F494903

General Info

Members Datasets Scaffolds Average Seq Length
1583 538 1570 88

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101391739|Ga0070665_1013917392
Length 97
Sequence MIRPVLTEVGIFLIPFVAYALFLVATRSGVFAQSSWPAHLVAKLVFGSLLLVVVSFMLLAHYSGAPPDSTYVPAHIENGKFVPGAEISKPAKSGAGK

Samples

Sample ID Description Type Environment
1 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
4 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
5 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
6 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
7 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
8 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
9 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
10 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
138 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
139 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
140 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
141 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
236 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
240 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
245 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
246 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
247 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
248 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
263 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
264 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
269 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
270 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
271 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
275 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
276 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
278 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
284 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
297 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
298 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
299 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
300 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
303 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
304 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
305 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
306 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
307 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
308 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
309 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
310 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
311 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
312 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
313 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
319 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
338 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
345 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
346 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
347 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
348 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
349 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
350 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
351 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
352 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
362 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
367 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
368 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
369 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
373 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
374 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
375 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
376 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
377 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
388 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
389 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
392 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
393 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
399 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
429 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
450 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
451 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
452 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
482 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
483 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
484 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
485 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
486 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
487 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
488 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
489 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
490 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
491 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
492 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
493 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
494 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
495 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
496 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
497 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
498 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
499 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
500 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
501 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
502 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
503 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
504 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
505 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
506 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
507 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
508 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
509 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
510 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
511 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
512 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
513 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
514 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
515 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
516 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
517 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
518 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
521 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
522 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
523 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
524 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
525 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
526 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
527 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
528 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
529 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
530 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
531 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
536 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
537 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
538 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0.32
Rhizoplane 6.7
Rhizosphere 75.93
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10205595 3300001990 Bacteria 581
2 JGI24745J21846_1027480 3300002073 Bacteria 681
3 JGI25406J46586_10107804 3300003203 Bacteria 826
4 JGI25153J46596_10003847 3300003215 Bacteria 8260
5 JGI25153J46596_10068119 3300003215 Bacteria 934
6 JGI25404J52841_10018446 3300003659 Bacteria 1512
7 JGI25404J52841_10030139 3300003659 Bacteria 1163
8 JGI25404J52841_10039869 3300003659 Bacteria 994
9 JGI25404J52841_10068574 3300003659 Bacteria 742
10 JGI25404J52841_10125444 3300003659 Bacteria 542
11 JGI25405J52794_10072855 3300003911 Bacteria 751
12 Ga0065704_10605390 3300005289 Bacteria 605
13 Ga0065707_10447293 3300005295 Bacteria 804
14 Ga0070658_10261559 3300005327 Bacteria 1470
15 Ga0070658_11277660 3300005327 Bacteria 638
16 Ga0070676_10148408 3300005328 Bacteria 1499
17 Ga0070683_100053571 3300005329 Bacteria 3738
18 Ga0070683_100266643 3300005329 Bacteria 1629
19 Ga0070683_102335598 3300005329 Bacteria 513
20 Ga0070690_100311964 3300005330 Bacteria 1131
21 Ga0070690_100938820 3300005330 Bacteria 678
22 Ga0070690_100950632 3300005330 Bacteria 675
23 Ga0070670_100350636 3300005331 Bacteria 1297
24 Ga0070670_100495527 3300005331 Bacteria 1086
25 Ga0070670_101188000 3300005331 Bacteria 697
26 Ga0070670_101586518 3300005331 Bacteria 602
27 Ga0068869_100019814 3300005334 Bacteria 4605
28 Ga0068869_100019846 3300005334 Bacteria 4601
29 Ga0068869_100127193 3300005334 Bacteria 1955
30 Ga0068869_100883413 3300005334 Bacteria 773
31 Ga0070666_10262098 3300005335 Bacteria 1226
32 Ga0070666_11262394 3300005335 Bacteria 551
33 Ga0070680_100028269 3300005336 Bacteria 4496
34 Ga0070680_101310583 3300005336 Bacteria 627
35 Ga0070682_100133669 3300005337 Bacteria 1682
36 Ga0070682_100600642 3300005337 Bacteria 869
37 Ga0070682_100658425 3300005337 Bacteria 835
38 Ga0070682_100814938 3300005337 Bacteria 760
39 Ga0070682_101224187 3300005337 Bacteria 635
40 Ga0068868_100136290 3300005338 Bacteria 2012
41 Ga0068868_100185125 3300005338 Bacteria 1730
42 Ga0068868_100213239 3300005338 Bacteria 1614
43 Ga0068868_100444549 3300005338 Bacteria 1126
44 Ga0068868_101578539 3300005338 Bacteria 616
45 Ga0068868_101792061 3300005338 Bacteria 580
46 Ga0070660_100020056 3300005339 Bacteria 4907
47 Ga0070660_100235393 3300005339 Bacteria 1491
48 Ga0070660_100341725 3300005339 Bacteria 1232
49 Ga0070660_100882055 3300005339 Bacteria 754
50 Ga0070660_101881055 3300005339 Bacteria 510
51 Ga0070689_100405166 3300005340 Bacteria 1154
52 Ga0070689_100984317 3300005340 Bacteria 749
53 Ga0070687_100469753 3300005343 Bacteria 841
54 Ga0070661_100036019 3300005344 Bacteria 3597
55 Ga0070661_100047483 3300005344 Bacteria 3142
56 Ga0070661_100163527 3300005344 Bacteria 1686
57 Ga0070661_101251471 3300005344 Bacteria 622
58 Ga0070692_10210110 3300005345 Bacteria 1145
59 Ga0070692_10240069 3300005345 Bacteria 1080
60 Ga0070692_10347373 3300005345 Bacteria 921
61 Ga0070668_100043454 3300005347 Bacteria 3446
62 Ga0070668_100103253 3300005347 Bacteria 2261
63 Ga0070668_100315141 3300005347 Bacteria 1315
64 Ga0070668_100962763 3300005347 Bacteria 765
65 Ga0070668_101278275 3300005347 Bacteria 666
66 Ga0070668_101663508 3300005347 Bacteria 586
67 Ga0070668_101857124 3300005347 Bacteria 554
68 Ga0070668_101976846 3300005347 Bacteria 537
69 Ga0070669_100190223 3300005353 Bacteria 1610
70 Ga0070669_100212280 3300005353 Bacteria 1527
71 Ga0070669_100839004 3300005353 Bacteria 782
72 Ga0070675_100269912 3300005354 Bacteria 1493
73 Ga0070675_100494463 3300005354 Bacteria 1102
74 Ga0070675_101253201 3300005354 Bacteria 683
75 Ga0070675_102188006 3300005354 Bacteria 509
76 Ga0070671_100073612 3300005355 Bacteria 2853
77 Ga0070671_100114304 3300005355 Bacteria 2269
78 Ga0070671_100239137 3300005355 Bacteria 1541
79 Ga0070671_100677317 3300005355 Bacteria 894
80 Ga0070671_101637850 3300005355 Bacteria 571
81 Ga0070674_100132453 3300005356 Bacteria 1860
82 Ga0070674_100216183 3300005356 Bacteria 1489
83 Ga0070674_100780267 3300005356 Bacteria 824
84 Ga0070674_101429133 3300005356 Bacteria 620
85 Ga0070674_101756639 3300005356 Bacteria 562
86 Ga0070674_102183475 3300005356 Bacteria 505
87 Ga0070673_100624088 3300005364 Bacteria 985
88 Ga0070673_100716569 3300005364 Bacteria 920
89 Ga0070673_101899444 3300005364 Bacteria 565
90 Ga0070688_100131032 3300005365 Bacteria 1692
91 Ga0070688_100307998 3300005365 Bacteria 1147
92 Ga0070688_100715514 3300005365 Bacteria 777
93 Ga0070688_100796424 3300005365 Bacteria 739
94 Ga0070659_100059727 3300005366 Bacteria 3010
95 Ga0070659_100061696 3300005366 Bacteria 2963
96 Ga0070659_100066163 3300005366 Bacteria 2863
97 Ga0070659_101210558 3300005366 Bacteria 668
98 Ga0070659_101469764 3300005366 Bacteria 607
99 Ga0070659_101851122 3300005366 Bacteria 541
100 Ga0070667_100170258 3300005367 Bacteria 1922
101 Ga0070667_100488615 3300005367 Bacteria 1128
102 Ga0070667_101018872 3300005367 Bacteria 773
103 Ga0070667_102300539 3300005367 Bacteria 508
104 Ga0070709_10000738 3300005434 Bacteria 18492
105 Ga0070709_10069632 3300005434 Bacteria 2266
106 Ga0070709_11390431 3300005434 Bacteria 568
107 Ga0070714_100004168 3300005435 Bacteria 10874
108 Ga0070714_100148142 3300005435 Bacteria 2113
109 Ga0070714_100623515 3300005435 Bacteria 1037
110 Ga0070714_100746811 3300005435 Bacteria 946
111 Ga0070713_100099673 3300005436 Bacteria 2514
112 Ga0070710_10000243 3300005437 Bacteria 25537
113 Ga0070710_10025706 3300005437 Bacteria 3121
114 Ga0070710_10367761 3300005437 Bacteria 956
115 Ga0070701_10166754 3300005438 Bacteria 1280
116 Ga0070701_10397247 3300005438 Bacteria 873
117 Ga0070711_100004522 3300005439 Bacteria 8223
118 Ga0070711_100025421 3300005439 Bacteria 3874
119 Ga0070711_100203421 3300005439 Bacteria 1529
120 Ga0070711_100220188 3300005439 Bacteria 1475
121 Ga0070711_101259798 3300005439 Bacteria 641
122 Ga0070705_101370232 3300005440 Bacteria 588
123 Ga0070700_100226646 3300005441 Bacteria 1327
124 Ga0070700_100961538 3300005441 Bacteria 699
125 Ga0070700_100983145 3300005441 Bacteria 692
126 Ga0070694_100709075 3300005444 Bacteria 819
127 Ga0070708_100198307 3300005445 Bacteria 1878
128 Ga0070708_101471534 3300005445 Bacteria 635
129 Ga0070708_102005890 3300005445 Bacteria 536
130 Ga0070663_100012871 3300005455 Bacteria 5311
131 Ga0070663_100029413 3300005455 Bacteria 3754
132 Ga0070663_100170347 3300005455 Bacteria 1683
133 Ga0070663_100256472 3300005455 Bacteria 1386
134 Ga0070663_100395590 3300005455 Bacteria 1128
135 Ga0070663_100789495 3300005455 Bacteria 813
136 Ga0070663_101900812 3300005455 Bacteria 535
137 Ga0070663_101996951 3300005455 Bacteria 522
138 Ga0070678_100072887 3300005456 Bacteria 2576
139 Ga0070678_100093939 3300005456 Bacteria 2307
140 Ga0070678_100154468 3300005456 Bacteria 1852
141 Ga0070678_100216802 3300005456 Bacteria 1589
142 Ga0070678_100871068 3300005456 Bacteria 822
143 Ga0070678_100905598 3300005456 Bacteria 806
144 Ga0070678_101206927 3300005456 Bacteria 701
145 Ga0070662_100110263 3300005457 Bacteria 2095
146 Ga0070662_100112882 3300005457 Bacteria 2073
147 Ga0070662_100609893 3300005457 Bacteria 918
148 Ga0070681_10010419 3300005458 Bacteria 9183
149 Ga0070681_10083698 3300005458 Bacteria 3143
150 Ga0070681_10108404 3300005458 Bacteria 2717
151 Ga0070681_10320559 3300005458 Bacteria 1459
152 Ga0068867_100071550 3300005459 Bacteria 2594
153 Ga0068867_101612941 3300005459 Bacteria 607
154 Ga0070685_10293827 3300005466 Bacteria 1093
155 Ga0070685_10381161 3300005466 Bacteria 972
156 Ga0070706_100172423 3300005467 Bacteria 2020
157 Ga0070706_100559225 3300005467 Bacteria 1064
158 Ga0070707_100150437 3300005468 Bacteria 2266
159 Ga0070698_100104049 3300005471 Bacteria 2809
160 Ga0070698_102133458 3300005471 Bacteria 514
161 Ga0070699_100449354 3300005518 Bacteria 1168
162 Ga0070699_100450502 3300005518 Bacteria 1167
163 Ga0070699_102015429 3300005518 Bacteria 528
164 Ga0070699_102172961 3300005518 Bacteria 506
165 Ga0070679_100085416 3300005530 Bacteria 3143
166 Ga0070679_100232113 3300005530 Bacteria 1804
167 Ga0070679_101691117 3300005530 Bacteria 581
168 Ga0070684_100201779 3300005535 Bacteria 1811
169 Ga0070684_101281093 3300005535 Bacteria 690
170 Ga0070684_101343586 3300005535 Bacteria 673
171 Ga0070697_100602487 3300005536 Bacteria 966
172 Ga0070697_101776763 3300005536 Bacteria 552
173 Ga0068853_100015280 3300005539 Bacteria 6309
174 Ga0068853_100033910 3300005539 Bacteria 4331
175 Ga0068853_100084137 3300005539 Bacteria 2787
176 Ga0068853_100210141 3300005539 Bacteria 1773
177 Ga0068853_100324077 3300005539 Bacteria 1429
178 Ga0070672_100498210 3300005543 Bacteria 1053
179 Ga0070672_100518968 3300005543 Bacteria 1032
180 Ga0070672_100578663 3300005543 Bacteria 977
181 Ga0070672_101233308 3300005543 Bacteria 667
182 Ga0070686_100405751 3300005544 Bacteria 1038
183 Ga0070696_100078710 3300005546 Bacteria 2331
184 Ga0070696_101281348 3300005546 Bacteria 621
185 Ga0070696_101630965 3300005546 Bacteria 555
186 Ga0070693_100271740 3300005547 Bacteria 1132
187 Ga0070693_100499388 3300005547 Bacteria 863
188 Ga0070693_100603747 3300005547 Bacteria 792
189 Ga0070693_101100475 3300005547 Bacteria 606
190 Ga0070665_100068671 3300005548 Bacteria 3553
191 Ga0070665_100081195 3300005548 Bacteria 3248
192 Ga0070665_100207013 3300005548 Bacteria 1962
193 Ga0070665_100318838 3300005548 Bacteria 1558
194 Ga0070665_100340521 3300005548 Bacteria 1504
195 Ga0070665_100342582 3300005548 Bacteria 1500
196 Ga0070665_100402619 3300005548 Bacteria 1377
197 Ga0070665_100724452 3300005548 Bacteria 1008
198 Ga0070665_101391739 3300005548 Bacteria 711
199 Ga0070665_101678039 3300005548 Bacteria 643
200 Ga0070704_100846643 3300005549 Bacteria 820
201 Ga0070704_101610763 3300005549 Bacteria 599
202 Ga0070704_101900796 3300005549 Bacteria 552
203 Ga0068855_100068067 3300005563 Bacteria 4146
204 Ga0068855_100110876 3300005563 Bacteria 3149
205 Ga0068855_100128605 3300005563 Bacteria 2894
206 Ga0068855_100454697 3300005563 Bacteria 1397
207 Ga0068855_100944459 3300005563 Bacteria 909
208 Ga0068855_101465407 3300005563 Bacteria 702
209 Ga0070664_100624139 3300005564 Bacteria 1001
210 Ga0070664_100749075 3300005564 Bacteria 912
211 Ga0070664_100912345 3300005564 Bacteria 824
212 Ga0070664_101199725 3300005564 Bacteria 716
213 Ga0070664_101227131 3300005564 Bacteria 708
214 Ga0070664_101477980 3300005564 Bacteria 643
215 Ga0070664_102180974 3300005564 Bacteria 526
216 Ga0068857_100016254 3300005577 Bacteria 6519
217 Ga0068857_100694510 3300005577 Bacteria 966
218 Ga0068857_101188405 3300005577 Bacteria 738
219 Ga0068857_102143772 3300005577 Bacteria 549
220 Ga0068854_100498051 3300005578 Bacteria 1025
221 Ga0068854_100653925 3300005578 Bacteria 903
222 Ga0068854_101037497 3300005578 Bacteria 728
223 Ga0068854_101090900 3300005578 Bacteria 711
224 Ga0068856_100514495 3300005614 Bacteria 1218
225 Ga0068856_100858959 3300005614 Bacteria 927
226 Ga0068856_100953412 3300005614 Bacteria 877
227 Ga0068856_102125986 3300005614 Bacteria 571
228 Ga0070702_100044253 3300005615 Bacteria 2512
229 Ga0070702_100195472 3300005615 Bacteria 1335
230 Ga0070702_100239175 3300005615 Bacteria 1224
231 Ga0070702_100934605 3300005615 Bacteria 682
232 Ga0068852_100146364 3300005616 Bacteria 2192
233 Ga0068852_100427805 3300005616 Bacteria 1307
234 Ga0068852_100826010 3300005616 Bacteria 942
235 Ga0068852_100877349 3300005616 Bacteria 914
236 Ga0068852_101238290 3300005616 Bacteria 767
237 Ga0068859_100037821 3300005617 Bacteria 4843
238 Ga0068859_100291131 3300005617 Bacteria 1726
239 Ga0068859_100300173 3300005617 Bacteria 1699
240 Ga0068859_100345487 3300005617 Bacteria 1582
241 Ga0068859_101171374 3300005617 Bacteria 846
242 Ga0068864_100011654 3300005618 Bacteria 7260
243 Ga0068864_100662703 3300005618 Bacteria 1017
244 Ga0068864_100819503 3300005618 Bacteria 916
245 Ga0068864_101171001 3300005618 Bacteria 767
246 Ga0068866_10355946 3300005718 Bacteria 932
247 Ga0068866_10427502 3300005718 Bacteria 861
248 Ga0068866_11230630 3300005718 Bacteria 542
249 Ga0068861_100195174 3300005719 Bacteria 1695
250 Ga0068861_100484933 3300005719 Bacteria 1114
251 Ga0068861_101402383 3300005719 Bacteria 682
252 Ga0068861_101812227 3300005719 Bacteria 605
253 Ga0068861_102026209 3300005719 Bacteria 574
254 Ga0068861_102585442 3300005719 Bacteria 511
255 Ga0068851_10127945 3300005834 Bacteria 1371
256 Ga0068851_10169554 3300005834 Bacteria 1204
257 Ga0068851_10791023 3300005834 Bacteria 589
258 Ga0068851_10888245 3300005834 Bacteria 558
