593
1277 Ga0395905_0298390 3300037471 Bacteria 1498
1278 Ga0395905_0333172 3300037471 Bacteria 1408
1279 Ga0395905_0459131 3300037471 Bacteria 1172
1280 Ga0436364_1237071 3300037853 Bacteria 5720
1281 Ga0395901_0000036 3300038443 Bacteria 214274
1282 Ga0395901_0029349 3300038443 Bacteria 5662
1283 Ga0395901_0036123 3300038443 Bacteria 5105
1284 Ga0395901_0041563 3300038443 Bacteria 4766
1285 Ga0395901_0044907 3300038443 Bacteria 4583
1286 Ga0395901_0063461 3300038443 Bacteria 3844
1287 Ga0395901_0074441 3300038443 Bacteria 3543
1288 Ga0395901_0078112 3300038443 Bacteria 3456
1289 Ga0395901_0083670 3300038443 Bacteria 3335
1290 Ga0395901_0086517 3300038443 Bacteria 3277
1291 Ga0395901_0090077 3300038443 Bacteria 3210
1292 Ga0395901_0092515 3300038443 Bacteria 3165
1293 Ga0395901_0117538 3300038443 Bacteria 2794
1294 Ga0395901_0139481 3300038443 Bacteria 2548
1295 Ga0395901_0262147 3300038443 Bacteria 1798
1296 Ga0395901_0342713 3300038443 Bacteria 1544
1297 Ga0395901_0434180 3300038443 Bacteria 1345
1298 Ga0400484_40600 3300038725 Bacteria 3097
1299 Ga0400488_40889 3300038741 Bacteria 2638
1300 Ga0400483_035009 3300039062 Bacteria 1074
1301 Ga0400483_052866 3300039062 Bacteria 3438
1302 Ga0400483_156985 3300039062 Bacteria 3077
1303 Ga0400483_175745 3300039062 Bacteria 3292
1304 Ga0400483_246114 3300039062 Bacteria 2469
1305 Ga0436365_1435754 3300039437 Bacteria 20552
1306 Ga0436365_1487032 3300039437 Bacteria 2357
1307 Ga0439461_0004264 3300041410 Bacteria 2381
1308 Ga0439455_0000196 3300042012 Bacteria 7033
1309 Ga0450914_000083 3300042118 Bacteria 2776
1310 Ga0439446_0002259 3300042156 Bacteria 4600
1311 Ga0439458_0000061 3300042157 Bacteria 18934
1312 Ga0439458_0000731 3300042157 Bacteria 8452
1313 Ga0439458_0000947 3300042157 Bacteria 7466
1314 Ga0439434_0002599 3300042435 Bacteria 5259
1315 Ga0439435_0000122 3300042436 Bacteria 10191
1316 Ga0451577_0000002 3300042876 Bacteria 1731375
1317 Ga0451577_0188643 3300042876 Bacteria 1859
1318 Ga0451577_0291491 3300042876 Bacteria 1479
1319 Ga0451577_0342000 3300042876 Bacteria 1357
1320 Ga0451577_0407843 3300042876 Bacteria 1234
1321 Ga0451577_0564223 3300042876 Bacteria 1033
1322 Ga0453683_0000003 3300044673 Bacteria 942572
1323 Ga0453683_0008588 3300044673 Bacteria 6852
1324 Ga0453683_0013118 3300044673 Bacteria 5419
1325 Ga0453683_0021942 3300044673 Bacteria 4074
1326 Ga0453683_0028708 3300044673 Bacteria 3521
1327 Ga0466966_0021955 3300044684 Bacteria 4190
1328 Ga0466961_0055002 3300044693 Bacteria 2538
1329 Ga0466961_0062524 3300044693 Bacteria 2366
1330 Ga0466963_0002212 3300044694 Bacteria 10759
1331 Ga0466963_0024045 3300044694 Bacteria 3875
1332 Ga0466963_0069014 3300044694 Bacteria 2375
1333 Ga0466963_0108871 3300044694 Bacteria 1900
1334 Ga0466963_0115984 3300044694 Bacteria 1841
1335 Ga0466963_0224623 3300044694 Bacteria 1315
1336 Ga0453684_0000002 3300044712 Bacteria 1731375
1337 Ga0453684_0000136 3300044712 Bacteria 323402
1338 Ga0453684_0003022 3300044712 Bacteria 39115
1339 Ga0453684_0140528 3300044712 Bacteria 2884
1340 Ga0453684_0179063 3300044712 Bacteria 2490
1341 Ga0466968_0071147 3300044735 Bacteria 1515
1342 Ga0466957_0005279 3300044842 Bacteria 7236
1343 Ga0466957_0008880 3300044842 Bacteria 5726
1344 Ga0466957_0008931 3300044842 Bacteria 5712
1345 Ga0466957_0113535 3300044842 Bacteria 1720
1346 Ga0466957_0378735 3300044842 Bacteria 965
1347 Ga0466957_0391588 3300044842 Bacteria 949
1348 Ga0466960_0073510 3300044901 Bacteria 1706
1349 Ga0466959_0065355 3300045049 Bacteria 2639
1350 Ga0466959_0174714 3300045049 Bacteria 1505
1351 Ga0451576_0000025 3300045051 Bacteria 427980
1352 Ga0451576_0000470 3300045051 Bacteria 91544
1353 Ga0451576_0001215 3300045051 Bacteria 45894
1354 Ga0451576_0002448 3300045051 Bacteria 27669
1355 Ga0451576_0032599 3300045051 Bacteria 5544
1356 Ga0451576_0196612 3300045051 Bacteria 2106
1357 Ga0451576_0211898 3300045051 Bacteria 2023
1358 Ga0451576_0748256 3300045051 Unclassified 1027
1359 Ga0466958_0012655 3300045836 Bacteria 4783
1360 Ga0466958_0028163 3300045836 Bacteria 3330
1361 Ga0466958_0030532 3300045836 Bacteria 3202
1362 Ga0466967_0031355 3300045976 Bacteria 4474
1363 Ga0466967_0036335 3300045976 Bacteria 4204
1364 Ga0466967_0110620 3300045976 Bacteria 2524
1365 Ga0466967_0168787 3300045976 Bacteria 2057
1366 Ga0466967_0286726 3300045976 Bacteria 1581
1367 Ga0466967_0311794 3300045976 Bacteria 1516
1368 Ga0495617_026580 3300046452 Bacteria 1949
1369 Ga0495627_000550 3300046453 Bacteria 30944
1370 Ga0495638_0000016 3300046460 Bacteria 396505
1371 Ga0495651_0000027 3300046462 Bacteria 107496
1372 Ga0495650_0000196 3300046471 Bacteria 131306
1373 Ga0495650_0000821 3300046471 Bacteria 37806
1374 Ga0495650_0000875 3300046471 Bacteria 35798
1375 Ga0495585_0001441 3300046492 Bacteria 18647
1376 Ga0495596_0000962 3300046500 Bacteria 17151
1377 Ga0495607_0021945 3300046501 Bacteria 4015
1378 Ga0495583_0000094 3300046506 Bacteria 153549
1379 Ga0495583_0065725 3300046506 Bacteria 1606
1380 Ga0495583_0114168 3300046506 Bacteria 1142
1381 Ga0495606_0007579 3300046507 Bacteria 9666
1382 Ga0495606_0088154 3300046507 Bacteria 1914
1383 Ga0495610_0001737 3300046512 Bacteria 19075
1384 Ga0495620_0038165 3300046515 Bacteria 2133
1385 Ga0495631_0006646 3300046518 Bacteria 5946
1386 Ga0495632_0001032 3300046519 Bacteria 24085
1387 Ga0495632_0001802 3300046519 Bacteria 17286
1388 Ga0495643_0000561 3300046522 Bacteria 45970
1389 Ga0495643_0001112 3300046522 Bacteria 26687
1390 Ga0495643_0051465 3300046522 Bacteria 2215
1391 Ga0495643_0067013 3300046522 Bacteria 1892
1392 Ga0495643_0100028 3300046522 Bacteria 1487
1393 Ga0495648_0000013 3300046524 Bacteria 289090
1394 Ga0495648_0010827 3300046524 Bacteria 6925
1395 Ga0495663_0030169 3300046525 Bacteria 1605
1396 Ga0495663_0032695 3300046525 Bacteria 1550
1397 Ga0495663_0039600 3300046525 Bacteria 1428
1398 Ga0495642_0134684 3300046528 Bacteria 1065
1399 Ga0495642_0135865 3300046528 Bacteria 1060
1400 Ga0495598_0013318 3300046537 Bacteria 2036
1401 Ga0495609_0012051 3300046538 Bacteria 4104
1402 Ga0495609_0038550 3300046538 Bacteria 2154
1403 Ga0495621_0000721 3300046539 Bacteria 8376
1404 Ga0495597_0002693 3300046542 Bacteria 10968
1405 Ga0495622_0023242 3300046557 Bacteria 2890
1406 Ga0495633_0001018 3300046558 Bacteria 22959
1407 Ga0495633_0012093 3300046558 Bacteria 4608
1408 Ga0495633_0016571 3300046558 Bacteria 3796
1409 Ga0495633_0051395 3300046558 Bacteria 1942
1410 Ga0495633_0132292 3300046558 Bacteria 1154
1411 Ga0495667_0053855 3300046559 Bacteria 2649
1412 Ga0495668_0016477 3300046616 Bacteria 4296
1413 Ga0495611_0007031 3300046648 Bacteria 4780
1414 Ga0495611_0072237 3300046648 Bacteria 1579
1415 Ga0495625_0005611 3300046660 Bacteria 11377
1416 Ga0495625_0044221 3300046660 Bacteria 3225
1417 Ga0495625_0064107 3300046660 Bacteria 2593
1418 Ga0495635_0273238 3300046663 Unclassified 1136
1419 Ga0495661_0043813 3300046665 Bacteria 2748
1420 Ga0495658_0367702 3300046683 Bacteria 915
1421 Ga0495669_0025841 3300046684 Bacteria 2564
1422 Ga0495669_0026382 3300046684 Bacteria 2539
1423 Ga0495669_0094516 3300046684 Bacteria 1383
1424 Ga0495670_0002453 3300046691 Bacteria 9169
1425 Ga0495670_0004571 3300046691 Bacteria 6790
1426 Ga0495670_0013608 3300046691 Bacteria 4000
1427 Ga0495670_0112988 3300046691 Bacteria 1407
1428 Ga0495671_0000018 3300046692 Bacteria 291470
1429 Ga0495671_0081568 3300046692 Bacteria 1585
1430 Ga0495687_000080 3300047443 Bacteria 147467
1431 Ga0495673_0000029 3300047469 Bacteria 471019
1432 Ga0495673_0025165 3300047469 Bacteria 2862
1433 Ga0495681_0001176 3300047470 Bacteria 19883
1434 Ga0495681_0120035 3300047470 Bacteria 1129
1435 Ga0495686_0000072 3300047472 Bacteria 216371
1436 Ga0495686_0000141 3300047472 Bacteria 144510
1437 Ga0495686_0000779 3300047472 Bacteria 41840
1438 Ga0495686_0004823 3300047472 Bacteria 10891
1439 Ga0495686_0012248 3300047472 Bacteria 6007
1440 Ga0495686_0058475 3300047472 Bacteria 2403
1441 Ga0495602_0044367 3300048088 Bacteria 4034
1442 Ga0495615_0000031 3300048090 Bacteria 46088
1443 Ga0496100_0019568 3300048903 Bacteria 4042
1444 Ga0496100_0321326 3300048903 Bacteria 1163
1445 Ga0496101_0005744 3300048904 Bacteria 7927
1446 Ga0496101_0017007 3300048904 Bacteria 4925
1447 Ga0496101_0065269 3300048904 Bacteria 2653
1448 Ga0496102_0000034 3300048905 Bacteria 213826
1449 Ga0496102_0000283 3300048905 Bacteria 64727
1450 Ga0496102_0000698 3300048905 Bacteria 33409
1451 Ga0496103_0000026 3300048906 Bacteria 213826
1452 Ga0496103_0000251 3300048906 Bacteria 51828
1453 Ga0496103_0000258 3300048906 Bacteria 50941
1454 Ga0496103_0134416 3300048906 Bacteria 1580
1455 Ga0496104_0000095 3300048907 Bacteria 86844
1456 Ga0496104_0237177 3300048907 Bacteria 1736
1457 Ga0496104_0296633 3300048907 Bacteria 1529
1458 Ga0496105_0000045 3300048908 Bacteria 110946
1459 Ga0496105_0000184 3300048908 Bacteria 41790
1460 Ga0496105_0093508 3300048908 Bacteria 2483
1461 Ga0496105_0219576 3300048908 Bacteria 1548
1462 Ga0496106_0069404 3300048909 Bacteria 2690
1463 Ga0496107_0041922 3300048910 Bacteria 3288
1464 Ga0496107_0141354 3300048910 Bacteria 1779
1465 Ga0496107_0234871 3300048910 Bacteria 1364
1466 Ga0496107_0300649 3300048910 Bacteria 1194
1467 Ga0496107_0505023 3300048910 Bacteria 897
1468 Ga0496108_0000883 3300048911 Bacteria 23370
1469 Ga0496108_0003813 3300048911 Bacteria 12074
1470 Ga0496108_0281155 3300048911 Bacteria 1449
1471 Ga0496108_0528832 3300048911 Bacteria 1029
1472 Ga0496109_0041645 3300048912 Bacteria 4160
1473 Ga0496109_0305964 3300048912 Bacteria 1499
1474 Ga0496109_0400326 3300048912 Bacteria 1297
1475 Ga0496109_0478316 3300048912 Bacteria 1176
1476 Ga0496109_0738474 3300048912 Bacteria 922
1477 Ga0496110_0008175 3300048913 Bacteria 8408
1478 Ga0496110_0034951 3300048913 Bacteria 4357
1479 Ga0496110_0039299 3300048913 Bacteria 4120
1480 Ga0496110_0048465 3300048913 Bacteria 3725
1481 Ga0496110_0297519 3300048913 Bacteria 1470
1482 Ga0496110_0544292 3300048913 Bacteria 1055
1483 Ga0496111_0022069 3300048914 Bacteria 4453
1484 Ga0496111_0046627 3300048914 Bacteria 3120
1485 Ga0496111_0117310 3300048914 Bacteria 1963
1486 Ga0496111_0369274 3300048914 Bacteria 1061
1487 Ga0496111_0375666 3300048914 Bacteria 1051
1488 Ga0496112_0002645 3300048915 Bacteria 14476
1489 Ga0496112_0007215 3300048915 Bacteria 9851
1490 Ga0496112_0055396 3300048915 Bacteria 3899
1491 Ga0496112_0058491 3300048915 Bacteria 3796
1492 Ga0496112_0082475 3300048915 Bacteria 3180
1493 Ga0496113_0000015 3300048916 Bacteria 79463
1494 Ga0496113_0000637 3300048916 Bacteria 17636
1495 Ga0496113_0017624 3300048916 Bacteria 4962
1496 Ga0496114_0000019 3300048917 Bacteria 244365
1497 Ga0496114_0028693 3300048917 Bacteria 4568
1498 Ga0496114_0108801 3300048917 Bacteria 2373
1499 Ga0496115_0010292 3300048918 Bacteria 6982
1500 Ga0496116_0001510 3300048919 Bacteria 25820
1501 Ga0496116_0012516 3300048919 Bacteria 6926
1502 Ga0496117_0000072 3300048920 Bacteria 238366
1503 Ga0496117_0003627 3300048920 Bacteria 17779
1504 Ga0496117_0006334 3300048920 Bacteria 12039
1505 Ga0496117_0010819 3300048920 Bacteria 8235
1506 Ga0496117_0021488 3300048920 Bacteria 5218
1507 Ga0496117_0066547 3300048920 Bacteria 2443
1508 Ga0496118_0000030 3300048921 Bacteria 339946
1509 Ga0496118_0000335 3300048921 Bacteria 80253
1510 Ga0496118_0001582 3300048921 Bacteria 33783
1511 Ga0496118_0041482 3300048921 Bacteria 3643
1512 Ga0496119_0000300 3300048922 Bacteria 69505
1513 Ga0496119_0001028 3300048922 Bacteria 35759
1514 Ga0496119_0009603 3300048922 Bacteria 8260
1515 Ga0496119_0015665 3300048922 Bacteria 5816
1516 Ga0496119_0055536 3300048922 Bacteria 2405
1517 Ga0496120_0000375 3300048923 Bacteria 72596
1518 Ga0496120_0000961 3300048923 Bacteria 39309
1519 Ga0496120_0054074 3300048923 Bacteria 2278
1520 Ga0496121_0000018 3300048924 Bacteria 542045
1521 Ga0496121_0000348 3300048924 Bacteria 96438
1522 Ga0496121_0003242 3300048924 Bacteria 23388
1523 Ga0496121_0006549 3300048924 Bacteria 14391
1524 Ga0496121_0160893 3300048924 Bacteria 1642
1525 Ga0496121_0324737 3300048924 Bacteria 1035
1526 Ga0496122_0000728 3300048925 Bacteria 64421
1527 Ga0496122_0001670 3300048925 Bacteria 34420
1528 Ga0496122_0003011 3300048925 Bacteria 22872
1529 Ga0496122_0003611 3300048925 Bacteria 20144
1530 Ga0496123_0000440 3300048926 Bacteria 74760
1531 Ga0496123_0001386 3300048926 Bacteria 33976
1532 Ga0496123_0002688 3300048926 Bacteria 21407
1533 Ga0496123_0002776 3300048926 Bacteria 20871
1534 Ga0496124_0000061 3300048927 Bacteria 238225
1535 Ga0496124_0000482 3300048927 Bacteria 68586
1536 Ga0496124_0010844 3300048927 Bacteria 9175
1537 Ga0496124_0013614 3300048927 Bacteria 7930
1538 Ga0496124_0015274 3300048927 Bacteria 7367
1539 Ga0496124_0050352 3300048927 Bacteria 3550
1540 Ga0496124_0086109 3300048927 Bacteria 2573
1541 Ga0496124_0315152 3300048927 Bacteria 1123
1542 Ga0496125_0001088 3300048928 Bacteria 41873
1543 Ga0496125_0005137 3300048928 Bacteria 14723
1544 Ga0496126_0000158 3300048929 Bacteria 156032
1545 Ga0495682_0004987 3300049460 Bacteria 5581
1546 Ga0501298_006085 3300049521 Bacteria 1961
1547 Ga0501300_000003 3300049523 Bacteria 46003
1548 Ga0501043_0139331 3300049579 Bacteria 1900
1549 Ga0501067_0017237 3300049583 Bacteria 3992
1550 Ga0501074_0067764 3300049590 Bacteria 2566
1551 Ga0501206_000046 3300049653 Bacteria 11101
1552 Ga0501222_000245 3300049662 Bacteria 9310
1553 Ga0501224_000275 3300049664 Bacteria 5936
1554 Ga0501227_000132 3300049665 Bacteria 13483
1555 Ga0501080_0044205 3300049742 Bacteria 4147
1556 Ga0501081_0364836 3300049743 Bacteria 1066
1557 Ga0501273_009741 3300049770 Bacteria 1172
1558 Ga0501281_00216 3300049777 Bacteria 6519
1559 Ga0501044_0003972 3300049823 Bacteria 16564
1560 Ga0501044_0033354 3300049823 Bacteria 5412
1561 nmdc:mga05p37_583773_c1 3300050507 Bacteria 1265
1562 nmdc:mga08y16_72262_c1 3300050511 Bacteria 3595
1563 nmdc:mga0n895_535298_c1 3300050512 Bacteria 1178
1564 nmdc:mga0rr50_392177_c1 3300050513 Bacteria 1172
1565 nmdc:mga08x19_268875_c1 3300050514 Bacteria 1179
1566 nmdc:mga08x19_6440_c1 3300050514 Bacteria 6955
1567 nmdc:mga08x19_66160_c1 3300050514 Bacteria 2348
1568 nmdc:mga0a205_4795_c1 3300050515 Bacteria 12158
1569 Ga0500643_000659 3300053087 Bacteria 23124
1570 Ga0500644_0151755 3300053088 Bacteria 929
1571 Ga0500651_0001733 3300053093 Bacteria 11166