259 Ga0068870_10037013 3300005840 Bacteria 2513
260 Ga0068870_10147230 3300005840 Bacteria 1384
261 Ga0068870_10797623 3300005840 Bacteria 660
262 Ga0068863_100150913 3300005841 Bacteria 2223
263 Ga0068863_102074763 3300005841 Bacteria 579
264 Ga0068863_102326398 3300005841 Bacteria 546
265 Ga0068858_100030745 3300005842 Bacteria 4987
266 Ga0068858_100097777 3300005842 Bacteria 2736
267 Ga0068858_100141992 3300005842 Bacteria 2254
268 Ga0068858_100889016 3300005842 Bacteria 871
269 Ga0068858_100978978 3300005842 Bacteria 828
270 Ga0068858_101075076 3300005842 Bacteria 789
271 Ga0068858_102341447 3300005842 Bacteria 528
272 Ga0068860_100230767 3300005843 Bacteria 1799
273 Ga0068860_100357918 3300005843 Bacteria 1437
274 Ga0068860_100422628 3300005843 Bacteria 1321
275 Ga0068860_101871924 3300005843 Bacteria 622
276 Ga0068862_100159674 3300005844 Bacteria 2011
277 Ga0068862_100269906 3300005844 Bacteria 1555
278 Ga0068862_100489604 3300005844 Bacteria 1165
279 Ga0068862_100651731 3300005844 Bacteria 1016
280 Ga0068862_100974172 3300005844 Bacteria 837
281 Ga0068862_101404197 3300005844 Bacteria 701
282 Ga0068862_102736071 3300005844 Bacteria 505
283 Ga0081455_10001871 3300005937 Bacteria 25308
284 Ga0081455_10018136 3300005937 Bacteria 6718
285 Ga0081455_10042954 3300005937 Bacteria 3960
286 Ga0081455_10957411 3300005937 Bacteria 531
287 Ga0081540_1002386 3300005983 Bacteria 15324
288 Ga0081540_1003527 3300005983 Bacteria 12331
289 Ga0081540_1005126 3300005983 Bacteria 9820
290 Ga0081540_1005516 3300005983 Bacteria 9433
291 Ga0081540_1007198 3300005983 Bacteria 7982
292 Ga0081540_1017121 3300005983 Bacteria 4500
293 Ga0081540_1068601 3300005983 Bacteria 1651
294 Ga0081540_1199299 3300005983 Bacteria 730
295 Ga0081540_1202220 3300005983 Bacteria 721
296 Ga0081540_1259790 3300005983 Bacteria 604
297 Ga0081539_10000306 3300005985 Bacteria 110402
298 Ga0081539_10001290 3300005985 Bacteria 44006
299 Ga0081539_10031544 3300005985 Bacteria 3264
300 Ga0081539_10088992 3300005985 Bacteria 1600
301 Ga0070717_10037532 3300006028 Bacteria 3934
302 Ga0075365_10032740 3300006038 Bacteria 3345
303 Ga0075365_10062453 3300006038 Bacteria 2491
304 Ga0075365_10113318 3300006038 Bacteria 1865
305 Ga0075365_10124785 3300006038 Bacteria 1778
306 Ga0075365_10173159 3300006038 Bacteria 1507
307 Ga0075365_10185873 3300006038 Bacteria 1453
308 Ga0075365_10217679 3300006038 Bacteria 1339
309 Ga0075365_10765891 3300006038 Bacteria 681
310 Ga0075368_10067956 3300006042 Bacteria 1436
311 Ga0075368_10080689 3300006042 Bacteria 1323
312 Ga0075368_10161543 3300006042 Bacteria 939
313 Ga0075368_10260974 3300006042 Bacteria 742
314 Ga0075368_10432982 3300006042 Bacteria 581
315 Ga0075363_100011319 3300006048 Bacteria 4268
316 Ga0075363_100052752 3300006048 Bacteria 2171
317 Ga0075363_100218221 3300006048 Bacteria 1092
318 Ga0075363_100487984 3300006048 Bacteria 730
319 Ga0075363_100554789 3300006048 Bacteria 686
320 Ga0075364_10056473 3300006051 Bacteria 2570
321 Ga0075364_10068512 3300006051 Bacteria 2334
322 Ga0075364_10206033 3300006051 Bacteria 1333
323 Ga0075364_10211166 3300006051 Bacteria 1316
324 Ga0075364_10257404 3300006051 Bacteria 1186
325 Ga0075364_10351702 3300006051 Bacteria 1004
326 Ga0075364_10412319 3300006051 Bacteria 922
327 Ga0075364_10758941 3300006051 Bacteria 662
328 Ga0075364_10835643 3300006051 Bacteria 627
329 Ga0075364_11103701 3300006051 Bacteria 538
330 Ga0070715_10022420 3300006163 Bacteria 2463
331 Ga0070716_100272303 3300006173 Bacteria 1164
332 Ga0070716_100292218 3300006173 Bacteria 1130
333 Ga0070716_100366549 3300006173 Bacteria 1025
334 Ga0070716_100394165 3300006173 Bacteria 994
335 Ga0070716_100965457 3300006173 Bacteria 672
336 Ga0070712_100017200 3300006175 Bacteria 4678
337 Ga0070712_100073656 3300006175 Bacteria 2450
338 Ga0075362_10036145 3300006177 Bacteria 2159
339 Ga0075362_10065886 3300006177 Bacteria 1645
340 Ga0075362_10377479 3300006177 Bacteria 713
341 Ga0075362_10446003 3300006177 Bacteria 657
342 Ga0075362_10621444 3300006177 Bacteria 559
343 Ga0075362_10702335 3300006177 Bacteria 528
344 Ga0075367_10032570 3300006178 Bacteria 3000
345 Ga0075367_10090655 3300006178 Bacteria 1859
346 Ga0075367_10172523 3300006178 Bacteria 1347
347 Ga0075367_10229550 3300006178 Bacteria 1162
348 Ga0075367_10687863 3300006178 Bacteria 650
349 Ga0075367_10724306 3300006178 Bacteria 633
350 Ga0075367_10893074 3300006178 Bacteria 567
351 Ga0075369_10015118 3300006186 Bacteria 3093
352 Ga0075369_10052823 3300006186 Bacteria 1762
353 Ga0075369_10333072 3300006186 Bacteria 711
354 Ga0075369_10475748 3300006186 Bacteria 593
355 Ga0075369_10529317 3300006186 Bacteria 561
356 Ga0075366_10185662 3300006195 Bacteria 1263
357 Ga0075366_10187647 3300006195 Bacteria 1256
358 Ga0075366_10388548 3300006195 Bacteria 858
359 Ga0075366_10436295 3300006195 Bacteria 808
360 Ga0075366_10437137 3300006195 Bacteria 807
361 Ga0075366_10774304 3300006195 Bacteria 596
362 Ga0075366_10859853 3300006195 Bacteria 565
363 Ga0075366_11014831 3300006195 Bacteria 518
364 Ga0097621_100065582 3300006237 Bacteria 2989
365 Ga0097621_100203771 3300006237 Bacteria 1719
366 Ga0097621_100364443 3300006237 Bacteria 1288
367 Ga0075370_10007146 3300006353 Bacteria 5669
368 Ga0075370_10022166 3300006353 Bacteria 3485
369 Ga0075370_10130973 3300006353 Bacteria 1463
370 Ga0075370_10147575 3300006353 Bacteria 1377
371 Ga0075370_10510377 3300006353 Bacteria 726
372 Ga0075370_10771766 3300006353 Bacteria 585
373 Ga0075370_10805250 3300006353 Bacteria 573
374 Ga0068871_100328919 3300006358 Bacteria 1348
375 Ga0068871_100566037 3300006358 Bacteria 1030
376 Ga0068871_100655611 3300006358 Bacteria 959
377 Ga0068871_101488103 3300006358 Bacteria 639
378 Ga0068871_101648480 3300006358 Bacteria 608
379 Ga0075428_100299635 3300006844 Bacteria 1728
380 Ga0075428_101126202 3300006844 Bacteria 828
381 Ga0075430_100693214 3300006846 Bacteria 840
382 Ga0075431_100495910 3300006847 Bacteria 1213
383 Ga0075433_10592735 3300006852 Bacteria 973
384 Ga0075433_10808937 3300006852 Bacteria 819
385 Ga0075434_100414961 3300006871 Bacteria 1367
386 Ga0075434_100520660 3300006871 Bacteria 1209
387 Ga0075434_101527222 3300006871 Bacteria 677
388 Ga0075429_100223840 3300006880 Bacteria 1648
389 Ga0068865_100162759 3300006881 Bacteria 1704
390 Ga0068865_100203997 3300006881 Bacteria 1536
391 Ga0068865_100317212 3300006881 Bacteria 1252
392 Ga0068865_100459303 3300006881 Bacteria 1054
393 Ga0075436_100180150 3300006914 Bacteria 1493
394 Ga0097620_100037821 3300006931 Bacteria 4843
395 Ga0097620_100291136 3300006931 Bacteria 1726
396 Ga0097620_100300187 3300006931 Bacteria 1699
397 Ga0097620_100345498 3300006931 Bacteria 1582
398 Ga0097620_101171072 3300006931 Bacteria 846
399 Ga0075435_100285486 3300007076 Bacteria 1409
400 Ga0075435_100299732 3300007076 Bacteria 1375
401 Ga0099794_10001765 3300007265 Bacteria 7699
402 Ga0099794_10032223 3300007265 Bacteria 2459
403 Ga0099794_10101959 3300007265 Bacteria 1433
404 Ga0099794_10525188 3300007265 Bacteria 624
405 Ga0099795_10036809 3300007788 Bacteria 1719
406 Ga0099795_10043623 3300007788 Bacteria 1606
407 Ga0099795_10073650 3300007788 Bacteria 1293
408 Ga0099795_10103467 3300007788 Bacteria 1120
409 Ga0099795_10144387 3300007788 Bacteria 970
410 Ga0099795_10501919 3300007788 Bacteria 566
411 Ga0105251_10183691 3300009011 Bacteria 942
412 Ga0105250_10273571 3300009092 Bacteria 726
413 Ga0105250_10317250 3300009092 Bacteria 677
414 Ga0105250_10502712 3300009092 Bacteria 550
415 Ga0105240_10060156 3300009093 Bacteria 4736
416 Ga0105240_10122224 3300009093 Bacteria 3134
417 Ga0105240_10795676 3300009093 Bacteria 1025
418 Ga0105240_10848848 3300009093 Bacteria 986
419 Ga0111539_10068249 3300009094 Bacteria 4198
420 Ga0111539_11299374 3300009094 Bacteria 844
421 Ga0111539_11447415 3300009094 Bacteria 797
422 Ga0105245_10029815 3300009098 Bacteria 4823
423 Ga0105245_10074752 3300009098 Bacteria 3084
424 Ga0105245_10259257 3300009098 Bacteria 1691
425 Ga0105245_11346786 3300009098 Bacteria 763
426 Ga0105245_11563524 3300009098 Bacteria 711
427 Ga0105245_12614055 3300009098 Bacteria 558
428 Ga0105245_12902269 3300009098 Bacteria 531
429 Ga0105245_13066373 3300009098 Bacteria 518
430 Ga0105247_10051977 3300009101 Bacteria 2525
431 Ga0105247_10070032 3300009101 Bacteria 2190
432 Ga0105247_10092597 3300009101 Bacteria 1920
433 Ga0105247_10209169 3300009101 Bacteria 1315
434 Ga0105247_10513310 3300009101 Bacteria 875
435 Ga0105247_10685920 3300009101 Bacteria 769
436 Ga0105247_11223007 3300009101 Bacteria 599
437 Ga0114129_10474411 3300009147 Bacteria 1638
438 Ga0114129_12502271 3300009147 Bacteria 617
439 Ga0105243_10426116 3300009148 Bacteria 1239
440 Ga0105243_10619951 3300009148 Bacteria 1044
441 Ga0105243_11228052 3300009148 Bacteria 764
442 Ga0105243_11290920 3300009148 Bacteria 747
443 Ga0105243_12254750 3300009148 Bacteria 582
444 Ga0105241_10080773 3300009174 Bacteria 2545
445 Ga0105241_10414871 3300009174 Bacteria 1184
446 Ga0105241_10962812 3300009174 Bacteria 796
447 Ga0105241_11911788 3300009174 Bacteria 582
448 Ga0105242_10102527 3300009176 Bacteria 2427
449 Ga0105242_10486007 3300009176 Bacteria 1171
450 Ga0105242_10643434 3300009176 Bacteria 1030
451 Ga0105242_10754010 3300009176 Bacteria 959
452 Ga0105242_12668926 3300009176 Bacteria 549
453 Ga0105248_10144416 3300009177 Bacteria 2685
454 Ga0105248_10206120 3300009177 Bacteria 2215
455 Ga0105248_10510854 3300009177 Bacteria 1355
456 Ga0105248_11271581 3300009177 Bacteria 832
457 Ga0105248_11569109 3300009177 Bacteria 746
458 Ga0105248_12566847 3300009177 Bacteria 581
459 Ga0105248_12740032 3300009177 Bacteria 562
460 Ga0105248_12870798 3300009177 Bacteria 549
461 Ga0105237_10047383 3300009545 Bacteria 4321
462 Ga0105237_10181266 3300009545 Bacteria 2106
463 Ga0105237_10187692 3300009545 Bacteria 2067
464 Ga0105237_10318767 3300009545 Bacteria 1558
465 Ga0105237_10767988 3300009545 Bacteria 971
466 Ga0105237_10773148 3300009545 Bacteria 967
467 Ga0105237_11226104 3300009545 Bacteria 757
468 Ga0105237_12215548 3300009545 Bacteria 559
469 Ga0105237_12292351 3300009545 Bacteria 550
470 Ga0105238_10074780 3300009551 Bacteria 3380
471 Ga0105238_10234815 3300009551 Bacteria 1811
472 Ga0105238_10412465 3300009551 Bacteria 1344
473 Ga0105238_10480527 3300009551 Bacteria 1242
474 Ga0105238_10766591 3300009551 Bacteria 979
475 Ga0105238_10860955 3300009551 Bacteria 924
476 Ga0105238_10895530 3300009551 Bacteria 906
477 Ga0105238_11091023 3300009551 Bacteria 821
478 Ga0105238_11602692 3300009551 Bacteria 681
479 Ga0105238_11723574 3300009551 Bacteria 658
480 Ga0105238_12278024 3300009551 Bacteria 577
481 Ga0105249_10248901 3300009553 Bacteria 1761
482 Ga0105249_11457243 3300009553 Bacteria 757
483 Ga0105249_11960893 3300009553 Bacteria 658
484 Ga0105249_12216738 3300009553 Bacteria 622
485 Ga0105249_12374849 3300009553 Bacteria 603
486 Ga0099796_10028563 3300010159 Bacteria 1792
487 Ga0099796_10093614 3300010159 Bacteria 1120
488 Ga0099796_10156471 3300010159 Bacteria 901
489 Ga0099796_10226926 3300010159 Bacteria 767
490 Ga0099796_10286710 3300010159 Bacteria 694
491 Ga0105239_10058721 3300010375 Bacteria 4222
492 Ga0105239_10102973 3300010375 Bacteria 3159
493 Ga0105239_10132578 3300010375 Bacteria 2772
494 Ga0105239_10170028 3300010375 Bacteria 2437
495 Ga0105239_10220946 3300010375 Bacteria 2125
496 Ga0105239_10228578 3300010375 Bacteria 2087
497 Ga0105239_10474514 3300010375 Bacteria 1421
498 Ga0105239_11020845 3300010375 Bacteria 951
499 Ga0105239_11521172 3300010375 Bacteria 773
500 Ga0105239_12942189 3300010375 Bacteria 555
501 Ga0105246_10029465 3300011119 Bacteria 3615
502 Ga0105246_10317841 3300011119 Bacteria 1264
503 Ga0105246_10502989 3300011119 Bacteria 1029
504 Ga0105246_10538014 3300011119 Bacteria 999
505 Ga0105246_11124206 3300011119 Bacteria 719
506 Ga0105246_11148669 3300011119 Bacteria 712
507 Ga0105246_11236924 3300011119 Bacteria 689
508 Ga0105246_11355813 3300011119 Bacteria 662
509 Ga0105246_11501298 3300011119 Bacteria 633
510 Ga0105246_11528246 3300011119 Bacteria 628
511 Ga0105246_11575932 3300011119 Bacteria 620
512 Ga0157335_1017748 3300012492 Bacteria 647
513 Ga0157339_1037616 3300012505 Bacteria 594
514 Ga0157315_1017459 3300012508 Bacteria 722
515 Ga0157327_1084482 3300012512 Bacteria 517
516 Ga0157326_1065639 3300012513 Bacteria 564
517 Ga0157371_10045157 3300013102 Bacteria 3136
518 Ga0157370_10104669 3300013104 Bacteria 2649
519 Ga0157370_10149340 3300013104 Bacteria 2175
520 Ga0157370_10198787 3300013104 Bacteria 1860
521 Ga0157370_11804781 3300013104 Bacteria 549
522 Ga0157369_10005277 3300013105 Bacteria 15062
523 Ga0157374_10003779 3300013296 Bacteria 12738
524 Ga0157374_10134697 3300013296 Bacteria 2394
525 Ga0157374_10797578 3300013296 Bacteria 960
526 Ga0157374_11044283 3300013296 Bacteria 837
527 Ga0157374_12126547 3300013296 Bacteria 588
528 Ga0157374_12643460 3300013296 Bacteria 530
529 Ga0157378_10020136 3300013297 Bacteria 5867
530 Ga0157378_10175233 3300013297 Bacteria 2014
531 Ga0157378_10300535 3300013297 Bacteria 1553
532 Ga0157378_10308646 3300013297 Bacteria 1533
533 Ga0157378_10812317 3300013297 Bacteria 961
534 Ga0157378_10887956 3300013297 Bacteria 921
535 Ga0157378_11025546 3300013297 Bacteria 860
536 Ga0157378_11330639 3300013297 Bacteria 760
537 Ga0157378_11351106 3300013297 Bacteria 755
538 Ga0163162_10027469 3300013306 Bacteria 5628
539 Ga0163162_10348294 3300013306 Bacteria 1614
540 Ga0163162_10392740 3300013306 Bacteria 1520
541 Ga0163162_10437748 3300013306 Bacteria 1440
542 Ga0163162_10603130 3300013306 Bacteria 1224
543 Ga0163162_11332269 3300013306 Bacteria 816
544 Ga0163162_12166570 3300013306 Bacteria 638
545 Ga0163162_12211565 3300013306 Bacteria 631
546 Ga0163162_13055629 3300013306 Bacteria 537
547 Ga0157372_10833269 3300013307 Bacteria 1071
548 Ga0157372_12279965 3300013307 Bacteria 622
549 Ga0157372_12868469 3300013307 Bacteria 552
550 Ga0157375_10044081 3300013308 Bacteria 4330
551 Ga0157375_10074267 3300013308 Bacteria 3421
552 Ga0157375_10366751 3300013308 Bacteria 1606
553 Ga0157375_10603415 3300013308 Bacteria 1257
554 Ga0157375_10743592 3300013308 Bacteria 1132
555 Ga0157375_11002122 3300013308 Bacteria 975
556 Ga0157375_12016179 3300013308 Bacteria 686
557 Ga0157375_12326726 3300013308 Bacteria 639
558 Ga0163163_10007753 3300014325 Bacteria 9488
559 Ga0163163_10286345 3300014325 Bacteria 1700
560 Ga0163163_10767922 3300014325 Bacteria 1027
561 Ga0163163_11926539 3300014325 Bacteria 651
562 Ga0157380_10222062 3300014326 Bacteria 1691
563 Ga0157380_10244209 3300014326 Bacteria 1621
564 Ga0157380_11311404 3300014326 Bacteria 771
565 Ga0157380_11858744 3300014326 Bacteria 662
566 Ga0157377_10497823 3300014745 Bacteria 851
567 Ga0157377_10558487 3300014745 Bacteria 810
568 Ga0157377_11342719 3300014745 Bacteria 561
569 Ga0157379_10188163 3300014968 Bacteria 1866
570 Ga0157379_10266153 3300014968 Bacteria 1558
571 Ga0157379_10267310 3300014968 Bacteria 1555
572 Ga0157379_10962302 3300014968 Bacteria 812
573 Ga0157379_11819485 3300014968 Bacteria 599
574 Ga0157376_10012121 3300014969 Bacteria 6386
575 Ga0157376_10277318 3300014969 Bacteria 1577
576 Ga0157376_10307821 3300014969 Bacteria 1502
577 Ga0157376_10960965 3300014969 Bacteria 875
578 Ga0157376_11482695 3300014969 Bacteria 711
579 Ga0157376_13073648 3300014969 Bacteria 505
580 Ga0182007_10071745 3300015262 Bacteria 1134
581 Ga0163161_10191617 3300017792 Bacteria 1572
582 Ga0163161_10433263 3300017792 Bacteria 1060
583 Ga0163161_10448388 3300017792 Bacteria 1043
584 Ga0163161_11598349 3300017792 Bacteria 575
585 Ga0163161_11772392 3300017792 Bacteria 548
586 Ga0207666_1035495 3300025271 Bacteria 773
587 Ga0209564_1001221 3300025295 Bacteria 29064
588 Ga0209758_1003949 3300025297 Bacteria 12880
589 Ga0209758_1007275 3300025297 Bacteria 7604
590 Ga0209758_1053161 3300025297 Bacteria 1394
591 Ga0207426_1135669 3300025302 Bacteria 591
592 Ga0207697_10165331 3300025315 Bacteria 966
593 Ga0207697_10349231 3300025315 Bacteria 657
594 Ga0207656_10119122 3300025321 Bacteria 1227
595 Ga0207656_10283968 3300025321 Bacteria 817
596 Ga0207696_1187911 3300025711 Bacteria 545
597 Ga0207653_10063705 3300025885 Bacteria 1248
598 Ga0207692_10000577 3300025898 Bacteria 13067
599 Ga0207692_10014611 3300025898 Bacteria 3434
600 Ga0207692_10265453 3300025898 Bacteria 1033
601 Ga0207642_10958279 3300025899 Bacteria 550
602 Ga0207710_10092411 3300025900 Bacteria 1418
603 Ga0207710_10101896 3300025900 Bacteria 1355
604 Ga0207710_10221864 3300025900 Bacteria 939
605 Ga0207710_10448414 3300025900 Bacteria 666
606 Ga0207710_10517668 3300025900 Bacteria 620
607 Ga0207688_10025581 3300025901 Bacteria 3242
608 Ga0207688_10104912 3300025901 Bacteria 1635
609 Ga0207688_10454278 3300025901 Bacteria 799
610 Ga0207680_10275413 3300025903 Bacteria 1168
611 Ga0207680_10541850 3300025903 Bacteria 830
612 Ga0207680_10659221 3300025903 Bacteria 749
613 Ga0207680_11039545 3300025903 Bacteria 586
614 Ga0207685_10119673 3300025905 Bacteria 1154
615 Ga0207699_10001017 3300025906 Bacteria 13279
616 Ga0207699_10012918 3300025906 Bacteria 4257
617 Ga0207699_10813853 3300025906 Bacteria 687
618 Ga0207645_10194138 3300025907 Bacteria 1335
619 Ga0207645_10514463 3300025907 Bacteria 811
620 Ga0207643_10025399 3300025908 Bacteria 3274
621 Ga0207643_10122560 3300025908 Bacteria 1541
622 Ga0207705_10081491 3300025909 Bacteria 2359
623 Ga0207705_10184232 3300025909 Bacteria 1577
624 Ga0207705_10356852 3300025909 Bacteria 1127
625 Ga0207705_11107658 3300025909 Bacteria 610
626 Ga0207705_11321839 3300025909 Bacteria 550
627 Ga0207684_10073200 3300025910 Bacteria 2910
628 Ga0207654_10016752 3300025911 Bacteria 3819
629 Ga0207654_10206016 3300025911 Bacteria 1297
630 Ga0207654_10527764 3300025911 Bacteria 836
631 Ga0207654_10923019 3300025911 Bacteria 633
632 Ga0207707_10002176 3300025912 Bacteria 17733
633 Ga0207707_10128201 3300025912 Bacteria 2219
634 Ga0207707_10423957 3300025912 Bacteria 1140
635 Ga0207707_10606616 3300025912 Bacteria 926
636 Ga0207695_10036086 3300025913 Bacteria 5349
637 Ga0207695_10718095 3300025913 Bacteria 880
638 Ga0207695_10767894 3300025913 Bacteria 844
639 Ga0207671_10066890 3300025914 Bacteria 2675
640 Ga0207671_10082917 3300025914 Bacteria 2407
641 Ga0207671_10094207 3300025914 Bacteria 2260
642 Ga0207671_10124876 3300025914 Bacteria 1970
643 Ga0207671_10139164 3300025914 Bacteria 1869
644 Ga0207693_10024501 3300025915 Bacteria 4787
645 Ga0207693_10519904 3300025915 Bacteria 929
646 Ga0207693_10638589 3300025915 Bacteria 827
647 Ga0207663_10016885 3300025916 Bacteria 4059
648 Ga0207663_10104043 3300025916 Bacteria 1913
649 Ga0207663_10144689 3300025916 Bacteria 1660
650 Ga0207663_10297486 3300025916 Bacteria 1205
651 Ga0207663_11126195 3300025916 Bacteria 631
652 Ga0207663_11730461 3300025916 Bacteria 503
653 Ga0207660_10001786 3300025917 Bacteria 14369
654 Ga0207660_10077620 3300025917 Bacteria 2432
655 Ga0207660_10282687 3300025917 Bacteria 1317
656 Ga0207662_10026976 3300025918 Bacteria 3316
657 Ga0207657_10024094 3300025919 Bacteria 5650
658 Ga0207657_10084836 3300025919 Bacteria 2654
659 Ga0207657_10298216 3300025919 Bacteria 1277
660 Ga0207657_10799550 3300025919 Bacteria 729
661 Ga0207657_10923390 3300025919 Bacteria 672
662 Ga0207649_10021015 3300025920 Bacteria 3750
663 Ga0207649_10260374 3300025920 Bacteria 1253
664 Ga0207649_10511846 3300025920 Bacteria 914
665 Ga0207652_10002365 3300025921 Bacteria 15944
666 Ga0207652_10469875 3300025921 Bacteria 1133
667 Ga0207652_10643496 3300025921 Bacteria 948
668 Ga0207646_10119995 3300025922 Bacteria 2362
669 Ga0207681_10206613 3300025923 Bacteria 1511
670 Ga0207681_11494655 3300025923 Bacteria 566
671 Ga0207681_11533680 3300025923 Bacteria 558
672 Ga0207681_11680109 3300025923 Bacteria 531
673 Ga0207694_10010594 3300025924 Bacteria 6960