1572 Ga0500641_0016532 3300053096 Bacteria 2748
1573 Ga0500555_000043 3300053103 Bacteria 64581
1574 Ga0500592_000888 3300053116 Bacteria 4879
1575 Ga0500618_002482 3300053125 Bacteria 6920
1576 Ga0500642_0005307 3300053130 Bacteria 4149
1577 Ga0500655_000135 3300053133 Bacteria 18478
1578 Ga0500559_0153866 3300053136 Bacteria 1080
1579 Ga0500568_0005072 3300053139 Bacteria 6892
1580 Ga0500577_0128345 3300053142 Bacteria 1061
1581 Ga0500590_002410 3300053148 Bacteria 8279
1582 Ga0500622_0002578 3300053156 Bacteria 12988
1583 Ga0500570_000103 3300053724 Bacteria 24102
1584 Ga0500596_006187 3300053735 Bacteria 2046
1585 Ga0466962_0031867 3300061719 Bacteria 2524

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0364836 Ga0501081_0364836_18_713 224
2 3300005842 Ga0068858_100303090 Ga0068858_1003030902 242
3 3300013306 Ga0163162_10727798 Ga0163162_107277982 242
4 3300046537 Ga0495598_0013318 Ga0495598_0013318_1200_1967 242
5 3300046683 Ga0495658_0367702 Ga0495658_0367702_66_845 242
6 3300046691 Ga0495670_0112988 Ga0495670_0112988_557_1324 242
7 3300048920 Ga0496117_0021488 Ga0496117_0021488_570_1361 243
8 3300005331 Ga0070670_100396988 Ga0070670_1003969882 247
9 3300005457 Ga0070662_100087549 Ga0070662_1000875491 248
10 3300005543 Ga0070672_100208143 Ga0070672_1002081431 248
11 3300005548 Ga0070665_100008161 Ga0070665_1000081617 248
12 3300009177 Ga0105248_10936614 Ga0105248_109366141 248
13 3300013308 Ga0157375_10008048 Ga0157375_100080487 248
14 3300042876 Ga0451577_0342000 Ga0451577_0342000_252_1088 249
15 3300005331 Ga0070670_100012404 Ga0070670_1000124045 250
16 3300005334 Ga0068869_100270401 Ga0068869_1002704011 250
17 3300005344 Ga0070661_100355981 Ga0070661_1003559811 250
18 3300014745 Ga0157377_10087173 Ga0157377_100871732 250
19 3300025315 Ga0207697_10003191 Ga0207697_100031917 250
20 3300025923 Ga0207681_10075460 Ga0207681_100754602 250
21 3300025925 Ga0207650_10085126 Ga0207650_100851262 250
22 3300031911 Ga0307412_10009423 Ga0307412_100094235 251
23 3300031995 Ga0307409_100046960 Ga0307409_1000469603 251
24 3300032002 Ga0307416_100505050 Ga0307416_1005050502 251
25 3300032005 Ga0307411_10222872 Ga0307411_102228722 251
26 3300037418 Ga0395900_0249920 Ga0395900_0249920_382_1224 251
27 3300031548 Ga0307408_100145546 Ga0307408_1001455462 252
28 3300031852 Ga0307410_10016234 Ga0307410_100162343 252
29 3300031901 Ga0307406_10043819 Ga0307406_100438192 252
30 3300031911 Ga0307412_10010038 Ga0307412_100100385 252
31 3300032004 Ga0307414_10015198 Ga0307414_100151985 252
32 3300045051 Ga0451576_0196612 Ga0451576_0196612_1067_1903 252
33 3300031731 Ga0307405_10168830 Ga0307405_101688302 253
34 3300031903 Ga0307407_10284123 Ga0307407_102841231 253
35 3300049770 Ga0501273_009741 Ga0501273_009741_100_960 253
36 3300032004 Ga0307414_10542439 Ga0307414_105424392 254
37 3300005328 Ga0070676_10094351 Ga0070676_100943512 255
38 3300005353 Ga0070669_100105752 Ga0070669_1001057522 255
39 3300005457 Ga0070662_100058479 Ga0070662_1000584792 255
40 3300005844 Ga0068862_100138006 Ga0068862_1001380062 255
41 3300009094 Ga0111539_10229351 Ga0111539_102293512 255
42 3300025932 Ga0207690_10006599 Ga0207690_100065992 255
43 3300025940 Ga0207691_10142485 Ga0207691_101424852 255
44 3300025945 Ga0207679_10099108 Ga0207679_100991081 255
45 3300026067 Ga0207678_10099782 Ga0207678_100997822 255
46 3300037471 Ga0395905_0014935 Ga0395905_0014935_3257_4108 255
47 3300046528 Ga0495642_0135865 Ga0495642_0135865_10_798 255
48 3300002737 JGI25162J39368_1001576 JGI25162J39368_100157612 257
49 3300003214 JGI25165J46597_1001950 JGI25165J46597_10019502 257
50 3300005578 Ga0068854_100121159 Ga0068854_1001211592 258
51 3300005841 Ga0068863_100148037 Ga0068863_1001480371 258
52 3300013306 Ga0163162_10006810 Ga0163162_100068108 258
53 3300025940 Ga0207691_10002229 Ga0207691_1000222921 258
54 3300026089 Ga0207648_10050544 Ga0207648_100505443 258
55 3300037312 Ga0395899_0000759 Ga0395899_0000759_14987_15838 258
56 3300037418 Ga0395900_0000130 Ga0395900_0000130_121903_122754 258
57 3300037466 Ga0395898_0000274 Ga0395898_0000274_36305_37156 258
58 3300037471 Ga0395905_0000006 Ga0395905_0000006_16086_16937 258
59 3300038443 Ga0395901_0044907 Ga0395901_0044907_738_1589 258
60 3300046525 Ga0495663_0032695 Ga0495663_0032695_405_1256 258
61 3300046539 Ga0495621_0000721 Ga0495621_0000721_2523_3374 258
62 3300046558 Ga0495633_0012093 Ga0495633_0012093_2168_3019 258
63 3300046691 Ga0495670_0002453 Ga0495670_0002453_2524_3375 258
64 3300048907 Ga0496104_0237177 Ga0496104_0237177_169_978 258
65 3300048910 Ga0496107_0505023 Ga0496107_0505023_74_883 258
66 3300048912 Ga0496109_0041645 Ga0496109_0041645_969_1778 258
67 3300048913 Ga0496110_0034951 Ga0496110_0034951_1305_2114 258
68 3300005445 Ga0070708_100386250 Ga0070708_1003862502 259
69 3300005467 Ga0070706_100024683 Ga0070706_1000246834 259
70 3300005563 Ga0068855_100692868 Ga0068855_1006928682 259
71 3300006871 Ga0075434_100157772 Ga0075434_1001577722 259
72 3300013104 Ga0157370_10002797 Ga0157370_1000279716 259
73 3300025949 Ga0207667_10128501 Ga0207667_101285012 259
74 3300050514 nmdc:mga08x19_268875_c1 nmdc:mga08x19_268875_c1_120_974 259
75 3300005328 Ga0070676_10216913 Ga0070676_102169131 260
76 3300009098 Ga0105245_10058155 Ga0105245_100581552 260
77 3300013296 Ga0157374_10324720 Ga0157374_103247202 260
78 3300025907 Ga0207645_10092732 Ga0207645_100927322 260
79 3300025927 Ga0207687_10115714 Ga0207687_101157142 260
80 3300037418 Ga0395900_0106953 Ga0395900_0106953_1378_2229 260
81 3300039062 Ga0400483_246114 Ga0400483_246114_483_1301 260
82 3300045836 Ga0466958_0030532 Ga0466958_0030532_2066_2869 260
83 3300046663 Ga0495635_0273238 Ga0495635_0273238_200_1033 260
84 3300005434 Ga0070709_10042690 Ga0070709_100426903 261
85 3300005435 Ga0070714_100157555 Ga0070714_1001575552 261
86 3300005539 Ga0068853_100446769 Ga0068853_1004467691 261
87 3300005548 Ga0070665_100183971 Ga0070665_1001839712 261
88 3300006028 Ga0070717_10104913 Ga0070717_101049132 261
89 3300006175 Ga0070712_100084343 Ga0070712_1000843432 261
90 3300025915 Ga0207693_10034254 Ga0207693_100342544 261
91 3300025917 Ga0207660_10172314 Ga0207660_101723142 261
92 3300025919 Ga0207657_10081741 Ga0207657_100817412 261
93 3300025929 Ga0207664_10318852 Ga0207664_103188522 261
94 3300028379 Ga0268266_10407086 Ga0268266_104070861 261
95 3300031911 Ga0307412_10002603 Ga0307412_100026033 261
96 3300044901 Ga0466960_0073510 Ga0466960_0073510_105_956 261
97 3300046500 Ga0495596_0000962 Ga0495596_0000962_15264_16049 261
98 3300046506 Ga0495583_0065725 Ga0495583_0065725_491_1276 261
99 3300046522 Ga0495643_0051465 Ga0495643_0051465_897_1682 261
100 3300046538 Ga0495609_0012051 Ga0495609_0012051_1813_2598 261
101 3300046660 Ga0495625_0005611 Ga0495625_0005611_2074_2859 261
102 3300053142 Ga0500577_0128345 Ga0500577_0128345_125_985 261
103 3300001904 JGI24736J21556_1002025 JGI24736J21556_10020254 262
104 3300001979 JGI24740J21852_10007917 JGI24740J21852_100079174 262
105 3300001989 JGI24739J22299_10003379 JGI24739J22299_100033795 262
106 3300001990 JGI24737J22298_10001763 JGI24737J22298_100017635 262
107 3300002067 JGI24735J21928_10067908 JGI24735J21928_100679082 262
108 3300002075 JGI24738J21930_10002718 JGI24738J21930_100027184 262
109 3300005330 Ga0070690_100003836 Ga0070690_1000038362 262
110 3300005330 Ga0070690_100004850 Ga0070690_1000048506 262
111 3300005331 Ga0070670_100144090 Ga0070670_1001440902 262
112 3300005334 Ga0068869_100000736 Ga0068869_1000007362 262
113 3300005335 Ga0070666_10001026 Ga0070666_100010269 262
114 3300005338 Ga0068868_100000916 Ga0068868_1000009169 262
115 3300005338 Ga0068868_100002996 Ga0068868_1000029965 262
116 3300005339 Ga0070660_100008743 Ga0070660_1000087432 262
117 3300005343 Ga0070687_100095397 Ga0070687_1000953971 262
118 3300005344 Ga0070661_100141614 Ga0070661_1001416141 262
119 3300005347 Ga0070668_100000060 Ga0070668_10000006056 262
120 3300005347 Ga0070668_100024560 Ga0070668_1000245602 262
121 3300005353 Ga0070669_100013522 Ga0070669_1000135225 262
122 3300005354 Ga0070675_100014360 Ga0070675_1000143605 262
123 3300005355 Ga0070671_100000619 Ga0070671_1000006199 262
124 3300005355 Ga0070671_100003527 Ga0070671_1000035279 262
125 3300005355 Ga0070671_100008998 Ga0070671_1000089982 262
126 3300005356 Ga0070674_100006000 Ga0070674_1000060002 262
127 3300005364 Ga0070673_100014389 Ga0070673_1000143892 262
128 3300005366 Ga0070659_100007590 Ga0070659_1000075908 262
129 3300005367 Ga0070667_100016770 Ga0070667_1000167703 262
130 3300005367 Ga0070667_100025767 Ga0070667_1000257675 262
131 3300005367 Ga0070667_100101494 Ga0070667_1001014943 262
132 3300005457 Ga0070662_100007973 Ga0070662_1000079735 262
133 3300005457 Ga0070662_100071655 Ga0070662_1000716552 262
134 3300005459 Ga0068867_100004301 Ga0068867_1000043014 262
135 3300005530 Ga0070679_100192364 Ga0070679_1001923641 262
136 3300005539 Ga0068853_100028474 Ga0068853_1000284743 262
137 3300005543 Ga0070672_100005662 Ga0070672_1000056622 262
138 3300005548 Ga0070665_100040818 Ga0070665_1000408183 262
139 3300005548 Ga0070665_100148488 Ga0070665_1001484883 262
140 3300005563 Ga0068855_100023893 Ga0068855_1000238934 262
141 3300005564 Ga0070664_100164141 Ga0070664_1001641412 262
142 3300005577 Ga0068857_100004716 Ga0068857_1000047167 262
143 3300005578 Ga0068854_100006279 Ga0068854_1000062794 262
144 3300005614 Ga0068856_100025064 Ga0068856_1000250641 262
145 3300005616 Ga0068852_100002104 Ga0068852_1000021045 262
146 3300005617 Ga0068859_100005841 Ga0068859_1000058418 262
147 3300005617 Ga0068859_100031030 Ga0068859_1000310304 262
148 3300005618 Ga0068864_100001030 Ga0068864_10000103010 262
149 3300005719 Ga0068861_100149658 Ga0068861_1001496582 262
150 3300005841 Ga0068863_100000001 Ga0068863_100000001280 262
151 3300005841 Ga0068863_100010376 Ga0068863_1000103763 262
152 3300005842 Ga0068858_100000640 Ga0068858_10000064034 262
153 3300005842 Ga0068858_100005629 Ga0068858_1000056296 262
154 3300005842 Ga0068858_100026604 Ga0068858_1000266042 262
155 3300005843 Ga0068860_100026751 Ga0068860_1000267513 262
156 3300005843 Ga0068860_100042895 Ga0068860_1000428952 262
157 3300005844 Ga0068862_100018240 Ga0068862_1000182405 262
158 3300005844 Ga0068862_100070296 Ga0068862_1000702963 262
159 3300005844 Ga0068862_100102414 Ga0068862_1001024142 262
160 3300006881 Ga0068865_100009141 Ga0068865_1000091412 262
161 3300006931 Ga0097620_100005841 Ga0097620_1000058418 262
162 3300006931 Ga0097620_100031028 Ga0097620_1000310284 262
163 3300009098 Ga0105245_10048946 Ga0105245_100489462 262
164 3300009174 Ga0105241_10124992 Ga0105241_101249922 262
165 3300009177 Ga0105248_10002250 Ga0105248_1000225013 262
166 3300009177 Ga0105248_10002307 Ga0105248_100023079 262
167 3300009177 Ga0105248_10139697 Ga0105248_101396972 262
168 3300009553 Ga0105249_10004830 Ga0105249_100048303 262
169 3300010375 Ga0105239_10000073 Ga0105239_1000007397 262
170 3300011119 Ga0105246_10022279 Ga0105246_100222794 262
171 3300013100 Ga0157373_10006582 Ga0157373_100065825 262
172 3300013100 Ga0157373_10026230 Ga0157373_100262304 262
173 3300013102 Ga0157371_10013321 Ga0157371_100133214 262
174 3300013105 Ga0157369_10361188 Ga0157369_103611882 262
175 3300013296 Ga0157374_10084593 Ga0157374_100845932 262
176 3300013297 Ga0157378_10006254 Ga0157378_100062548 262
177 3300013297 Ga0157378_10151667 Ga0157378_101516672 262
178 3300013308 Ga0157375_10081138 Ga0157375_100811383 262
179 3300013308 Ga0157375_10888356 Ga0157375_108883562 262
180 3300014968 Ga0157379_10018945 Ga0157379_100189454 262
181 3300014968 Ga0157379_10279636 Ga0157379_102796362 262
182 3300025315 Ga0207697_10000246 Ga0207697_1000024614 262
183 3300025901 Ga0207688_10002836 Ga0207688_100028366 262
184 3300025903 Ga0207680_10002124 Ga0207680_100021242 262
185 3300025904 Ga0207647_10000857 Ga0207647_1000085725 262
186 3300025909 Ga0207705_10001949 Ga0207705_100019498 262
187 3300025912 Ga0207707_10237103 Ga0207707_102371032 262
188 3300025918 Ga0207662_10114392 Ga0207662_101143922 262
189 3300025919 Ga0207657_10002754 Ga0207657_100027547 262
190 3300025921 Ga0207652_10272523 Ga0207652_102725232 262
191 3300025923 Ga0207681_10023302 Ga0207681_100233023 262
192 3300025924 Ga0207694_10067313 Ga0207694_100673133 262
193 3300025927 Ga0207687_10041239 Ga0207687_100412392 262
194 3300025931 Ga0207644_10000012 Ga0207644_10000012139 262
195 3300025931 Ga0207644_10024537 Ga0207644_100245373 262
196 3300025931 Ga0207644_10079073 Ga0207644_100790732 262
197 3300025932 Ga0207690_10020816 Ga0207690_100208162 262
198 3300025933 Ga0207706_10133138 Ga0207706_101331382 262
199 3300025937 Ga0207669_10006738 Ga0207669_100067383 262
200 3300025938 Ga0207704_10024353 Ga0207704_100243534 262
201 3300025940 Ga0207691_10002373 Ga0207691_100023735 262
202 3300025941 Ga0207711_10001346 Ga0207711_100013469 262
203 3300025941 Ga0207711_10010120 Ga0207711_100101207 262
204 3300025941 Ga0207711_10043198 Ga0207711_100431983 262
205 3300025942 Ga0207689_10000665 Ga0207689_1000066526 262
206 3300025945 Ga0207679_10018158 Ga0207679_100181584 262
207 3300025945 Ga0207679_10125468 Ga0207679_101254682 262
208 3300025945 Ga0207679_10314109 Ga0207679_103141092 262
209 3300025949 Ga0207667_10032356 Ga0207667_100323566 262
210 3300025960 Ga0207651_10009980 Ga0207651_100099804 262
211 3300025972 Ga0207668_10000056 Ga0207668_1000005627 262
212 3300025972 Ga0207668_10031037 Ga0207668_100310372 262
213 3300025981 Ga0207640_10005579 Ga0207640_100055794 262
214 3300025986 Ga0207658_10227254 Ga0207658_102272542 262
215 3300026023 Ga0207677_10002262 Ga0207677_100022624 262
216 3300026035 Ga0207703_10003318 Ga0207703_100033189 262
217 3300026035 Ga0207703_10040753 Ga0207703_100407532 262
218 3300026041 Ga0207639_10160979 Ga0207639_101609792 262
219 3300026088 Ga0207641_10000001 Ga0207641_10000001616 262
220 3300026088 Ga0207641_10116498 Ga0207641_101164982 262
221 3300026089 Ga0207648_10001222 Ga0207648_1000122226 262
222 3300026089 Ga0207648_10156640 Ga0207648_101566402 262
223 3300026095 Ga0207676_10022970 Ga0207676_100229703 262
224 3300026116 Ga0207674_10007038 Ga0207674_1000703810 262
225 3300026118 Ga0207675_100185924 Ga0207675_1001859242 262
226 3300026142 Ga0207698_10056574 Ga0207698_100565743 262
227 3300028379 Ga0268266_10118461 Ga0268266_101184613 262
228 3300028380 Ga0268265_10016352 Ga0268265_100163525 262
229 3300028380 Ga0268265_10044753 Ga0268265_100447532 262
230 3300028380 Ga0268265_10068825 Ga0268265_100688252 262
231 3300028381 Ga0268264_10040519 Ga0268264_100405193 262
232 3300028381 Ga0268264_10144360 Ga0268264_101443601 262
233 3300030736 Ga0316180_1000793 Ga0316180_10007932 262
234 3300030745 Ga0316182_1441032 Ga0316182_14410323 262
235 3300031241 Ga0265325_10008469 Ga0265325_100084696 262
236 3300037312 Ga0395899_0002320 Ga0395899_0002320_3789_4640 262
237 3300044693 Ga0466961_0062524 Ga0466961_0062524_492_1343 262
238 3300045049 Ga0466959_0174714 Ga0466959_0174714_456_1307 262
239 3300046559 Ga0495667_0053855 Ga0495667_0053855_1277_2116 262
240 3300048911 Ga0496108_0000883 Ga0496108_0000883_3600_4451 262
241 3300048912 Ga0496109_0478316 Ga0496109_0478316_220_1071 262
242 3300048914 Ga0496111_0117310 Ga0496111_0117310_36_890 262
243 3300048915 Ga0496112_0082475 Ga0496112_0082475_577_1428 262
244 3300048925 Ga0496122_0003611 Ga0496122_0003611_13998_14852 262
245 3300048926 Ga0496123_0002776 Ga0496123_0002776_5915_6769 262
246 3300048927 Ga0496124_0015274 Ga0496124_0015274_931_1785 262
247 3300001979 JGI24740J21852_10004342 JGI24740J21852_100043426 263
248 3300001989 JGI24739J22299_10016194 JGI24739J22299_100161942 263
249 3300001990 JGI24737J22298_10003795 JGI24737J22298_100037953 263
250 3300005327 Ga0070658_10006783 Ga0070658_100067833 263
251 3300005329 Ga0070683_100002527 Ga0070683_10000252713 263
252 3300005330 Ga0070690_100081775 Ga0070690_1000817752 263
253 3300005331 Ga0070670_100040860 Ga0070670_1000408604 263
254 3300005335 Ga0070666_10002276 Ga0070666_100022767 263
255 3300005335 Ga0070666_10206030 Ga0070666_102060302 263
256 3300005339 Ga0070660_100002355 Ga0070660_1000023558 263
257 3300005344 Ga0070661_100000484 Ga0070661_10000048416 263
258 3300005366 Ga0070659_100000951 Ga0070659_1000009517 263
259 3300005367 Ga0070667_100001187 Ga0070667_10000118727 263
260 3300005367 Ga0070667_100002027 Ga0070667_1000020275 263
261 3300005455 Ga0070663_100007544 Ga0070663_1000075445 263
262 3300005457 Ga0070662_100000219 Ga0070662_10000021916 263
263 3300005535 Ga0070684_100045979 Ga0070684_1000459794 263
264 3300005539 Ga0068853_100000981 Ga0068853_1000009816 263
265 3300005539 Ga0068853_100105203 Ga0068853_1001052033 263
266 3300005547 Ga0070693_100005998 Ga0070693_1000059984 263
267 3300005548 Ga0070665_100021498 Ga0070665_1000214984 263
268 3300005563 Ga0068855_100000213 Ga0068855_10000021329 263
269 3300005563 Ga0068855_100002532 Ga0068855_1000025328 263
270 3300005564 Ga0070664_100000968 Ga0070664_10000096817 263
271 3300005578 Ga0068854_100060734 Ga0068854_1000607343 263
272 3300005614 Ga0068856_100001632 Ga0068856_10000163222 263
273 3300005617 Ga0068859_100162427 Ga0068859_1001624272 263
274 3300005618 Ga0068864_100038916 Ga0068864_1000389163 263
275 3300005841 Ga0068863_100003965 Ga0068863_10000396516 263
276 3300005842 Ga0068858_100328231 Ga0068858_1003282312 263
277 3300005843 Ga0068860_100000063 Ga0068860_100000063187 263
278 3300005843 Ga0068860_100004665 Ga0068860_10000466513 263
279 3300006358 Ga0068871_100017874 Ga0068871_1000178743 263
280 3300006931 Ga0097620_100162414 Ga0097620_1001624142 263
281 3300009094 Ga0111539_10032274 Ga0111539_100322746 263
282 3300009147 Ga0114129_10327341 Ga0114129_103273411 263
283 3300009174 Ga0105241_10192205 Ga0105241_101922052 263
284 3300009177 Ga0105248_10006178 Ga0105248_100061788 263
285 3300013100 Ga0157373_10043186 Ga0157373_100431863 263
286 3300013102 Ga0157371_10001382 Ga0157371_1000138220 263
287 3300013307 Ga0157372_10179235 Ga0157372_101792352 263
288 3300014325 Ga0163163_10001185 Ga0163163_100011858 263
289 3300025904 Ga0207647_10006623 Ga0207647_100066233 263
290 3300025907 Ga0207645_10157160 Ga0207645_101571602 263
291 3300025909 Ga0207705_10001383 Ga0207705_100013836 263
292 3300025919 Ga0207657_10001053 Ga0207657_1000105314 263
293 3300025920 Ga0207649_10001865 Ga0207649_100018656 263
294 3300025925 Ga0207650_10071140 Ga0207650_100711402 263
295 3300025931 Ga0207644_10021715 Ga0207644_100217155 263
296 3300025932 Ga0207690_10001504 Ga0207690_100015046 263
297 3300025933 Ga0207706_10000782 Ga0207706_1000078221 263
298 3300025944 Ga0207661_10003391 Ga0207661_100033916 263
299 3300025945 Ga0207679_10002000 Ga0207679_100020006 263
300 3300025949 Ga0207667_10000007 Ga0207667_1000000777 263
301 3300025949 Ga0207667_10003727 Ga0207667_100037275 263
302 3300025981 Ga0207640_10002766 Ga0207640_100027664 263
303 3300025981 Ga0207640_10007992 Ga0207640_100079925 263
304 3300025981 Ga0207640_10053846 Ga0207640_100538463 263
305 3300025986 Ga0207658_10000444 Ga0207658_1000044437 263
306 3300025986 Ga0207658_10000967 Ga0207658_1000096724 263
307 3300026035 Ga0207703_10245738 Ga0207703_102457382 263
308 3300026041 Ga0207639_10000866 Ga0207639_1000086614 263
309 3300026067 Ga0207678_10001883 Ga0207678_100018833 263
310 3300026078 Ga0207702_10001633 Ga0207702_100016337 263
311 3300026088 Ga0207641_10001414 Ga0207641_100014148 263
312 3300026088 Ga0207641_10002153 Ga0207641_1000215317 263
313 3300026088 Ga0207641_10427660 Ga0207641_104276602 263
314 3300026142 Ga0207698_10004362 Ga0207698_100043626 263
315 3300027907 Ga0207428_10075628 Ga0207428_100756283 263
316 3300028379 Ga0268266_10019637 Ga0268266_100196375 263
317 3300028381 Ga0268264_10000083 Ga0268264_10000083236 263
318 3300028381 Ga0268264_10003279 Ga0268264_1000327913 263
319 3300031852 Ga0307410_10000697 Ga0307410_100006975 263
320 3300031903 Ga0307407_10038679 Ga0307407_100386792 263
321 3300035091 Ga0373951_0022131 Ga0373951_0022131_180_1031 263
322 3300035121 Ga0373960_0080568 Ga0373960_0080568_27_878 263
323 3300037471 Ga0395905_0111295 Ga0395905_0111295_1436_2287 263
324 3300042118 Ga0450914_000083 Ga0450914_000083_1594_2439 263
325 3300044842 Ga0466957_0378735 Ga0466957_0378735_88_939 263
326 3300044842 Ga0466957_0391588 Ga0466957_0391588_55_855 263
327 3300048910 Ga0496107_0041922 Ga0496107_0041922_941_1792 263
328 3300048914 Ga0496111_0369274 Ga0496111_0369274_150_1001 263
329 3300050507 nmdc:mga05p37_583773_c1 nmdc:mga05p37_583773_c1_11_856 263
330 3300050511 nmdc:mga08y16_72262_c1 nmdc:mga08y16_72262_c1_1963_2808 263
331 3300001979 JGI24740J21852_10034798 JGI24740J21852_100347982 264
332 3300005336 Ga0070680_100041285 Ga0070680_1000412852 264
333 3300005344 Ga0070661_100016626 Ga0070661_1000166261 264
334 3300005366 Ga0070659_100014237 Ga0070659_1000142373 264
335 3300005455 Ga0070663_100385118 Ga0070663_1003851182 264
336 3300005458 Ga0070681_10007969 Ga0070681_100079698 264
337 3300005530 Ga0070679_100031283 Ga0070679_1000312835 264
338 3300009545 Ga0105237_10044899 Ga0105237_100448994 264
339 3300021384 Ga0213876_10097071 Ga0213876_100970712 264
340 3300025909 Ga0207705_10005934 Ga0207705_100059341 264
341 3300025912 Ga0207707_10029535 Ga0207707_100295353 264
342 3300025917 Ga0207660_10005969 Ga0207660_100059695 264
343 3300025919 Ga0207657_10008345 Ga0207657_100083453 264
344 3300025920 Ga0207649_10243886 Ga0207649_102438862 264
345 3300025921 Ga0207652_10008168 Ga0207652_100081686 264
346 3300025932 Ga0207690_10008161 Ga0207690_100081614 264
347 3300026067 Ga0207678_10421348 Ga0207678_104213482 264
348 3300028794 Ga0307515_10099369 Ga0307515_100993693 264
349 3300037418 Ga0395900_0123675 Ga0395900_0123675_285_1136 264
350 3300037471 Ga0395905_0049828 Ga0395905_0049828_2828_3679 264
351 3300039437 Ga0436365_1435754 Ga0436365_1435754_13699_14550 264
352 3300045976 Ga0466967_0168787 Ga0466967_0168787_783_1634 264
353 3300005355 Ga0070671_100108550 Ga0070671_1001085502 265
354 3300013307 Ga0157372_10060836 Ga0157372_100608364 265
355 3300025233 Ga0209437_100248 Ga0209437_10024876 265
356 3300025261 Ga0209233_1000241 Ga0209233_10002412 265
357 3300044694 Ga0466963_0115984 Ga0466963_0115984_553_1404 265
358 3300048903 Ga0496100_0321326 Ga0496100_0321326_109_960 265
359 3300048904 Ga0496101_0017007 Ga0496101_0017007_271_1122 265
360 3300005327 Ga0070658_10029812 Ga0070658_100298124 266
361 3300005328 Ga0070676_10015499 Ga0070676_100154994 266
362 3300005330 Ga0070690_100256974 Ga0070690_1002569742 266
363 3300005353 Ga0070669_100297271 Ga0070669_1002972711 266
364 3300005355 Ga0070671_100174711 Ga0070671_1001747112 266
365 3300005456 Ga0070678_100269377 Ga0070678_1002693771 266
366 3300005457 Ga0070662_100089743 Ga0070662_1000897432 266
367 3300005548 Ga0070665_100000820 Ga0070665_1000008205 266
368 3300005548 Ga0070665_100152752 Ga0070665_1001527523 266
369 3300005564 Ga0070664_100076647 Ga0070664_1000766473 266
370 3300005564 Ga0070664_100152006 Ga0070664_1001520062 266
371 3300005577 Ga0068857_100093704 Ga0068857_1000937043 266
372 3300005577 Ga0068857_100143881 Ga0068857_1001438812 266
373 3300005616 Ga0068852_100311771 Ga0068852_1003117712 266
374 3300005834 Ga0068851_10016688 Ga0068851_100166884 266
375 3300005844 Ga0068862_100016220 Ga0068862_1000162205 266
376 3300009551 Ga0105238_10043720 Ga0105238_100437203 266
377 3300009553 Ga0105249_10136781 Ga0105249_101367813 266
378 3300011119 Ga0105246_10197172 Ga0105246_101971722 266
379 3300025315 Ga0207697_10086245 Ga0207697_100862452 266
380 3300025907 Ga0207645_10115524 Ga0207645_101155242 266
381 3300025920 Ga0207649_10067345 Ga0207649_100673452 266
382 3300025931 Ga0207644_10301540 Ga0207644_103015402 266
383 3300025932 Ga0207690_10110368 Ga0207690_101103682 266
384 3300025933 Ga0207706_10043950 Ga0207706_100439504 266
385 3300025933 Ga0207706_10048860 Ga0207706_100488604 266
386 3300025933 Ga0207706_10124592 Ga0207706_101245921 266
387 3300025942 Ga0207689_10004224 Ga0207689_100042242 266
388 3300025945 Ga0207679_10132251 Ga0207679_101322512 266
389 3300025960 Ga0207651_10490945 Ga0207651_104909452 266
390 3300025986 Ga0207658_10007597 Ga0207658_100075974 266
391 3300026116 Ga0207674_10291385 Ga0207674_102913852 266
392 3300026121 Ga0207683_10223237 Ga0207683_102232372 266
393 3300026142 Ga0207698_10503072 Ga0207698_105030722 266
394 3300028379 Ga0268266_10000950 Ga0268266_1000095030 266
395 3300028379 Ga0268266_10109071 Ga0268266_101090713 266
396 3300028380 Ga0268265_10017515 Ga0268265_100175153 266
397 3300028381 Ga0268264_10450042 Ga0268264_104500422 266
398 3300031731 Ga0307405_10558617 Ga0307405_105586171 266
399 3300031824 Ga0307413_10409926 Ga0307413_104099261 266
400 3300031852 Ga0307410_10111612 Ga0307410_101116123 266
401 3300031995 Ga0307409_100285461 Ga0307409_1002854612 266
402 3300032004 Ga0307414_10124425 Ga0307414_101244252 266
403 3300032005 Ga0307411_10061547 Ga0307411_100615473 266
404 3300037471 Ga0395905_0002188 Ga0395905_0002188_14295_15146 266
405 3300037471 Ga0395905_0071055 Ga0395905_0071055_492_1337 266
406 3300038443 Ga0395901_0041563 Ga0395901_0041563_1266_2117 266
407 3300038443 Ga0395901_0078112 Ga0395901_0078112_1125_1976 266
408 3300038443 Ga0395901_0139481 Ga0395901_0139481_180_1031 266
409 3300038443 Ga0395901_0342713 Ga0395901_0342713_314_1174 266
410 3300044694 Ga0466963_0108871 Ga0466963_0108871_351_1202 266
411 3300044842 Ga0466957_0005279 Ga0466957_0005279_5389_6240 266
412 3300045976 Ga0466967_0036335 Ga0466967_0036335_1145_1996 266
413 3300045976 Ga0466967_0286726 Ga0466967_0286726_32_883 266
414 3300050515 nmdc:mga0a205_4795_c1 nmdc:mga0a205_4795_c1_3568_4413 266
415 3300001915 JGI24741J21665_1009991 JGI24741J21665_10099912 267
416 3300001915 JGI24741J21665_1016976 JGI24741J21665_10169761 267
417 3300001979 JGI24740J21852_10000510 JGI24740J21852_100005107 267
418 3300001979 JGI24740J21852_10019466 JGI24740J21852_100194662 267
419 3300001989 JGI24739J22299_10011416 JGI24739J22299_100114162 267
420 3300001989 JGI24739J22299_10017712 JGI24739J22299_100177122 267
421 3300001989 JGI24739J22299_10025599 JGI24739J22299_100255992 267
422 3300001990 JGI24737J22298_10034662 JGI24737J22298_100346622 267
423 3300005327 Ga0070658_10030911 Ga0070658_100309113 267
424 3300005327 Ga0070658_10070155 Ga0070658_100701552 267
425 3300005331 Ga0070670_100188654 Ga0070670_1001886542 267
426 3300005335 Ga0070666_10004347 Ga0070666_100043475 267
427 3300005336 Ga0070680_100041126 Ga0070680_1000411264 267
428 3300005338 Ga0068868_100665272 Ga0068868_1006652721 267
429 3300005339 Ga0070660_100503693 Ga0070660_1005036931 267
430 3300005344 Ga0070661_100035410 Ga0070661_1000354104 267
431 3300005355 Ga0070671_100514301 Ga0070671_1005143011 267
432 3300005366 Ga0070659_100048570 Ga0070659_1000485704 267
433 3300005366 Ga0070659_100146194 Ga0070659_1001461942 267
434 3300005366 Ga0070659_100190742 Ga0070659_1001907422 267
435 3300005367 Ga0070667_100170448 Ga0070667_1001704482 267
436 3300005455 Ga0070663_100032863 Ga0070663_1000328634 267
437 3300005457 Ga0070662_100002610 Ga0070662_1000026104 267
438 3300005457 Ga0070662_100374107 Ga0070662_1003741071 267
439 3300005459 Ga0068867_100005403 Ga0068867_1000054036 267
440 3300005530 Ga0070679_100155236 Ga0070679_1001552362 267
441 3300005539 Ga0068853_100038256 Ga0068853_1000382564 267
442 3300005548 Ga0070665_100086627 Ga0070665_1000866272 267
443 3300005563 Ga0068855_100036195 Ga0068855_1000361952 267
444 3300005564 Ga0070664_100100110 Ga0070664_1001001102 267
445 3300005577 Ga0068857_100045888 Ga0068857_1000458882 267
446 3300005578 Ga0068854_100003189 Ga0068854_1000031893 267
447 3300005616 Ga0068852_100020813 Ga0068852_1000208135 267
448 3300005834 Ga0068851_10036307 Ga0068851_100363072 267
449 3300006237 Ga0097621_100079006 Ga0097621_1000790061 267
450 3300013100 Ga0157373_10020484 Ga0157373_100204845 267
451 3300013297 Ga0157378_10069363 Ga0157378_100693632 267
452 3300013307 Ga0157372_10020920 Ga0157372_100209204 267
453 3300013307 Ga0157372_10180772 Ga0157372_101807722 267
454 3300025321 Ga0207656_10002352 Ga0207656_100023525 267
455 3300025904 Ga0207647_10107077 Ga0207647_101070772 267
456 3300025908 Ga0207643_10017984 Ga0207643_100179842 267
457 3300025909 Ga0207705_10040574 Ga0207705_100405743 267
458 3300025909 Ga0207705_10044981 Ga0207705_100449812 267
459 3300025919 Ga0207657_10007378 Ga0207657_100073785 267
460 3300025920 Ga0207649_10055965 Ga0207649_100559652 267
461 3300025920 Ga0207649_10307175 Ga0207649_103071752 267
462 3300025921 Ga0207652_10328695 Ga0207652_103286952 267
463 3300025925 Ga0207650_10145066 Ga0207650_101450662 267
464 3300025932 Ga0207690_10042864 Ga0207690_100428642 267