674 Ga0207694_10126246 3300025924 Bacteria 2047
675 Ga0207694_10227399 3300025924 Bacteria 1523
676 Ga0207694_10259330 3300025924 Bacteria 1424
677 Ga0207694_10354263 3300025924 Bacteria 1215
678 Ga0207694_10484913 3300025924 Bacteria 1034
679 Ga0207694_10604574 3300025924 Bacteria 922
680 Ga0207694_11097593 3300025924 Bacteria 673
681 Ga0207694_11421318 3300025924 Bacteria 586
682 Ga0207694_11453743 3300025924 Bacteria 579
683 Ga0207650_10067567 3300025925 Bacteria 2682
684 Ga0207650_10244288 3300025925 Bacteria 1451
685 Ga0207650_10597555 3300025925 Bacteria 928
686 Ga0207650_11162688 3300025925 Bacteria 657
687 Ga0207650_11451828 3300025925 Bacteria 583
688 Ga0207659_10224464 3300025926 Bacteria 1512
689 Ga0207659_10332775 3300025926 Bacteria 1256
690 Ga0207659_10902227 3300025926 Bacteria 760
691 Ga0207659_11081945 3300025926 Bacteria 690
692 Ga0207659_11605895 3300025926 Bacteria 555
693 Ga0207687_10009764 3300025927 Bacteria 6279
694 Ga0207687_10110392 3300025927 Bacteria 2040
695 Ga0207687_10602451 3300025927 Bacteria 926
696 Ga0207687_10964670 3300025927 Bacteria 731
697 Ga0207687_11266498 3300025927 Bacteria 634
698 Ga0207687_11476732 3300025927 Bacteria 584
699 Ga0207687_11514306 3300025927 Bacteria 576
700 Ga0207700_10748729 3300025928 Bacteria 873
701 Ga0207700_11507765 3300025928 Bacteria 596
702 Ga0207664_10099602 3300025929 Bacteria 2399
703 Ga0207664_10309589 3300025929 Bacteria 1391
704 Ga0207664_10688152 3300025929 Bacteria 919
705 Ga0207644_10158028 3300025931 Bacteria 1760
706 Ga0207644_10204176 3300025931 Bacteria 1560
707 Ga0207644_11081364 3300025931 Bacteria 674
708 Ga0207644_11263062 3300025931 Bacteria 621
709 Ga0207690_10079318 3300025932 Bacteria 2288
710 Ga0207690_10170955 3300025932 Bacteria 1628
711 Ga0207690_10417263 3300025932 Bacteria 1073
712 Ga0207690_11754800 3300025932 Bacteria 518
713 Ga0207706_10149220 3300025933 Bacteria 2056
714 Ga0207706_10494900 3300025933 Bacteria 1056
715 Ga0207706_11295565 3300025933 Bacteria 602
716 Ga0207686_10025096 3300025934 Bacteria 3462
717 Ga0207686_10116199 3300025934 Bacteria 1813
718 Ga0207686_10123215 3300025934 Bacteria 1767
719 Ga0207686_11026556 3300025934 Bacteria 670
720 Ga0207709_10731431 3300025935 Bacteria 794
721 Ga0207709_10939973 3300025935 Bacteria 704
722 Ga0207709_11479716 3300025935 Bacteria 563
723 Ga0207670_10462267 3300025936 Bacteria 1025
724 Ga0207670_10674424 3300025936 Bacteria 854
725 Ga0207670_11531122 3300025936 Bacteria 567
726 Ga0207669_10190924 3300025937 Bacteria 1478
727 Ga0207669_10655559 3300025937 Bacteria 859
728 Ga0207669_11068122 3300025937 Bacteria 680
729 Ga0207669_11074635 3300025937 Bacteria 678
730 Ga0207704_10059748 3300025938 Bacteria 2355
731 Ga0207704_10217654 3300025938 Bacteria 1410
732 Ga0207704_10316018 3300025938 Bacteria 1203
733 Ga0207704_10646967 3300025938 Bacteria 870
734 Ga0207704_11134645 3300025938 Bacteria 665
735 Ga0207665_10011153 3300025939 Bacteria 5896
736 Ga0207665_10068456 3300025939 Bacteria 2419
737 Ga0207665_10109023 3300025939 Bacteria 1943
738 Ga0207665_10117626 3300025939 Bacteria 1875
739 Ga0207665_10440509 3300025939 Bacteria 998
740 Ga0207691_11053811 3300025940 Bacteria 677
741 Ga0207691_11079828 3300025940 Bacteria 668
742 Ga0207711_10061641 3300025941 Bacteria 3234
743 Ga0207711_10475281 3300025941 Bacteria 1164
744 Ga0207711_10849681 3300025941 Bacteria 849
745 Ga0207711_11509957 3300025941 Bacteria 615
746 Ga0207689_10146666 3300025942 Bacteria 1944
747 Ga0207689_10280912 3300025942 Bacteria 1379
748 Ga0207689_11058398 3300025942 Bacteria 684
749 Ga0207689_11203376 3300025942 Bacteria 638
750 Ga0207661_10013603 3300025944 Bacteria 5943
751 Ga0207661_10116855 3300025944 Bacteria 2265
752 Ga0207661_10778977 3300025944 Bacteria 881
753 Ga0207661_11897506 3300025944 Bacteria 541
754 Ga0207679_10093013 3300025945 Bacteria 2337
755 Ga0207679_10356885 3300025945 Bacteria 1276
756 Ga0207679_10469512 3300025945 Bacteria 1118
757 Ga0207679_10919219 3300025945 Bacteria 801
758 Ga0207679_11413067 3300025945 Bacteria 638
759 Ga0207679_11420735 3300025945 Bacteria 637
760 Ga0207667_10010838 3300025949 Bacteria 10632
761 Ga0207667_10077713 3300025949 Bacteria 3441
762 Ga0207667_10136354 3300025949 Bacteria 2527
763 Ga0207667_10621324 3300025949 Bacteria 1088
764 Ga0207667_10950665 3300025949 Bacteria 849
765 Ga0207651_11078227 3300025960 Bacteria 719
766 Ga0207651_11368697 3300025960 Bacteria 637
767 Ga0207651_11403801 3300025960 Bacteria 628
768 Ga0207712_10143686 3300025961 Bacteria 1834
769 Ga0207712_10765806 3300025961 Bacteria 847
770 Ga0207712_11404919 3300025961 Bacteria 625
771 Ga0207712_12032756 3300025961 Bacteria 514
772 Ga0207668_10039435 3300025972 Bacteria 3179
773 Ga0207668_10047504 3300025972 Bacteria 2939
774 Ga0207668_10091454 3300025972 Bacteria 2236
775 Ga0207668_10140122 3300025972 Bacteria 1858
776 Ga0207668_10166715 3300025972 Bacteria 1723
777 Ga0207668_10295322 3300025972 Bacteria 1335
778 Ga0207668_10401826 3300025972 Bacteria 1158
779 Ga0207668_10855529 3300025972 Bacteria 807
780 Ga0207668_11115233 3300025972 Bacteria 707
781 Ga0207640_10809835 3300025981 Bacteria 812
782 Ga0207640_11745264 3300025981 Bacteria 562
783 Ga0207658_10869258 3300025986 Bacteria 820
784 Ga0207658_11209724 3300025986 Bacteria 691
785 Ga0207658_12093083 3300025986 Bacteria 514
786 Ga0207658_12200386 3300025986 Bacteria 500
787 Ga0207677_10063932 3300026023 Bacteria 2560
788 Ga0207677_10146068 3300026023 Bacteria 1818
789 Ga0207677_10219069 3300026023 Bacteria 1525
790 Ga0207677_10428766 3300026023 Bacteria 1128
791 Ga0207677_11867319 3300026023 Bacteria 558
792 Ga0207703_10075920 3300026035 Bacteria 2786
793 Ga0207703_10084343 3300026035 Bacteria 2657
794 Ga0207703_10114321 3300026035 Bacteria 2308
795 Ga0207703_10232588 3300026035 Bacteria 1653
796 Ga0207703_12328487 3300026035 Bacteria 511
797 Ga0207639_10062631 3300026041 Bacteria 2877
798 Ga0207639_10110551 3300026041 Bacteria 2239
799 Ga0207639_10267859 3300026041 Bacteria 1497
800 Ga0207639_10492012 3300026041 Bacteria 1119
801 Ga0207639_10556511 3300026041 Bacteria 1053
802 Ga0207639_10683432 3300026041 Bacteria 951
803 Ga0207639_11126040 3300026041 Bacteria 736
804 Ga0207678_10053927 3300026067 Bacteria 3463
805 Ga0207678_10080094 3300026067 Bacteria 2796
806 Ga0207678_10138257 3300026067 Bacteria 2079
807 Ga0207678_10147501 3300026067 Bacteria 2008
808 Ga0207678_10242627 3300026067 Bacteria 1543
809 Ga0207678_10329454 3300026067 Bacteria 1314
810 Ga0207678_11210793 3300026067 Bacteria 669
811 Ga0207678_11432074 3300026067 Bacteria 611
812 Ga0207708_10228716 3300026075 Bacteria 1493
813 Ga0207708_10954651 3300026075 Bacteria 744
814 Ga0207708_11097376 3300026075 Bacteria 694
815 Ga0207702_10291940 3300026078 Bacteria 1545
816 Ga0207702_11377852 3300026078 Bacteria 699
817 Ga0207702_11790144 3300026078 Bacteria 606
818 Ga0207641_10128085 3300026088 Bacteria 2275
819 Ga0207641_10298158 3300026088 Bacteria 1522
820 Ga0207641_11652732 3300026088 Bacteria 642
821 Ga0207648_10095892 3300026089 Bacteria 2595
822 Ga0207648_10463116 3300026089 Bacteria 1156
823 Ga0207648_10562739 3300026089 Bacteria 1048
824 Ga0207676_10079312 3300026095 Bacteria 2662
825 Ga0207676_10099178 3300026095 Bacteria 2410
826 Ga0207676_10631137 3300026095 Bacteria 1032
827 Ga0207676_11531438 3300026095 Bacteria 664
828 Ga0207674_10083221 3300026116 Bacteria 3200
829 Ga0207674_10349016 3300026116 Bacteria 1430
830 Ga0207674_11574486 3300026116 Bacteria 626
831 Ga0207675_100057952 3300026118 Bacteria 3615
832 Ga0207675_100171161 3300026118 Bacteria 2076
833 Ga0207675_100562748 3300026118 Bacteria 1140
834 Ga0207683_10094409 3300026121 Bacteria 2666
835 Ga0207683_10095176 3300026121 Bacteria 2655
836 Ga0207683_10107984 3300026121 Bacteria 2490
837 Ga0207683_10132018 3300026121 Bacteria 2246
838 Ga0207683_10363204 3300026121 Bacteria 1330
839 Ga0207698_10037660 3300026142 Bacteria 3565
840 Ga0207698_10122759 3300026142 Bacteria 2202
841 Ga0207698_10199533 3300026142 Bacteria 1790
842 Ga0207698_10558016 3300026142 Bacteria 1124
843 Ga0207698_10693525 3300026142 Bacteria 1013
844 Ga0207698_10837118 3300026142 Bacteria 924
845 Ga0209179_1000351 3300027512 Bacteria 4498
846 Ga0209179_1013201 3300027512 Bacteria 1497
847 Ga0209179_1132257 3300027512 Bacteria 557
848 Ga0209588_1000878 3300027671 Bacteria 7640
849 Ga0209588_1038864 3300027671 Bacteria 1534
850 Ga0209588_1146802 3300027671 Bacteria 748
851 Ga0209813_10008814 3300027866 Bacteria 2559
852 Ga0209813_10056058 3300027866 Bacteria 1246
853 Ga0209813_10165010 3300027866 Bacteria 801
854 Ga0209813_10506935 3300027866 Bacteria 501
855 Ga0207428_10688499 3300027907 Bacteria 732
856 Ga0268266_10000670 3300028379 Bacteria 46181
857 Ga0268266_10012528 3300028379 Bacteria 7328
858 Ga0268266_10036248 3300028379 Bacteria 4197
859 Ga0268266_10125312 3300028379 Bacteria 2291
860 Ga0268266_10196582 3300028379 Bacteria 1844
861 Ga0268266_10220033 3300028379 Bacteria 1745
862 Ga0268266_10404766 3300028379 Bacteria 1291
863 Ga0268266_10510888 3300028379 Bacteria 1148
864 Ga0268266_10697926 3300028379 Bacteria 978
865 Ga0268266_10963272 3300028379 Bacteria 825
866 Ga0268266_11344219 3300028379 Bacteria 690
867 Ga0268266_11720137 3300028379 Bacteria 602
868 Ga0268265_10093973 3300028380 Bacteria 2404
869 Ga0268265_10126118 3300028380 Bacteria 2118
870 Ga0268265_10400453 3300028380 Bacteria 1268
871 Ga0268265_10573317 3300028380 Bacteria 1074
872 Ga0268265_10717435 3300028380 Bacteria 967
873 Ga0268265_11078272 3300028380 Bacteria 796
874 Ga0268265_11939985 3300028380 Bacteria 596
875 Ga0268264_10211581 3300028381 Bacteria 1780
876 Ga0268264_10281030 3300028381 Bacteria 1559
877 Ga0268264_10364642 3300028381 Bacteria 1379
878 Ga0268264_10499511 3300028381 Bacteria 1186
879 Ga0268264_10655987 3300028381 Bacteria 1039
880 Ga0268264_11500701 3300028381 Bacteria 685
881 Ga0268264_11884420 3300028381 Bacteria 608
882 Ga0265326_10016244 3300028558 Bacteria 2153
883 Ga0265319_1027573 3300028563 Bacteria 2013
884 Ga0265334_10014815 3300028573 Bacteria 3245
885 Ga0265318_10015868 3300028577 Bacteria 3121
886 Ga0265323_10064894 3300028653 Bacteria 1260
887 Ga0265336_10000598 3300028666 Bacteria 20180
888 Ga0307517_10000512 3300028786 Bacteria 66501
889 Ga0307517_10118508 3300028786 Bacteria 1970
890 Ga0307517_10327584 3300028786 Bacteria 844
891 Ga0307515_10022025 3300028794 Bacteria 11255
892 Ga0307515_10363107 3300028794 Bacteria 1088
893 Ga0307515_10561665 3300028794 Bacteria 751
894 Ga0265338_10000116 3300028800 Bacteria 146839
895 Ga0265324_10012440 3300029957 Bacteria 3207
896 Ga0307512_10359757 3300030522 Bacteria 636
897 Ga0265330_10021854 3300031235 Bacteria 2915
898 Ga0265340_10059179 3300031247 Bacteria 1838
899 Ga0265339_10003487 3300031249 Bacteria 10996
900 Ga0307513_10111079 3300031456 Bacteria 2734
901 Ga0307513_10125971 3300031456 Bacteria 2517
902 Ga0307513_10219632 3300031456 Bacteria 1723
903 Ga0307513_10704986 3300031456 Bacteria 715
904 Ga0307509_10124356 3300031507 Bacteria 2549
905 Ga0307408_101912993 3300031548 Bacteria 569
906 Ga0307508_10000008 3300031616 Bacteria 265023
907 Ga0307508_10125719 3300031616 Bacteria 2167
908 Ga0307508_10303976 3300031616 Bacteria 1188
909 Ga0307516_10114139 3300031730 Bacteria 2499
910 Ga0307516_10426363 3300031730 Bacteria 984
911 Ga0307516_10426764 3300031730 Bacteria 983
912 Ga0307405_11564452 3300031731 Bacteria 581
913 Ga0307405_12161292 3300031731 Bacteria 500
914 Ga0307413_10186048 3300031824 Bacteria 1486
915 Ga0307410_12069139 3300031852 Bacteria 509
916 Ga0307406_10227129 3300031901 Bacteria 1391
917 Ga0307406_10727563 3300031901 Bacteria 831
918 Ga0307406_11041558 3300031901 Bacteria 704
919 Ga0307407_10385138 3300031903 Bacteria 1002
920 Ga0307407_10653675 3300031903 Bacteria 788
921 Ga0307412_10133933 3300031911 Bacteria 1805
922 Ga0307412_10264397 3300031911 Bacteria 1343
923 Ga0307412_10723058 3300031911 Bacteria 857
924 Ga0307412_10833823 3300031911 Bacteria 803
925 Ga0307412_10973022 3300031911 Bacteria 748
926 Ga0307412_11289578 3300031911 Bacteria 657
927 Ga0307409_100037914 3300031995 Bacteria 3558
928 Ga0307409_100609669 3300031995 Bacteria 1080
929 Ga0307409_101280783 3300031995 Bacteria 758
930 Ga0307409_101597040 3300031995 Bacteria 680
931 Ga0307416_100374435 3300032002 Bacteria 1451
932 Ga0307416_100598498 3300032002 Bacteria 1182
933 Ga0307416_101716231 3300032002 Bacteria 732
934 Ga0307414_10282430 3300032004 Bacteria 1396
935 Ga0307414_10391927 3300032004 Bacteria 1204
936 Ga0307414_12135239 3300032004 Bacteria 523
937 Ga0307411_10108176 3300032005 Bacteria 1983
938 Ga0307411_10351685 3300032005 Bacteria 1201
939 Ga0307411_10722577 3300032005 Bacteria 870
940 Ga0307411_10866050 3300032005 Bacteria 800
941 Ga0307411_11527350 3300032005 Bacteria 614
942 Ga0307415_100163658 3300032126 Bacteria 1727
943 Ga0307415_100500443 3300032126 Bacteria 1062
944 Ga0307415_100572527 3300032126 Bacteria 1000
945 Ga0307415_100776829 3300032126 Bacteria 872
946 Ga0307415_101111652 3300032126 Bacteria 740
947 Ga0307507_10503249 3300033179 Bacteria 652
948 Ga0307510_10009215 3300033180 Bacteria 11759
949 Ga0307510_10009742 3300033180 Bacteria 11434
950 Ga0307510_10159281 3300033180 Bacteria 1858
951 Ga0307510_10202068 3300033180 Bacteria 1521
952 Ga0307510_10568209 3300033180 Bacteria 582
953 Ga0373930_0001441 3300034816 Bacteria 3537
954 Ga0373950_0151467 3300034818 Bacteria 531
955 Ga0373926_0266358 3300035083 Bacteria 666
956 Ga0373926_0304035 3300035083 Bacteria 623
957 Ga0373928_0019596 3300035084 Bacteria 1413
958 Ga0373929_0016903 3300035085 Bacteria 1435
959 Ga0373929_0047419 3300035085 Bacteria 973
960 Ga0373940_0057516 3300035088 Bacteria 1105
961 Ga0373944_0173578 3300035089 Bacteria 770
962 Ga0373951_0113380 3300035091 Bacteria 732
963 Ga0373952_0117761 3300035092 Bacteria 717
964 Ga0373923_0025654 3300035111 Bacteria 2338
965 Ga0373932_0200365 3300035112 Bacteria 709
966 Ga0373932_0219639 3300035112 Bacteria 682
967 Ga0373936_0001697 3300035113 Bacteria 8084
968 Ga0373936_0061131 3300035113 Bacteria 1538
969 Ga0373936_0242807 3300035113 Bacteria 803
970 Ga0373936_0273822 3300035113 Bacteria 758
971 Ga0373941_0108588 3300035115 Bacteria 975
972 Ga0373945_0007150 3300035116 Bacteria 3614
973 Ga0373954_0108494 3300035118 Bacteria 1342
974 Ga0373943_0008157 3300035170 Bacteria 4700
975 Ga0373943_0094690 3300035170 Bacteria 1552
976 Ga0373946_0022363 3300035171 Bacteria 2460
977 Ga0373946_0037316 3300035171 Bacteria 1974
978 Ga0373946_0060591 3300035171 Bacteria 1609
979 Ga0373955_0009286 3300035172 Bacteria 4605
980 Ga0373962_0105125 3300035242 Bacteria 885
981 Ga0373931_0015883 3300035691 Bacteria 3697
982 Ga0373931_0075718 3300035691 Bacteria 1847
983 Ga0373931_0267215 3300035691 Bacteria 1046
984 Ga0373931_1025124 3300035691 Bacteria 559
985 Ga0373935_0001766 3300035692 Bacteria 12152
986 Ga0373935_0241613 3300035692 Bacteria 1261
987 Ga0373935_0457988 3300035692 Bacteria 922
988 Ga0373935_0616038 3300035692 Bacteria 795
989 Ga0373927_0000346 3300035695 Bacteria 36389
990 Ga0373927_0030692 3300035695 Bacteria 3506
991 Ga0373927_0062334 3300035695 Bacteria 2411
992 Ga0373927_0131258 3300035695 Bacteria 1637
993 Ga0373927_0238016 3300035695 Bacteria 1196
994 Ga0373927_0726433 3300035695 Bacteria 656
995 Ga0373947_0001267 3300035725 Bacteria 15562
996 Ga0373947_0094240 3300035725 Bacteria 1872
997 Ga0373937_0112363 3300036401 Bacteria 2534
998 Ga0373937_0390713 3300036401 Bacteria 1320
999 Ga0373937_1974260 3300036401 Bacteria 530
1000 Ga0373925_0001404 3300037068 Bacteria 20938
1001 Ga0373925_0083042 3300037068 Bacteria 2439
1002 Ga0373925_1185760 3300037068 Bacteria 628
1003 Ga0395899_0151687 3300037312 Bacteria 1642
1004 Ga0395899_0222815 3300037312 Bacteria 1306
1005 Ga0395899_0291301 3300037312 Bacteria 1107
1006 Ga0395900_0000134 3300037418 Bacteria 124444
1007 Ga0395900_0434408 3300037418 Bacteria 1271
1008 Ga0395900_1338018 3300037418 Bacteria 630
1009 Ga0395898_0102741 3300037466 Bacteria 2743
1010 Ga0395898_0134716 3300037466 Bacteria 2365
1011 Ga0395905_0014230 3300037471 Bacteria 7601
1012 Ga0395905_0050316 3300037471 Bacteria 3904
1013 Ga0395905_0767039 3300037471 Bacteria 867
1014 Ga0436364_0264957 3300037853 Bacteria 516
1015 Ga0395901_0030976 3300038443 Bacteria 5514
1016 Ga0395901_0187727 3300038443 Bacteria 2168
1017 Ga0395901_0294990 3300038443 Bacteria 1682
1018 Ga0395901_0349714 3300038443 Bacteria 1525
1019 Ga0436365_0101349 3300039437 Bacteria 534
1020 Ga0436365_1730624 3300039437 Bacteria 859
1021 Ga0436360_0228735 3300039438 Bacteria 674
1022 Ga0436360_0885589 3300039438 Bacteria 1089
1023 Ga0436362_0973033 3300039453 Bacteria 579
1024 Ga0439465_0113434 3300041413 Bacteria 945
1025 Ga0451789_0257448 3300041443 Bacteria 903
1026 Ga0451791_0431041 3300041451 Bacteria 655
1027 Ga0451793_1558836 3300041452 Bacteria 518
1028 Ga0451793_1711476 3300041452 Bacteria 1424
1029 Ga0451797_0428135 3300041453 Bacteria 606
1030 Ga0451797_1397639 3300041453 Bacteria 593
1031 Ga0451802_1512357 3300041460 Bacteria 535
1032 Ga0451807_1979322 3300041486 Bacteria 539
1033 Ga0451807_2687982 3300041486 Bacteria 801
1034 Ga0451833_0528442 3300041491 Bacteria 609
1035 Ga0451845_0758677 3300041501 Bacteria 640
1036 Ga0451849_0847938 3300041505 Bacteria 1028
1037 Ga0451843_0507948 3300041509 Bacteria 543
1038 Ga0451853_0618798 3300041512 Bacteria 579
1039 Ga0451853_1984475 3300041512 Bacteria 1688
1040 Ga0450904_022680 3300042139 Bacteria 641
1041 Ga0439464_0026932 3300042439 Bacteria 1597
1042 Ga0466965_0089255 3300044683 Bacteria 1566
1043 Ga0466971_0318079 3300044719 Bacteria 750
1044 Ga0466960_0049939 3300044901 Bacteria 2015
1045 Ga0466967_1227900 3300045976 Bacteria 747
1046 Ga0466967_2443944 3300045976 Bacteria 518
1047 Ga0495617_085289 3300046452 Bacteria 1033
1048 Ga0495592_0006304 3300046454 Bacteria 8827
1049 Ga0495603_0000092 3300046455 Bacteria 40980
1050 Ga0495603_0033560 3300046455 Bacteria 3088
1051 Ga0495603_0118070 3300046455 Bacteria 1546
1052 Ga0495603_0279177 3300046455 Bacteria 960
1053 Ga0495603_0520208 3300046455 Bacteria 681
1054 Ga0495590_0214969 3300046457 Bacteria 709
1055 Ga0495590_0278918 3300046457 Bacteria 626
1056 Ga0495629_0000181 3300046459 Bacteria 56739
1057 Ga0495629_0796914 3300046459 Bacteria 623
1058 Ga0495638_0232937 3300046460 Bacteria 1023
1059 Ga0495638_0256526 3300046460 Bacteria 961
1060 Ga0495638_0524715 3300046460 Bacteria 592
1061 Ga0495641_0001499 3300046461 Bacteria 19900
1062 Ga0495651_0079831 3300046462 Bacteria 2472
1063 Ga0495651_0084179 3300046462 Bacteria 2397
1064 Ga0495651_0259399 3300046462 Bacteria 1183
1065 Ga0495580_0001467 3300046472 Bacteria 20684
1066 Ga0495580_0039558 3300046472 Bacteria 3374
1067 Ga0495582_0000039 3300046473 Bacteria 66883
1068 Ga0495639_0000489 3300046475 Bacteria 18815
1069 Ga0495639_0094062 3300046475 Bacteria 1409
1070 Ga0495662_0000343 3300046476 Bacteria 20338
1071 Ga0495662_0300236 3300046476 Bacteria 790
1072 Ga0495664_0034367 3300046477 Bacteria 2982
1073 Ga0495664_0265505 3300046477 Bacteria 1037
1074 Ga0495664_0373162 3300046477 Bacteria 858
1075 Ga0495584_0616836 3300046491 Bacteria 553
1076 Ga0495584_0652805 3300046491 Bacteria 536
1077 Ga0495585_0481642 3300046492 Bacteria 591
1078 Ga0495594_0000619 3300046499 Bacteria 18269
1079 Ga0495594_0054447 3300046499 Bacteria 2205
1080 Ga0495594_0110649 3300046499 Bacteria 1549
1081 Ga0495594_0642145 3300046499 Bacteria 601
1082 Ga0495596_0072692 3300046500 Bacteria 1335
1083 Ga0495596_0074874 3300046500 Bacteria 1315
1084 Ga0495596_0210350 3300046500 Bacteria 755
1085 Ga0495606_0151173 3300046507 Bacteria 1362
1086 Ga0495606_0215377 3300046507 Bacteria 1085
1087 Ga0495606_0271730 3300046507 Bacteria 931
1088 Ga0495606_0359485 3300046507 Bacteria 770
1089 Ga0495606_0533771 3300046507 Bacteria 587
1090 Ga0495606_0593876 3300046507 Bacteria 544