465 3300025932 Ga0207690_10246173 Ga0207690_102461732 267
466 3300025932 Ga0207690_10341999 Ga0207690_103419992 267
467 3300025933 Ga0207706_10000143 Ga0207706_1000014359 267
468 3300025933 Ga0207706_10019976 Ga0207706_100199764 267
469 3300025945 Ga0207679_10048447 Ga0207679_100484472 267
470 3300025981 Ga0207640_10035191 Ga0207640_100351913 267
471 3300025986 Ga0207658_10217721 Ga0207658_102177212 267
472 3300026041 Ga0207639_10221194 Ga0207639_102211942 267
473 3300026041 Ga0207639_10221226 Ga0207639_102212262 267
474 3300026067 Ga0207678_10000774 Ga0207678_1000077420 267
475 3300026067 Ga0207678_10067882 Ga0207678_100678823 267
476 3300026089 Ga0207648_10007531 Ga0207648_100075315 267
477 3300026116 Ga0207674_10028879 Ga0207674_100288796 267
478 3300026142 Ga0207698_10180474 Ga0207698_101804742 267
479 3300028379 Ga0268266_10225469 Ga0268266_102254692 267
480 3300031911 Ga0307412_10310006 Ga0307412_103100062 267
481 3300032005 Ga0307411_10002581 Ga0307411_100025814 267
482 3300032126 Ga0307415_100477456 Ga0307415_1004774562 267
483 3300037312 Ga0395899_0151766 Ga0395899_0151766_418_1269 267
484 3300037418 Ga0395900_0210441 Ga0395900_0210441_738_1589 267
485 3300037418 Ga0395900_0221769 Ga0395900_0221769_644_1495 267
486 3300037466 Ga0395898_0121056 Ga0395898_0121056_628_1479 267
487 3300037471 Ga0395905_0010405 Ga0395905_0010405_6399_7250 267
488 3300038443 Ga0395901_0029349 Ga0395901_0029349_788_1639 267
489 3300038443 Ga0395901_0117538 Ga0395901_0117538_439_1290 267
490 3300044684 Ga0466966_0021955 Ga0466966_0021955_1590_2441 267
491 3300044693 Ga0466961_0055002 Ga0466961_0055002_576_1427 267
492 3300044694 Ga0466963_0002212 Ga0466963_0002212_7054_7905 267
493 3300045049 Ga0466959_0065355 Ga0466959_0065355_750_1601 267
494 3300045976 Ga0466967_0031355 Ga0466967_0031355_3195_4046 267
495 3300046507 Ga0495606_0088154 Ga0495606_0088154_806_1633 267
496 3300046522 Ga0495643_0000561 Ga0495643_0000561_8394_9221 267
497 3300046684 Ga0495669_0026382 Ga0495669_0026382_1190_2041 267
498 3300048913 Ga0496110_0544292 Ga0496110_0544292_102_923 267
499 3300048927 Ga0496124_0086109 Ga0496124_0086109_329_1150 267
500 3300061719 Ga0466962_0031867 Ga0466962_0031867_359_1210 267
501 iso_pu_bacteria 2838074704 2838081047 267
502 iso_pu_bacteria 2842482326 2842486620 267
503 3300005334 Ga0068869_100372044 Ga0068869_1003720441 268
504 3300005455 Ga0070663_100011047 Ga0070663_1000110472 268
505 3300005456 Ga0070678_100497442 Ga0070678_1004974422 268
506 3300005457 Ga0070662_100109439 Ga0070662_1001094392 268
507 3300005457 Ga0070662_100202988 Ga0070662_1002029882 268
508 3300005459 Ga0068867_100071006 Ga0068867_1000710063 268
509 3300005578 Ga0068854_100024106 Ga0068854_1000241063 268
510 3300005718 Ga0068866_10114689 Ga0068866_101146892 268
511 3300005842 Ga0068858_100006391 Ga0068858_1000063915 268
512 3300009098 Ga0105245_10115296 Ga0105245_101152962 268
513 3300009176 Ga0105242_10110316 Ga0105242_101103163 268
514 3300009177 Ga0105248_10271286 Ga0105248_102712862 268
515 3300013100 Ga0157373_10049531 Ga0157373_100495313 268
516 3300014745 Ga0157377_10025880 Ga0157377_100258802 268
517 3300025321 Ga0207656_10059795 Ga0207656_100597952 268
518 3300025920 Ga0207649_10134868 Ga0207649_101348681 268
519 3300025934 Ga0207686_10025415 Ga0207686_100254153 268
520 3300025935 Ga0207709_10233076 Ga0207709_102330762 268
521 3300025937 Ga0207669_10455108 Ga0207669_104551082 268
522 3300026035 Ga0207703_10002300 Ga0207703_100023008 268
523 3300026067 Ga0207678_10040551 Ga0207678_100405515 268
524 3300026089 Ga0207648_10048084 Ga0207648_100480844 268
525 3300031727 Ga0316576_10090648 Ga0316576_100906482 268
526 3300037312 Ga0395899_0058962 Ga0395899_0058962_310_1161 268
527 3300037466 Ga0395898_0313214 Ga0395898_0313214_510_1361 268
528 3300044842 Ga0466957_0008880 Ga0466957_0008880_308_1159 268
529 3300048913 Ga0496110_0048465 Ga0496110_0048465_2734_3585 268
530 3300050512 nmdc:mga0n895_535298_c1 nmdc:mga0n895_535298_c1_230_1075 268
531 3300005331 Ga0070670_100125702 Ga0070670_1001257022 269
532 3300005347 Ga0070668_100009237 Ga0070668_1000092373 269
533 3300005353 Ga0070669_100000801 Ga0070669_1000008017 269
534 3300005355 Ga0070671_100001089 Ga0070671_10000108913 269
535 3300005355 Ga0070671_100009026 Ga0070671_1000090264 269
536 3300005367 Ga0070667_100000426 Ga0070667_10000042612 269
537 3300005467 Ga0070706_100138568 Ga0070706_1001385682 269
538 3300005548 Ga0070665_100002948 Ga0070665_1000029489 269
539 3300005843 Ga0068860_100322917 Ga0068860_1003229172 269
540 3300005844 Ga0068862_100019444 Ga0068862_1000194445 269
541 3300006028 Ga0070717_10631559 Ga0070717_106315592 269
542 3300009092 Ga0105250_10003029 Ga0105250_100030295 269
543 3300009177 Ga0105248_10036669 Ga0105248_100366693 269
544 3300013306 Ga0163162_10413489 Ga0163162_104134891 269
545 3300022740 Ga0228710_1006963 Ga0228710_100696315 269
546 3300025711 Ga0207696_1004421 Ga0207696_10044215 269
547 3300025735 Ga0207713_1008424 Ga0207713_10084244 269
548 3300025923 Ga0207681_10000165 Ga0207681_1000016538 269
549 3300025925 Ga0207650_10216654 Ga0207650_102166542 269
550 3300025931 Ga0207644_10137064 Ga0207644_101370642 269
551 3300025941 Ga0207711_10053063 Ga0207711_100530633 269
552 3300025972 Ga0207668_10003038 Ga0207668_100030387 269
553 3300025986 Ga0207658_10000343 Ga0207658_1000034333 269
554 3300026088 Ga0207641_10244677 Ga0207641_102446772 269
555 3300028379 Ga0268266_10001749 Ga0268266_1000174913 269
556 3300028381 Ga0268264_10048575 Ga0268264_100485754 269
557 3300035086 Ga0373934_0001489 Ga0373934_0001489_641_1510 269
558 3300035119 Ga0373956_0000015 Ga0373956_0000015_29212_30081 269
559 3300035120 Ga0373957_0010494 Ga0373957_0010494_1428_2297 269
560 3300035724 Ga0373933_0000194 Ga0373933_0000194_1532_2401 269
561 3300036401 Ga0373937_0000182 Ga0373937_0000182_11952_12821 269
562 3300036647 Ga0316582_0008317 Ga0316582_0008317_4680_5516 269
563 3300045976 Ga0466967_0311794 Ga0466967_0311794_580_1431 269
564 3300046462 Ga0495651_0000027 Ga0495651_0000027_47682_48551 269
565 3300046501 Ga0495607_0021945 Ga0495607_0021945_55_882 269
566 3300048904 Ga0496101_0065269 Ga0496101_0065269_332_1228 269
567 3300048905 Ga0496102_0000283 Ga0496102_0000283_16169_17065 269
568 3300048906 Ga0496103_0000251 Ga0496103_0000251_34474_35370 269
569 3300048907 Ga0496104_0000095 Ga0496104_0000095_76302_77198 269
570 3300048908 Ga0496105_0000045 Ga0496105_0000045_67034_67930 269
571 3300048913 Ga0496110_0039299 Ga0496110_0039299_1195_2055 269
572 3300048913 Ga0496110_0297519 Ga0496110_0297519_260_1156 269
573 3300048914 Ga0496111_0022069 Ga0496111_0022069_1366_2262 269
574 3300048915 Ga0496112_0002645 Ga0496112_0002645_13290_14186 269
575 3300048916 Ga0496113_0000015 Ga0496113_0000015_16162_17058 269
576 3300048919 Ga0496116_0012516 Ga0496116_0012516_4105_5001 269
577 3300048920 Ga0496117_0003627 Ga0496117_0003627_7620_8516 269
578 3300048921 Ga0496118_0001582 Ga0496118_0001582_15990_16886 269
579 3300048922 Ga0496119_0000300 Ga0496119_0000300_7872_8768 269
580 3300048923 Ga0496120_0000375 Ga0496120_0000375_62443_63339 269
581 3300048924 Ga0496121_0006549 Ga0496121_0006549_8529_9425 269
582 3300048925 Ga0496122_0001670 Ga0496122_0001670_8115_9011 269
583 3300048926 Ga0496123_0001386 Ga0496123_0001386_16052_16948 269
584 3300048927 Ga0496124_0013614 Ga0496124_0013614_3132_4028 269
585 3300048928 Ga0496125_0001088 Ga0496125_0001088_25410_26306 269
586 3300048929 Ga0496126_0000158 Ga0496126_0000158_138985_139881 269
587 3300049579 Ga0501043_0139331 Ga0501043_0139331_74_892 269
588 3300049823 Ga0501044_0033354 Ga0501044_0033354_1565_2383 269
589 3300001990 JGI24737J22298_10005497 JGI24737J22298_100054974 270
590 3300002067 JGI24735J21928_10035048 JGI24735J21928_100350482 270
591 3300002067 JGI24735J21928_10038309 JGI24735J21928_100383092 270
592 3300002067 JGI24735J21928_10043173 JGI24735J21928_100431732 270
593 3300005327 Ga0070658_10009576 Ga0070658_100095763 270
594 3300005331 Ga0070670_100077725 Ga0070670_1000777252 270
595 3300005335 Ga0070666_10000003 Ga0070666_10000003293 270
596 3300005336 Ga0070680_100094473 Ga0070680_1000944732 270
597 3300005339 Ga0070660_100007051 Ga0070660_1000070516 270
598 3300005345 Ga0070692_10011390 Ga0070692_100113904 270
599 3300005366 Ga0070659_100005070 Ga0070659_1000050703 270
600 3300005444 Ga0070694_100001709 Ga0070694_1000017094 270
601 3300005457 Ga0070662_100001600 Ga0070662_1000016009 270
602 3300005468 Ga0070707_100000959 Ga0070707_10000095926 270
603 3300005468 Ga0070707_100436354 Ga0070707_1004363542 270
604 3300005539 Ga0068853_100059234 Ga0068853_1000592343 270
605 3300005543 Ga0070672_100002866 Ga0070672_1000028664 270
606 3300005548 Ga0070665_100029427 Ga0070665_1000294271 270
607 3300005616 Ga0068852_100083537 Ga0068852_1000835372 270
608 3300005718 Ga0068866_10166889 Ga0068866_101668892 270
609 3300005843 Ga0068860_100010469 Ga0068860_1000104695 270
610 3300005843 Ga0068860_100198246 Ga0068860_1001982462 270
611 3300006237 Ga0097621_100175494 Ga0097621_1001754942 270
612 3300009093 Ga0105240_10231794 Ga0105240_102317942 270
613 3300009551 Ga0105238_10001867 Ga0105238_1000186716 270
614 3300009553 Ga0105249_10002467 Ga0105249_100024677 270
615 3300010375 Ga0105239_10542246 Ga0105239_105422462 270
616 3300013306 Ga0163162_10000236 Ga0163162_1000023616 270
617 3300013306 Ga0163162_10011046 Ga0163162_100110465 270
618 3300025903 Ga0207680_10000006 Ga0207680_10000006440 270
619 3300025909 Ga0207705_10023036 Ga0207705_100230364 270
620 3300025913 Ga0207695_10188493 Ga0207695_101884932 270
621 3300025917 Ga0207660_10208045 Ga0207660_102080452 270
622 3300025919 Ga0207657_10013461 Ga0207657_100134614 270
623 3300025922 Ga0207646_10081132 Ga0207646_100811322 270
624 3300025924 Ga0207694_10001181 Ga0207694_100011812 270
625 3300025932 Ga0207690_10002175 Ga0207690_1000217510 270
626 3300025933 Ga0207706_10018790 Ga0207706_100187901 270
627 3300025940 Ga0207691_10005303 Ga0207691_100053035 270
628 3300025961 Ga0207712_10000566 Ga0207712_100005663 270
629 3300025972 Ga0207668_10030859 Ga0207668_100308592 270
630 3300026041 Ga0207639_10209751 Ga0207639_102097512 270
631 3300028379 Ga0268266_10000021 Ga0268266_10000021378 270
632 3300028381 Ga0268264_10001923 Ga0268264_100019239 270
633 3300028381 Ga0268264_10259361 Ga0268264_102593612 270
634 3300031665 Ga0316575_10043791 Ga0316575_100437912 270
635 3300031665 Ga0316575_10092843 Ga0316575_100928431 270
636 3300032133 Ga0316583_10017114 Ga0316583_100171142 270
637 3300032168 Ga0316593_10014409 Ga0316593_100144092 270
638 3300033180 Ga0307510_10014110 Ga0307510_100141102 270
639 3300035398 Ga0316574_0000632 Ga0316574_0000632_10837_11679 270
640 3300035691 Ga0373931_0094209 Ga0373931_0094209_267_1106 270
641 3300036647 Ga0316582_0004691 Ga0316582_0004691_5175_6008 270
642 3300037312 Ga0395899_0068267 Ga0395899_0068267_767_1600 270
643 3300037471 Ga0395905_0132676 Ga0395905_0132676_1009_1869 270
644 3300038443 Ga0395901_0074441 Ga0395901_0074441_1412_2272 270
645 3300038725 Ga0400484_40600 Ga0400484_40600_1868_2686 270
646 3300038741 Ga0400488_40889 Ga0400488_40889_948_1766 270
647 3300039062 Ga0400483_035009 Ga0400483_035009_190_1008 270
648 3300039062 Ga0400483_052866 Ga0400483_052866_800_1618 270
649 3300039062 Ga0400483_156985 Ga0400483_156985_2091_2909 270
650 3300039062 Ga0400483_175745 Ga0400483_175745_2205_3023 270
651 3300042876 Ga0451577_0407843 Ga0451577_0407843_219_1058 270
652 3300044673 Ga0453683_0008588 Ga0453683_0008588_3428_4264 270
653 3300044673 Ga0453683_0013118 Ga0453683_0013118_125_964 270
654 3300044673 Ga0453683_0028708 Ga0453683_0028708_1644_2480 270
655 3300044712 Ga0453684_0000136 Ga0453684_0000136_172462_173298 270
656 3300045051 Ga0451576_0000025 Ga0451576_0000025_254593_255429 270
657 3300046471 Ga0495650_0000875 Ga0495650_0000875_1252_2082 270
658 3300046660 Ga0495625_0064107 Ga0495625_0064107_1573_2403 270
659 3300048922 Ga0496119_0015665 Ga0496119_0015665_4288_5127 270
660 3300048924 Ga0496121_0000018 Ga0496121_0000018_274459_275349 270
661 3300048924 Ga0496121_0160893 Ga0496121_0160893_707_1537 270
662 3300048927 Ga0496124_0000482 Ga0496124_0000482_66259_67089 270
663 3300053139 Ga0500568_0005072 Ga0500568_0005072_861_1682 270
664 3300001976 JGI24752J21851_1000307 JGI24752J21851_10003072 271
665 3300002067 JGI24735J21928_10004079 JGI24735J21928_100040791 271
666 3300002239 JGI24034J26672_10004300 JGI24034J26672_100043002 271
667 3300005295 Ga0065707_10131361 Ga0065707_101313611 271
668 3300005327 Ga0070658_10299189 Ga0070658_102991892 271
669 3300005331 Ga0070670_100000215 Ga0070670_10000021514 271
670 3300005331 Ga0070670_100405859 Ga0070670_1004058592 271
671 3300005334 Ga0068869_100119573 Ga0068869_1001195732 271
672 3300005339 Ga0070660_100028245 Ga0070660_1000282454 271
673 3300005340 Ga0070689_100027730 Ga0070689_1000277304 271
674 3300005344 Ga0070661_100303694 Ga0070661_1003036942 271
675 3300005347 Ga0070668_100338998 Ga0070668_1003389982 271
676 3300005354 Ga0070675_100152911 Ga0070675_1001529112 271
677 3300005355 Ga0070671_100075157 Ga0070671_1000751571 271
678 3300005355 Ga0070671_100158038 Ga0070671_1001580382 271
679 3300005355 Ga0070671_100231109 Ga0070671_1002311092 271
680 3300005355 Ga0070671_100250990 Ga0070671_1002509902 271
681 3300005355 Ga0070671_100391816 Ga0070671_1003918162 271
682 3300005355 Ga0070671_100570677 Ga0070671_1005706771 271
683 3300005356 Ga0070674_100011808 Ga0070674_1000118086 271
684 3300005364 Ga0070673_100403605 Ga0070673_1004036051 271
685 3300005366 Ga0070659_100049220 Ga0070659_1000492203 271
686 3300005367 Ga0070667_100000311 Ga0070667_10000031114 271
687 3300005367 Ga0070667_100114419 Ga0070667_1001144192 271
688 3300005434 Ga0070709_10011673 Ga0070709_100116734 271
689 3300005435 Ga0070714_100070859 Ga0070714_1000708592 271
690 3300005436 Ga0070713_100008425 Ga0070713_1000084257 271
691 3300005437 Ga0070710_10033748 Ga0070710_100337482 271
692 3300005439 Ga0070711_100044480 Ga0070711_1000444802 271
693 3300005441 Ga0070700_100053911 Ga0070700_1000539112 271
694 3300005441 Ga0070700_100162921 Ga0070700_1001629212 271
695 3300005456 Ga0070678_100027755 Ga0070678_1000277553 271
696 3300005458 Ga0070681_10004426 Ga0070681_100044264 271
697 3300005459 Ga0068867_100116336 Ga0068867_1001163362 271
698 3300005459 Ga0068867_100429558 Ga0068867_1004295581 271
699 3300005518 Ga0070699_100115885 Ga0070699_1001158852 271
700 3300005530 Ga0070679_100062984 Ga0070679_1000629842 271
701 3300005539 Ga0068853_100030851 Ga0068853_1000308512 271
702 3300005539 Ga0068853_100083430 Ga0068853_1000834302 271
703 3300005546 Ga0070696_100053019 Ga0070696_1000530192 271
704 3300005563 Ga0068855_100123502 Ga0068855_1001235022 271
705 3300005563 Ga0068855_100284869 Ga0068855_1002848692 271
706 3300005564 Ga0070664_100197576 Ga0070664_1001975762 271
707 3300005577 Ga0068857_100038979 Ga0068857_1000389794 271
708 3300005614 Ga0068856_100150554 Ga0068856_1001505542 271
709 3300005617 Ga0068859_100045069 Ga0068859_1000450692 271
710 3300005617 Ga0068859_100058999 Ga0068859_1000589994 271
711 3300005618 Ga0068864_100000080 Ga0068864_10000008084 271
712 3300005618 Ga0068864_100093056 Ga0068864_1000930562 271
713 3300005618 Ga0068864_100454406 Ga0068864_1004544061 271
714 3300005718 Ga0068866_10069840 Ga0068866_100698402 271
715 3300005719 Ga0068861_100102730 Ga0068861_1001027302 271
716 3300005840 Ga0068870_10053192 Ga0068870_100531922 271
717 3300005841 Ga0068863_100000087 Ga0068863_10000008784 271
718 3300005841 Ga0068863_100277638 Ga0068863_1002776382 271
719 3300005844 Ga0068862_100000101 Ga0068862_10000010184 271
720 3300005844 Ga0068862_100102783 Ga0068862_1001027833 271
721 3300006237 Ga0097621_100056087 Ga0097621_1000560872 271
722 3300006358 Ga0068871_100020727 Ga0068871_1000207273 271
723 3300006358 Ga0068871_100223985 Ga0068871_1002239852 271
724 3300006844 Ga0075428_100729151 Ga0075428_1007291511 271
725 3300006881 Ga0068865_100332470 Ga0068865_1003324702 271
726 3300006931 Ga0097620_100045071 Ga0097620_1000450712 271
727 3300006931 Ga0097620_100059000 Ga0097620_1000590002 271
728 3300007076 Ga0075435_100380311 Ga0075435_1003803112 271
729 3300009011 Ga0105251_10000248 Ga0105251_1000024837 271
730 3300009093 Ga0105240_10076090 Ga0105240_100760904 271
731 3300009098 Ga0105245_10170761 Ga0105245_101707612 271
732 3300009098 Ga0105245_10430114 Ga0105245_104301141 271
733 3300009101 Ga0105247_10010992 Ga0105247_100109924 271
734 3300009148 Ga0105243_10164162 Ga0105243_101641622 271
735 3300009174 Ga0105241_10215072 Ga0105241_102150722 271
736 3300009176 Ga0105242_10079123 Ga0105242_100791232 271
737 3300009177 Ga0105248_10000029 Ga0105248_10000029131 271
738 3300009177 Ga0105248_10928122 Ga0105248_109281221 271
739 3300009545 Ga0105237_10110227 Ga0105237_101102273 271
740 3300009545 Ga0105237_10161427 Ga0105237_101614272 271
741 3300009551 Ga0105238_10078488 Ga0105238_100784883 271
742 3300009551 Ga0105238_10091345 Ga0105238_100913453 271
743 3300009553 Ga0105249_10000024 Ga0105249_10000024123 271
744 3300010375 Ga0105239_10075351 Ga0105239_100753512 271
745 3300010375 Ga0105239_10190805 Ga0105239_101908051 271
746 3300011119 Ga0105246_10173911 Ga0105246_101739112 271
747 3300013100 Ga0157373_10163160 Ga0157373_101631602 271
748 3300013104 Ga0157370_10019615 Ga0157370_100196154 271
749 3300013104 Ga0157370_10041443 Ga0157370_100414432 271
750 3300013105 Ga0157369_10017309 Ga0157369_100173093 271
751 3300013296 Ga0157374_10237560 Ga0157374_102375602 271
752 3300013297 Ga0157378_10024372 Ga0157378_100243722 271
753 3300013306 Ga0163162_10004280 Ga0163162_100042804 271
754 3300013307 Ga0157372_10041579 Ga0157372_100415792 271
755 3300013307 Ga0157372_10205378 Ga0157372_102053782 271
756 3300013307 Ga0157372_10792219 Ga0157372_107922192 271
757 3300013308 Ga0157375_10084118 Ga0157375_100841184 271
758 3300013308 Ga0157375_10632127 Ga0157375_106321272 271
759 3300014325 Ga0163163_10395114 Ga0163163_103951141 271
760 3300014326 Ga0157380_10512905 Ga0157380_105129052 271
761 3300014968 Ga0157379_10031344 Ga0157379_100313442 271
762 3300014968 Ga0157379_10576732 Ga0157379_105767321 271
763 3300025735 Ga0207713_1001621 Ga0207713_100162110 271
764 3300025893 Ga0207682_10002359 Ga0207682_100023596 271
765 3300025898 Ga0207692_10082900 Ga0207692_100829002 271
766 3300025899 Ga0207642_10238754 Ga0207642_102387542 271
767 3300025904 Ga0207647_10042088 Ga0207647_100420882 271
768 3300025906 Ga0207699_10012730 Ga0207699_100127302 271
769 3300025907 Ga0207645_10004977 Ga0207645_100049772 271
770 3300025909 Ga0207705_10294640 Ga0207705_102946402 271
771 3300025912 Ga0207707_10051694 Ga0207707_100516943 271
772 3300025912 Ga0207707_10063189 Ga0207707_100631893 271
773 3300025912 Ga0207707_10067207 Ga0207707_100672072 271
774 3300025913 Ga0207695_10110438 Ga0207695_101104382 271
775 3300025913 Ga0207695_10213331 Ga0207695_102133311 271
776 3300025918 Ga0207662_10012396 Ga0207662_100123962 271
777 3300025919 Ga0207657_10032636 Ga0207657_100326362 271
778 3300025920 Ga0207649_10079631 Ga0207649_100796312 271
779 3300025921 Ga0207652_10103002 Ga0207652_101030022 271
780 3300025921 Ga0207652_10221233 Ga0207652_102212332 271
781 3300025923 Ga0207681_10438777 Ga0207681_104387771 271
782 3300025924 Ga0207694_10006910 Ga0207694_100069107 271
783 3300025924 Ga0207694_10065590 Ga0207694_100655903 271
784 3300025925 Ga0207650_10000261 Ga0207650_1000026118 271
785 3300025926 Ga0207659_10567969 Ga0207659_105679691 271
786 3300025928 Ga0207700_10057657 Ga0207700_100576572 271
787 3300025929 Ga0207664_10014169 Ga0207664_100141695 271
788 3300025931 Ga0207644_10161327 Ga0207644_101613272 271
789 3300025932 Ga0207690_10036014 Ga0207690_100360142 271
790 3300025933 Ga0207706_10019344 Ga0207706_100193446 271
791 3300025937 Ga0207669_10002845 Ga0207669_100028454 271
792 3300025941 Ga0207711_10000004 Ga0207711_10000004375 271
793 3300025945 Ga0207679_10123652 Ga0207679_101236522 271
794 3300025949 Ga0207667_10056836 Ga0207667_100568361 271
795 3300025949 Ga0207667_10201258 Ga0207667_102012583 271
796 3300025949 Ga0207667_10298950 Ga0207667_102989501 271
797 3300025961 Ga0207712_10000034 Ga0207712_10000034123 271
798 3300025981 Ga0207640_10133581 Ga0207640_101335812 271
799 3300025981 Ga0207640_10312010 Ga0207640_103120101 271
800 3300025986 Ga0207658_10000239 Ga0207658_1000023918 271
801 3300026035 Ga0207703_10011785 Ga0207703_100117854 271
802 3300026041 Ga0207639_10000444 Ga0207639_1000044417 271
803 3300026078 Ga0207702_10350595 Ga0207702_103505951 271
804 3300026088 Ga0207641_10000010 Ga0207641_1000001018 271
805 3300026095 Ga0207676_10000036 Ga0207676_1000003661 271
806 3300026116 Ga0207674_10022183 Ga0207674_100221832 271
807 3300026116 Ga0207674_10113888 Ga0207674_101138881 271
808 3300026116 Ga0207674_10225038 Ga0207674_102250382 271
809 3300026118 Ga0207675_100119961 Ga0207675_1001199611 271
810 3300026121 Ga0207683_10005122 Ga0207683_100051222 271
811 3300026142 Ga0207698_10003914 Ga0207698_100039146 271
812 3300027360 Ga0209969_1002048 Ga0209969_10020483 271
813 3300027364 Ga0209967_1000454 Ga0209967_10004543 271
814 3300027378 Ga0209981_1000559 Ga0209981_10005598 271
815 3300027462 Ga0210000_1000657 Ga0210000_10006573 271
816 3300027471 Ga0209995_1006673 Ga0209995_10066732 271
817 3300027614 Ga0209970_1020031 Ga0209970_10200311 271
818 3300028380 Ga0268265_10000059 Ga0268265_1000005914 271
819 3300028380 Ga0268265_10046520 Ga0268265_100465203 271
820 3300028381 Ga0268264_10080771 Ga0268264_100807712 271
821 3300028381 Ga0268264_10211174 Ga0268264_102111742 271
822 3300028666 Ga0265336_10001095 Ga0265336_100010958 271
823 3300029957 Ga0265324_10000034 Ga0265324_10000034114 271
824 3300031235 Ga0265330_10010943 Ga0265330_100109434 271
825 3300031238 Ga0265332_10002472 Ga0265332_100024728 271
826 3300031241 Ga0265325_10001197 Ga0265325_1000119721 271
827 3300031241 Ga0265325_10056177 Ga0265325_100561772 271
828 3300031250 Ga0265331_10002231 Ga0265331_100022317 271
829 3300031250 Ga0265331_10014874 Ga0265331_100148742 271
830 3300031251 Ga0265327_10028307 Ga0265327_100283072 271
831 3300031344 Ga0265316_10014713 Ga0265316_100147135 271
832 3300031344 Ga0265316_10079046 Ga0265316_100790462 271
833 3300031665 Ga0316575_10000032 Ga0316575_1000003230 271
834 3300031665 Ga0316575_10013342 Ga0316575_100133422 271
835 3300031711 Ga0265314_10000455 Ga0265314_1000045515 271
836 3300031711 Ga0265314_10015711 Ga0265314_100157114 271
837 3300031711 Ga0265314_10097282 Ga0265314_100972822 271
838 3300031727 Ga0316576_10195538 Ga0316576_101955382 271
839 3300031731 Ga0307405_10025213 Ga0307405_100252132 271
840 3300031824 Ga0307413_10398562 Ga0307413_103985622 271
841 3300031852 Ga0307410_10101728 Ga0307410_101017282 271
842 3300031852 Ga0307410_10117562 Ga0307410_101175622 271
843 3300031911 Ga0307412_10065102 Ga0307412_100651022 271
844 3300032002 Ga0307416_100014367 Ga0307416_1000143672 271
845 3300032002 Ga0307416_100181399 Ga0307416_1001813992 271
846 3300032126 Ga0307415_100165571 Ga0307415_1001655712 271
847 3300032133 Ga0316583_10000448 Ga0316583_1000044812 271
848 3300032133 Ga0316583_10016234 Ga0316583_100162342 271
849 3300035086 Ga0373934_0018133 Ga0373934_0018133_512_1366 271
850 3300035118 Ga0373954_0001519 Ga0373954_0001519_6668_7528 271
851 3300035170 Ga0373943_0086436 Ga0373943_0086436_275_1135 271
852 3300035171 Ga0373946_0015802 Ga0373946_0015802_1814_2671 271
853 3300035172 Ga0373955_0106145 Ga0373955_0106145_189_1055 271
854 3300036401 Ga0373937_0028802 Ga0373937_0028802_3424_4290 271
855 3300036647 Ga0316582_0012361 Ga0316582_0012361_2796_3632 271
856 3300036647 Ga0316582_0300241 Ga0316582_0300241_96_947 271
857 3300037471 Ga0395905_0068873 Ga0395905_0068873_1192_2043 271
858 3300037471 Ga0395905_0268130 Ga0395905_0268130_389_1234 271
859 3300037471 Ga0395905_0333172 Ga0395905_0333172_285_1136 271
860 3300039437 Ga0436365_1487032 Ga0436365_1487032_929_1765 271
861 3300041410 Ga0439461_0004264 Ga0439461_0004264_405_1250 271
862 3300042156 Ga0439446_0002259 Ga0439446_0002259_2621_3466 271
863 3300042157 Ga0439458_0000731 Ga0439458_0000731_288_1139 271
864 3300042435 Ga0439434_0002599 Ga0439434_0002599_2182_3027 271
865 3300042436 Ga0439435_0000122 Ga0439435_0000122_8035_8880 271
866 3300042876 Ga0451577_0000002 Ga0451577_0000002_1910_2761 271
867 3300042876 Ga0451577_0188643 Ga0451577_0188643_32_883 271
868 3300042876 Ga0451577_0291491 Ga0451577_0291491_263_1102 271
869 3300042876 Ga0451577_0564223 Ga0451577_0564223_111_959 271
870 3300044673 Ga0453683_0000003 Ga0453683_0000003_1910_2761 271
871 3300044673 Ga0453683_0021942 Ga0453683_0021942_3156_4007 271
872 3300044712 Ga0453684_0000002 Ga0453684_0000002_1728615_1729466 271
873 3300044712 Ga0453684_0003022 Ga0453684_0003022_1943_2794 271
874 3300044712 Ga0453684_0140528 Ga0453684_0140528_351_1202 271
875 3300044712 Ga0453684_0179063 Ga0453684_0179063_716_1567 271
876 3300045051 Ga0451576_0000470 Ga0451576_0000470_70796_71647 271
877 3300045051 Ga0451576_0001215 Ga0451576_0001215_43134_43985 271
878 3300045051 Ga0451576_0002448 Ga0451576_0002448_6747_7598 271
879 3300045051 Ga0451576_0032599 Ga0451576_0032599_4416_5267 271
880 3300045051 Ga0451576_0211898 Ga0451576_0211898_913_1752 271
881 3300046557 Ga0495622_0023242 Ga0495622_0023242_777_1631 271
882 3300048906 Ga0496103_0134416 Ga0496103_0134416_66_890 271
883 3300048908 Ga0496105_0219576 Ga0496105_0219576_221_1075 271
884 3300048911 Ga0496108_0281155 Ga0496108_0281155_469_1323 271
885 3300048920 Ga0496117_0006334 Ga0496117_0006334_1939_2763 271
886 3300048921 Ga0496118_0000335 Ga0496118_0000335_33274_34098 271
887 3300048924 Ga0496121_0324737 Ga0496121_0324737_164_988 271
888 3300050513 nmdc:mga0rr50_392177_c1 nmdc:mga0rr50_392177_c1_79_915 271
889 3300050514 nmdc:mga08x19_6440_c1 nmdc:mga08x19_6440_c1_2151_2987 271
890 3300050514 nmdc:mga08x19_66160_c1 nmdc:mga08x19_66160_c1_549_1409 271
891 iso_pu_bacteria 2599185354 2600203523 271
892 iso_pu_bacteria 2643221541 2643729197 271
893 iso_pu_bacteria 2643221606 2644045672 271
894 iso_pu_bacteria 2643221671 2644393250 271
895 iso_pu_bacteria 2751185897 2753765706 271
896 iso_pu_bacteria 8054302542 8054307605 271
897 iso_pu_bacteria 8057101203 8057105145 271
898 3300032126 Ga0307415_100293719 Ga0307415_1002937192 272
899 3300037471 Ga0395905_0070601 Ga0395905_0070601_156_1022 272
900 3300045051 Ga0451576_0748256 Ga0451576_0748256_139_978 272
901 3300047469 Ga0495673_0025165 Ga0495673_0025165_1175_2002 272
902 iso_pu_bacteria 2510917021 2511127899 272
903 iso_pu_bacteria 2582581305 2585263925 272
904 iso_pu_bacteria 2738541301 2738849529 272
905 iso_pu_bacteria 2738541304 2738865258 272
906 iso_pu_bacteria 2738543022 2739297776 272
907 iso_pu_bacteria 2738543033 2739359454 272
908 iso_pu_bacteria 2885427238 2885428401 272
909 iso_pu_bacteria 2887375801 2887377924 272
910 iso_pu_bacteria 2896184354 2896186336 272
911 3300048927 Ga0496124_0050352 Ga0496124_0050352_1407_2237 273
912 3300031911 Ga0307412_10123293 Ga0307412_101232932 274
913 3300031995 Ga0307409_100199359 Ga0307409_1001993592 274
914 3300032004 Ga0307414_10241522 Ga0307414_102415222 274
915 3300032126 Ga0307415_100008943 Ga0307415_1000089434 274
916 3300001989 JGI24739J22299_10018339 JGI24739J22299_100183394 275
917 3300001990 JGI24737J22298_10012773 JGI24737J22298_100127732 275
918 3300005295 Ga0065707_10088012 Ga0065707_100880125 275
919 3300005457 Ga0070662_100112432 Ga0070662_1001124321 275
920 3300005539 Ga0068853_100008986 Ga0068853_1000089864 275
921 3300005577 Ga0068857_100093063 Ga0068857_1000930633 275
922 3300005578 Ga0068854_100029377 Ga0068854_1000293774 275
923 3300005617 Ga0068859_100051254 Ga0068859_1000512543 275
924 3300005937 Ga0081455_10000049 Ga0081455_10000049131 275
925 3300006931 Ga0097620_100051254 Ga0097620_1000512543 275
926 3300009551 Ga0105238_10152378 Ga0105238_101523784 275
927 3300009553 Ga0105249_10014202 Ga0105249_100142024 275
928 3300026041 Ga0207639_10006681 Ga0207639_100066813 275
929 3300026116 Ga0207674_10055246 Ga0207674_100552463 275
930 3300031731 Ga0307405_10004996 Ga0307405_100049962 275
931 3300031824 Ga0307413_10002690 Ga0307413_100026903 275
932 3300031824 Ga0307413_10024069 Ga0307413_100240691 275
933 3300031824 Ga0307413_10041411 Ga0307413_100414112 275
934 3300031852 Ga0307410_10001364 Ga0307410_100013649 275
935 3300031852 Ga0307410_10053311 Ga0307410_100533113 275
936 3300031901 Ga0307406_10112341 Ga0307406_101123411 275
937 3300031903 Ga0307407_10021781 Ga0307407_100217813 275
938 3300031911 Ga0307412_10140762 Ga0307412_101407622 275
939 3300031995 Ga0307409_100650341 Ga0307409_1006503412 275
940 3300032004 Ga0307414_10052399 Ga0307414_100523992 275