1091 Ga0495608_0346541 3300046511 Bacteria 915
1092 Ga0495610_0048361 3300046512 Bacteria 2088
1093 Ga0495616_0142836 3300046513 Bacteria 1088
1094 Ga0495616_0294707 3300046513 Bacteria 686
1095 Ga0495618_0422641 3300046514 Bacteria 812
1096 Ga0495618_0854552 3300046514 Bacteria 527
1097 Ga0495620_0031824 3300046515 Bacteria 2411
1098 Ga0495620_0167572 3300046515 Bacteria 852
1099 Ga0495620_0204645 3300046515 Bacteria 759
1100 Ga0495620_0424154 3300046515 Bacteria 503
1101 Ga0495628_0110032 3300046516 Bacteria 2120
1102 Ga0495628_0981050 3300046516 Bacteria 582
1103 Ga0495630_0001653 3300046517 Bacteria 15507
1104 Ga0495631_0037167 3300046518 Bacteria 2171
1105 Ga0495631_0246649 3300046518 Bacteria 761
1106 Ga0495631_0320954 3300046518 Bacteria 659
1107 Ga0495632_0075002 3300046519 Bacteria 1619
1108 Ga0495632_0104820 3300046519 Bacteria 1331
1109 Ga0495632_0126752 3300046519 Bacteria 1190
1110 Ga0495643_0078452 3300046522 Bacteria 1724
1111 Ga0495644_0065431 3300046523 Bacteria 1366
1112 Ga0495644_0150924 3300046523 Bacteria 889
1113 Ga0495644_0159957 3300046523 Bacteria 863
1114 Ga0495648_0161537 3300046524 Bacteria 1158
1115 Ga0495648_0260649 3300046524 Bacteria 832
1116 Ga0495648_0523210 3300046524 Bacteria 505
1117 Ga0495663_0248320 3300046525 Bacteria 631
1118 Ga0495663_0401771 3300046525 Bacteria 504
1119 Ga0495666_0063983 3300046526 Bacteria 1756
1120 Ga0495666_0146398 3300046526 Bacteria 1099
1121 Ga0495642_0065300 3300046528 Bacteria 1515
1122 Ga0495652_0085914 3300046529 Bacteria 2584
1123 Ga0495665_0000079 3300046531 Bacteria 42321
1124 Ga0495640_0002836 3300046533 Bacteria 13937
1125 Ga0495640_0278461 3300046533 Bacteria 1042
1126 Ga0495640_0348185 3300046533 Bacteria 915
1127 Ga0495640_0439391 3300046533 Bacteria 798
1128 Ga0495586_0062202 3300046535 Bacteria 2032
1129 Ga0495587_0419727 3300046536 Bacteria 743
1130 Ga0495609_0187943 3300046538 Bacteria 867
1131 Ga0495609_0279450 3300046538 Bacteria 683
1132 Ga0495621_0264540 3300046539 Bacteria 705
1133 Ga0495597_0123488 3300046542 Bacteria 1078
1134 Ga0495622_0000987 3300046557 Bacteria 15239
1135 Ga0495622_0073143 3300046557 Bacteria 1581
1136 Ga0495622_0185309 3300046557 Bacteria 932
1137 Ga0495622_0247781 3300046557 Bacteria 784
1138 Ga0495622_0366386 3300046557 Bacteria 623
1139 Ga0495633_0081849 3300046558 Bacteria 1502
1140 Ga0495633_0328373 3300046558 Bacteria 694
1141 Ga0495633_0548328 3300046558 Bacteria 520
1142 Ga0495667_0006293 3300046559 Bacteria 8054
1143 Ga0495667_0034023 3300046559 Bacteria 3408
1144 Ga0495656_0086431 3300046615 Bacteria 1426
1145 Ga0495656_0612839 3300046615 Bacteria 583
1146 Ga0495668_0050474 3300046616 Bacteria 2306
1147 Ga0495668_0083750 3300046616 Bacteria 1749
1148 Ga0495668_0113688 3300046616 Bacteria 1480
1149 Ga0495668_0119882 3300046616 Bacteria 1439
1150 Ga0495668_0263869 3300046616 Bacteria 943
1151 Ga0495668_0317435 3300046616 Bacteria 854
1152 Ga0495668_0428630 3300046616 Bacteria 727
1153 Ga0495634_0077181 3300046642 Bacteria 2185
1154 Ga0495611_0038191 3300046648 Bacteria 2135
1155 Ga0495611_0442520 3300046648 Bacteria 593
1156 Ga0495625_0576942 3300046660 Bacteria 678
1157 Ga0495625_0584181 3300046660 Bacteria 673
1158 Ga0495625_0688945 3300046660 Bacteria 605
1159 Ga0495625_0795087 3300046660 Bacteria 550
1160 Ga0495635_0001923 3300046663 Bacteria 14132
1161 Ga0495635_0564867 3300046663 Bacteria 745
1162 Ga0495635_0712960 3300046663 Bacteria 650
1163 Ga0495635_1009726 3300046663 Bacteria 529
1164 Ga0495588_0019722 3300046674 Bacteria 3307
1165 Ga0495588_0148423 3300046674 Bacteria 1239
1166 Ga0495588_0210587 3300046674 Bacteria 1026
1167 Ga0495599_0478628 3300046678 Bacteria 735
1168 Ga0495599_0576728 3300046678 Bacteria 657
1169 Ga0495623_0687895 3300046679 Bacteria 525
1170 Ga0495623_0710628 3300046679 Bacteria 514
1171 Ga0495646_0044735 3300046680 Bacteria 2706
1172 Ga0495647_0000562 3300046681 Bacteria 10934
1173 Ga0495647_0209040 3300046681 Bacteria 858
1174 Ga0495658_0004610 3300046683 Bacteria 6783
1175 Ga0495658_0231876 3300046683 Bacteria 1158
1176 Ga0495658_0701828 3300046683 Bacteria 648
1177 Ga0495658_0848347 3300046683 Bacteria 584
1178 Ga0495669_0032121 3300046684 Bacteria 2306
1179 Ga0495669_0189960 3300046684 Bacteria 980
1180 Ga0495613_0000543 3300046689 Bacteria 31253
1181 Ga0495624_0001851 3300046690 Bacteria 16133
1182 Ga0495624_0356534 3300046690 Bacteria 880
1183 Ga0495624_0361481 3300046690 Bacteria 873
1184 Ga0495624_0883391 3300046690 Bacteria 526
1185 Ga0495671_0161560 3300046692 Bacteria 1089
1186 Ga0495671_0203205 3300046692 Bacteria 961
1187 Ga0495649_0475282 3300046694 Bacteria 623
1188 Ga0495649_0692465 3300046694 Bacteria 500
1189 Ga0495589_0174947 3300046794 Bacteria 1020
1190 Ga0495589_0226170 3300046794 Bacteria 878
1191 Ga0495589_0488415 3300046794 Bacteria 562
1192 Ga0495589_0548271 3300046794 Bacteria 527
1193 Ga0495600_0185665 3300046809 Bacteria 1339
1194 Ga0495600_0314716 3300046809 Bacteria 985
1195 Ga0495600_0688625 3300046809 Bacteria 616
1196 Ga0495581_0000024 3300047315 Bacteria 55574
1197 Ga0495581_0143434 3300047315 Bacteria 1394
1198 Ga0495581_0198146 3300047315 Bacteria 1174
1199 Ga0495581_0309830 3300047315 Bacteria 923
1200 Ga0495604_0186290 3300047317 Bacteria 1449
1201 Ga0495604_0281318 3300047317 Bacteria 1124
1202 Ga0495604_0340942 3300047317 Bacteria 998
1203 Ga0495674_0019174 3300047319 Bacteria 6354
1204 Ga0495674_0321769 3300047319 Bacteria 1260
1205 Ga0495674_0671211 3300047319 Bacteria 816
1206 Ga0495672_0011028 3300047320 Bacteria 6400
1207 Ga0495672_0025851 3300047320 Bacteria 3753
1208 Ga0495672_0189303 3300047320 Bacteria 1036
1209 Ga0495672_0300885 3300047320 Bacteria 760
1210 Ga0495676_0063772 3300047321 Bacteria 2870
1211 Ga0495676_0171577 3300047321 Bacteria 1526
1212 Ga0495676_0282779 3300047321 Bacteria 1123
1213 Ga0495680_0161079 3300047322 Bacteria 1629
1214 Ga0495683_0189431 3300047323 Bacteria 934
1215 Ga0495687_091359 3300047443 Bacteria 1165
1216 Ga0495675_0341861 3300047444 Bacteria 882
1217 Ga0495677_0346648 3300047445 Bacteria 586
1218 Ga0495677_0432557 3300047445 Bacteria 521
1219 Ga0495685_141447 3300047447 Bacteria 784
1220 Ga0495673_0040209 3300047469 Bacteria 2115
1221 Ga0495673_0050320 3300047469 Bacteria 1829
1222 Ga0495673_0189993 3300047469 Bacteria 773
1223 Ga0495681_0135438 3300047470 Bacteria 1045
1224 Ga0495681_0166780 3300047470 Bacteria 914
1225 Ga0495684_0044730 3300047471 Bacteria 3389
1226 Ga0495686_0023990 3300047472 Bacteria 4012
1227 Ga0495686_0047360 3300047472 Bacteria 2715
1228 Ga0495686_0139220 3300047472 Bacteria 1433
1229 Ga0495686_0204079 3300047472 Bacteria 1133
1230 Ga0495686_0220938 3300047472 Bacteria 1078
1231 Ga0495593_0000019 3300047673 Bacteria 74042
1232 Ga0495593_0146760 3300047673 Bacteria 1194
1233 Ga0495614_0011005 3300048089 Bacteria 3981
1234 Ga0495615_0078174 3300048090 Bacteria 903
1235 Ga0495626_0306177 3300048091 Bacteria 627
1236 Ga0496100_0010707 3300048903 Bacteria 5202
1237 Ga0496100_0098620 3300048903 Bacteria 2009
1238 Ga0496100_0142779 3300048903 Bacteria 1699
1239 Ga0496100_0833096 3300048903 Bacteria 723
1240 Ga0496101_0004532 3300048904 Bacteria 8770
1241 Ga0496101_0085973 3300048904 Bacteria 2331
1242 Ga0496101_0091497 3300048904 Bacteria 2264
1243 Ga0496101_0358504 3300048904 Bacteria 1146
1244 Ga0496101_0512912 3300048904 Bacteria 947
1245 Ga0496101_0927845 3300048904 Bacteria 685
1246 Ga0496101_1334796 3300048904 Bacteria 560
1247 Ga0496101_1376980 3300048904 Bacteria 551
1248 Ga0496101_1411153 3300048904 Bacteria 543
1249 Ga0496102_0006263 3300048905 Bacteria 10146
1250 Ga0496102_0175785 3300048905 Bacteria 2016
1251 Ga0496102_0430216 3300048905 Bacteria 1239
1252 Ga0496102_0474361 3300048905 Bacteria 1172
1253 Ga0496102_0537218 3300048905 Bacteria 1092
1254 Ga0496102_0776863 3300048905 Bacteria 880
1255 Ga0496102_0822078 3300048905 Bacteria 851
1256 Ga0496102_0954726 3300048905 Bacteria 778
1257 Ga0496102_0986171 3300048905 Bacteria 763
1258 Ga0496103_0246669 3300048906 Bacteria 1149
1259 Ga0496103_0249966 3300048906 Bacteria 1141
1260 Ga0496103_0530205 3300048906 Bacteria 752
1261 Ga0496104_0008945 3300048907 Bacteria 8901
1262 Ga0496104_0027692 3300048907 Bacteria 5247
1263 Ga0496104_0276050 3300048907 Bacteria 1593
1264 Ga0496104_0483331 3300048907 Bacteria 1150
1265 Ga0496104_0623358 3300048907 Bacteria 988
1266 Ga0496105_0032314 3300048908 Bacteria 4293
1267 Ga0496105_0050263 3300048908 Bacteria 3444
1268 Ga0496105_0432689 3300048908 Bacteria 1040
1269 Ga0496105_0931103 3300048908 Bacteria 653
1270 Ga0496105_1044509 3300048908 Bacteria 609
1271 Ga0496106_0006039 3300048909 Bacteria 8965
1272 Ga0496106_0031229 3300048909 Bacteria 3969
1273 Ga0496106_0082571 3300048909 Bacteria 2470
1274 Ga0496106_0118035 3300048909 Bacteria 2071
1275 Ga0496106_0249318 3300048909 Bacteria 1419
1276 Ga0496106_0268600 3300048909 Bacteria 1365
1277 Ga0496106_0269585 3300048909 Bacteria 1363
1278 Ga0496106_1146929 3300048909 Bacteria 608
1279 Ga0496107_0002095 3300048910 Bacteria 12782
1280 Ga0496107_0037002 3300048910 Bacteria 3502
1281 Ga0496107_0101070 3300048910 Bacteria 2114
1282 Ga0496107_0149565 3300048910 Bacteria 1727
1283 Ga0496107_0405892 3300048910 Bacteria 1013
1284 Ga0496107_1042523 3300048910 Bacteria 592
1285 Ga0496108_0107049 3300048911 Bacteria 2387
1286 Ga0496108_0199841 3300048911 Bacteria 1735
1287 Ga0496108_0223260 3300048911 Bacteria 1637
1288 Ga0496108_1379248 3300048911 Bacteria 590
1289 Ga0496109_0024900 3300048912 Bacteria 5327
1290 Ga0496109_0051840 3300048912 Bacteria 3738
1291 Ga0496109_0082541 3300048912 Bacteria 2962
1292 Ga0496109_1382162 3300048912 Bacteria 640
1293 Ga0496109_1486818 3300048912 Bacteria 612
1294 Ga0496109_1630133 3300048912 Bacteria 579
1295 Ga0496110_0045663 3300048913 Bacteria 3830
1296 Ga0496110_0052068 3300048913 Bacteria 3598
1297 Ga0496110_0109226 3300048913 Bacteria 2484
1298 Ga0496110_0370162 3300048913 Bacteria 1306
1299 Ga0496110_0673092 3300048913 Bacteria 935
1300 Ga0496110_0840828 3300048913 Bacteria 823
1301 Ga0496110_1385849 3300048913 Bacteria 612
1302 Ga0496110_1643176 3300048913 Bacteria 552
1303 Ga0496111_0007619 3300048914 Bacteria 7113
1304 Ga0496111_0029517 3300048914 Bacteria 3895
1305 Ga0496111_0599340 3300048914 Bacteria 807
1306 Ga0496111_0621193 3300048914 Bacteria 790
1307 Ga0496111_0834118 3300048914 Bacteria 666
1308 Ga0496111_1040622 3300048914 Bacteria 585
1309 Ga0496112_0000142 3300048915 Bacteria 44742
1310 Ga0496112_0070420 3300048915 Bacteria 3456
1311 Ga0496112_0126064 3300048915 Bacteria 2531
1312 Ga0496112_0126574 3300048915 Bacteria 2525
1313 Ga0496112_0219035 3300048915 Bacteria 1860
1314 Ga0496113_0136243 3300048916 Bacteria 1929
1315 Ga0496113_0471879 3300048916 Bacteria 1008
1316 Ga0496113_0661320 3300048916 Bacteria 835
1317 Ga0496113_1054137 3300048916 Bacteria 639
1318 Ga0496113_1597535 3300048916 Bacteria 502
1319 Ga0496114_0140308 3300048917 Bacteria 2092
1320 Ga0496114_0164625 3300048917 Bacteria 1930
1321 Ga0496114_0633547 3300048917 Bacteria 941
1322 Ga0496114_0678809 3300048917 Bacteria 904
1323 Ga0496114_1756436 3300048917 Bacteria 508
1324 Ga0496115_0008444 3300048918 Bacteria 7619
1325 Ga0496115_0023426 3300048918 Bacteria 4792
1326 Ga0496115_0170574 3300048918 Bacteria 1800
1327 Ga0496115_0186686 3300048918 Bacteria 1713
1328 Ga0496115_0407115 3300048918 Bacteria 1103
1329 Ga0496115_0589998 3300048918 Bacteria 884
1330 Ga0496115_0783863 3300048918 Bacteria 743
1331 Ga0496115_0935919 3300048918 Bacteria 666
1332 Ga0496115_1153158 3300048918 Bacteria 585
1333 Ga0496116_0280195 3300048919 Bacteria 808
1334 Ga0496117_0063557 3300048920 Bacteria 2522
1335 Ga0496117_0255088 3300048920 Bacteria 954
1336 Ga0496117_0456721 3300048920 Bacteria 630
1337 Ga0496118_0078432 3300048921 Bacteria 2337
1338 Ga0496118_0100325 3300048921 Bacteria 1958
1339 Ga0496118_0126830 3300048921 Bacteria 1649
1340 Ga0496119_0039804 3300048922 Bacteria 3018
1341 Ga0496119_0514944 3300048922 Bacteria 555
1342 Ga0496120_0097426 3300048923 Bacteria 1560
1343 Ga0496120_0325430 3300048923 Bacteria 697
1344 Ga0496121_0000365 3300048924 Bacteria 92822
1345 Ga0496121_0044807 3300048924 Bacteria 3810
1346 Ga0496121_0049914 3300048924 Bacteria 3541
1347 Ga0496121_0061871 3300048924 Bacteria 3069
1348 Ga0496121_0068003 3300048924 Bacteria 2884
1349 Ga0496121_0240431 3300048924 Bacteria 1262
1350 Ga0496121_0276243 3300048924 Bacteria 1152
1351 Ga0496121_0386034 3300048924 Bacteria 922
1352 Ga0496121_0494961 3300048924 Bacteria 777
1353 Ga0496122_0075294 3300048925 Bacteria 2382
1354 Ga0496122_0573552 3300048925 Bacteria 533
1355 Ga0496123_0089507 3300048926 Bacteria 1833
1356 Ga0496123_0270332 3300048926 Bacteria 827
1357 Ga0496124_0105179 3300048927 Bacteria 2281
1358 Ga0496124_0260208 3300048927 Bacteria 1277
1359 Ga0496124_0330108 3300048927 Bacteria 1088
1360 Ga0496124_0398566 3300048927 Bacteria 956
1361 Ga0496124_0722749 3300048927 Bacteria 628
1362 Ga0496125_0023958 3300048928 Bacteria 5624
1363 Ga0496125_0215167 3300048928 Bacteria 1244
1364 Ga0496125_0490000 3300048928 Bacteria 694
1365 Ga0496125_0539463 3300048928 Bacteria 648
1366 Ga0496125_0742785 3300048928 Bacteria 515
1367 Ga0496126_0001612 3300048929 Bacteria 34184
1368 Ga0496126_0010859 3300048929 Bacteria 9493
1369 Ga0496126_0045532 3300048929 Bacteria 4031
1370 Ga0496126_0214192 3300048929 Bacteria 1620
1371 Ga0496126_0316703 3300048929 Bacteria 1283
1372 Ga0496126_0381422 3300048929 Bacteria 1147
1373 Ga0496126_1102541 3300048929 Bacteria 589
1374 Ga0496126_1183727 3300048929 Bacteria 563
1375 Ga0495678_136639 3300049459 Bacteria 807
1376 Ga0495682_0055317 3300049460 Bacteria 1439
1377 Ga0495682_0078241 3300049460 Bacteria 1190
1378 Ga0495682_0164353 3300049460 Bacteria 790
1379 Ga0501031_0002596 3300049568 Bacteria 11509
1380 Ga0501032_0000366 3300049569 Bacteria 37562
1381 Ga0501033_0012013 3300049570 Bacteria 6614
1382 Ga0501034_0000332 3300049571 Bacteria 82900
1383 Ga0501036_0000220 3300049572 Bacteria 38322
1384 Ga0501036_0257814 3300049572 Bacteria 1461
1385 Ga0501036_0825729 3300049572 Bacteria 763
1386 Ga0501037_0000054 3300049573 Bacteria 109898
1387 Ga0501037_0340439 3300049573 Bacteria 1036
1388 Ga0501038_0009813 3300049574 Bacteria 8766
1389 Ga0501038_0076510 3300049574 Bacteria 2827
1390 Ga0501038_1204814 3300049574 Bacteria 550
1391 Ga0501039_0016571 3300049575 Bacteria 5644
1392 Ga0501040_0154974 3300049576 Bacteria 1618
1393 Ga0501041_0666616 3300049577 Bacteria 665
1394 Ga0501042_0075958 3300049578 Bacteria 2404
1395 Ga0501042_0120612 3300049578 Bacteria 1888
1396 Ga0501043_0000338 3300049579 Bacteria 42452
1397 Ga0501046_0000087 3300049580 Bacteria 99252
1398 Ga0501047_0001092 3300049581 Bacteria 27014
1399 Ga0501048_0001217 3300049582 Bacteria 19492
1400 Ga0501048_0201835 3300049582 Bacteria 1410
1401 Ga0501067_0001618 3300049583 Bacteria 12343
1402 Ga0501068_0000069 3300049584 Bacteria 40615
1403 Ga0501069_0352058 3300049585 Bacteria 868
1404 Ga0501070_0032173 3300049586 Bacteria 4390
1405 Ga0501070_0319870 3300049586 Bacteria 1262
1406 Ga0501071_0046123 3300049587 Bacteria 3130
1407 Ga0501071_0434237 3300049587 Bacteria 1004
1408 Ga0501072_0010024 3300049588 Bacteria 7207
1409 Ga0501073_0000112 3300049589 Bacteria 52280
1410 Ga0501074_0000225 3300049590 Bacteria 31306
1411 Ga0501076_1683090 3300049592 Bacteria 520
1412 Ga0501079_0001029 3300049741 Bacteria 19331
1413 Ga0501079_0148761 3300049741 Bacteria 1826
1414 Ga0501080_0001351 3300049742 Bacteria 20483
1415 Ga0501080_1124482 3300049742 Bacteria 677
1416 Ga0501081_0646690 3300049743 Bacteria 793
1417 Ga0501083_0008891 3300049744 Bacteria 7093
1418 Ga0501264_023375 3300049761 Bacteria 670
1419 Ga0501035_0001855 3300049822 Bacteria 21278
1420 Ga0501035_1061921 3300049822 Bacteria 634
1421 Ga0501044_0000163 3300049823 Bacteria 82581
1422 Ga0501044_0887203 3300049823 Bacteria 767
1423 Ga0501044_0976201 3300049823 Bacteria 720
1424 Ga0501045_0005738 3300049824 Bacteria 8597
1425 Ga0501045_0879210 3300049824 Bacteria 659
1426 nmdc:mga03683_181702_c1 3300050489 Bacteria 960
1427 nmdc:mga03683_391022_c1 3300050489 Bacteria 663
1428 nmdc:mga03683_452661_c1 3300050489 Bacteria 618
1429 nmdc:mga03683_514888_c1 3300050489 Bacteria 580
1430 nmdc:mga03n38_10398_c1 3300050490 Bacteria 3420
1431 nmdc:mga03n38_117725_c1 3300050490 Bacteria 1302
1432 nmdc:mga03n38_207573_c1 3300050490 Bacteria 1017
1433 nmdc:mga00v17_25695_c1 3300050491 Bacteria 3425
1434 nmdc:mga00v17_336897_c1 3300050491 Bacteria 981
1435 nmdc:mga00v17_544419_c1 3300050491 Bacteria 751
1436 nmdc:mga00v17_92435_c1 3300050491 Bacteria 1902
1437 nmdc:mga0yw44_1183844_c1 3300050492 Bacteria 516
1438 nmdc:mga0yw44_140348_c1 3300050492 Bacteria 1570
1439 nmdc:mga0yw44_26922_c1 3300050492 Bacteria 3289
1440 nmdc:mga0yw44_765421_c1 3300050492 Bacteria 656
1441 nmdc:mga0yw44_915226_c1 3300050492 Bacteria 595
1442 nmdc:mga0k408_186686_c1 3300050493 Bacteria 1237
1443 nmdc:mga0k408_214824_c1 3300050493 Bacteria 717
1444 nmdc:mga0k408_440120_c1 3300050493 Bacteria 774
1445 nmdc:mga0k408_486440_c1 3300050493 Bacteria 732
1446 nmdc:mga0k408_769293_c1 3300050493 Bacteria 562
1447 nmdc:mga06z11_276119_c1 3300050494 Bacteria 995
1448 nmdc:mga06z11_434920_c1 3300050494 Bacteria 792
1449 nmdc:mga06z11_523537_c1 3300050494 Bacteria 719
1450 nmdc:mga06z11_554276_c1 3300050494 Bacteria 698
1451 nmdc:mga04h51_128210_c1 3300050495 Bacteria 952
1452 nmdc:mga04h51_266893_c1 3300050495 Bacteria 690
1453 nmdc:mga07m45_384351_c1 3300050496 Bacteria 815
1454 nmdc:mga07m45_58342_c1 3300050496 Bacteria 2184
1455 nmdc:mga05p37_173532_c1 3300050507 Bacteria 2628
1456 nmdc:mga09592_185406_c1 3300050508 Bacteria 1800
1457 nmdc:mga0qj67_876932_c1 3300050509 Bacteria 708
1458 nmdc:mga06r32_509030_c1 3300050510 Bacteria 1180
1459 nmdc:mga08y16_283079_c1 3300050511 Bacteria 1710
1460 nmdc:mga08y16_493333_c1 3300050511 Bacteria 1245
1461 nmdc:mga08y16_883096_c1 3300050511 Bacteria 881
1462 nmdc:mga0n895_1101968_c1 3300050512 Bacteria 771
1463 nmdc:mga0n895_271163_c1 3300050512 Bacteria 1721
1464 nmdc:mga0n895_551657_c1 3300050512 Bacteria 1158
1465 nmdc:mga0n895_573543_c1 3300050512 Bacteria 1133
1466 nmdc:mga0rr50_237140_c1 3300050513 Bacteria 1511
1467 nmdc:mga0rr50_36950_c1 3300050513 Bacteria 3521
1468 nmdc:mga0rr50_409196_c1 3300050513 Bacteria 1147
1469 nmdc:mga08x19_133398_c1 3300050514 Bacteria 1672
1470 nmdc:mga0a205_252505_c1 3300050515 Bacteria 1642
1471 nmdc:mga0a205_596368_c1 3300050515 Bacteria 958
1472 nmdc:mga0sz30_191930_c1 3300050516 Bacteria 548
1473 nmdc:mga0sz30_209315_c1 3300050516 Bacteria 866
1474 nmdc:mga0sz30_24939_c1 3300050516 Bacteria 2444
1475 nmdc:mga0sz30_550891_c1 3300050516 Bacteria 520
1476 nmdc:mga0sz30_586922_c1 3300050516 Bacteria 504
1477 nmdc:mga0sz30_8011_c3 3300050516 Bacteria 1180
1478 Ga0495601_0518683 3300053077 Bacteria 768
1479 Ga0500610_0132829 3300053079 Bacteria 1264
1480 Ga0500610_0341235 3300053079 Bacteria 639
1481 Ga0495655_0232042 3300053083 Bacteria 615
1482 Ga0495595_0046016 3300053084 Bacteria 2008
1483 Ga0495619_0018611 3300053085 Bacteria 4408
1484 Ga0495619_0243635 3300053085 Bacteria 1246
1485 Ga0495619_0569325 3300053085 Bacteria 776
1486 Ga0495619_0651863 3300053085 Bacteria 718
1487 Ga0500644_0476671 3300053088 Bacteria 548
1488 Ga0500581_301251 3300053089 Bacteria 638
1489 Ga0500646_0290787 3300053090 Bacteria 584
1490 Ga0500651_0005851 3300053093 Bacteria 7048
1491 Ga0500651_0086963 3300053093 Bacteria 1930
1492 Ga0500651_0094249 3300053093 Bacteria 1841
1493 Ga0500651_0600647 3300053093 Bacteria 597
1494 Ga0500566_0001887 3300053094 Bacteria 12333
1495 Ga0500566_0041032 3300053094 Bacteria 2674
1496 Ga0500566_0413794 3300053094 Bacteria 600
1497 Ga0500641_0005771 3300053096 Bacteria 4386
1498 Ga0500641_0009492 3300053096 Bacteria 3501
1499 Ga0500650_0166342 3300053098 Bacteria 1015