941 3300032005 Ga0307411_10013055 Ga0307411_100130553 275
942 3300032005 Ga0307411_10032713 Ga0307411_100327134 275
943 3300032126 Ga0307415_100234936 Ga0307415_1002349362 275
944 3300044735 Ga0466968_0071147 Ga0466968_0071147_425_1255 275
945 3300046506 Ga0495583_0114168 Ga0495583_0114168_99_926 275
946 3300046522 Ga0495643_0001112 Ga0495643_0001112_2227_3054 275
947 3300046525 Ga0495663_0039600 Ga0495663_0039600_314_1141 275
948 3300046616 Ga0495668_0016477 Ga0495668_0016477_2836_3663 275
949 3300047472 Ga0495686_0000779 Ga0495686_0000779_7416_8291 275
950 3300048090 Ga0495615_0000031 Ga0495615_0000031_38935_39762 275
951 3300048924 Ga0496121_0000348 Ga0496121_0000348_30338_31177 275
952 3300048925 Ga0496122_0000728 Ga0496122_0000728_13989_14816 275
953 3300048926 Ga0496123_0000440 Ga0496123_0000440_13988_14815 275
954 3300049523 Ga0501300_000003 Ga0501300_000003_7202_8050 275
955 3300049653 Ga0501206_000046 Ga0501206_000046_7556_8404 275
956 3300049662 Ga0501222_000245 Ga0501222_000245_3320_4168 275
957 3300049664 Ga0501224_000275 Ga0501224_000275_910_1758 275
958 3300049665 Ga0501227_000132 Ga0501227_000132_6360_7208 275
959 3300053116 Ga0500592_000888 Ga0500592_000888_3348_4175 275
960 3300053136 Ga0500559_0153866 Ga0500559_0153866_213_1040 275
961 iso_pu_bacteria 2984555340 2984559144 275
962 iso_pu_bacteria 2993356040 2993359830 275
963 2162886007 SwRhRL2b_contig_2334788 SwRhRL2b_0502.00010660 276
964 2162886007 SwRhRL2b_contig_688890 SwRhRL2b_0280.00005030 276
965 3300001915 JGI24741J21665_1006827 JGI24741J21665_10068273 276
966 3300001915 JGI24741J21665_1008590 JGI24741J21665_10085902 276
967 3300001979 JGI24740J21852_10028967 JGI24740J21852_100289672 276
968 3300001979 JGI24740J21852_10056642 JGI24740J21852_100566421 276
969 3300001989 JGI24739J22299_10006699 JGI24739J22299_100066991 276
970 3300001990 JGI24737J22298_10000494 JGI24737J22298_100004945 276
971 3300002067 JGI24735J21928_10005053 JGI24735J21928_100050532 276
972 3300002067 JGI24735J21928_10007347 JGI24735J21928_100073472 276
973 3300002067 JGI24735J21928_10007986 JGI24735J21928_100079863 276
974 3300002067 JGI24735J21928_10019572 JGI24735J21928_100195722 276
975 3300002075 JGI24738J21930_10002391 JGI24738J21930_100023913 276
976 3300002077 JGI24744J21845_10001768 JGI24744J21845_100017683 276
977 3300003322 rootL2_10214738 rootL2_102147381 276
978 3300003762 Ga0055542_1008997 Ga0055542_10089972 276
979 3300005289 Ga0065704_10000277 Ga0065704_1000027752 276
980 3300005289 Ga0065704_10070166 Ga0065704_10070166154 276
981 3300005290 Ga0065712_10245083 Ga0065712_102450831 276
982 3300005293 Ga0065715_10123978 Ga0065715_101239781 276
983 3300005293 Ga0065715_10174748 Ga0065715_101747482 276
984 3300005327 Ga0070658_10000346 Ga0070658_1000034644 276
985 3300005327 Ga0070658_10001292 Ga0070658_100012923 276
986 3300005327 Ga0070658_10004662 Ga0070658_100046629 276
987 3300005327 Ga0070658_10022658 Ga0070658_100226583 276
988 3300005327 Ga0070658_10028612 Ga0070658_100286124 276
989 3300005327 Ga0070658_10029286 Ga0070658_100292863 276
990 3300005327 Ga0070658_10048778 Ga0070658_100487783 276
991 3300005327 Ga0070658_10050618 Ga0070658_100506181 276
992 3300005327 Ga0070658_10056061 Ga0070658_100560612 276
993 3300005327 Ga0070658_10318288 Ga0070658_103182882 276
994 3300005327 Ga0070658_10333576 Ga0070658_103335762 276
995 3300005328 Ga0070676_10003358 Ga0070676_100033586 276
996 3300005328 Ga0070676_10037177 Ga0070676_100371772 276
997 3300005329 Ga0070683_100013626 Ga0070683_1000136266 276
998 3300005329 Ga0070683_100055757 Ga0070683_1000557572 276
999 3300005330 Ga0070690_100015145 Ga0070690_1000151452 276
1000 3300005331 Ga0070670_100002629 Ga0070670_10000262912 276
1001 3300005331 Ga0070670_100010219 Ga0070670_1000102192 276
1002 3300005331 Ga0070670_100012723 Ga0070670_1000127235 276
1003 3300005331 Ga0070670_100021381 Ga0070670_1000213815 276
1004 3300005331 Ga0070670_100035052 Ga0070670_1000350522 276
1005 3300005331 Ga0070670_100070918 Ga0070670_1000709182 276
1006 3300005331 Ga0070670_100208852 Ga0070670_1002088522 276
1007 3300005331 Ga0070670_100302369 Ga0070670_1003023692 276
1008 3300005333 Ga0070677_10005554 Ga0070677_100055544 276
1009 3300005333 Ga0070677_10241618 Ga0070677_102416181 276
1010 3300005335 Ga0070666_10020001 Ga0070666_100200012 276
1011 3300005335 Ga0070666_10046797 Ga0070666_100467973 276
1012 3300005335 Ga0070666_10297876 Ga0070666_102978762 276
1013 3300005336 Ga0070680_100382841 Ga0070680_1003828411 276
1014 3300005336 Ga0070680_100556201 Ga0070680_1005562011 276
1015 3300005338 Ga0068868_100234436 Ga0068868_1002344361 276
1016 3300005339 Ga0070660_100000061 Ga0070660_10000006127 276
1017 3300005339 Ga0070660_100041906 Ga0070660_1000419062 276
1018 3300005339 Ga0070660_100051068 Ga0070660_1000510683 276
1019 3300005339 Ga0070660_100067753 Ga0070660_1000677533 276
1020 3300005339 Ga0070660_100086870 Ga0070660_1000868703 276
1021 3300005344 Ga0070661_100027230 Ga0070661_1000272303 276
1022 3300005344 Ga0070661_100042833 Ga0070661_1000428332 276
1023 3300005344 Ga0070661_100078160 Ga0070661_1000781602 276
1024 3300005344 Ga0070661_100213759 Ga0070661_1002137592 276
1025 3300005344 Ga0070661_100256285 Ga0070661_1002562852 276
1026 3300005344 Ga0070661_100278924 Ga0070661_1002789242 276
1027 3300005345 Ga0070692_10042128 Ga0070692_100421282 276
1028 3300005345 Ga0070692_10166504 Ga0070692_101665042 276
1029 3300005347 Ga0070668_100005937 Ga0070668_1000059374 276
1030 3300005347 Ga0070668_100015747 Ga0070668_1000157472 276
1031 3300005347 Ga0070668_100118574 Ga0070668_1001185743 276
1032 3300005353 Ga0070669_100000039 Ga0070669_10000003964 276
1033 3300005353 Ga0070669_100126703 Ga0070669_1001267032 276
1034 3300005354 Ga0070675_100002767 Ga0070675_1000027674 276
1035 3300005354 Ga0070675_100015009 Ga0070675_1000150092 276
1036 3300005354 Ga0070675_100096808 Ga0070675_1000968082 276
1037 3300005354 Ga0070675_100111533 Ga0070675_1001115331 276
1038 3300005355 Ga0070671_100000773 Ga0070671_1000007733 276
1039 3300005355 Ga0070671_100006541 Ga0070671_1000065417 276
1040 3300005355 Ga0070671_100030434 Ga0070671_1000304345 276
1041 3300005355 Ga0070671_100082437 Ga0070671_1000824372 276
1042 3300005355 Ga0070671_100257118 Ga0070671_1002571182 276
1043 3300005356 Ga0070674_100014053 Ga0070674_1000140534 276
1044 3300005356 Ga0070674_100023891 Ga0070674_1000238914 276
1045 3300005356 Ga0070674_100106261 Ga0070674_1001062613 276
1046 3300005356 Ga0070674_100253924 Ga0070674_1002539242 276
1047 3300005364 Ga0070673_100092197 Ga0070673_1000921972 276
1048 3300005364 Ga0070673_100384427 Ga0070673_1003844272 276
1049 3300005366 Ga0070659_100022542 Ga0070659_1000225422 276
1050 3300005366 Ga0070659_100071857 Ga0070659_1000718572 276
1051 3300005366 Ga0070659_100080375 Ga0070659_1000803753 276
1052 3300005366 Ga0070659_100202262 Ga0070659_1002022622 276
1053 3300005366 Ga0070659_100204957 Ga0070659_1002049572 276
1054 3300005366 Ga0070659_100216876 Ga0070659_1002168762 276
1055 3300005367 Ga0070667_100000719 Ga0070667_1000007199 276
1056 3300005367 Ga0070667_100016267 Ga0070667_1000162673 276
1057 3300005367 Ga0070667_100023131 Ga0070667_1000231314 276
1058 3300005367 Ga0070667_100039178 Ga0070667_1000391784 276
1059 3300005367 Ga0070667_100257829 Ga0070667_1002578292 276
1060 3300005367 Ga0070667_100294973 Ga0070667_1002949731 276
1061 3300005367 Ga0070667_100314193 Ga0070667_1003141932 276
1062 3300005367 Ga0070667_100497516 Ga0070667_1004975162 276
1063 3300005455 Ga0070663_100001512 Ga0070663_1000015125 276
1064 3300005455 Ga0070663_100003374 Ga0070663_1000033743 276
1065 3300005455 Ga0070663_100018361 Ga0070663_1000183612 276
1066 3300005455 Ga0070663_100153681 Ga0070663_1001536812 276
1067 3300005455 Ga0070663_100456063 Ga0070663_1004560632 276
1068 3300005456 Ga0070678_100005924 Ga0070678_1000059245 276
1069 3300005456 Ga0070678_100013063 Ga0070678_1000130632 276
1070 3300005456 Ga0070678_100046844 Ga0070678_1000468442 276
1071 3300005456 Ga0070678_100085640 Ga0070678_1000856402 276
1072 3300005456 Ga0070678_100135069 Ga0070678_1001350692 276
1073 3300005457 Ga0070662_100027175 Ga0070662_1000271752 276
1074 3300005457 Ga0070662_100082238 Ga0070662_1000822382 276
1075 3300005457 Ga0070662_100152521 Ga0070662_1001525212 276
1076 3300005457 Ga0070662_100168012 Ga0070662_1001680122 276
1077 3300005457 Ga0070662_100228458 Ga0070662_1002284582 276
1078 3300005457 Ga0070662_100371354 Ga0070662_1003713542 276
1079 3300005458 Ga0070681_10055825 Ga0070681_100558252 276
1080 3300005459 Ga0068867_100006326 Ga0068867_1000063267 276
1081 3300005459 Ga0068867_100011025 Ga0068867_1000110256 276
1082 3300005459 Ga0068867_100017468 Ga0068867_1000174682 276
1083 3300005530 Ga0070679_100027894 Ga0070679_1000278943 276
1084 3300005530 Ga0070679_100200596 Ga0070679_1002005962 276
1085 3300005535 Ga0070684_100007162 Ga0070684_1000071625 276
1086 3300005539 Ga0068853_100018144 Ga0068853_1000181443 276
1087 3300005539 Ga0068853_100088568 Ga0068853_1000885682 276
1088 3300005543 Ga0070672_100028839 Ga0070672_1000288394 276
1089 3300005543 Ga0070672_100035121 Ga0070672_1000351213 276
1090 3300005543 Ga0070672_100053474 Ga0070672_1000534742 276
1091 3300005543 Ga0070672_100077767 Ga0070672_1000777672 276
1092 3300005543 Ga0070672_100134435 Ga0070672_1001344353 276
1093 3300005543 Ga0070672_100166931 Ga0070672_1001669312 276
1094 3300005543 Ga0070672_100237596 Ga0070672_1002375962 276
1095 3300005547 Ga0070693_100247166 Ga0070693_1002471661 276
1096 3300005548 Ga0070665_100001414 Ga0070665_10000141419 276
1097 3300005548 Ga0070665_100010033 Ga0070665_1000100334 276
1098 3300005548 Ga0070665_100011572 Ga0070665_1000115725 276
1099 3300005548 Ga0070665_100028966 Ga0070665_1000289662 276
1100 3300005563 Ga0068855_100000318 Ga0068855_10000031855 276
1101 3300005563 Ga0068855_100000521 Ga0068855_10000052137 276
1102 3300005563 Ga0068855_100260587 Ga0068855_1002605872 276
1103 3300005563 Ga0068855_100645099 Ga0068855_1006450991 276
1104 3300005564 Ga0070664_100001709 Ga0070664_10000170916 276
1105 3300005564 Ga0070664_100009914 Ga0070664_1000099147 276
1106 3300005564 Ga0070664_100049031 Ga0070664_1000490313 276
1107 3300005564 Ga0070664_100055882 Ga0070664_1000558824 276
1108 3300005564 Ga0070664_100551193 Ga0070664_1005511931 276
1109 3300005577 Ga0068857_100005165 Ga0068857_1000051657 276
1110 3300005577 Ga0068857_100014492 Ga0068857_1000144927 276
1111 3300005577 Ga0068857_100286460 Ga0068857_1002864602 276
1112 3300005578 Ga0068854_100000305 Ga0068854_1000003059 276
1113 3300005578 Ga0068854_100030143 Ga0068854_1000301432 276
1114 3300005578 Ga0068854_100040802 Ga0068854_1000408024 276
1115 3300005578 Ga0068854_100148454 Ga0068854_1001484542 276
1116 3300005614 Ga0068856_100101998 Ga0068856_1001019983 276
1117 3300005614 Ga0068856_100212485 Ga0068856_1002124852 276
1118 3300005614 Ga0068856_100280407 Ga0068856_1002804072 276
1119 3300005616 Ga0068852_100039096 Ga0068852_1000390964 276
1120 3300005616 Ga0068852_100052813 Ga0068852_1000528132 276
1121 3300005616 Ga0068852_100284708 Ga0068852_1002847082 276
1122 3300005616 Ga0068852_100292679 Ga0068852_1002926792 276
1123 3300005616 Ga0068852_100302945 Ga0068852_1003029452 276
1124 3300005616 Ga0068852_100423509 Ga0068852_1004235092 276
1125 3300005617 Ga0068859_100006378 Ga0068859_1000063784 276
1126 3300005617 Ga0068859_100029513 Ga0068859_1000295133 276
1127 3300005617 Ga0068859_100040182 Ga0068859_1000401822 276
1128 3300005618 Ga0068864_100004698 Ga0068864_1000046989 276
1129 3300005618 Ga0068864_100007742 Ga0068864_1000077422 276
1130 3300005718 Ga0068866_10006755 Ga0068866_100067555 276
1131 3300005840 Ga0068870_10037909 Ga0068870_100379092 276
1132 3300005841 Ga0068863_100002281 Ga0068863_10000228117 276
1133 3300005841 Ga0068863_100004857 Ga0068863_1000048576 276
1134 3300005841 Ga0068863_100006844 Ga0068863_1000068443 276
1135 3300005841 Ga0068863_100008188 Ga0068863_1000081883 276
1136 3300005842 Ga0068858_100003609 Ga0068858_10000360912 276
1137 3300005842 Ga0068858_100020002 Ga0068858_1000200025 276
1138 3300005842 Ga0068858_100045039 Ga0068858_1000450396 276
1139 3300005843 Ga0068860_100006919 Ga0068860_1000069193 276
1140 3300005843 Ga0068860_100019783 Ga0068860_1000197832 276
1141 3300005844 Ga0068862_100010866 Ga0068862_1000108665 276
1142 3300005844 Ga0068862_100111639 Ga0068862_1001116392 276
1143 3300005985 Ga0081539_10046157 Ga0081539_100461572 276
1144 3300006175 Ga0070712_100490843 Ga0070712_1004908431 276
1145 3300006237 Ga0097621_100015274 Ga0097621_1000152745 276
1146 3300006237 Ga0097621_100148176 Ga0097621_1001481762 276
1147 3300006237 Ga0097621_100593006 Ga0097621_1005930061 276
1148 3300006353 Ga0075370_10111389 Ga0075370_101113892 276
1149 3300006358 Ga0068871_100012038 Ga0068871_1000120382 276
1150 3300006358 Ga0068871_100184331 Ga0068871_1001843312 276
1151 3300006881 Ga0068865_100007803 Ga0068865_1000078033 276
1152 3300006881 Ga0068865_100029311 Ga0068865_1000293112 276
1153 3300006881 Ga0068865_100122431 Ga0068865_1001224312 276
1154 3300006931 Ga0097620_100006378 Ga0097620_1000063784 276
1155 3300006931 Ga0097620_100029513 Ga0097620_1000295133 276
1156 3300006931 Ga0097620_100040181 Ga0097620_1000401812 276
1157 3300009092 Ga0105250_10012130 Ga0105250_100121302 276
1158 3300009093 Ga0105240_10012857 Ga0105240_100128575 276
1159 3300009098 Ga0105245_10005132 Ga0105245_100051327 276
1160 3300009101 Ga0105247_10013032 Ga0105247_100130322 276
1161 3300009101 Ga0105247_10050241 Ga0105247_100502412 276
1162 3300009148 Ga0105243_10019063 Ga0105243_100190633 276
1163 3300009148 Ga0105243_10034579 Ga0105243_100345794 276
1164 3300009148 Ga0105243_10362337 Ga0105243_103623372 276
1165 3300009174 Ga0105241_10031750 Ga0105241_100317505 276
1166 3300009176 Ga0105242_10004511 Ga0105242_100045114 276
1167 3300009176 Ga0105242_10340836 Ga0105242_103408362 276
1168 3300009177 Ga0105248_10002781 Ga0105248_1000278117 276
1169 3300009177 Ga0105248_10314815 Ga0105248_103148151 276
1170 3300009177 Ga0105248_10315269 Ga0105248_103152692 276
1171 3300009551 Ga0105238_10051853 Ga0105238_100518532 276
1172 3300009553 Ga0105249_10004337 Ga0105249_100043374 276
1173 3300010375 Ga0105239_10033368 Ga0105239_100333685 276
1174 3300010375 Ga0105239_10079188 Ga0105239_100791882 276
1175 3300011119 Ga0105246_10332686 Ga0105246_103326861 276
1176 3300013100 Ga0157373_10025278 Ga0157373_100252782 276
1177 3300013100 Ga0157373_10027801 Ga0157373_100278014 276
1178 3300013100 Ga0157373_10066690 Ga0157373_100666902 276
1179 3300013100 Ga0157373_10076624 Ga0157373_100766242 276
1180 3300013102 Ga0157371_10000458 Ga0157371_1000045834 276
1181 3300013102 Ga0157371_10149178 Ga0157371_101491782 276
1182 3300013102 Ga0157371_10295730 Ga0157371_102957302 276
1183 3300013102 Ga0157371_10427211 Ga0157371_104272111 276
1184 3300013102 Ga0157371_10452648 Ga0157371_104526481 276
1185 3300013104 Ga0157370_10049730 Ga0157370_100497302 276
1186 3300013104 Ga0157370_10222562 Ga0157370_102225622 276
1187 3300013104 Ga0157370_10548379 Ga0157370_105483792 276
1188 3300013105 Ga0157369_10130557 Ga0157369_101305572 276
1189 3300013296 Ga0157374_10505298 Ga0157374_105052982 276
1190 3300013297 Ga0157378_10029068 Ga0157378_100290682 276
1191 3300013306 Ga0163162_10031373 Ga0163162_100313732 276
1192 3300013306 Ga0163162_10031503 Ga0163162_100315034 276
1193 3300013306 Ga0163162_10070176 Ga0163162_100701762 276
1194 3300013306 Ga0163162_10075705 Ga0163162_100757054 276
1195 3300013306 Ga0163162_10566021 Ga0163162_105660212 276
1196 3300013307 Ga0157372_10061988 Ga0157372_100619883 276
1197 3300013307 Ga0157372_10155616 Ga0157372_101556162 276
1198 3300013307 Ga0157372_10209810 Ga0157372_102098102 276
1199 3300013307 Ga0157372_10778988 Ga0157372_107789882 276
1200 3300013308 Ga0157375_10107059 Ga0157375_101070592 276
1201 3300013308 Ga0157375_10403669 Ga0157375_104036692 276
1202 3300013308 Ga0157375_10580044 Ga0157375_105800442 276
1203 3300013308 Ga0157375_10672693 Ga0157375_106726932 276
1204 3300014325 Ga0163163_10000486 Ga0163163_1000048641 276
1205 3300014325 Ga0163163_10012757 Ga0163163_100127573 276
1206 3300014325 Ga0163163_10022986 Ga0163163_100229862 276
1207 3300014326 Ga0157380_10005490 Ga0157380_100054905 276
1208 3300014326 Ga0157380_10141637 Ga0157380_101416372 276
1209 3300014326 Ga0157380_10286323 Ga0157380_102863232 276
1210 3300014968 Ga0157379_10044790 Ga0157379_100447902 276
1211 3300014968 Ga0157379_10052629 Ga0157379_100526294 276
1212 3300014969 Ga0157376_10001808 Ga0157376_100018085 276
1213 3300017792 Ga0163161_10022718 Ga0163161_100227182 276
1214 3300017792 Ga0163161_10037732 Ga0163161_100377324 276
1215 3300021388 Ga0213875_10020131 Ga0213875_100201313 276
1216 3300025254 Ga0209148_1000112 Ga0209148_100011231 276
1217 3300025315 Ga0207697_10014993 Ga0207697_100149933 276
1218 3300025321 Ga0207656_10102569 Ga0207656_101025692 276
1219 3300025711 Ga0207696_1008638 Ga0207696_10086384 276
1220 3300025735 Ga0207713_1053799 Ga0207713_10537992 276
1221 3300025893 Ga0207682_10004235 Ga0207682_100042354 276
1222 3300025893 Ga0207682_10014123 Ga0207682_100141232 276
1223 3300025893 Ga0207682_10076455 Ga0207682_100764552 276
1224 3300025901 Ga0207688_10119334 Ga0207688_101193342 276
1225 3300025901 Ga0207688_10135246 Ga0207688_101352462 276
1226 3300025903 Ga0207680_10034205 Ga0207680_100342053 276
1227 3300025903 Ga0207680_10322023 Ga0207680_103220232 276
1228 3300025904 Ga0207647_10009598 Ga0207647_100095989 276
1229 3300025904 Ga0207647_10050587 Ga0207647_100505872 276
1230 3300025904 Ga0207647_10058366 Ga0207647_100583662 276
1231 3300025904 Ga0207647_10064261 Ga0207647_100642613 276
1232 3300025904 Ga0207647_10108330 Ga0207647_101083302 276
1233 3300025907 Ga0207645_10001990 Ga0207645_100019907 276
1234 3300025907 Ga0207645_10059073 Ga0207645_100590733 276
1235 3300025909 Ga0207705_10000014 Ga0207705_10000014153 276
1236 3300025909 Ga0207705_10000131 Ga0207705_1000013144 276
1237 3300025909 Ga0207705_10001170 Ga0207705_1000117016 276
1238 3300025909 Ga0207705_10006298 Ga0207705_100062985 276
1239 3300025909 Ga0207705_10014989 Ga0207705_100149894 276
1240 3300025909 Ga0207705_10025868 Ga0207705_100258682 276
1241 3300025909 Ga0207705_10026848 Ga0207705_100268483 276
1242 3300025909 Ga0207705_10232378 Ga0207705_102323782 276
1243 3300025909 Ga0207705_10349257 Ga0207705_103492571 276
1244 3300025912 Ga0207707_10093841 Ga0207707_100938412 276
1245 3300025913 Ga0207695_10035048 Ga0207695_100350485 276
1246 3300025914 Ga0207671_10011024 Ga0207671_100110243 276
1247 3300025917 Ga0207660_10335387 Ga0207660_103353871 276
1248 3300025919 Ga0207657_10000181 Ga0207657_1000018148 276
1249 3300025919 Ga0207657_10004300 Ga0207657_100043009 276
1250 3300025919 Ga0207657_10009307 Ga0207657_100093075 276
1251 3300025919 Ga0207657_10018700 Ga0207657_100187004 276
1252 3300025919 Ga0207657_10033269 Ga0207657_100332693 276
1253 3300025919 Ga0207657_10101765 Ga0207657_101017653 276
1254 3300025919 Ga0207657_10251102 Ga0207657_102511021 276
1255 3300025919 Ga0207657_10304218 Ga0207657_103042182 276
1256 3300025920 Ga0207649_10033738 Ga0207649_100337383 276
1257 3300025920 Ga0207649_10042008 Ga0207649_100420083 276
1258 3300025920 Ga0207649_10146139 Ga0207649_101461392 276
1259 3300025920 Ga0207649_10183569 Ga0207649_101835692 276
1260 3300025920 Ga0207649_10231759 Ga0207649_102317592 276
1261 3300025921 Ga0207652_10018191 Ga0207652_100181912 276
1262 3300025923 Ga0207681_10000144 Ga0207681_100001446 276
1263 3300025923 Ga0207681_10027718 Ga0207681_100277184 276
1264 3300025923 Ga0207681_10564245 Ga0207681_105642451 276
1265 3300025924 Ga0207694_10224236 Ga0207694_102242362 276
1266 3300025925 Ga0207650_10002113 Ga0207650_100021135 276
1267 3300025925 Ga0207650_10009693 Ga0207650_100096937 276
1268 3300025925 Ga0207650_10042981 Ga0207650_100429812 276
1269 3300025925 Ga0207650_10096046 Ga0207650_100960463 276
1270 3300025925 Ga0207650_10262052 Ga0207650_102620522 276
1271 3300025925 Ga0207650_10280270 Ga0207650_102802702 276
1272 3300025925 Ga0207650_10287416 Ga0207650_102874162 276
1273 3300025925 Ga0207650_10347058 Ga0207650_103470582 276
1274 3300025925 Ga0207650_10364159 Ga0207650_103641592 276
1275 3300025926 Ga0207659_10005777 Ga0207659_100057774 276
1276 3300025926 Ga0207659_10117903 Ga0207659_101179032 276
1277 3300025929 Ga0207664_10114716 Ga0207664_101147162 276
1278 3300025931 Ga0207644_10001127 Ga0207644_100011279 276
1279 3300025931 Ga0207644_10028462 Ga0207644_100284622 276
1280 3300025931 Ga0207644_10045508 Ga0207644_100455083 276
1281 3300025931 Ga0207644_10229762 Ga0207644_102297621 276
1282 3300025932 Ga0207690_10009287 Ga0207690_100092873 276
1283 3300025932 Ga0207690_10104737 Ga0207690_101047372 276
1284 3300025933 Ga0207706_10003940 Ga0207706_100039402 276
1285 3300025933 Ga0207706_10012729 Ga0207706_100127297 276
1286 3300025933 Ga0207706_10015530 Ga0207706_100155303 276
1287 3300025933 Ga0207706_10023922 Ga0207706_100239222 276
1288 3300025933 Ga0207706_10348212 Ga0207706_103482122 276
1289 3300025934 Ga0207686_10248801 Ga0207686_102488012 276
1290 3300025935 Ga0207709_10017667 Ga0207709_100176673 276
1291 3300025937 Ga0207669_10001146 Ga0207669_1000114610 276
1292 3300025937 Ga0207669_10004373 Ga0207669_100043734 276
1293 3300025937 Ga0207669_10082671 Ga0207669_100826712 276
1294 3300025938 Ga0207704_10095134 Ga0207704_100951342 276
1295 3300025940 Ga0207691_10009242 Ga0207691_100092425 276
1296 3300025940 Ga0207691_10013146 Ga0207691_100131466 276
1297 3300025940 Ga0207691_10046274 Ga0207691_100462742 276
1298 3300025940 Ga0207691_10061342 Ga0207691_100613423 276
1299 3300025940 Ga0207691_10068436 Ga0207691_100684361 276
1300 3300025940 Ga0207691_10076796 Ga0207691_100767964 276
1301 3300025940 Ga0207691_10163917 Ga0207691_101639172 276
1302 3300025941 Ga0207711_10018522 Ga0207711_100185224 276
1303 3300025941 Ga0207711_10021813 Ga0207711_100218135 276
1304 3300025941 Ga0207711_10147366 Ga0207711_101473662 276
1305 3300025942 Ga0207689_10095664 Ga0207689_100956643 276
1306 3300025944 Ga0207661_10006246 Ga0207661_100062463 276
1307 3300025944 Ga0207661_10208306 Ga0207661_102083062 276
1308 3300025945 Ga0207679_10001455 Ga0207679_100014554 276
1309 3300025945 Ga0207679_10196378 Ga0207679_101963782 276
1310 3300025949 Ga0207667_10000586 Ga0207667_100005867 276
1311 3300025949 Ga0207667_10002477 Ga0207667_1000247711 276
1312 3300025949 Ga0207667_10140224 Ga0207667_101402243 276
1313 3300025960 Ga0207651_10012586 Ga0207651_100125862 276
1314 3300025960 Ga0207651_10048916 Ga0207651_100489163 276
1315 3300025960 Ga0207651_10131387 Ga0207651_101313872 276
1316 3300025961 Ga0207712_10024343 Ga0207712_100243433 276
1317 3300025961 Ga0207712_10164512 Ga0207712_101645121 276
1318 3300025972 Ga0207668_10000559 Ga0207668_100005597 276
1319 3300025972 Ga0207668_10003063 Ga0207668_100030632 276
1320 3300025972 Ga0207668_10124432 Ga0207668_101244323 276
1321 3300025981 Ga0207640_10000253 Ga0207640_1000025318 276
1322 3300025981 Ga0207640_10010192 Ga0207640_100101923 276
1323 3300025981 Ga0207640_10017297 Ga0207640_100172972 276
1324 3300025986 Ga0207658_10000216 Ga0207658_1000021638 276
1325 3300025986 Ga0207658_10022705 Ga0207658_100227052 276
1326 3300025986 Ga0207658_10023093 Ga0207658_100230934 276
1327 3300025986 Ga0207658_10024781 Ga0207658_100247813 276
1328 3300025986 Ga0207658_10149044 Ga0207658_101490442 276
1329 3300026023 Ga0207677_10016517 Ga0207677_100165172 276
1330 3300026023 Ga0207677_10072946 Ga0207677_100729463 276
1331 3300026041 Ga0207639_10019480 Ga0207639_100194803 276
1332 3300026041 Ga0207639_10092771 Ga0207639_100927712 276
1333 3300026041 Ga0207639_10109625 Ga0207639_101096252 276
1334 3300026041 Ga0207639_10240277 Ga0207639_102402772 276
1335 3300026041 Ga0207639_10341486 Ga0207639_103414862 276
1336 3300026041 Ga0207639_10560781 Ga0207639_105607811 276
1337 3300026067 Ga0207678_10009002 Ga0207678_100090025 276
1338 3300026067 Ga0207678_10018567 Ga0207678_100185674 276
1339 3300026067 Ga0207678_10024573 Ga0207678_100245732 276
1340 3300026067 Ga0207678_10035965 Ga0207678_100359652 276
1341 3300026067 Ga0207678_10099945 Ga0207678_100999452 276
1342 3300026067 Ga0207678_10156896 Ga0207678_101568962 276
1343 3300026078 Ga0207702_10058050 Ga0207702_100580502 276
1344 3300026078 Ga0207702_10102102 Ga0207702_101021023 276
1345 3300026088 Ga0207641_10000659 Ga0207641_1000065937 276
1346 3300026088 Ga0207641_10042461 Ga0207641_100424613 276
1347 3300026089 Ga0207648_10004660 Ga0207648_100046602 276
1348 3300026089 Ga0207648_10013607 Ga0207648_100136076 276
1349 3300026089 Ga0207648_10019760 Ga0207648_100197605 276
1350 3300026089 Ga0207648_10550877 Ga0207648_105508771 276
1351 3300026095 Ga0207676_10001085 Ga0207676_1000108513 276
1352 3300026095 Ga0207676_10038135 Ga0207676_100381352 276
1353 3300026095 Ga0207676_10075761 Ga0207676_100757613 276
1354 3300026116 Ga0207674_10000347 Ga0207674_1000034713 276
1355 3300026116 Ga0207674_10015519 Ga0207674_100155195 276
1356 3300026116 Ga0207674_10016538 Ga0207674_100165385 276
1357 3300026116 Ga0207674_10194749 Ga0207674_101947492 276
1358 3300026121 Ga0207683_10003742 Ga0207683_100037426 276
1359 3300026121 Ga0207683_10004977 Ga0207683_100049773 276
1360 3300026121 Ga0207683_10009327 Ga0207683_100093274 276
1361 3300026121 Ga0207683_10087429 Ga0207683_100874293 276
1362 3300026121 Ga0207683_10106175 Ga0207683_101061752 276
1363 3300026121 Ga0207683_10406009 Ga0207683_104060092 276
1364 3300026142 Ga0207698_10012797 Ga0207698_100127976 276
1365 3300026142 Ga0207698_10040390 Ga0207698_100403903 276
1366 3300026142 Ga0207698_10047016 Ga0207698_100470162 276
1367 3300026142 Ga0207698_10086309 Ga0207698_100863092 276
1368 3300027462 Ga0210000_1015533 Ga0210000_10155332 276
1369 3300027876 Ga0209974_10001178 Ga0209974_100011782 276
1370 3300027876 Ga0209974_10014651 Ga0209974_100146513 276
1371 3300027876 Ga0209974_10067119 Ga0209974_100671192 276
1372 3300028379 Ga0268266_10003294 Ga0268266_100032943 276
1373 3300028379 Ga0268266_10004866 Ga0268266_100048665 276
1374 3300028379 Ga0268266_10014246 Ga0268266_100142465 276
1375 3300028379 Ga0268266_10034830 Ga0268266_100348302 276
1376 3300028379 Ga0268266_10090011 Ga0268266_100900112 276
1377 3300028380 Ga0268265_10040065 Ga0268265_100400652 276
1378 3300028380 Ga0268265_10048490 Ga0268265_100484902 276
1379 3300028381 Ga0268264_10015638 Ga0268264_100156386 276
1380 3300028381 Ga0268264_10360032 Ga0268264_103600322 276
1381 3300031548 Ga0307408_100047586 Ga0307408_1000475863 276
1382 3300031548 Ga0307408_100098350 Ga0307408_1000983502 276
1383 3300031548 Ga0307408_100254979 Ga0307408_1002549792 276
1384 3300031548 Ga0307408_100278304 Ga0307408_1002783042 276
1385 3300031548 Ga0307408_100326230 Ga0307408_1003262302 276
1386 3300031731 Ga0307405_10002851 Ga0307405_100028517 276
1387 3300031731 Ga0307405_10013091 Ga0307405_100130913 276
1388 3300031731 Ga0307405_10140658 Ga0307405_101406582 276
1389 3300031731 Ga0307405_10144681 Ga0307405_101446812 276
1390 3300031731 Ga0307405_10212469 Ga0307405_102124691 276
1391 3300031824 Ga0307413_10015649 Ga0307413_100156494 276
1392 3300031824 Ga0307413_10112114 Ga0307413_101121142 276
1393 3300031824 Ga0307413_10133124 Ga0307413_101331242 276
1394 3300031852 Ga0307410_10000804 Ga0307410_100008045 276
1395 3300031852 Ga0307410_10008085 Ga0307410_100080853 276
1396 3300031852 Ga0307410_10035061 Ga0307410_100350614 276
1397 3300031852 Ga0307410_10114749 Ga0307410_101147492 276
1398 3300031852 Ga0307410_10251925 Ga0307410_102519252 276
1399 3300031901 Ga0307406_10014377 Ga0307406_100143773 276
1400 3300031901 Ga0307406_10015068 Ga0307406_100150684 276
1401 3300031901 Ga0307406_10075409 Ga0307406_100754092 276
1402 3300031901 Ga0307406_10262522 Ga0307406_102625222 276
1403 3300031903 Ga0307407_10085186 Ga0307407_100851862 276
1404 3300031911 Ga0307412_10025472 Ga0307412_100254722 276
1405 3300031911 Ga0307412_10058014 Ga0307412_100580143 276
1406 3300031995 Ga0307409_100000935 Ga0307409_1000009355 276
1407 3300031995 Ga0307409_100016171 Ga0307409_1000161714 276
1408 3300031995 Ga0307409_100041395 Ga0307409_1000413952 276
1409 3300031995 Ga0307409_100044321 Ga0307409_1000443212 276
1410 3300031995 Ga0307409_100056449 Ga0307409_1000564492 276
1411 3300031995 Ga0307409_100120135 Ga0307409_1001201353 276
1412 3300031995 Ga0307409_100278546 Ga0307409_1002785462 276
1413 3300031995 Ga0307409_100306395 Ga0307409_1003063952 276
1414 3300032002 Ga0307416_100010035 Ga0307416_1000100354 276
1415 3300032002 Ga0307416_100014257 Ga0307416_1000142574 276
1416 3300032002 Ga0307416_100024296 Ga0307416_1000242962 276