1500 Ga0500554_001030 3300053102 Bacteria 5414
1501 Ga0500554_023572 3300053102 Bacteria 1733
1502 Ga0500555_041975 3300053103 Bacteria 1272
1503 Ga0500555_134239 3300053103 Bacteria 613
1504 Ga0500556_0151586 3300053104 Bacteria 914
1505 Ga0500557_074278 3300053105 Bacteria 1118
1506 Ga0500562_059119 3300053108 Bacteria 1029
1507 Ga0500562_132140 3300053108 Bacteria 680
1508 Ga0500569_008708 3300053109 Bacteria 2332
1509 Ga0500594_0047027 3300053118 Bacteria 1202
1510 Ga0500595_001597 3300053119 Bacteria 11940
1511 Ga0500595_004850 3300053119 Bacteria 5951
1512 Ga0500595_005773 3300053119 Bacteria 5350
1513 Ga0500595_007229 3300053119 Bacteria 4620
1514 Ga0500595_007341 3300053119 Bacteria 4577
1515 Ga0500595_207828 3300053119 Bacteria 539
1516 Ga0500607_223857 3300053121 Bacteria 780
1517 Ga0500608_069719 3300053122 Bacteria 1672
1518 Ga0500614_248254 3300053123 Bacteria 555
1519 Ga0500617_099031 3300053124 Bacteria 1235
1520 Ga0500618_011413 3300053125 Bacteria 2355
1521 Ga0500618_022971 3300053125 Bacteria 1513
1522 Ga0500621_114244 3300053126 Bacteria 1052
1523 Ga0500628_232751 3300053129 Bacteria 539
1524 Ga0500642_0004029 3300053130 Bacteria 4539
1525 Ga0500658_0154941 3300053134 Bacteria 1034
1526 Ga0500658_0210695 3300053134 Bacteria 890
1527 Ga0500559_0006649 3300053136 Bacteria 5199
1528 Ga0500559_0123354 3300053136 Bacteria 1206
1529 Ga0500559_0532833 3300053136 Bacteria 537
1530 Ga0500564_195924 3300053138 Bacteria 833
1531 Ga0500568_0009828 3300053139 Bacteria 4520
1532 Ga0500568_0129492 3300053139 Bacteria 939
1533 Ga0500568_0134511 3300053139 Bacteria 918
1534 Ga0500588_0402930 3300053146 Bacteria 521
1535 Ga0500589_110958 3300053147 Bacteria 1176
1536 Ga0500590_044396 3300053148 Bacteria 2277
1537 Ga0500590_193219 3300053148 Bacteria 870
1538 Ga0500603_023551 3300053150 Bacteria 1533
1539 Ga0500604_0027551 3300053151 Bacteria 1645
1540 Ga0500604_0208423 3300053151 Bacteria 673
1541 Ga0500604_0252923 3300053151 Bacteria 610
1542 Ga0500616_0000048 3300053153 Bacteria 313108
1543 Ga0500620_263973 3300053155 Bacteria 569
1544 Ga0500622_0029920 3300053156 Bacteria 2861
1545 Ga0500624_037974 3300053157 Bacteria 855
1546 Ga0500627_0046736 3300053158 Bacteria 1877
1547 Ga0500627_0209728 3300053158 Bacteria 871
1548 Ga0500627_0385664 3300053158 Bacteria 599
1549 Ga0500634_0026820 3300053161 Bacteria 3138
1550 Ga0500634_0265218 3300053161 Bacteria 703
1551 Ga0500638_001878 3300053162 Bacteria 6970
1552 Ga0500636_0060938 3300053177 Bacteria 2202
1553 Ga0500637_0000070 3300053178 Bacteria 36880
1554 Ga0500637_0089959 3300053178 Bacteria 1777
1555 Ga0500637_0341081 3300053178 Bacteria 801
1556 Ga0500611_232873 3300053727 Bacteria 528
1557 Ga0500645_025383 3300053730 Bacteria 1808
1558 Ga0500645_075112 3300053730 Bacteria 967
1559 Ga0500609_006035 3300053731 Bacteria 1651
1560 Ga0500609_008522 3300053731 Bacteria 1384
1561 Ga0500656_034105 3300053732 Bacteria 690
1562 Ga0500596_062023 3300053735 Bacteria 627
1563 Ga0500587_059540 3300053739 Bacteria 582
1564 Ga0501084_0033981 3300054114 Bacteria 4264
1565 Ga0500661_000547 3300055283 Bacteria 7008
1566 Ga0501082_0059225 3300060353 Bacteria 3300
1567 Ga0501082_0242365 3300060353 Bacteria 1569
1568 Ga0501082_0852811 3300060353 Bacteria 797
1569 Ga0501082_1165193 3300060353 Bacteria 674
1570 Ga0530510_0395187 3300061734 Bacteria 1042

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_11451828 Ga0207650_114518281 71
2 iso_pu_bacteria 2857509624 2857511024 80
3 3300047320 Ga0495672_0189303 Ga0495672_0189303_640_903 81
4 3300014968 Ga0157379_10188163 Ga0157379_101881633 83
5 3300031730 Ga0307516_10426764 Ga0307516_104267642 83
6 3300047320 Ga0495672_0011028 Ga0495672_0011028_4237_4545 83
7 iso_pu_bacteria 2513237095 2513651586 83
8 iso_pu_bacteria 2513237098 2513677758 83
9 iso_pu_bacteria 2524023210 2524467743 83
10 iso_pu_bacteria 2816332527 2818243273 83
11 iso_pu_bacteria 2874620515 2874625825 83
12 iso_pu_bacteria 2885383462 2885390480 83
13 iso_pu_bacteria 2885409591 2885410101 83
14 iso_pu_bacteria 2888378607 2888385990 83
15 iso_pu_bacteria 2904666416 2904673814 83
16 iso_pu_bacteria 8006926726 8006931429 83
17 iso_pu_bacteria 8006984368 8006985238 83
18 iso_pu_bacteria 8056681323 8056682178 83
19 3300044683 Ga0466965_0089255 Ga0466965_0089255_205_459 84
20 3300044901 Ga0466960_0049939 Ga0466960_0049939_175_429 84
21 3300005356 Ga0070674_101756639 Ga0070674_1017566391 85
22 3300025931 Ga0207644_11263062 Ga0207644_112630622 85
23 3300028379 Ga0268266_11720137 Ga0268266_117201372 85
24 3300028786 Ga0307517_10000512 Ga0307517_1000051212 85
25 3300031456 Ga0307513_10111079 Ga0307513_101110792 85
26 3300049460 Ga0495682_0078241 Ga0495682_0078241_562_855 85
27 3300053727 Ga0500611_232873 Ga0500611_232873_16_309 85
28 3300006038 Ga0075365_10124785 Ga0075365_101247853 86
29 3300006051 Ga0075364_10835643 Ga0075364_108356432 86
30 3300010159 Ga0099796_10286710 Ga0099796_102867102 86
31 3300011119 Ga0105246_11236924 Ga0105246_112369242 86
32 3300053079 Ga0500610_0132829 Ga0500610_0132829_296_574 86
33 3300001990 JGI24737J22298_10205595 JGI24737J22298_102055951 87
34 3300002073 JGI24745J21846_1027480 JGI24745J21846_10274802 87
35 3300003203 JGI25406J46586_10107804 JGI25406J46586_101078042 87
36 3300003215 JGI25153J46596_10003847 JGI25153J46596_100038477 87
37 3300003215 JGI25153J46596_10068119 JGI25153J46596_100681191 87
38 3300003659 JGI25404J52841_10018446 JGI25404J52841_100184462 87
39 3300003659 JGI25404J52841_10030139 JGI25404J52841_100301392 87
40 3300003659 JGI25404J52841_10039869 JGI25404J52841_100398692 87
41 3300003659 JGI25404J52841_10068574 JGI25404J52841_100685742 87
42 3300003659 JGI25404J52841_10125444 JGI25404J52841_101254442 87
43 3300003911 JGI25405J52794_10072855 JGI25405J52794_100728552 87
44 3300005289 Ga0065704_10605390 Ga0065704_106053901 87
45 3300005295 Ga0065707_10447293 Ga0065707_104472932 87
46 3300005327 Ga0070658_10261559 Ga0070658_102615593 87
47 3300005327 Ga0070658_11277660 Ga0070658_112776602 87
48 3300005328 Ga0070676_10148408 Ga0070676_101484083 87
49 3300005329 Ga0070683_100053571 Ga0070683_1000535715 87
50 3300005329 Ga0070683_100266643 Ga0070683_1002666432 87
51 3300005329 Ga0070683_102335598 Ga0070683_1023355982 87
52 3300005330 Ga0070690_100311964 Ga0070690_1003119643 87
53 3300005330 Ga0070690_100938820 Ga0070690_1009388202 87
54 3300005330 Ga0070690_100950632 Ga0070690_1009506322 87
55 3300005331 Ga0070670_100350636 Ga0070670_1003506362 87
56 3300005331 Ga0070670_100495527 Ga0070670_1004955272 87
57 3300005331 Ga0070670_101188000 Ga0070670_1011880002 87
58 3300005331 Ga0070670_101586518 Ga0070670_1015865181 87
59 3300005334 Ga0068869_100019814 Ga0068869_1000198143 87
60 3300005334 Ga0068869_100019846 Ga0068869_1000198464 87
61 3300005334 Ga0068869_100127193 Ga0068869_1001271932 87
62 3300005334 Ga0068869_100883413 Ga0068869_1008834132 87
63 3300005335 Ga0070666_10262098 Ga0070666_102620982 87
64 3300005335 Ga0070666_11262394 Ga0070666_112623942 87
65 3300005336 Ga0070680_100028269 Ga0070680_1000282695 87
66 3300005336 Ga0070680_101310583 Ga0070680_1013105832 87
67 3300005337 Ga0070682_100133669 Ga0070682_1001336692 87
68 3300005337 Ga0070682_100600642 Ga0070682_1006006422 87
69 3300005337 Ga0070682_100658425 Ga0070682_1006584252 87
70 3300005337 Ga0070682_100814938 Ga0070682_1008149382 87
71 3300005337 Ga0070682_101224187 Ga0070682_1012241871 87
72 3300005338 Ga0068868_100136290 Ga0068868_1001362902 87
73 3300005338 Ga0068868_100185125 Ga0068868_1001851252 87
74 3300005338 Ga0068868_100213239 Ga0068868_1002132392 87
75 3300005338 Ga0068868_100444549 Ga0068868_1004445492 87
76 3300005338 Ga0068868_101578539 Ga0068868_1015785391 87
77 3300005338 Ga0068868_101792061 Ga0068868_1017920612 87
78 3300005339 Ga0070660_100020056 Ga0070660_1000200565 87
79 3300005339 Ga0070660_100235393 Ga0070660_1002353931 87
80 3300005339 Ga0070660_100341725 Ga0070660_1003417252 87
81 3300005339 Ga0070660_100882055 Ga0070660_1008820552 87
82 3300005339 Ga0070660_101881055 Ga0070660_1018810552 87
83 3300005340 Ga0070689_100405166 Ga0070689_1004051662 87
84 3300005340 Ga0070689_100984317 Ga0070689_1009843172 87
85 3300005343 Ga0070687_100469753 Ga0070687_1004697532 87
86 3300005344 Ga0070661_100036019 Ga0070661_1000360195 87
87 3300005344 Ga0070661_100047483 Ga0070661_1000474832 87
88 3300005344 Ga0070661_100163527 Ga0070661_1001635271 87
89 3300005344 Ga0070661_101251471 Ga0070661_1012514711 87
90 3300005345 Ga0070692_10210110 Ga0070692_102101102 87
91 3300005345 Ga0070692_10240069 Ga0070692_102400692 87
92 3300005345 Ga0070692_10347373 Ga0070692_103473732 87
93 3300005347 Ga0070668_100043454 Ga0070668_1000434542 87
94 3300005347 Ga0070668_100103253 Ga0070668_1001032533 87
95 3300005347 Ga0070668_100315141 Ga0070668_1003151412 87
96 3300005347 Ga0070668_100962763 Ga0070668_1009627632 87
97 3300005347 Ga0070668_101278275 Ga0070668_1012782752 87
98 3300005347 Ga0070668_101663508 Ga0070668_1016635081 87
99 3300005347 Ga0070668_101857124 Ga0070668_1018571242 87
100 3300005347 Ga0070668_101976846 Ga0070668_1019768461 87
101 3300005353 Ga0070669_100190223 Ga0070669_1001902233 87
102 3300005353 Ga0070669_100212280 Ga0070669_1002122802 87
103 3300005353 Ga0070669_100839004 Ga0070669_1008390042 87
104 3300005354 Ga0070675_100269912 Ga0070675_1002699122 87
105 3300005354 Ga0070675_100494463 Ga0070675_1004944632 87
106 3300005354 Ga0070675_101253201 Ga0070675_1012532011 87
107 3300005354 Ga0070675_102188006 Ga0070675_1021880061 87
108 3300005355 Ga0070671_100073612 Ga0070671_1000736122 87
109 3300005355 Ga0070671_100114304 Ga0070671_1001143043 87
110 3300005355 Ga0070671_100239137 Ga0070671_1002391371 87
111 3300005355 Ga0070671_100677317 Ga0070671_1006773172 87
112 3300005355 Ga0070671_101637850 Ga0070671_1016378502 87
113 3300005356 Ga0070674_100132453 Ga0070674_1001324533 87
114 3300005356 Ga0070674_100216183 Ga0070674_1002161832 87
115 3300005356 Ga0070674_100780267 Ga0070674_1007802672 87
116 3300005356 Ga0070674_101429133 Ga0070674_1014291332 87
117 3300005356 Ga0070674_102183475 Ga0070674_1021834752 87
118 3300005364 Ga0070673_100624088 Ga0070673_1006240881 87
119 3300005364 Ga0070673_100716569 Ga0070673_1007165692 87
120 3300005364 Ga0070673_101899444 Ga0070673_1018994442 87
121 3300005365 Ga0070688_100131032 Ga0070688_1001310322 87
122 3300005365 Ga0070688_100307998 Ga0070688_1003079982 87
123 3300005365 Ga0070688_100715514 Ga0070688_1007155142 87
124 3300005365 Ga0070688_100796424 Ga0070688_1007964242 87
125 3300005366 Ga0070659_100059727 Ga0070659_1000597274 87
126 3300005366 Ga0070659_100061696 Ga0070659_1000616963 87
127 3300005366 Ga0070659_100066163 Ga0070659_1000661632 87
128 3300005366 Ga0070659_101210558 Ga0070659_1012105581 87
129 3300005366 Ga0070659_101469764 Ga0070659_1014697642 87
130 3300005366 Ga0070659_101851122 Ga0070659_1018511221 87
131 3300005367 Ga0070667_100170258 Ga0070667_1001702582 87
132 3300005367 Ga0070667_100488615 Ga0070667_1004886151 87
133 3300005367 Ga0070667_101018872 Ga0070667_1010188722 87
134 3300005367 Ga0070667_102300539 Ga0070667_1023005391 87
135 3300005434 Ga0070709_10000738 Ga0070709_1000073816 87
136 3300005434 Ga0070709_10069632 Ga0070709_100696322 87
137 3300005434 Ga0070709_11390431 Ga0070709_113904311 87
138 3300005435 Ga0070714_100004168 Ga0070714_10000416810 87
139 3300005435 Ga0070714_100148142 Ga0070714_1001481422 87
140 3300005435 Ga0070714_100623515 Ga0070714_1006235152 87
141 3300005435 Ga0070714_100746811 Ga0070714_1007468112 87
142 3300005436 Ga0070713_100099673 Ga0070713_1000996734 87
143 3300005437 Ga0070710_10000243 Ga0070710_100002433 87
144 3300005437 Ga0070710_10025706 Ga0070710_100257062 87
145 3300005437 Ga0070710_10367761 Ga0070710_103677612 87
146 3300005438 Ga0070701_10166754 Ga0070701_101667542 87
147 3300005438 Ga0070701_10397247 Ga0070701_103972472 87
148 3300005439 Ga0070711_100004522 Ga0070711_1000045226 87
149 3300005439 Ga0070711_100025421 Ga0070711_1000254214 87
150 3300005439 Ga0070711_100203421 Ga0070711_1002034212 87
151 3300005439 Ga0070711_100220188 Ga0070711_1002201882 87
152 3300005439 Ga0070711_101259798 Ga0070711_1012597981 87
153 3300005440 Ga0070705_101370232 Ga0070705_1013702321 87
154 3300005441 Ga0070700_100226646 Ga0070700_1002266462 87
155 3300005441 Ga0070700_100961538 Ga0070700_1009615382 87
156 3300005441 Ga0070700_100983145 Ga0070700_1009831452 87
157 3300005444 Ga0070694_100709075 Ga0070694_1007090752 87
158 3300005445 Ga0070708_100198307 Ga0070708_1001983073 87
159 3300005445 Ga0070708_101471534 Ga0070708_1014715342 87
160 3300005445 Ga0070708_102005890 Ga0070708_1020058902 87
161 3300005455 Ga0070663_100012871 Ga0070663_1000128716 87
162 3300005455 Ga0070663_100029413 Ga0070663_1000294134 87
163 3300005455 Ga0070663_100170347 Ga0070663_1001703472 87
164 3300005455 Ga0070663_100256472 Ga0070663_1002564722 87
165 3300005455 Ga0070663_100395590 Ga0070663_1003955901 87
166 3300005455 Ga0070663_100789495 Ga0070663_1007894952 87
167 3300005455 Ga0070663_101900812 Ga0070663_1019008122 87
168 3300005455 Ga0070663_101996951 Ga0070663_1019969512 87
169 3300005456 Ga0070678_100072887 Ga0070678_1000728872 87
170 3300005456 Ga0070678_100093939 Ga0070678_1000939394 87
171 3300005456 Ga0070678_100154468 Ga0070678_1001544683 87
172 3300005456 Ga0070678_100216802 Ga0070678_1002168022 87
173 3300005456 Ga0070678_100871068 Ga0070678_1008710682 87
174 3300005456 Ga0070678_100905598 Ga0070678_1009055982 87
175 3300005456 Ga0070678_101206927 Ga0070678_1012069272 87
176 3300005457 Ga0070662_100110263 Ga0070662_1001102633 87
177 3300005457 Ga0070662_100112882 Ga0070662_1001128822 87
178 3300005457 Ga0070662_100609893 Ga0070662_1006098931 87
179 3300005458 Ga0070681_10010419 Ga0070681_100104194 87
180 3300005458 Ga0070681_10083698 Ga0070681_100836985 87
181 3300005458 Ga0070681_10108404 Ga0070681_101084044 87
182 3300005458 Ga0070681_10320559 Ga0070681_103205591 87
183 3300005459 Ga0068867_100071550 Ga0068867_1000715502 87
184 3300005459 Ga0068867_101612941 Ga0068867_1016129411 87
185 3300005466 Ga0070685_10293827 Ga0070685_102938272 87
186 3300005466 Ga0070685_10381161 Ga0070685_103811612 87
187 3300005467 Ga0070706_100172423 Ga0070706_1001724234 87
188 3300005467 Ga0070706_100559225 Ga0070706_1005592252 87
189 3300005468 Ga0070707_100150437 Ga0070707_1001504372 87
190 3300005471 Ga0070698_100104049 Ga0070698_1001040493 87
191 3300005471 Ga0070698_102133458 Ga0070698_1021334581 87
192 3300005518 Ga0070699_100449354 Ga0070699_1004493543 87
193 3300005518 Ga0070699_100450502 Ga0070699_1004505022 87
194 3300005518 Ga0070699_102015429 Ga0070699_1020154291 87
195 3300005518 Ga0070699_102172961 Ga0070699_1021729612 87
196 3300005530 Ga0070679_100085416 Ga0070679_1000854165 87
197 3300005530 Ga0070679_100232113 Ga0070679_1002321132 87
198 3300005530 Ga0070679_101691117 Ga0070679_1016911172 87
199 3300005535 Ga0070684_100201779 Ga0070684_1002017792 87
200 3300005535 Ga0070684_101281093 Ga0070684_1012810932 87
201 3300005535 Ga0070684_101343586 Ga0070684_1013435862 87
202 3300005536 Ga0070697_100602487 Ga0070697_1006024872 87
203 3300005536 Ga0070697_101776763 Ga0070697_1017767632 87
204 3300005539 Ga0068853_100015280 Ga0068853_1000152806 87
205 3300005539 Ga0068853_100033910 Ga0068853_1000339102 87
206 3300005539 Ga0068853_100084137 Ga0068853_1000841374 87
207 3300005539 Ga0068853_100210141 Ga0068853_1002101412 87
208 3300005539 Ga0068853_100324077 Ga0068853_1003240773 87
209 3300005543 Ga0070672_100498210 Ga0070672_1004982102 87
210 3300005543 Ga0070672_100518968 Ga0070672_1005189681 87
211 3300005543 Ga0070672_100578663 Ga0070672_1005786632 87
212 3300005543 Ga0070672_101233308 Ga0070672_1012333082 87
213 3300005544 Ga0070686_100405751 Ga0070686_1004057512 87
214 3300005546 Ga0070696_100078710 Ga0070696_1000787102 87
215 3300005546 Ga0070696_101281348 Ga0070696_1012813482 87
216 3300005546 Ga0070696_101630965 Ga0070696_1016309651 87
217 3300005547 Ga0070693_100271740 Ga0070693_1002717402 87
218 3300005547 Ga0070693_100499388 Ga0070693_1004993882 87
219 3300005547 Ga0070693_100603747 Ga0070693_1006037472 87
220 3300005547 Ga0070693_101100475 Ga0070693_1011004751 87
221 3300005548 Ga0070665_100068671 Ga0070665_1000686713 87
222 3300005548 Ga0070665_100081195 Ga0070665_1000811953 87
223 3300005548 Ga0070665_100207013 Ga0070665_1002070132 87
224 3300005548 Ga0070665_100318838 Ga0070665_1003188382 87
225 3300005548 Ga0070665_100340521 Ga0070665_1003405212 87
226 3300005548 Ga0070665_100342582 Ga0070665_1003425822 87
227 3300005548 Ga0070665_100402619 Ga0070665_1004026192 87
228 3300005548 Ga0070665_100724452 Ga0070665_1007244522 87
229 3300005548 Ga0070665_101391739 Ga0070665_1013917392 87
230 3300005548 Ga0070665_101678039 Ga0070665_1016780392 87
231 3300005549 Ga0070704_100846643 Ga0070704_1008466432 87
232 3300005549 Ga0070704_101610763 Ga0070704_1016107632 87
233 3300005549 Ga0070704_101900796 Ga0070704_1019007962 87
234 3300005563 Ga0068855_100068067 Ga0068855_1000680675 87
235 3300005563 Ga0068855_100110876 Ga0068855_1001108762 87
236 3300005563 Ga0068855_100128605 Ga0068855_1001286052 87
237 3300005563 Ga0068855_100454697 Ga0068855_1004546972 87
238 3300005563 Ga0068855_100944459 Ga0068855_1009444592 87
239 3300005563 Ga0068855_101465407 Ga0068855_1014654071 87
240 3300005564 Ga0070664_100624139 Ga0070664_1006241391 87
241 3300005564 Ga0070664_100749075 Ga0070664_1007490752 87
242 3300005564 Ga0070664_100912345 Ga0070664_1009123452 87
243 3300005564 Ga0070664_101199725 Ga0070664_1011997252 87
244 3300005564 Ga0070664_101227131 Ga0070664_1012271312 87
245 3300005564 Ga0070664_101477980 Ga0070664_1014779802 87
246 3300005564 Ga0070664_102180974 Ga0070664_1021809741 87
247 3300005577 Ga0068857_100016254 Ga0068857_1000162543 87
248 3300005577 Ga0068857_100694510 Ga0068857_1006945102 87
249 3300005577 Ga0068857_101188405 Ga0068857_1011884052 87
250 3300005577 Ga0068857_102143772 Ga0068857_1021437722 87
251 3300005578 Ga0068854_100498051 Ga0068854_1004980512 87
252 3300005578 Ga0068854_100653925 Ga0068854_1006539252 87
253 3300005578 Ga0068854_101037497 Ga0068854_1010374972 87
254 3300005578 Ga0068854_101090900 Ga0068854_1010909002 87
255 3300005614 Ga0068856_100514495 Ga0068856_1005144952 87
256 3300005614 Ga0068856_100858959 Ga0068856_1008589592 87
257 3300005614 Ga0068856_100953412 Ga0068856_1009534122 87
258 3300005614 Ga0068856_102125986 Ga0068856_1021259862 87
259 3300005615 Ga0070702_100044253 Ga0070702_1000442532 87
260 3300005615 Ga0070702_100195472 Ga0070702_1001954722 87
261 3300005615 Ga0070702_100239175 Ga0070702_1002391752 87
262 3300005615 Ga0070702_100934605 Ga0070702_1009346052 87
263 3300005616 Ga0068852_100146364 Ga0068852_1001463642 87
264 3300005616 Ga0068852_100427805 Ga0068852_1004278053 87
265 3300005616 Ga0068852_100826010 Ga0068852_1008260102 87
266 3300005616 Ga0068852_100877349 Ga0068852_1008773492 87
267 3300005616 Ga0068852_101238290 Ga0068852_1012382902 87
268 3300005617 Ga0068859_100037821 Ga0068859_1000378215 87
269 3300005617 Ga0068859_100291131 Ga0068859_1002911312 87
270 3300005617 Ga0068859_100300173 Ga0068859_1003001732 87
271 3300005617 Ga0068859_100345487 Ga0068859_1003454872 87
272 3300005617 Ga0068859_101171374 Ga0068859_1011713742 87
273 3300005618 Ga0068864_100011654 Ga0068864_1000116548 87
274 3300005618 Ga0068864_100662703 Ga0068864_1006627032 87
275 3300005618 Ga0068864_100819503 Ga0068864_1008195032 87
276 3300005618 Ga0068864_101171001 Ga0068864_1011710012 87
277 3300005718 Ga0068866_10355946 Ga0068866_103559462 87
278 3300005718 Ga0068866_10427502 Ga0068866_104275022 87
279 3300005718 Ga0068866_11230630 Ga0068866_112306302 87
280 3300005719 Ga0068861_100195174 Ga0068861_1001951742 87
281 3300005719 Ga0068861_100484933 Ga0068861_1004849332 87
282 3300005719 Ga0068861_101402383 Ga0068861_1014023831 87
283 3300005719 Ga0068861_101812227 Ga0068861_1018122272 87
284 3300005719 Ga0068861_102026209 Ga0068861_1020262091 87
285 3300005719 Ga0068861_102585442 Ga0068861_1025854422 87
286 3300005834 Ga0068851_10127945 Ga0068851_101279452 87
287 3300005834 Ga0068851_10169554 Ga0068851_101695542 87
288 3300005834 Ga0068851_10791023 Ga0068851_107910232 87
289 3300005834 Ga0068851_10888245 Ga0068851_108882452 87
290 3300005840 Ga0068870_10037013 Ga0068870_100370134 87
291 3300005840 Ga0068870_10147230 Ga0068870_101472302 87
292 3300005840 Ga0068870_10797623 Ga0068870_107976231 87
293 3300005841 Ga0068863_100150913 Ga0068863_1001509132 87
294 3300005841 Ga0068863_102074763 Ga0068863_1020747632 87
295 3300005841 Ga0068863_102326398 Ga0068863_1023263982 87
296 3300005842 Ga0068858_100030745 Ga0068858_1000307453 87
297 3300005842 Ga0068858_100097777 Ga0068858_1000977774 87
298 3300005842 Ga0068858_100141992 Ga0068858_1001419923 87
299 3300005842 Ga0068858_100889016 Ga0068858_1008890162 87
300 3300005842 Ga0068858_100978978 Ga0068858_1009789782 87
301 3300005842 Ga0068858_101075076 Ga0068858_1010750762 87
302 3300005842 Ga0068858_102341447 Ga0068858_1023414472 87
303 3300005843 Ga0068860_100230767 Ga0068860_1002307672 87
304 3300005843 Ga0068860_100357918 Ga0068860_1003579182 87
305 3300005843 Ga0068860_100422628 Ga0068860_1004226281 87
306 3300005843 Ga0068860_101871924 Ga0068860_1018719242 87
307 3300005844 Ga0068862_100159674 Ga0068862_1001596743 87
308 3300005844 Ga0068862_100269906 Ga0068862_1002699061 87
309 3300005844 Ga0068862_100489604 Ga0068862_1004896042 87
310 3300005844 Ga0068862_100651731 Ga0068862_1006517312 87
311 3300005844 Ga0068862_100974172 Ga0068862_1009741722 87
312 3300005844 Ga0068862_101404197 Ga0068862_1014041971 87
313 3300005844 Ga0068862_102736071 Ga0068862_1027360712 87
314 3300005937 Ga0081455_10001871 Ga0081455_1000187124 87
315 3300005937 Ga0081455_10018136 Ga0081455_100181364 87
316 3300005937 Ga0081455_10042954 Ga0081455_100429544 87
317 3300005937 Ga0081455_10957411 Ga0081455_109574111 87
318 3300005983 Ga0081540_1002386 Ga0081540_10023866 87
319 3300005983 Ga0081540_1003527 Ga0081540_10035277 87
320 3300005983 Ga0081540_1005126 Ga0081540_10051266 87
321 3300005983 Ga0081540_1005516 Ga0081540_10055167 87
322 3300005983 Ga0081540_1007198 Ga0081540_10071989 87
323 3300005983 Ga0081540_1017121 Ga0081540_10171214 87
324 3300005983 Ga0081540_1068601 Ga0081540_10686011 87
325 3300005983 Ga0081540_1199299 Ga0081540_11992992 87
326 3300005983 Ga0081540_1202220 Ga0081540_12022201 87
327 3300005983 Ga0081540_1259790 Ga0081540_12597902 87
328 3300005985 Ga0081539_10000306 Ga0081539_1000030621 87
329 3300005985 Ga0081539_10001290 Ga0081539_1000129026 87
330 3300005985 Ga0081539_10031544 Ga0081539_100315443 87
331 3300005985 Ga0081539_10088992 Ga0081539_100889922 87
332 3300006028 Ga0070717_10037532 Ga0070717_100375325 87
333 3300006038 Ga0075365_10032740 Ga0075365_100327403 87
334 3300006038 Ga0075365_10062453 Ga0075365_100624533 87
335 3300006038 Ga0075365_10113318 Ga0075365_101133183 87
336 3300006038 Ga0075365_10173159 Ga0075365_101731592 87
337 3300006038 Ga0075365_10185873 Ga0075365_101858731 87
338 3300006038 Ga0075365_10217679 Ga0075365_102176792 87
339 3300006038 Ga0075365_10765891 Ga0075365_107658911 87
340 3300006042 Ga0075368_10067956 Ga0075368_100679562 87
341 3300006042 Ga0075368_10080689 Ga0075368_100806892 87
342 3300006042 Ga0075368_10161543 Ga0075368_101615432 87
343 3300006042 Ga0075368_10260974 Ga0075368_102609742 87
344 3300006042 Ga0075368_10432982 Ga0075368_104329822 87
345 3300006048 Ga0075363_100011319 Ga0075363_1000113195 87
346 3300006048 Ga0075363_100052752 Ga0075363_1000527524 87
347 3300006048 Ga0075363_100218221 Ga0075363_1002182212 87
348 3300006048 Ga0075363_100487984 Ga0075363_1004879842 87
349 3300006048 Ga0075363_100554789 Ga0075363_1005547892 87
350 3300006051 Ga0075364_10056473 Ga0075364_100564732 87
351 3300006051 Ga0075364_10068512 Ga0075364_100685123 87
352 3300006051 Ga0075364_10206033 Ga0075364_102060331 87
353 3300006051 Ga0075364_10211166 Ga0075364_102111662 87
354 3300006051 Ga0075364_10257404 Ga0075364_102574042 87
355 3300006051 Ga0075364_10351702 Ga0075364_103517022 87
356 3300006051 Ga0075364_10412319 Ga0075364_104123192 87
357 3300006051 Ga0075364_10758941 Ga0075364_107589411 87
358 3300006051 Ga0075364_11103701 Ga0075364_111037012 87
359 3300006163 Ga0070715_10022420 Ga0070715_100224203 87
360 3300006173 Ga0070716_100272303 Ga0070716_1002723032 87
361 3300006173 Ga0070716_100292218 Ga0070716_1002922183 87
362 3300006173 Ga0070716_100366549 Ga0070716_1003665492 87
363 3300006173 Ga0070716_100394165 Ga0070716_1003941652 87
364 3300006173 Ga0070716_100965457 Ga0070716_1009654572 87
365 3300006175 Ga0070712_100017200 Ga0070712_1000172004 87
366 3300006175 Ga0070712_100073656 Ga0070712_1000736562 87
367 3300006177 Ga0075362_10036145 Ga0075362_100361453 87
368 3300006177 Ga0075362_10065886 Ga0075362_100658862 87
369 3300006177 Ga0075362_10377479 Ga0075362_103774792 87
370 3300006177 Ga0075362_10446003 Ga0075362_104460032 87
371 3300006177 Ga0075362_10621444 Ga0075362_106214442 87
372 3300006177 Ga0075362_10702335 Ga0075362_107023352 87
373 3300006178 Ga0075367_10032570 Ga0075367_100325704 87
374 3300006178 Ga0075367_10090655 Ga0075367_100906553 87
375 3300006178 Ga0075367_10172523 Ga0075367_101725233 87
376 3300006178 Ga0075367_10229550 Ga0075367_102295503 87
377 3300006178 Ga0075367_10687863 Ga0075367_106878631 87
378 3300006178 Ga0075367_10724306 Ga0075367_107243061 87
379 3300006178 Ga0075367_10893074 Ga0075367_108930742 87
380 3300006186 Ga0075369_10015118 Ga0075369_100151182 87
381 3300006186 Ga0075369_10052823 Ga0075369_100528232 87
382 3300006186 Ga0075369_10333072 Ga0075369_103330722 87
383 3300006186 Ga0075369_10475748 Ga0075369_104757482 87
384 3300006186 Ga0075369_10529317 Ga0075369_105293172 87
385 3300006195 Ga0075366_10185662 Ga0075366_101856622 87
386 3300006195 Ga0075366_10187647 Ga0075366_101876472 87
387 3300006195 Ga0075366_10388548 Ga0075366_103885482 87
388 3300006195 Ga0075366_10436295 Ga0075366_104362952 87
389 3300006195 Ga0075366_10437137 Ga0075366_104371372 87
390 3300006195 Ga0075366_10774304 Ga0075366_107743042 87
391 3300006195 Ga0075366_10859853 Ga0075366_108598532 87
392 3300006195 Ga0075366_11014831 Ga0075366_110148312 87
393 3300006237 Ga0097621_100065582 Ga0097621_1000655822 87
394 3300006237 Ga0097621_100203771 Ga0097621_1002037712 87
395 3300006237 Ga0097621_100364443 Ga0097621_1003644432 87
396 3300006353 Ga0075370_10007146 Ga0075370_100071469 87
397 3300006353 Ga0075370_10022166 Ga0075370_100221662 87
398 3300006353 Ga0075370_10130973 Ga0075370_101309732 87
399 3300006353 Ga0075370_10147575 Ga0075370_101475752 87
400 3300006353 Ga0075370_10510377 Ga0075370_105103772 87
401 3300006353 Ga0075370_10771766 Ga0075370_107717661 87
402 3300006353 Ga0075370_10805250 Ga0075370_108052501 87
403 3300006358 Ga0068871_100328919 Ga0068871_1003289191 87
404 3300006358 Ga0068871_100566037 Ga0068871_1005660372 87
405 3300006358 Ga0068871_100655611 Ga0068871_1006556111 87
406 3300006358 Ga0068871_101488103 Ga0068871_1014881032 87
407 3300006358 Ga0068871_101648480 Ga0068871_1016484802 87
408 3300006844 Ga0075428_100299635 Ga0075428_1002996352 87
409 3300006844 Ga0075428_101126202 Ga0075428_1011262022 87
410 3300006846 Ga0075430_100693214 Ga0075430_1006932142 87
411 3300006847 Ga0075431_100495910 Ga0075431_1004959102 87
412 3300006852 Ga0075433_10592735 Ga0075433_105927352 87
413 3300006852 Ga0075433_10808937 Ga0075433_108089372 87
414 3300006871 Ga0075434_100414961 Ga0075434_1004149611 87
415 3300006871 Ga0075434_100520660 Ga0075434_1005206602 87
416 3300006871 Ga0075434_101527222 Ga0075434_1015272221 87
417 3300006880 Ga0075429_100223840 Ga0075429_1002238403 87
418 3300006881 Ga0068865_100162759 Ga0068865_1001627592 87
419 3300006881 Ga0068865_100203997 Ga0068865_1002039972 87
420 3300006881 Ga0068865_100317212 Ga0068865_1003172122 87
421 3300006881 Ga0068865_100459303 Ga0068865_1004593032 87
422 3300006914 Ga0075436_100180150 Ga0075436_1001801502 87
423 3300006931 Ga0097620_100037821 Ga0097620_1000378213 87
424 3300006931 Ga0097620_100291136 Ga0097620_1002911362 87
425 3300006931 Ga0097620_100300187 Ga0097620_1003001872 87
426 3300006931 Ga0097620_100345498 Ga0097620_1003454982 87
427 3300006931 Ga0097620_101171072 Ga0097620_1011710722 87
428 3300007076 Ga0075435_100285486 Ga0075435_1002854861 87
429 3300007076 Ga0075435_100299732 Ga0075435_1002997323 87
430 3300007265 Ga0099794_10001765 Ga0099794_100017655 87
431 3300007265 Ga0099794_10032223 Ga0099794_100322233 87
432 3300007265 Ga0099794_10101959 Ga0099794_101019592 87
433 3300007265 Ga0099794_10525188 Ga0099794_105251882 87
434 3300007788 Ga0099795_10036809 Ga0099795_100368092 87
435 3300007788 Ga0099795_10043623 Ga0099795_100436232 87
436 3300007788 Ga0099795_10073650 Ga0099795_100736502 87
437 3300007788 Ga0099795_10103467 Ga0099795_101034672 87
438 3300007788 Ga0099795_10144387 Ga0099795_101443872 87
439 3300007788 Ga0099795_10501919 Ga0099795_105019192 87
440 3300009011 Ga0105251_10183691 Ga0105251_101836912 87
441 3300009092 Ga0105250_10273571 Ga0105250_102735713 87
442 3300009092 Ga0105250_10317250 Ga0105250_103172502 87
443 3300009092 Ga0105250_10502712 Ga0105250_105027121 87
444 3300009093 Ga0105240_10060156 Ga0105240_100601565 87
445 3300009093 Ga0105240_10122224 Ga0105240_101222244 87
446 3300009093 Ga0105240_10795676 Ga0105240_107956762 87
447 3300009093 Ga0105240_10848848 Ga0105240_108488482 87
448 3300009094 Ga0111539_10068249 Ga0111539_100682494 87
449 3300009094 Ga0111539_11299374 Ga0111539_112993742 87
450 3300009094 Ga0111539_11447415 Ga0111539_114474152 87
451 3300009098 Ga0105245_10029815 Ga0105245_100298155 87
452 3300009098 Ga0105245_10074752 Ga0105245_100747524 87
453 3300009098 Ga0105245_10259257 Ga0105245_102592572 87
454 3300009098 Ga0105245_11346786 Ga0105245_113467862 87
455 3300009098 Ga0105245_11563524 Ga0105245_115635242 87
456 3300009098 Ga0105245_12614055 Ga0105245_126140552 87
457 3300009098 Ga0105245_12902269 Ga0105245_129022692 87
458 3300009098 Ga0105245_13066373 Ga0105245_130663732 87
459 3300009101 Ga0105247_10051977 Ga0105247_100519773 87
460 3300009101 Ga0105247_10070032 Ga0105247_100700323 87
461 3300009101 Ga0105247_10092597 Ga0105247_100925972 87
462 3300009101 Ga0105247_10209169 Ga0105247_102091692 87
463 3300009101 Ga0105247_10513310 Ga0105247_105133101 87
464 3300009101 Ga0105247_10685920 Ga0105247_106859202 87
465 3300009101 Ga0105247_11223007 Ga0105247_112230071 87
466 3300009147 Ga0114129_10474411 Ga0114129_104744112 87
467 3300009147 Ga0114129_12502271 Ga0114129_125022712 87
468 3300009148 Ga0105243_10426116 Ga0105243_104261162 87
469 3300009148 Ga0105243_10619951 Ga0105243_106199512 87
470 3300009148 Ga0105243_11228052 Ga0105243_112280522 87
471 3300009148 Ga0105243_11290920 Ga0105243_112909202 87
472 3300009148 Ga0105243_12254750 Ga0105243_122547502 87
473 3300009174 Ga0105241_10080773 Ga0105241_100807733 87
474 3300009174 Ga0105241_10414871 Ga0105241_104148712 87
475 3300009174 Ga0105241_10962812 Ga0105241_109628122 87
476 3300009174 Ga0105241_11911788 Ga0105241_119117882 87
477 3300009176 Ga0105242_10102527 Ga0105242_101025273 87
478 3300009176 Ga0105242_10486007 Ga0105242_104860072 87
479 3300009176 Ga0105242_10643434 Ga0105242_106434342 87
480 3300009176 Ga0105242_10754010 Ga0105242_107540102 87
481 3300009176 Ga0105242_12668926 Ga0105242_126689261 87
482 3300009177 Ga0105248_10144416 Ga0105248_101444162 87
483 3300009177 Ga0105248_10206120 Ga0105248_102061202 87
484 3300009177 Ga0105248_10510854 Ga0105248_105108543 87
485 3300009177 Ga0105248_11271581 Ga0105248_112715812 87
486 3300009177 Ga0105248_11569109 Ga0105248_115691092 87
487 3300009177 Ga0105248_12566847 Ga0105248_125668472 87
488 3300009177 Ga0105248_12740032 Ga0105248_127400321 87
489 3300009177 Ga0105248_12870798 Ga0105248_128707982 87
490 3300009545 Ga0105237_10047383 Ga0105237_100473832 87
491 3300009545 Ga0105237_10181266 Ga0105237_101812662 87
492 3300009545 Ga0105237_10187692 Ga0105237_101876922 87
493 3300009545 Ga0105237_10318767 Ga0105237_103187672 87
494 3300009545 Ga0105237_10767988 Ga0105237_107679882 87
495 3300009545 Ga0105237_10773148 Ga0105237_107731482 87
496 3300009545 Ga0105237_11226104 Ga0105237_112261042 87
497 3300009545 Ga0105237_12215548 Ga0105237_122155482 87
498 3300009545 Ga0105237_12292351 Ga0105237_122923512 87
499 3300009551 Ga0105238_10074780 Ga0105238_100747803 87
500 3300009551 Ga0105238_10234815 Ga0105238_102348152 87
501 3300009551 Ga0105238_10412465 Ga0105238_104124652 87
502 3300009551 Ga0105238_10480527 Ga0105238_104805272 87
503 3300009551 Ga0105238_10766591 Ga0105238_107665912 87
504 3300009551 Ga0105238_10860955 Ga0105238_108609552 87
505 3300009551 Ga0105238_10895530 Ga0105238_108955302 87
506 3300009551 Ga0105238_11091023 Ga0105238_110910232 87
507 3300009551 Ga0105238_11602692 Ga0105238_116026922 87
508 3300009551 Ga0105238_11723574 Ga0105238_117235742 87
509 3300009551 Ga0105238_12278024 Ga0105238_122780242 87
510 3300009553 Ga0105249_10248901 Ga0105249_102489011 87
511 3300009553 Ga0105249_11457243 Ga0105249_114572432 87
512 3300009553 Ga0105249_11960893 Ga0105249_119608932 87
513 3300009553 Ga0105249_12216738 Ga0105249_122167382 87
514 3300009553 Ga0105249_12374849 Ga0105249_123748492 87
515 3300010159 Ga0099796_10028563 Ga0099796_100285631 87
516 3300010159 Ga0099796_10093614 Ga0099796_100936142 87
517 3300010159 Ga0099796_10156471 Ga0099796_101564711 87
518 3300010159 Ga0099796_10226926 Ga0099796_102269262 87
519 3300010375 Ga0105239_10058721 Ga0105239_100587213 87
520 3300010375 Ga0105239_10102973 Ga0105239_101029734 87
521 3300010375 Ga0105239_10132578 Ga0105239_101325783 87
522 3300010375 Ga0105239_10170028 Ga0105239_101700282 87
523 3300010375 Ga0105239_10220946 Ga0105239_102209463 87
524 3300010375 Ga0105239_10228578 Ga0105239_102285782 87
525 3300010375 Ga0105239_10474514 Ga0105239_104745142 87
526 3300010375 Ga0105239_11020845 Ga0105239_110208452 87
527 3300010375 Ga0105239_11521172 Ga0105239_115211721 87
528 3300010375 Ga0105239_12942189 Ga0105239_129421892 87
529 3300011119 Ga0105246_10029465 Ga0105246_100294654 87
530 3300011119 Ga0105246_10317841 Ga0105246_103178413 87
531 3300011119 Ga0105246_10502989 Ga0105246_105029891 87
532 3300011119 Ga0105246_10538014 Ga0105246_105380142 87
533 3300011119 Ga0105246_11124206 Ga0105246_111242062 87
534 3300011119 Ga0105246_11148669 Ga0105246_111486692 87
535 3300011119 Ga0105246_11355813 Ga0105246_113558132 87
536 3300011119 Ga0105246_11501298 Ga0105246_115012981 87
537 3300011119 Ga0105246_11528246 Ga0105246_115282462 87
538 3300011119 Ga0105246_11575932 Ga0105246_115759322 87
539 3300012492 Ga0157335_1017748 Ga0157335_10177481 87
540 3300012505 Ga0157339_1037616 Ga0157339_10376161 87
541 3300012508 Ga0157315_1017459 Ga0157315_10174592 87
542 3300012512 Ga0157327_1084482 Ga0157327_10844822 87
543 3300012513 Ga0157326_1065639 Ga0157326_10656392 87
544 3300013102 Ga0157371_10045157 Ga0157371_100451572 87
545 3300013104 Ga0157370_10104669 Ga0157370_101046694 87
546 3300013104 Ga0157370_10149340 Ga0157370_101493402 87
547 3300013104 Ga0157370_10198787 Ga0157370_101987872 87
548 3300013104 Ga0157370_11804781 Ga0157370_118047811 87
549 3300013105 Ga0157369_10005277 Ga0157369_100052776 87
550 3300013296 Ga0157374_10003779 Ga0157374_100037797 87
551 3300013296 Ga0157374_10134697 Ga0157374_101346974 87
552 3300013296 Ga0157374_10797578 Ga0157374_107975782 87
553 3300013296 Ga0157374_11044283 Ga0157374_110442831 87
554 3300013296 Ga0157374_12126547 Ga0157374_121265472 87
555 3300013296 Ga0157374_12643460 Ga0157374_126434602 87
556 3300013297 Ga0157378_10020136 Ga0157378_100201365 87
557 3300013297 Ga0157378_10175233 Ga0157378_101752333 87
558 3300013297 Ga0157378_10300535 Ga0157378_103005352 87
559 3300013297 Ga0157378_10308646 Ga0157378_103086463 87
560 3300013297 Ga0157378_10812317 Ga0157378_108123172 87
561 3300013297 Ga0157378_10887956 Ga0157378_108879562 87
562 3300013297 Ga0157378_11025546 Ga0157378_110255462 87
563 3300013297 Ga0157378_11330639 Ga0157378_113306392 87
564 3300013297 Ga0157378_11351106 Ga0157378_113511062 87
565 3300013306 Ga0163162_10027469 Ga0163162_100274692 87
566 3300013306 Ga0163162_10348294 Ga0163162_103482942 87
567 3300013306 Ga0163162_10392740 Ga0163162_103927402 87
568 3300013306 Ga0163162_10437748 Ga0163162_104377482 87
569 3300013306 Ga0163162_10603130 Ga0163162_106031302 87
570 3300013306 Ga0163162_11332269 Ga0163162_113322692 87
571 3300013306 Ga0163162_12166570 Ga0163162_121665702 87
572 3300013306 Ga0163162_12211565 Ga0163162_122115652 87
573 3300013306 Ga0163162_13055629 Ga0163162_130556292 87
574 3300013307 Ga0157372_10833269 Ga0157372_108332692 87
575 3300013307 Ga0157372_12279965 Ga0157372_122799652 87
576 3300013307 Ga0157372_12868469 Ga0157372_128684692 87
577 3300013308 Ga0157375_10044081 Ga0157375_100440814 87
578 3300013308 Ga0157375_10074267 Ga0157375_100742674 87
579 3300013308 Ga0157375_10366751 Ga0157375_103667512 87
580 3300013308 Ga0157375_10603415 Ga0157375_106034152 87
581 3300013308 Ga0157375_10743592 Ga0157375_107435922 87
582 3300013308 Ga0157375_11002122 Ga0157375_110021222 87
583 3300013308 Ga0157375_12016179 Ga0157375_120161792 87
584 3300013308 Ga0157375_12326726 Ga0157375_123267262 87
585 3300014325 Ga0163163_10007753 Ga0163163_100077534 87
586 3300014325 Ga0163163_10286345 Ga0163163_102863452 87
587 3300014325 Ga0163163_10767922 Ga0163163_107679222 87
588 3300014325 Ga0163163_11926539 Ga0163163_119265392 87
589 3300014326 Ga0157380_10222062 Ga0157380_102220623 87
590 3300014326 Ga0157380_10244209 Ga0157380_102442092 87
591 3300014326 Ga0157380_11311404 Ga0157380_113114042 87
592 3300014326 Ga0157380_11858744 Ga0157380_118587442 87
593 3300014745 Ga0157377_10497823 Ga0157377_104978232 87
594 3300014745 Ga0157377_10558487 Ga0157377_105584872 87
595 3300014745 Ga0157377_11342719 Ga0157377_113427192 87
596 3300014968 Ga0157379_10266153 Ga0157379_102661533 87
597 3300014968 Ga0157379_10267310 Ga0157379_102673102 87
598 3300014968 Ga0157379_10962302 Ga0157379_109623022 87
599 3300014968 Ga0157379_11819485 Ga0157379_118194851 87
600 3300014969 Ga0157376_10012121 Ga0157376_100121214 87
601 3300014969 Ga0157376_10277318 Ga0157376_102773183 87
602 3300014969 Ga0157376_10307821 Ga0157376_103078212 87
603 3300014969 Ga0157376_10960965 Ga0157376_109609652 87
604 3300014969 Ga0157376_11482695 Ga0157376_114826951 87
605 3300014969 Ga0157376_13073648 Ga0157376_130736482 87
606 3300015262 Ga0182007_10071745 Ga0182007_100717452 87
607 3300017792 Ga0163161_10191617 Ga0163161_101916172 87
608 3300017792 Ga0163161_10433263 Ga0163161_104332632 87
609 3300017792 Ga0163161_10448388 Ga0163161_104483882 87
610 3300017792 Ga0163161_11598349 Ga0163161_115983492 87
611 3300017792 Ga0163161_11772392 Ga0163161_117723922 87
612 3300025271 Ga0207666_1035495 Ga0207666_10354952 87
613 3300025295 Ga0209564_1001221 Ga0209564_100122113 87
614 3300025297 Ga0209758_1003949 Ga0209758_100394915 87
615 3300025297 Ga0209758_1007275 Ga0209758_10072756 87
616 3300025297 Ga0209758_1053161 Ga0209758_10531612 87
617 3300025302 Ga0207426_1135669 Ga0207426_11356692 87
618 3300025315 Ga0207697_10165331 Ga0207697_101653312 87
619 3300025315 Ga0207697_10349231 Ga0207697_103492312 87
620 3300025321 Ga0207656_10119122 Ga0207656_101191222 87
621 3300025321 Ga0207656_10283968 Ga0207656_102839682 87
622 3300025711 Ga0207696_1187911 Ga0207696_11879111 87
623 3300025885 Ga0207653_10063705 Ga0207653_100637052 87
624 3300025898 Ga0207692_10000577 Ga0207692_100005773 87
625 3300025898 Ga0207692_10014611 Ga0207692_100146112 87
626 3300025898 Ga0207692_10265453 Ga0207692_102654532 87
627 3300025899 Ga0207642_10958279 Ga0207642_109582792 87
628 3300025900 Ga0207710_10092411 Ga0207710_100924112 87
629 3300025900 Ga0207710_10101896 Ga0207710_101018962 87