1417 3300032002 Ga0307416_100057735 Ga0307416_1000577352 276
1418 3300032002 Ga0307416_100158528 Ga0307416_1001585282 276
1419 3300032004 Ga0307414_10003237 Ga0307414_100032374 276
1420 3300032004 Ga0307414_10037025 Ga0307414_100370253 276
1421 3300032004 Ga0307414_10048127 Ga0307414_100481272 276
1422 3300032004 Ga0307414_10121647 Ga0307414_101216472 276
1423 3300032004 Ga0307414_10445556 Ga0307414_104455562 276
1424 3300032005 Ga0307411_10001280 Ga0307411_100012806 276
1425 3300032005 Ga0307411_10002763 Ga0307411_100027635 276
1426 3300032005 Ga0307411_10130433 Ga0307411_101304332 276
1427 3300032005 Ga0307411_10137379 Ga0307411_101373792 276
1428 3300032005 Ga0307411_10185196 Ga0307411_101851962 276
1429 3300032005 Ga0307411_10229719 Ga0307411_102297192 276
1430 3300032126 Ga0307415_100006043 Ga0307415_1000060432 276
1431 3300032126 Ga0307415_100009323 Ga0307415_1000093232 276
1432 3300032126 Ga0307415_100012933 Ga0307415_1000129334 276
1433 3300032126 Ga0307415_100269365 Ga0307415_1002693652 276
1434 3300032126 Ga0307415_100532337 Ga0307415_1005323372 276
1435 3300033180 Ga0307510_10064550 Ga0307510_100645505 276
1436 3300035118 Ga0373954_0001895 Ga0373954_0001895_1053_1904 276
1437 3300035172 Ga0373955_0058383 Ga0373955_0058383_209_1060 276
1438 3300036401 Ga0373937_0043741 Ga0373937_0043741_83_934 276
1439 3300037312 Ga0395899_0000548 Ga0395899_0000548_20095_20946 276
1440 3300037312 Ga0395899_0059781 Ga0395899_0059781_1573_2424 276
1441 3300037312 Ga0395899_0142474 Ga0395899_0142474_761_1612 276
1442 3300037312 Ga0395899_0177806 Ga0395899_0177806_160_1011 276
1443 3300037418 Ga0395900_0000036 Ga0395900_0000036_117320_118171 276
1444 3300037418 Ga0395900_0007644 Ga0395900_0007644_4255_5106 276
1445 3300037418 Ga0395900_0012943 Ga0395900_0012943_3461_4312 276
1446 3300037418 Ga0395900_0028632 Ga0395900_0028632_3707_4558 276
1447 3300037418 Ga0395900_0043360 Ga0395900_0043360_1688_2548 276
1448 3300037418 Ga0395900_0066496 Ga0395900_0066496_140_991 276
1449 3300037418 Ga0395900_0096909 Ga0395900_0096909_1720_2571 276
1450 3300037418 Ga0395900_0114356 Ga0395900_0114356_1566_2417 276
1451 3300037418 Ga0395900_0135467 Ga0395900_0135467_425_1276 276
1452 3300037418 Ga0395900_0166320 Ga0395900_0166320_275_1126 276
1453 3300037418 Ga0395900_0236819 Ga0395900_0236819_679_1530 276
1454 3300037418 Ga0395900_0386958 Ga0395900_0386958_262_1122 276
1455 3300037466 Ga0395898_0006106 Ga0395898_0006106_7564_8415 276
1456 3300037466 Ga0395898_0019937 Ga0395898_0019937_5460_6311 276
1457 3300037466 Ga0395898_0022022 Ga0395898_0022022_4334_5194 276
1458 3300037466 Ga0395898_0104650 Ga0395898_0104650_243_1103 276
1459 3300037466 Ga0395898_0142056 Ga0395898_0142056_17_868 276
1460 3300037466 Ga0395898_0196155 Ga0395898_0196155_834_1685 276
1461 3300037466 Ga0395898_0342595 Ga0395898_0342595_120_971 276
1462 3300037471 Ga0395905_0001816 Ga0395905_0001816_6192_7043 276
1463 3300037471 Ga0395905_0012104 Ga0395905_0012104_6320_7180 276
1464 3300037471 Ga0395905_0026955 Ga0395905_0026955_154_1005 276
1465 3300037471 Ga0395905_0080218 Ga0395905_0080218_1868_2728 276
1466 3300037471 Ga0395905_0080253 Ga0395905_0080253_1423_2274 276
1467 3300037471 Ga0395905_0093682 Ga0395905_0093682_1285_2136 276
1468 3300037471 Ga0395905_0115057 Ga0395905_0115057_92_943 276
1469 3300037471 Ga0395905_0119587 Ga0395905_0119587_570_1418 276
1470 3300037471 Ga0395905_0215317 Ga0395905_0215317_877_1728 276
1471 3300037471 Ga0395905_0298390 Ga0395905_0298390_47_898 276
1472 3300037471 Ga0395905_0459131 Ga0395905_0459131_86_937 276
1473 3300037853 Ga0436364_1237071 Ga0436364_1237071_2749_3579 276
1474 3300038443 Ga0395901_0000036 Ga0395901_0000036_101727_102578 276
1475 3300038443 Ga0395901_0036123 Ga0395901_0036123_2686_3537 276
1476 3300038443 Ga0395901_0063461 Ga0395901_0063461_2505_3356 276
1477 3300038443 Ga0395901_0083670 Ga0395901_0083670_783_1643 276
1478 3300038443 Ga0395901_0086517 Ga0395901_0086517_1383_2234 276
1479 3300038443 Ga0395901_0090077 Ga0395901_0090077_495_1346 276
1480 3300038443 Ga0395901_0092515 Ga0395901_0092515_523_1374 276
1481 3300038443 Ga0395901_0262147 Ga0395901_0262147_39_890 276
1482 3300038443 Ga0395901_0434180 Ga0395901_0434180_430_1281 276
1483 3300042012 Ga0439455_0000196 Ga0439455_0000196_2076_2927 276
1484 3300042157 Ga0439458_0000061 Ga0439458_0000061_12665_13516 276
1485 3300042157 Ga0439458_0000947 Ga0439458_0000947_4567_5418 276
1486 3300044694 Ga0466963_0024045 Ga0466963_0024045_369_1220 276
1487 3300044694 Ga0466963_0069014 Ga0466963_0069014_305_1156 276
1488 3300044694 Ga0466963_0224623 Ga0466963_0224623_105_956 276
1489 3300044842 Ga0466957_0008931 Ga0466957_0008931_1546_2397 276
1490 3300044842 Ga0466957_0113535 Ga0466957_0113535_138_989 276
1491 3300045836 Ga0466958_0012655 Ga0466958_0012655_2610_3461 276
1492 3300045836 Ga0466958_0028163 Ga0466958_0028163_1067_1918 276
1493 3300045976 Ga0466967_0110620 Ga0466967_0110620_72_923 276
1494 3300046452 Ga0495617_026580 Ga0495617_026580_793_1626 276
1495 3300046453 Ga0495627_000550 Ga0495627_000550_2855_3685 276
1496 3300046460 Ga0495638_0000016 Ga0495638_0000016_386658_387491 276
1497 3300046471 Ga0495650_0000196 Ga0495650_0000196_114337_115167 276
1498 3300046471 Ga0495650_0000821 Ga0495650_0000821_28592_29422 276
1499 3300046492 Ga0495585_0001441 Ga0495585_0001441_17136_17984 276
1500 3300046506 Ga0495583_0000094 Ga0495583_0000094_142208_143041 276
1501 3300046507 Ga0495606_0007579 Ga0495606_0007579_4014_4856 276
1502 3300046512 Ga0495610_0001737 Ga0495610_0001737_11475_12305 276
1503 3300046515 Ga0495620_0038165 Ga0495620_0038165_99_929 276
1504 3300046518 Ga0495631_0006646 Ga0495631_0006646_2010_2858 276
1505 3300046519 Ga0495632_0001032 Ga0495632_0001032_4324_5154 276
1506 3300046519 Ga0495632_0001802 Ga0495632_0001802_6197_7030 276
1507 3300046522 Ga0495643_0067013 Ga0495643_0067013_124_972 276
1508 3300046522 Ga0495643_0100028 Ga0495643_0100028_350_1201 276
1509 3300046524 Ga0495648_0000013 Ga0495648_0000013_9015_9848 276
1510 3300046524 Ga0495648_0010827 Ga0495648_0010827_475_1314 276
1511 3300046525 Ga0495663_0030169 Ga0495663_0030169_16_867 276
1512 3300046528 Ga0495642_0134684 Ga0495642_0134684_91_942 276
1513 3300046538 Ga0495609_0038550 Ga0495609_0038550_1026_1874 276
1514 3300046542 Ga0495597_0002693 Ga0495597_0002693_9137_9994 276
1515 3300046558 Ga0495633_0001018 Ga0495633_0001018_5692_6540 276
1516 3300046558 Ga0495633_0016571 Ga0495633_0016571_613_1446 276
1517 3300046558 Ga0495633_0051395 Ga0495633_0051395_1035_1886 276
1518 3300046558 Ga0495633_0132292 Ga0495633_0132292_142_972 276
1519 3300046648 Ga0495611_0007031 Ga0495611_0007031_1863_2711 276
1520 3300046648 Ga0495611_0072237 Ga0495611_0072237_329_1159 276
1521 3300046660 Ga0495625_0044221 Ga0495625_0044221_2180_3028 276
1522 3300046665 Ga0495661_0043813 Ga0495661_0043813_1256_2113 276
1523 3300046684 Ga0495669_0025841 Ga0495669_0025841_38_898 276
1524 3300046684 Ga0495669_0094516 Ga0495669_0094516_248_1099 276
1525 3300046691 Ga0495670_0004571 Ga0495670_0004571_1981_2838 276
1526 3300046691 Ga0495670_0013608 Ga0495670_0013608_2988_3836 276
1527 3300046692 Ga0495671_0000018 Ga0495671_0000018_10505_11338 276
1528 3300046692 Ga0495671_0081568 Ga0495671_0081568_475_1332 276
1529 3300047443 Ga0495687_000080 Ga0495687_000080_107929_108777 276
1530 3300047469 Ga0495673_0000029 Ga0495673_0000029_374785_375618 276
1531 3300047470 Ga0495681_0001176 Ga0495681_0001176_10660_11490 276
1532 3300047470 Ga0495681_0120035 Ga0495681_0120035_219_1067 276
1533 3300047472 Ga0495686_0000072 Ga0495686_0000072_113245_114090 276
1534 3300047472 Ga0495686_0000141 Ga0495686_0000141_71450_72280 276
1535 3300047472 Ga0495686_0004823 Ga0495686_0004823_2002_2847 276
1536 3300047472 Ga0495686_0012248 Ga0495686_0012248_4539_5387 276
1537 3300047472 Ga0495686_0058475 Ga0495686_0058475_300_1148 276
1538 3300048088 Ga0495602_0044367 Ga0495602_0044367_321_1172 276
1539 3300048903 Ga0496100_0019568 Ga0496100_0019568_153_1004 276
1540 3300048904 Ga0496101_0005744 Ga0496101_0005744_5861_6712 276
1541 3300048905 Ga0496102_0000034 Ga0496102_0000034_10801_11652 276
1542 3300048905 Ga0496102_0000698 Ga0496102_0000698_1784_2614 276
1543 3300048906 Ga0496103_0000026 Ga0496103_0000026_10801_11652 276
1544 3300048906 Ga0496103_0000258 Ga0496103_0000258_19316_20146 276
1545 3300048907 Ga0496104_0296633 Ga0496104_0296633_126_977 276
1546 3300048908 Ga0496105_0000184 Ga0496105_0000184_28840_29670 276
1547 3300048908 Ga0496105_0093508 Ga0496105_0093508_68_919 276
1548 3300048909 Ga0496106_0069404 Ga0496106_0069404_1386_2342 276
1549 3300048910 Ga0496107_0141354 Ga0496107_0141354_298_1128 276
1550 3300048910 Ga0496107_0234871 Ga0496107_0234871_344_1195 276
1551 3300048910 Ga0496107_0300649 Ga0496107_0300649_83_934 276
1552 3300048911 Ga0496108_0003813 Ga0496108_0003813_4555_5406 276
1553 3300048911 Ga0496108_0528832 Ga0496108_0528832_158_1009 276
1554 3300048912 Ga0496109_0305964 Ga0496109_0305964_453_1304 276
1555 3300048912 Ga0496109_0400326 Ga0496109_0400326_364_1215 276
1556 3300048912 Ga0496109_0738474 Ga0496109_0738474_40_891 276
1557 3300048913 Ga0496110_0008175 Ga0496110_0008175_2277_3128 276
1558 3300048914 Ga0496111_0046627 Ga0496111_0046627_386_1237 276
1559 3300048914 Ga0496111_0375666 Ga0496111_0375666_91_948 276
1560 3300048915 Ga0496112_0007215 Ga0496112_0007215_4131_4982 276
1561 3300048915 Ga0496112_0055396 Ga0496112_0055396_354_1205 276
1562 3300048915 Ga0496112_0058491 Ga0496112_0058491_719_1570 276
1563 3300048916 Ga0496113_0000637 Ga0496113_0000637_1259_2089 276
1564 3300048916 Ga0496113_0017624 Ga0496113_0017624_1040_1891 276
1565 3300048917 Ga0496114_0000019 Ga0496114_0000019_197487_198338 276
1566 3300048917 Ga0496114_0028693 Ga0496114_0028693_2168_3019 276
1567 3300048917 Ga0496114_0108801 Ga0496114_0108801_1465_2316 276
1568 3300048918 Ga0496115_0010292 Ga0496115_0010292_1924_2775 276
1569 3300048919 Ga0496116_0001510 Ga0496116_0001510_16106_16957 276
1570 3300048920 Ga0496117_0000072 Ga0496117_0000072_35341_36192 276
1571 3300048920 Ga0496117_0010819 Ga0496117_0010819_3673_4503 276
1572 3300048920 Ga0496117_0066547 Ga0496117_0066547_1305_2150 276
1573 3300048921 Ga0496118_0000030 Ga0496118_0000030_202175_203026 276
1574 3300048921 Ga0496118_0041482 Ga0496118_0041482_2272_3117 276
1575 3300048922 Ga0496119_0001028 Ga0496119_0001028_6081_6911 276
1576 3300048922 Ga0496119_0009603 Ga0496119_0009603_1602_2453 276
1577 3300048922 Ga0496119_0055536 Ga0496119_0055536_577_1407 276
1578 3300048923 Ga0496120_0000961 Ga0496120_0000961_14204_15034 276
1579 3300048923 Ga0496120_0054074 Ga0496120_0054074_1067_1897 276
1580 3300048924 Ga0496121_0003242 Ga0496121_0003242_21779_22609 276
1581 3300048925 Ga0496122_0003011 Ga0496122_0003011_4682_5512 276
1582 3300048926 Ga0496123_0002688 Ga0496123_0002688_13353_14183 276
1583 3300048927 Ga0496124_0000061 Ga0496124_0000061_202175_203026 276
1584 3300048927 Ga0496124_0010844 Ga0496124_0010844_4785_5615 276
1585 3300048927 Ga0496124_0315152 Ga0496124_0315152_159_995 276
1586 3300048928 Ga0496125_0005137 Ga0496125_0005137_13353_14183 276
1587 3300048929 Ga0496126_0000158 Ga0496126_0000158_45401_46231 276
1588 3300049460 Ga0495682_0004987 Ga0495682_0004987_330_1187 276
1589 3300049521 Ga0501298_006085 Ga0501298_006085_258_1109 276
1590 3300049583 Ga0501067_0017237 Ga0501067_0017237_2471_3322 276
1591 3300049590 Ga0501074_0067764 Ga0501074_0067764_1688_2539 276
1592 3300049742 Ga0501080_0044205 Ga0501080_0044205_2160_3011 276
1593 3300049777 Ga0501281_00216 Ga0501281_00216_4346_5176 276
1594 3300049823 Ga0501044_0003972 Ga0501044_0003972_6774_7604 276
1595 3300053087 Ga0500643_000659 Ga0500643_000659_14702_15547 276
1596 3300053088 Ga0500644_0151755 Ga0500644_0151755_53_886 276
1597 3300053093 Ga0500651_0001733 Ga0500651_0001733_1152_2009 276
1598 3300053096 Ga0500641_0016532 Ga0500641_0016532_173_1030 276
1599 3300053103 Ga0500555_000043 Ga0500555_000043_8082_8939 276
1600 3300053125 Ga0500618_002482 Ga0500618_002482_4361_5212 276
1601 3300053130 Ga0500642_0005307 Ga0500642_0005307_2580_3437 276
1602 3300053133 Ga0500655_000135 Ga0500655_000135_14876_15742 276
1603 3300053148 Ga0500590_002410 Ga0500590_002410_1332_2213 276
1604 3300053156 Ga0500622_0002578 Ga0500622_0002578_7359_8216 276
1605 3300053724 Ga0500570_000103 Ga0500570_000103_14055_14915 276
1606 3300053735 Ga0500596_006187 Ga0500596_006187_1184_2014 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

36

310

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tml-assembly2.cif.gz_A crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia 0.9845 3 276
3tml-assembly1.cif.gz_B crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia cenocepacia 0.9842 3 276
6mdy-assembly1.cif.gz_A crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9812 1 275
6mdy-assembly1.cif.gz_C crystal structure of a 2-dehydro-3-deoxyphosphooctonate aldolase from legionella pneumophila philadelphia 1 0.9799 1 275
2nxi-assembly1.cif.gz_B structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase. 0.9781 14 275
ID Description Score Start End Superfamily
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9768 12 275 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9573 3 276 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9548 12 275 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9465 1 276 3.20.20.70
3t4cC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9148 1 276 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2T5FVG6-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.999 1 276 GO:0005737
GO:0008676
GO:0019294
AF-A3WGF4-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9986 1 275 GO:0005737
GO:0008676
GO:0019294
AF-A0A157Z4M8-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9968 1 276 GO:0005737
GO:0008676
GO:0019294
AF-A0A372ENU5-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9963 1 274 GO:0005737
GO:0008676
GO:0019294
AF-A0A7G8VDK4-F1-model_v4 2-dehydro-3-deoxyphosphooctonate aldolase (EC 2.5.1.55) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthase) (KDO-8-phosphate synthase) (KDO 8-P synthase) (KDOPS) (Phospho-2-dehydro-3-deoxyoctonate aldolase) 0.9962 1 276 GO:0005737
GO:0008676
GO:0019294

Feature Viewer

pLDDT pTM Quality
94.56 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map