630 3300025900 Ga0207710_10221864 Ga0207710_102218641 87
631 3300025900 Ga0207710_10448414 Ga0207710_104484142 87
632 3300025900 Ga0207710_10517668 Ga0207710_105176682 87
633 3300025901 Ga0207688_10025581 Ga0207688_100255812 87
634 3300025901 Ga0207688_10104912 Ga0207688_101049122 87
635 3300025901 Ga0207688_10454278 Ga0207688_104542782 87
636 3300025903 Ga0207680_10275413 Ga0207680_102754132 87
637 3300025903 Ga0207680_10541850 Ga0207680_105418502 87
638 3300025903 Ga0207680_10659221 Ga0207680_106592212 87
639 3300025903 Ga0207680_11039545 Ga0207680_110395452 87
640 3300025905 Ga0207685_10119673 Ga0207685_101196731 87
641 3300025906 Ga0207699_10001017 Ga0207699_100010179 87
642 3300025906 Ga0207699_10012918 Ga0207699_100129184 87
643 3300025906 Ga0207699_10813853 Ga0207699_108138532 87
644 3300025907 Ga0207645_10194138 Ga0207645_101941382 87
645 3300025907 Ga0207645_10514463 Ga0207645_105144632 87
646 3300025908 Ga0207643_10025399 Ga0207643_100253994 87
647 3300025908 Ga0207643_10122560 Ga0207643_101225603 87
648 3300025909 Ga0207705_10081491 Ga0207705_100814913 87
649 3300025909 Ga0207705_10184232 Ga0207705_101842322 87
650 3300025909 Ga0207705_10356852 Ga0207705_103568522 87
651 3300025909 Ga0207705_11107658 Ga0207705_111076582 87
652 3300025909 Ga0207705_11321839 Ga0207705_113218391 87
653 3300025910 Ga0207684_10073200 Ga0207684_100732002 87
654 3300025911 Ga0207654_10016752 Ga0207654_100167526 87
655 3300025911 Ga0207654_10206016 Ga0207654_102060162 87
656 3300025911 Ga0207654_10527764 Ga0207654_105277642 87
657 3300025911 Ga0207654_10923019 Ga0207654_109230192 87
658 3300025912 Ga0207707_10002176 Ga0207707_1000217616 87
659 3300025912 Ga0207707_10128201 Ga0207707_101282012 87
660 3300025912 Ga0207707_10423957 Ga0207707_104239572 87
661 3300025912 Ga0207707_10606616 Ga0207707_106066162 87
662 3300025913 Ga0207695_10036086 Ga0207695_100360865 87
663 3300025913 Ga0207695_10718095 Ga0207695_107180952 87
664 3300025913 Ga0207695_10767894 Ga0207695_107678941 87
665 3300025914 Ga0207671_10066890 Ga0207671_100668903 87
666 3300025914 Ga0207671_10082917 Ga0207671_100829173 87
667 3300025914 Ga0207671_10094207 Ga0207671_100942073 87
668 3300025914 Ga0207671_10124876 Ga0207671_101248762 87
669 3300025914 Ga0207671_10139164 Ga0207671_101391642 87
670 3300025915 Ga0207693_10024501 Ga0207693_100245012 87
671 3300025915 Ga0207693_10519904 Ga0207693_105199042 87
672 3300025915 Ga0207693_10638589 Ga0207693_106385892 87
673 3300025916 Ga0207663_10016885 Ga0207663_100168853 87
674 3300025916 Ga0207663_10104043 Ga0207663_101040433 87
675 3300025916 Ga0207663_10144689 Ga0207663_101446892 87
676 3300025916 Ga0207663_10297486 Ga0207663_102974862 87
677 3300025916 Ga0207663_11126195 Ga0207663_111261952 87
678 3300025916 Ga0207663_11730461 Ga0207663_117304611 87
679 3300025917 Ga0207660_10001786 Ga0207660_100017866 87
680 3300025917 Ga0207660_10077620 Ga0207660_100776203 87
681 3300025917 Ga0207660_10282687 Ga0207660_102826872 87
682 3300025918 Ga0207662_10026976 Ga0207662_100269764 87
683 3300025919 Ga0207657_10024094 Ga0207657_100240944 87
684 3300025919 Ga0207657_10084836 Ga0207657_100848364 87
685 3300025919 Ga0207657_10298216 Ga0207657_102982163 87
686 3300025919 Ga0207657_10799550 Ga0207657_107995501 87
687 3300025919 Ga0207657_10923390 Ga0207657_109233902 87
688 3300025920 Ga0207649_10021015 Ga0207649_100210155 87
689 3300025920 Ga0207649_10260374 Ga0207649_102603742 87
690 3300025920 Ga0207649_10511846 Ga0207649_105118462 87
691 3300025921 Ga0207652_10002365 Ga0207652_100023656 87
692 3300025921 Ga0207652_10469875 Ga0207652_104698752 87
693 3300025921 Ga0207652_10643496 Ga0207652_106434962 87
694 3300025922 Ga0207646_10119995 Ga0207646_101199954 87
695 3300025923 Ga0207681_10206613 Ga0207681_102066132 87
696 3300025923 Ga0207681_11494655 Ga0207681_114946552 87
697 3300025923 Ga0207681_11533680 Ga0207681_115336802 87
698 3300025923 Ga0207681_11680109 Ga0207681_116801092 87
699 3300025924 Ga0207694_10010594 Ga0207694_100105945 87
700 3300025924 Ga0207694_10126246 Ga0207694_101262463 87
701 3300025924 Ga0207694_10227399 Ga0207694_102273992 87
702 3300025924 Ga0207694_10259330 Ga0207694_102593302 87
703 3300025924 Ga0207694_10354263 Ga0207694_103542632 87
704 3300025924 Ga0207694_10484913 Ga0207694_104849132 87
705 3300025924 Ga0207694_10604574 Ga0207694_106045742 87
706 3300025924 Ga0207694_11097593 Ga0207694_110975932 87
707 3300025924 Ga0207694_11421318 Ga0207694_114213182 87
708 3300025924 Ga0207694_11453743 Ga0207694_114537432 87
709 3300025925 Ga0207650_10067567 Ga0207650_100675672 87
710 3300025925 Ga0207650_10244288 Ga0207650_102442882 87
711 3300025925 Ga0207650_10597555 Ga0207650_105975552 87
712 3300025925 Ga0207650_11162688 Ga0207650_111626881 87
713 3300025926 Ga0207659_10224464 Ga0207659_102244642 87
714 3300025926 Ga0207659_10332775 Ga0207659_103327752 87
715 3300025926 Ga0207659_10902227 Ga0207659_109022272 87
716 3300025926 Ga0207659_11081945 Ga0207659_110819452 87
717 3300025926 Ga0207659_11605895 Ga0207659_116058951 87
718 3300025927 Ga0207687_10009764 Ga0207687_100097643 87
719 3300025927 Ga0207687_10110392 Ga0207687_101103923 87
720 3300025927 Ga0207687_10602451 Ga0207687_106024512 87
721 3300025927 Ga0207687_10964670 Ga0207687_109646701 87
722 3300025927 Ga0207687_11266498 Ga0207687_112664982 87
723 3300025927 Ga0207687_11476732 Ga0207687_114767322 87
724 3300025927 Ga0207687_11514306 Ga0207687_115143062 87
725 3300025928 Ga0207700_10748729 Ga0207700_107487292 87
726 3300025928 Ga0207700_11507765 Ga0207700_115077652 87
727 3300025929 Ga0207664_10099602 Ga0207664_100996022 87
728 3300025929 Ga0207664_10309589 Ga0207664_103095892 87
729 3300025929 Ga0207664_10688152 Ga0207664_106881522 87
730 3300025931 Ga0207644_10158028 Ga0207644_101580282 87
731 3300025931 Ga0207644_10204176 Ga0207644_102041762 87
732 3300025931 Ga0207644_11081364 Ga0207644_110813642 87
733 3300025932 Ga0207690_10079318 Ga0207690_100793182 87
734 3300025932 Ga0207690_10170955 Ga0207690_101709552 87
735 3300025932 Ga0207690_10417263 Ga0207690_104172632 87
736 3300025932 Ga0207690_11754800 Ga0207690_117548002 87
737 3300025933 Ga0207706_10149220 Ga0207706_101492202 87
738 3300025933 Ga0207706_10494900 Ga0207706_104949002 87
739 3300025933 Ga0207706_11295565 Ga0207706_112955652 87
740 3300025934 Ga0207686_10025096 Ga0207686_100250962 87
741 3300025934 Ga0207686_10116199 Ga0207686_101161992 87
742 3300025934 Ga0207686_10123215 Ga0207686_101232152 87
743 3300025934 Ga0207686_11026556 Ga0207686_110265562 87
744 3300025935 Ga0207709_10731431 Ga0207709_107314312 87
745 3300025935 Ga0207709_10939973 Ga0207709_109399732 87
746 3300025935 Ga0207709_11479716 Ga0207709_114797162 87
747 3300025936 Ga0207670_10462267 Ga0207670_104622672 87
748 3300025936 Ga0207670_10674424 Ga0207670_106744242 87
749 3300025936 Ga0207670_11531122 Ga0207670_115311222 87
750 3300025937 Ga0207669_10190924 Ga0207669_101909242 87
751 3300025937 Ga0207669_10655559 Ga0207669_106555592 87
752 3300025937 Ga0207669_11068122 Ga0207669_110681222 87
753 3300025937 Ga0207669_11074635 Ga0207669_110746352 87
754 3300025938 Ga0207704_10059748 Ga0207704_100597482 87
755 3300025938 Ga0207704_10217654 Ga0207704_102176541 87
756 3300025938 Ga0207704_10316018 Ga0207704_103160182 87
757 3300025938 Ga0207704_10646967 Ga0207704_106469672 87
758 3300025938 Ga0207704_11134645 Ga0207704_111346452 87
759 3300025939 Ga0207665_10011153 Ga0207665_100111534 87
760 3300025939 Ga0207665_10068456 Ga0207665_100684564 87
761 3300025939 Ga0207665_10109023 Ga0207665_101090233 87
762 3300025939 Ga0207665_10117626 Ga0207665_101176262 87
763 3300025939 Ga0207665_10440509 Ga0207665_104405092 87
764 3300025940 Ga0207691_11053811 Ga0207691_110538111 87
765 3300025940 Ga0207691_11079828 Ga0207691_110798282 87
766 3300025941 Ga0207711_10061641 Ga0207711_100616413 87
767 3300025941 Ga0207711_10475281 Ga0207711_104752812 87
768 3300025941 Ga0207711_10849681 Ga0207711_108496812 87
769 3300025941 Ga0207711_11509957 Ga0207711_115099572 87
770 3300025942 Ga0207689_10146666 Ga0207689_101466663 87
771 3300025942 Ga0207689_10280912 Ga0207689_102809122 87
772 3300025942 Ga0207689_11058398 Ga0207689_110583982 87
773 3300025942 Ga0207689_11203376 Ga0207689_112033762 87
774 3300025944 Ga0207661_10013603 Ga0207661_100136035 87
775 3300025944 Ga0207661_10116855 Ga0207661_101168552 87
776 3300025944 Ga0207661_10778977 Ga0207661_107789772 87
777 3300025944 Ga0207661_11897506 Ga0207661_118975062 87
778 3300025945 Ga0207679_10093013 Ga0207679_100930132 87
779 3300025945 Ga0207679_10356885 Ga0207679_103568852 87
780 3300025945 Ga0207679_10469512 Ga0207679_104695122 87
781 3300025945 Ga0207679_10919219 Ga0207679_109192192 87
782 3300025945 Ga0207679_11413067 Ga0207679_114130672 87
783 3300025945 Ga0207679_11420735 Ga0207679_114207352 87
784 3300025949 Ga0207667_10010838 Ga0207667_100108388 87
785 3300025949 Ga0207667_10077713 Ga0207667_100777134 87
786 3300025949 Ga0207667_10136354 Ga0207667_101363543 87
787 3300025949 Ga0207667_10621324 Ga0207667_106213242 87
788 3300025949 Ga0207667_10950665 Ga0207667_109506652 87
789 3300025960 Ga0207651_11078227 Ga0207651_110782272 87
790 3300025960 Ga0207651_11368697 Ga0207651_113686971 87
791 3300025960 Ga0207651_11403801 Ga0207651_114038012 87
792 3300025961 Ga0207712_10143686 Ga0207712_101436863 87
793 3300025961 Ga0207712_10765806 Ga0207712_107658062 87
794 3300025961 Ga0207712_11404919 Ga0207712_114049191 87
795 3300025961 Ga0207712_12032756 Ga0207712_120327562 87
796 3300025972 Ga0207668_10039435 Ga0207668_100394354 87
797 3300025972 Ga0207668_10047504 Ga0207668_100475042 87
798 3300025972 Ga0207668_10091454 Ga0207668_100914542 87
799 3300025972 Ga0207668_10140122 Ga0207668_101401223 87
800 3300025972 Ga0207668_10166715 Ga0207668_101667152 87
801 3300025972 Ga0207668_10295322 Ga0207668_102953222 87
802 3300025972 Ga0207668_10401826 Ga0207668_104018262 87
803 3300025972 Ga0207668_10855529 Ga0207668_108555292 87
804 3300025972 Ga0207668_11115233 Ga0207668_111152332 87
805 3300025981 Ga0207640_10809835 Ga0207640_108098351 87
806 3300025981 Ga0207640_11745264 Ga0207640_117452641 87
807 3300025986 Ga0207658_10869258 Ga0207658_108692582 87
808 3300025986 Ga0207658_11209724 Ga0207658_112097241 87
809 3300025986 Ga0207658_12093083 Ga0207658_120930831 87
810 3300025986 Ga0207658_12200386 Ga0207658_122003862 87
811 3300026023 Ga0207677_10063932 Ga0207677_100639322 87
812 3300026023 Ga0207677_10146068 Ga0207677_101460683 87
813 3300026023 Ga0207677_10219069 Ga0207677_102190692 87
814 3300026023 Ga0207677_10428766 Ga0207677_104287661 87
815 3300026023 Ga0207677_11867319 Ga0207677_118673192 87
816 3300026035 Ga0207703_10075920 Ga0207703_100759203 87
817 3300026035 Ga0207703_10084343 Ga0207703_100843433 87
818 3300026035 Ga0207703_10114321 Ga0207703_101143212 87
819 3300026035 Ga0207703_10232588 Ga0207703_102325883 87
820 3300026035 Ga0207703_12328487 Ga0207703_123284871 87
821 3300026041 Ga0207639_10062631 Ga0207639_100626312 87
822 3300026041 Ga0207639_10110551 Ga0207639_101105512 87
823 3300026041 Ga0207639_10267859 Ga0207639_102678592 87
824 3300026041 Ga0207639_10492012 Ga0207639_104920121 87
825 3300026041 Ga0207639_10556511 Ga0207639_105565113 87
826 3300026041 Ga0207639_10683432 Ga0207639_106834322 87
827 3300026041 Ga0207639_11126040 Ga0207639_111260402 87
828 3300026067 Ga0207678_10053927 Ga0207678_100539274 87
829 3300026067 Ga0207678_10080094 Ga0207678_100800942 87
830 3300026067 Ga0207678_10138257 Ga0207678_101382572 87
831 3300026067 Ga0207678_10147501 Ga0207678_101475012 87
832 3300026067 Ga0207678_10242627 Ga0207678_102426272 87
833 3300026067 Ga0207678_10329454 Ga0207678_103294542 87
834 3300026067 Ga0207678_11210793 Ga0207678_112107932 87
835 3300026067 Ga0207678_11432074 Ga0207678_114320742 87
836 3300026075 Ga0207708_10228716 Ga0207708_102287163 87
837 3300026075 Ga0207708_10954651 Ga0207708_109546512 87
838 3300026075 Ga0207708_11097376 Ga0207708_110973762 87
839 3300026078 Ga0207702_10291940 Ga0207702_102919402 87
840 3300026078 Ga0207702_11377852 Ga0207702_113778522 87
841 3300026078 Ga0207702_11790144 Ga0207702_117901442 87
842 3300026088 Ga0207641_10128085 Ga0207641_101280852 87
843 3300026088 Ga0207641_10298158 Ga0207641_102981582 87
844 3300026088 Ga0207641_11652732 Ga0207641_116527322 87
845 3300026089 Ga0207648_10095892 Ga0207648_100958922 87
846 3300026089 Ga0207648_10463116 Ga0207648_104631162 87
847 3300026089 Ga0207648_10562739 Ga0207648_105627392 87
848 3300026095 Ga0207676_10079312 Ga0207676_100793122 87
849 3300026095 Ga0207676_10099178 Ga0207676_100991782 87
850 3300026095 Ga0207676_10631137 Ga0207676_106311372 87
851 3300026095 Ga0207676_11531438 Ga0207676_115314382 87
852 3300026116 Ga0207674_10083221 Ga0207674_100832213 87
853 3300026116 Ga0207674_10349016 Ga0207674_103490162 87
854 3300026116 Ga0207674_11574486 Ga0207674_115744862 87
855 3300026118 Ga0207675_100057952 Ga0207675_1000579524 87
856 3300026118 Ga0207675_100171161 Ga0207675_1001711613 87
857 3300026118 Ga0207675_100562748 Ga0207675_1005627482 87
858 3300026121 Ga0207683_10094409 Ga0207683_100944092 87
859 3300026121 Ga0207683_10095176 Ga0207683_100951762 87
860 3300026121 Ga0207683_10107984 Ga0207683_101079842 87
861 3300026121 Ga0207683_10132018 Ga0207683_101320182 87
862 3300026121 Ga0207683_10363204 Ga0207683_103632042 87
863 3300026142 Ga0207698_10037660 Ga0207698_100376604 87
864 3300026142 Ga0207698_10122759 Ga0207698_101227594 87
865 3300026142 Ga0207698_10199533 Ga0207698_101995333 87
866 3300026142 Ga0207698_10558016 Ga0207698_105580162 87
867 3300026142 Ga0207698_10693525 Ga0207698_106935252 87
868 3300026142 Ga0207698_10837118 Ga0207698_108371182 87
869 3300027512 Ga0209179_1000351 Ga0209179_10003512 87
870 3300027512 Ga0209179_1013201 Ga0209179_10132012 87
871 3300027512 Ga0209179_1132257 Ga0209179_11322572 87
872 3300027671 Ga0209588_1000878 Ga0209588_10008786 87
873 3300027671 Ga0209588_1038864 Ga0209588_10388642 87
874 3300027671 Ga0209588_1146802 Ga0209588_11468022 87
875 3300027866 Ga0209813_10008814 Ga0209813_100088142 87
876 3300027866 Ga0209813_10056058 Ga0209813_100560583 87
877 3300027866 Ga0209813_10165010 Ga0209813_101650102 87
878 3300027866 Ga0209813_10506935 Ga0209813_105069352 87
879 3300027907 Ga0207428_10688499 Ga0207428_106884992 87
880 3300028379 Ga0268266_10000670 Ga0268266_1000067044 87
881 3300028379 Ga0268266_10012528 Ga0268266_100125286 87
882 3300028379 Ga0268266_10036248 Ga0268266_100362483 87
883 3300028379 Ga0268266_10125312 Ga0268266_101253122 87
884 3300028379 Ga0268266_10196582 Ga0268266_101965822 87
885 3300028379 Ga0268266_10220033 Ga0268266_102200333 87
886 3300028379 Ga0268266_10404766 Ga0268266_104047662 87
887 3300028379 Ga0268266_10510888 Ga0268266_105108882 87
888 3300028379 Ga0268266_10697926 Ga0268266_106979262 87
889 3300028379 Ga0268266_10963272 Ga0268266_109632722 87
890 3300028379 Ga0268266_11344219 Ga0268266_113442191 87
891 3300028380 Ga0268265_10093973 Ga0268265_100939732 87
892 3300028380 Ga0268265_10126118 Ga0268265_101261182 87
893 3300028380 Ga0268265_10400453 Ga0268265_104004532 87
894 3300028380 Ga0268265_10573317 Ga0268265_105733172 87
895 3300028380 Ga0268265_10717435 Ga0268265_107174352 87
896 3300028380 Ga0268265_11078272 Ga0268265_110782722 87
897 3300028380 Ga0268265_11939985 Ga0268265_119399852 87
898 3300028381 Ga0268264_10211581 Ga0268264_102115812 87
899 3300028381 Ga0268264_10281030 Ga0268264_102810302 87
900 3300028381 Ga0268264_10364642 Ga0268264_103646422 87
901 3300028381 Ga0268264_10499511 Ga0268264_104995112 87
902 3300028381 Ga0268264_10655987 Ga0268264_106559872 87
903 3300028381 Ga0268264_11500701 Ga0268264_115007012 87
904 3300028381 Ga0268264_11884420 Ga0268264_118844202 87
905 3300028558 Ga0265326_10016244 Ga0265326_100162442 87
906 3300028563 Ga0265319_1027573 Ga0265319_10275732 87
907 3300028573 Ga0265334_10014815 Ga0265334_100148154 87
908 3300028577 Ga0265318_10015868 Ga0265318_100158684 87
909 3300028653 Ga0265323_10064894 Ga0265323_100648942 87
910 3300028666 Ga0265336_10000598 Ga0265336_1000059816 87
911 3300028786 Ga0307517_10118508 Ga0307517_101185083 87
912 3300028786 Ga0307517_10327584 Ga0307517_103275842 87
913 3300028794 Ga0307515_10022025 Ga0307515_100220254 87
914 3300028794 Ga0307515_10363107 Ga0307515_103631072 87
915 3300028794 Ga0307515_10561665 Ga0307515_105616652 87
916 3300028800 Ga0265338_10000116 Ga0265338_1000011690 87
917 3300029957 Ga0265324_10012440 Ga0265324_100124405 87
918 3300030522 Ga0307512_10359757 Ga0307512_103597572 87
919 3300031235 Ga0265330_10021854 Ga0265330_100218543 87
920 3300031247 Ga0265340_10059179 Ga0265340_100591792 87
921 3300031249 Ga0265339_10003487 Ga0265339_100034879 87
922 3300031456 Ga0307513_10125971 Ga0307513_101259712 87
923 3300031456 Ga0307513_10219632 Ga0307513_102196322 87
924 3300031456 Ga0307513_10704986 Ga0307513_107049862 87
925 3300031507 Ga0307509_10124356 Ga0307509_101243562 87
926 3300031548 Ga0307408_101912993 Ga0307408_1019129932 87
927 3300031616 Ga0307508_10000008 Ga0307508_1000000899 87
928 3300031616 Ga0307508_10125719 Ga0307508_101257192 87
929 3300031616 Ga0307508_10303976 Ga0307508_103039762 87
930 3300031730 Ga0307516_10114139 Ga0307516_101141391 87
931 3300031730 Ga0307516_10426363 Ga0307516_104263632 87
932 3300031731 Ga0307405_11564452 Ga0307405_115644522 87
933 3300031731 Ga0307405_12161292 Ga0307405_121612922 87
934 3300031824 Ga0307413_10186048 Ga0307413_101860482 87
935 3300031852 Ga0307410_12069139 Ga0307410_120691392 87
936 3300031901 Ga0307406_10227129 Ga0307406_102271293 87
937 3300031901 Ga0307406_10727563 Ga0307406_107275632 87
938 3300031901 Ga0307406_11041558 Ga0307406_110415582 87
939 3300031903 Ga0307407_10385138 Ga0307407_103851382 87
940 3300031903 Ga0307407_10653675 Ga0307407_106536752 87
941 3300031911 Ga0307412_10133933 Ga0307412_101339333 87
942 3300031911 Ga0307412_10264397 Ga0307412_102643971 87
943 3300031911 Ga0307412_10723058 Ga0307412_107230582 87
944 3300031911 Ga0307412_10833823 Ga0307412_108338232 87
945 3300031911 Ga0307412_10973022 Ga0307412_109730222 87
946 3300031911 Ga0307412_11289578 Ga0307412_112895782 87
947 3300031995 Ga0307409_100037914 Ga0307409_1000379142 87
948 3300031995 Ga0307409_100609669 Ga0307409_1006096692 87
949 3300031995 Ga0307409_101280783 Ga0307409_1012807832 87
950 3300031995 Ga0307409_101597040 Ga0307409_1015970402 87
951 3300032002 Ga0307416_100374435 Ga0307416_1003744352 87
952 3300032002 Ga0307416_100598498 Ga0307416_1005984981 87
953 3300032002 Ga0307416_101716231 Ga0307416_1017162312 87
954 3300032004 Ga0307414_10282430 Ga0307414_102824302 87
955 3300032004 Ga0307414_10391927 Ga0307414_103919272 87
956 3300032004 Ga0307414_12135239 Ga0307414_121352392 87
957 3300032005 Ga0307411_10108176 Ga0307411_101081763 87
958 3300032005 Ga0307411_10351685 Ga0307411_103516852 87
959 3300032005 Ga0307411_10722577 Ga0307411_107225772 87
960 3300032005 Ga0307411_10866050 Ga0307411_108660502 87
961 3300032005 Ga0307411_11527350 Ga0307411_115273502 87
962 3300032126 Ga0307415_100163658 Ga0307415_1001636583 87
963 3300032126 Ga0307415_100500443 Ga0307415_1005004432 87
964 3300032126 Ga0307415_100572527 Ga0307415_1005725272 87
965 3300032126 Ga0307415_100776829 Ga0307415_1007768292 87
966 3300032126 Ga0307415_101111652 Ga0307415_1011116521 87
967 3300033179 Ga0307507_10503249 Ga0307507_105032492 87
968 3300033180 Ga0307510_10009215 Ga0307510_100092152 87
969 3300033180 Ga0307510_10009742 Ga0307510_1000974211 87
970 3300033180 Ga0307510_10159281 Ga0307510_101592812 87
971 3300033180 Ga0307510_10202068 Ga0307510_102020682 87
972 3300033180 Ga0307510_10568209 Ga0307510_105682091 87
973 3300034816 Ga0373930_0001441 Ga0373930_0001441_77_355 87
974 3300034818 Ga0373950_0151467 Ga0373950_0151467_100_363 87
975 3300035083 Ga0373926_0266358 Ga0373926_0266358_155_433 87
976 3300035083 Ga0373926_0304035 Ga0373926_0304035_14_292 87
977 3300035084 Ga0373928_0019596 Ga0373928_0019596_500_763 87
978 3300035085 Ga0373929_0016903 Ga0373929_0016903_887_1165 87
979 3300035085 Ga0373929_0047419 Ga0373929_0047419_440_703 87
980 3300035088 Ga0373940_0057516 Ga0373940_0057516_762_1040 87
981 3300035089 Ga0373944_0173578 Ga0373944_0173578_431_709 87
982 3300035091 Ga0373951_0113380 Ga0373951_0113380_447_710 87
983 3300035092 Ga0373952_0117761 Ga0373952_0117761_215_493 87
984 3300035111 Ga0373923_0025654 Ga0373923_0025654_679_942 87
985 3300035112 Ga0373932_0200365 Ga0373932_0200365_228_506 87
986 3300035112 Ga0373932_0219639 Ga0373932_0219639_223_501 87
987 3300035113 Ga0373936_0001697 Ga0373936_0001697_5392_5655 87
988 3300035113 Ga0373936_0061131 Ga0373936_0061131_1221_1484 87
989 3300035113 Ga0373936_0242807 Ga0373936_0242807_118_381 87
990 3300035113 Ga0373936_0273822 Ga0373936_0273822_91_369 87
991 3300035115 Ga0373941_0108588 Ga0373941_0108588_138_416 87
992 3300035116 Ga0373945_0007150 Ga0373945_0007150_2992_3255 87
993 3300035118 Ga0373954_0108494 Ga0373954_0108494_330_593 87
994 3300035170 Ga0373943_0008157 Ga0373943_0008157_1022_1285 87
995 3300035170 Ga0373943_0094690 Ga0373943_0094690_1224_1502 87
996 3300035171 Ga0373946_0022363 Ga0373946_0022363_343_606 87
997 3300035171 Ga0373946_0037316 Ga0373946_0037316_1070_1348 87
998 3300035171 Ga0373946_0060591 Ga0373946_0060591_443_706 87
999 3300035172 Ga0373955_0009286 Ga0373955_0009286_1915_2178 87
1000 3300035242 Ga0373962_0105125 Ga0373962_0105125_322_585 87
1001 3300035691 Ga0373931_0015883 Ga0373931_0015883_2856_3134 87
1002 3300035691 Ga0373931_0075718 Ga0373931_0075718_733_1011 87
1003 3300035691 Ga0373931_0267215 Ga0373931_0267215_526_789 87
1004 3300035691 Ga0373931_1025124 Ga0373931_1025124_209_487 87
1005 3300035692 Ga0373935_0001766 Ga0373935_0001766_5247_5510 87
1006 3300035692 Ga0373935_0241613 Ga0373935_0241613_198_476 87
1007 3300035692 Ga0373935_0457988 Ga0373935_0457988_46_339 87
1008 3300035692 Ga0373935_0616038 Ga0373935_0616038_388_651 87
1009 3300035695 Ga0373927_0000346 Ga0373927_0000346_21925_22188 87
1010 3300035695 Ga0373927_0030692 Ga0373927_0030692_2666_2929 87
1011 3300035695 Ga0373927_0062334 Ga0373927_0062334_597_875 87
1012 3300035695 Ga0373927_0131258 Ga0373927_0131258_1278_1556 87
1013 3300035695 Ga0373927_0238016 Ga0373927_0238016_497_790 87
1014 3300035695 Ga0373927_0726433 Ga0373927_0726433_295_573 87
1015 3300035725 Ga0373947_0001267 Ga0373947_0001267_4753_5016 87
1016 3300035725 Ga0373947_0094240 Ga0373947_0094240_111_389 87
1017 3300036401 Ga0373937_0112363 Ga0373937_0112363_875_1138 87
1018 3300036401 Ga0373937_0390713 Ga0373937_0390713_674_952 87
1019 3300036401 Ga0373937_1974260 Ga0373937_1974260_165_443 87
1020 3300037068 Ga0373925_0001404 Ga0373925_0001404_11163_11426 87
1021 3300037068 Ga0373925_0083042 Ga0373925_0083042_498_776 87
1022 3300037068 Ga0373925_1185760 Ga0373925_1185760_336_614 87
1023 3300037312 Ga0395899_0151687 Ga0395899_0151687_1182_1451 87
1024 3300037312 Ga0395899_0222815 Ga0395899_0222815_553_816 87
1025 3300037312 Ga0395899_0291301 Ga0395899_0291301_586_849 87
1026 3300037418 Ga0395900_0000134 Ga0395900_0000134_86459_86728 87
1027 3300037418 Ga0395900_0434408 Ga0395900_0434408_872_1135 87
1028 3300037418 Ga0395900_1338018 Ga0395900_1338018_149_412 87
1029 3300037466 Ga0395898_0102741 Ga0395898_0102741_286_549 87
1030 3300037466 Ga0395898_0134716 Ga0395898_0134716_2007_2276 87
1031 3300037471 Ga0395905_0014230 Ga0395905_0014230_2700_2963 87
1032 3300037471 Ga0395905_0050316 Ga0395905_0050316_2417_2680 87
1033 3300037471 Ga0395905_0767039 Ga0395905_0767039_428_691 87
1034 3300037853 Ga0436364_0264957 Ga0436364_0264957_142_408 87
1035 3300038443 Ga0395901_0030976 Ga0395901_0030976_179_448 87
1036 3300038443 Ga0395901_0187727 Ga0395901_0187727_1515_1778 87
1037 3300038443 Ga0395901_0294990 Ga0395901_0294990_172_435 87
1038 3300038443 Ga0395901_0349714 Ga0395901_0349714_290_553 87
1039 3300039437 Ga0436365_0101349 Ga0436365_0101349_194_457 87
1040 3300039437 Ga0436365_1730624 Ga0436365_1730624_153_416 87
1041 3300039438 Ga0436360_0228735 Ga0436360_0228735_384_647 87
1042 3300039438 Ga0436360_0885589 Ga0436360_0885589_461_724 87
1043 3300039453 Ga0436362_0973033 Ga0436362_0973033_170_433 87
1044 3300041413 Ga0439465_0113434 Ga0439465_0113434_587_850 87
1045 3300041443 Ga0451789_0257448 Ga0451789_0257448_193_456 87
1046 3300041451 Ga0451791_0431041 Ga0451791_0431041_370_633 87
1047 3300041452 Ga0451793_1558836 Ga0451793_1558836_92_370 87
1048 3300041452 Ga0451793_1711476 Ga0451793_1711476_1093_1356 87
1049 3300041453 Ga0451797_0428135 Ga0451797_0428135_176_439 87
1050 3300041453 Ga0451797_1397639 Ga0451797_1397639_18_305 87
1051 3300041460 Ga0451802_1512357 Ga0451802_1512357_227_490 87
1052 3300041486 Ga0451807_1979322 Ga0451807_1979322_216_479 87
1053 3300041486 Ga0451807_2687982 Ga0451807_2687982_153_416 87
1054 3300041491 Ga0451833_0528442 Ga0451833_0528442_26_319 87
1055 3300041501 Ga0451845_0758677 Ga0451845_0758677_188_451 87
1056 3300041505 Ga0451849_0847938 Ga0451849_0847938_579_842 87
1057 3300041509 Ga0451843_0507948 Ga0451843_0507948_231_518 87
1058 3300041512 Ga0451853_0618798 Ga0451853_0618798_86_349 87
1059 3300041512 Ga0451853_1984475 Ga0451853_1984475_1169_1432 87
1060 3300042139 Ga0450904_022680 Ga0450904_022680_261_524 87
1061 3300042439 Ga0439464_0026932 Ga0439464_0026932_950_1213 87
1062 3300044719 Ga0466971_0318079 Ga0466971_0318079_111_374 87
1063 3300045976 Ga0466967_1227900 Ga0466967_1227900_422_685 87
1064 3300045976 Ga0466967_2443944 Ga0466967_2443944_175_438 87
1065 3300046452 Ga0495617_085289 Ga0495617_085289_596_859 87
1066 3300046454 Ga0495592_0006304 Ga0495592_0006304_947_1210 87
1067 3300046455 Ga0495603_0000092 Ga0495603_0000092_15461_15724 87
1068 3300046455 Ga0495603_0033560 Ga0495603_0033560_2583_2846 87
1069 3300046455 Ga0495603_0118070 Ga0495603_0118070_205_483 87
1070 3300046455 Ga0495603_0279177 Ga0495603_0279177_523_786 87
1071 3300046455 Ga0495603_0520208 Ga0495603_0520208_337_615 87
1072 3300046457 Ga0495590_0214969 Ga0495590_0214969_434_697 87
1073 3300046457 Ga0495590_0278918 Ga0495590_0278918_128_406 87
1074 3300046459 Ga0495629_0000181 Ga0495629_0000181_42345_42608 87
1075 3300046459 Ga0495629_0796914 Ga0495629_0796914_74_337 87
1076 3300046460 Ga0495638_0232937 Ga0495638_0232937_169_432 87
1077 3300046460 Ga0495638_0256526 Ga0495638_0256526_550_813 87
1078 3300046460 Ga0495638_0524715 Ga0495638_0524715_264_527 87
1079 3300046461 Ga0495641_0001499 Ga0495641_0001499_3801_4064 87
1080 3300046462 Ga0495651_0079831 Ga0495651_0079831_1891_2154 87
1081 3300046462 Ga0495651_0084179 Ga0495651_0084179_1648_1911 87
1082 3300046462 Ga0495651_0259399 Ga0495651_0259399_203_481 87
1083 3300046472 Ga0495580_0001467 Ga0495580_0001467_6213_6476 87
1084 3300046472 Ga0495580_0039558 Ga0495580_0039558_1850_2113 87
1085 3300046473 Ga0495582_0000039 Ga0495582_0000039_39296_39559 87
1086 3300046475 Ga0495639_0000489 Ga0495639_0000489_17658_17921 87
1087 3300046475 Ga0495639_0094062 Ga0495639_0094062_379_672 87
1088 3300046476 Ga0495662_0000343 Ga0495662_0000343_17051_17314 87
1089 3300046476 Ga0495662_0300236 Ga0495662_0300236_173_451 87
1090 3300046477 Ga0495664_0034367 Ga0495664_0034367_1532_1795 87
1091 3300046477 Ga0495664_0265505 Ga0495664_0265505_663_926 87
1092 3300046477 Ga0495664_0373162 Ga0495664_0373162_560_838 87
1093 3300046491 Ga0495584_0616836 Ga0495584_0616836_77_340 87
1094 3300046491 Ga0495584_0652805 Ga0495584_0652805_200_463 87
1095 3300046492 Ga0495585_0481642 Ga0495585_0481642_172_435 87
1096 3300046499 Ga0495594_0000619 Ga0495594_0000619_3422_3685 87
1097 3300046499 Ga0495594_0054447 Ga0495594_0054447_484_747 87
1098 3300046499 Ga0495594_0110649 Ga0495594_0110649_1218_1496 87
1099 3300046499 Ga0495594_0642145 Ga0495594_0642145_311_574 87
1100 3300046500 Ga0495596_0072692 Ga0495596_0072692_71_334 87
1101 3300046500 Ga0495596_0074874 Ga0495596_0074874_181_459 87
1102 3300046500 Ga0495596_0210350 Ga0495596_0210350_234_497 87
1103 3300046507 Ga0495606_0151173 Ga0495606_0151173_93_356 87
1104 3300046507 Ga0495606_0215377 Ga0495606_0215377_352_615 87
1105 3300046507 Ga0495606_0271730 Ga0495606_0271730_128_406 87
1106 3300046507 Ga0495606_0359485 Ga0495606_0359485_272_535 87
1107 3300046507 Ga0495606_0533771 Ga0495606_0533771_28_291 87
1108 3300046507 Ga0495606_0593876 Ga0495606_0593876_117_380 87
1109 3300046511 Ga0495608_0346541 Ga0495608_0346541_554_847 87
1110 3300046512 Ga0495610_0048361 Ga0495610_0048361_1465_1728 87
1111 3300046513 Ga0495616_0142836 Ga0495616_0142836_753_1016 87
1112 3300046513 Ga0495616_0294707 Ga0495616_0294707_261_539 87
1113 3300046514 Ga0495618_0422641 Ga0495618_0422641_219_482 87
1114 3300046514 Ga0495618_0854552 Ga0495618_0854552_137_400 87
1115 3300046515 Ga0495620_0031824 Ga0495620_0031824_1376_1639 87
1116 3300046515 Ga0495620_0167572 Ga0495620_0167572_542_805 87
1117 3300046515 Ga0495620_0204645 Ga0495620_0204645_151_429 87
1118 3300046515 Ga0495620_0424154 Ga0495620_0424154_83_346 87
1119 3300046516 Ga0495628_0110032 Ga0495628_0110032_1124_1387 87
1120 3300046516 Ga0495628_0981050 Ga0495628_0981050_255_518 87
1121 3300046517 Ga0495630_0001653 Ga0495630_0001653_14859_15122 87
1122 3300046518 Ga0495631_0037167 Ga0495631_0037167_148_411 87
1123 3300046518 Ga0495631_0246649 Ga0495631_0246649_355_618 87
1124 3300046518 Ga0495631_0320954 Ga0495631_0320954_105_383 87
1125 3300046519 Ga0495632_0075002 Ga0495632_0075002_1046_1309 87
1126 3300046519 Ga0495632_0104820 Ga0495632_0104820_784_1062 87
1127 3300046519 Ga0495632_0126752 Ga0495632_0126752_491_784 87
1128 3300046522 Ga0495643_0078452 Ga0495643_0078452_361_624 87
1129 3300046523 Ga0495644_0065431 Ga0495644_0065431_954_1217 87
1130 3300046523 Ga0495644_0150924 Ga0495644_0150924_62_349 87
1131 3300046523 Ga0495644_0159957 Ga0495644_0159957_81_344 87
1132 3300046524 Ga0495648_0161537 Ga0495648_0161537_275_538 87
1133 3300046524 Ga0495648_0260649 Ga0495648_0260649_114_377 87
1134 3300046524 Ga0495648_0523210 Ga0495648_0523210_103_366 87
1135 3300046525 Ga0495663_0248320 Ga0495663_0248320_337_600 87
1136 3300046525 Ga0495663_0401771 Ga0495663_0401771_65_328 87
1137 3300046526 Ga0495666_0063983 Ga0495666_0063983_1237_1500 87
1138 3300046526 Ga0495666_0146398 Ga0495666_0146398_41_304 87
1139 3300046528 Ga0495642_0065300 Ga0495642_0065300_356_619 87
1140 3300046529 Ga0495652_0085914 Ga0495652_0085914_1763_2026 87
1141 3300046531 Ga0495665_0000079 Ga0495665_0000079_19156_19419 87
1142 3300046533 Ga0495640_0002836 Ga0495640_0002836_12425_12688 87
1143 3300046533 Ga0495640_0278461 Ga0495640_0278461_300_578 87
1144 3300046533 Ga0495640_0348185 Ga0495640_0348185_285_548 87
1145 3300046533 Ga0495640_0439391 Ga0495640_0439391_21_299 87
1146 3300046535 Ga0495586_0062202 Ga0495586_0062202_1366_1629 87
1147 3300046536 Ga0495587_0419727 Ga0495587_0419727_211_474 87
1148 3300046538 Ga0495609_0187943 Ga0495609_0187943_169_432 87
1149 3300046538 Ga0495609_0279450 Ga0495609_0279450_248_511 87
1150 3300046539 Ga0495621_0264540 Ga0495621_0264540_391_654 87
1151 3300046542 Ga0495597_0123488 Ga0495597_0123488_353_616 87
1152 3300046557 Ga0495622_0000987 Ga0495622_0000987_5046_5309 87
1153 3300046557 Ga0495622_0073143 Ga0495622_0073143_242_505 87
1154 3300046557 Ga0495622_0185309 Ga0495622_0185309_612_875 87
1155 3300046557 Ga0495622_0247781 Ga0495622_0247781_456_719 87
1156 3300046557 Ga0495622_0366386 Ga0495622_0366386_171_449 87
1157 3300046558 Ga0495633_0081849 Ga0495633_0081849_930_1193 87
1158 3300046558 Ga0495633_0328373 Ga0495633_0328373_225_503 87
1159 3300046558 Ga0495633_0548328 Ga0495633_0548328_104_367 87
1160 3300046559 Ga0495667_0006293 Ga0495667_0006293_6698_6961 87
1161 3300046559 Ga0495667_0034023 Ga0495667_0034023_1454_1717 87
1162 3300046615 Ga0495656_0086431 Ga0495656_0086431_995_1258 87
1163 3300046615 Ga0495656_0612839 Ga0495656_0612839_166_444 87
1164 3300046616 Ga0495668_0050474 Ga0495668_0050474_968_1246 87
1165 3300046616 Ga0495668_0083750 Ga0495668_0083750_941_1228 87
1166 3300046616 Ga0495668_0113688 Ga0495668_0113688_627_890 87
1167 3300046616 Ga0495668_0119882 Ga0495668_0119882_280_543 87
1168 3300046616 Ga0495668_0263869 Ga0495668_0263869_571_834 87
1169 3300046616 Ga0495668_0317435 Ga0495668_0317435_360_623 87
1170 3300046616 Ga0495668_0428630 Ga0495668_0428630_195_473 87
1171 3300046642 Ga0495634_0077181 Ga0495634_0077181_1398_1661 87
1172 3300046648 Ga0495611_0038191 Ga0495611_0038191_1522_1785 87
1173 3300046648 Ga0495611_0442520 Ga0495611_0442520_74_352 87
1174 3300046660 Ga0495625_0576942 Ga0495625_0576942_62_325 87
1175 3300046660 Ga0495625_0584181 Ga0495625_0584181_297_560 87
1176 3300046660 Ga0495625_0688945 Ga0495625_0688945_168_446 87
1177 3300046660 Ga0495625_0795087 Ga0495625_0795087_162_425 87
1178 3300046663 Ga0495635_0001923 Ga0495635_0001923_11579_11842 87
1179 3300046663 Ga0495635_0564867 Ga0495635_0564867_333_596 87
1180 3300046663 Ga0495635_0712960 Ga0495635_0712960_145_408 87
1181 3300046663 Ga0495635_1009726 Ga0495635_1009726_103_366 87
1182 3300046674 Ga0495588_0019722 Ga0495588_0019722_2316_2579 87
1183 3300046674 Ga0495588_0148423 Ga0495588_0148423_186_464 87
1184 3300046674 Ga0495588_0210587 Ga0495588_0210587_92_355 87
1185 3300046678 Ga0495599_0478628 Ga0495599_0478628_98_361 87
1186 3300046678 Ga0495599_0576728 Ga0495599_0576728_350_613 87
1187 3300046679 Ga0495623_0687895 Ga0495623_0687895_157_420 87
1188 3300046679 Ga0495623_0710628 Ga0495623_0710628_122_415 87
1189 3300046680 Ga0495646_0044735 Ga0495646_0044735_1807_2070 87
1190 3300046681 Ga0495647_0000562 Ga0495647_0000562_9470_9733 87
1191 3300046681 Ga0495647_0209040 Ga0495647_0209040_21_284 87
1192 3300046683 Ga0495658_0004610 Ga0495658_0004610_1838_2101 87
1193 3300046683 Ga0495658_0231876 Ga0495658_0231876_841_1119 87
1194 3300046683 Ga0495658_0701828 Ga0495658_0701828_204_497 87
1195 3300046683 Ga0495658_0848347 Ga0495658_0848347_190_453 87
1196 3300046684 Ga0495669_0032121 Ga0495669_0032121_970_1233 87
1197 3300046684 Ga0495669_0189960 Ga0495669_0189960_565_843 87
1198 3300046689 Ga0495613_0000543 Ga0495613_0000543_11046_11309 87
1199 3300046690 Ga0495624_0001851 Ga0495624_0001851_1656_1919 87
1200 3300046690 Ga0495624_0356534 Ga0495624_0356534_359_622 87
1201 3300046690 Ga0495624_0361481 Ga0495624_0361481_205_483 87
1202 3300046690 Ga0495624_0883391 Ga0495624_0883391_165_428 87
1203 3300046692 Ga0495671_0161560 Ga0495671_0161560_283_546 87
1204 3300046692 Ga0495671_0203205 Ga0495671_0203205_125_403 87
1205 3300046694 Ga0495649_0475282 Ga0495649_0475282_40_327 87
1206 3300046694 Ga0495649_0692465 Ga0495649_0692465_190_453 87
1207 3300046794 Ga0495589_0174947 Ga0495589_0174947_336_599 87
1208 3300046794 Ga0495589_0226170 Ga0495589_0226170_557_844 87
1209 3300046794 Ga0495589_0488415 Ga0495589_0488415_162_440 87
1210 3300046794 Ga0495589_0548271 Ga0495589_0548271_241_504 87
1211 3300046809 Ga0495600_0185665 Ga0495600_0185665_927_1190 87
1212 3300046809 Ga0495600_0314716 Ga0495600_0314716_421_684 87
1213 3300046809 Ga0495600_0688625 Ga0495600_0688625_306_599 87
1214 3300047315 Ga0495581_0000024 Ga0495581_0000024_1023_1286 87
1215 3300047315 Ga0495581_0143434 Ga0495581_0143434_793_1056 87
1216 3300047315 Ga0495581_0198146 Ga0495581_0198146_549_812 87
1217 3300047315 Ga0495581_0309830 Ga0495581_0309830_397_675 87
1218 3300047317 Ga0495604_0186290 Ga0495604_0186290_914_1177 87
1219 3300047317 Ga0495604_0281318 Ga0495604_0281318_465_728 87
1220 3300047317 Ga0495604_0340942 Ga0495604_0340942_344_622 87
1221 3300047319 Ga0495674_0019174 Ga0495674_0019174_3241_3504 87
1222 3300047319 Ga0495674_0321769 Ga0495674_0321769_606_869 87
1223 3300047319 Ga0495674_0671211 Ga0495674_0671211_441_704 87
1224 3300047320 Ga0495672_0025851 Ga0495672_0025851_886_1149 87
1225 3300047320 Ga0495672_0300885 Ga0495672_0300885_393_656 87
1226 3300047321 Ga0495676_0063772 Ga0495676_0063772_680_943 87
1227 3300047321 Ga0495676_0171577 Ga0495676_0171577_572_835 87
1228 3300047321 Ga0495676_0282779 Ga0495676_0282779_224_487 87
1229 3300047322 Ga0495680_0161079 Ga0495680_0161079_840_1103 87
1230 3300047323 Ga0495683_0189431 Ga0495683_0189431_141_404 87
1231 3300047443 Ga0495687_091359 Ga0495687_091359_457_720 87
1232 3300047444 Ga0495675_0341861 Ga0495675_0341861_67_330 87
1233 3300047445 Ga0495677_0346648 Ga0495677_0346648_266_544 87
1234 3300047445 Ga0495677_0432557 Ga0495677_0432557_95_358 87
1235 3300047447 Ga0495685_141447 Ga0495685_141447_43_321 87
1236 3300047469 Ga0495673_0040209 Ga0495673_0040209_676_939 87
1237 3300047469 Ga0495673_0050320 Ga0495673_0050320_469_732 87
1238 3300047469 Ga0495673_0189993 Ga0495673_0189993_171_434 87
1239 3300047470 Ga0495681_0135438 Ga0495681_0135438_389_652 87
1240 3300047470 Ga0495681_0166780 Ga0495681_0166780_264_527 87
1241 3300047471 Ga0495684_0044730 Ga0495684_0044730_951_1214 87
1242 3300047472 Ga0495686_0023990 Ga0495686_0023990_1015_1278 87
1243 3300047472 Ga0495686_0047360 Ga0495686_0047360_1615_1878 87
1244 3300047472 Ga0495686_0139220 Ga0495686_0139220_169_432 87
1245 3300047472 Ga0495686_0204079 Ga0495686_0204079_257_535 87
1246 3300047472 Ga0495686_0220938 Ga0495686_0220938_719_997 87
1247 3300047673 Ga0495593_0000019 Ga0495593_0000019_65290_65553 87
1248 3300047673 Ga0495593_0146760 Ga0495593_0146760_222_515 87
1249 3300048089 Ga0495614_0011005 Ga0495614_0011005_2133_2396 87
1250 3300048090 Ga0495615_0078174 Ga0495615_0078174_269_532 87
1251 3300048091 Ga0495626_0306177 Ga0495626_0306177_67_330 87
1252 3300048903 Ga0496100_0010707 Ga0496100_0010707_3547_3810 87
1253 3300048903 Ga0496100_0098620 Ga0496100_0098620_1376_1639 87
1254 3300048903 Ga0496100_0142779 Ga0496100_0142779_151_429 87
1255 3300048903 Ga0496100_0833096 Ga0496100_0833096_409_672 87
1256 3300048904 Ga0496101_0004532 Ga0496101_0004532_6312_6575 87
1257 3300048904 Ga0496101_0085973 Ga0496101_0085973_716_994 87
1258 3300048904 Ga0496101_0091497 Ga0496101_0091497_1591_1869 87
1259 3300048904 Ga0496101_0358504 Ga0496101_0358504_77_340 87
1260 3300048904 Ga0496101_0512912 Ga0496101_0512912_256_519 87
1261 3300048904 Ga0496101_0927845 Ga0496101_0927845_14_307 87
1262 3300048904 Ga0496101_1334796 Ga0496101_1334796_106_369 87
1263 3300048904 Ga0496101_1376980 Ga0496101_1376980_64_327 87
1264 3300048904 Ga0496101_1411153 Ga0496101_1411153_150_428 87
1265 3300048905 Ga0496102_0006263 Ga0496102_0006263_911_1174 87
1266 3300048905 Ga0496102_0175785 Ga0496102_0175785_999_1262 87
1267 3300048905 Ga0496102_0430216 Ga0496102_0430216_53_316 87
1268 3300048905 Ga0496102_0474361 Ga0496102_0474361_459_722 87
1269 3300048905 Ga0496102_0537218 Ga0496102_0537218_109_372 87
1270 3300048905 Ga0496102_0776863 Ga0496102_0776863_535_798 87
1271 3300048905 Ga0496102_0822078 Ga0496102_0822078_271_534 87
1272 3300048905 Ga0496102_0954726 Ga0496102_0954726_184_447 87
1273 3300048905 Ga0496102_0986171 Ga0496102_0986171_398_661 87
1274 3300048906 Ga0496103_0246669 Ga0496103_0246669_796_1059 87
1275 3300048906 Ga0496103_0249966 Ga0496103_0249966_423_686 87
1276 3300048906 Ga0496103_0530205 Ga0496103_0530205_63_326 87
1277 3300048907 Ga0496104_0008945 Ga0496104_0008945_8554_8817 87
1278 3300048907 Ga0496104_0027692 Ga0496104_0027692_894_1157 87
1279 3300048907 Ga0496104_0276050 Ga0496104_0276050_1229_1507 87
1280 3300048907 Ga0496104_0483331 Ga0496104_0483331_229_492 87
1281 3300048907 Ga0496104_0623358 Ga0496104_0623358_157_435 87
1282 3300048908 Ga0496105_0032314 Ga0496105_0032314_3160_3438 87
1283 3300048908 Ga0496105_0050263 Ga0496105_0050263_31_294 87
1284 3300048908 Ga0496105_0432689 Ga0496105_0432689_151_414 87
1285 3300048908 Ga0496105_0931103 Ga0496105_0931103_165_428 87
1286 3300048908 Ga0496105_1044509 Ga0496105_1044509_297_560 87
1287 3300048909 Ga0496106_0006039 Ga0496106_0006039_8447_8710 87
1288 3300048909 Ga0496106_0031229 Ga0496106_0031229_2233_2496 87
1289 3300048909 Ga0496106_0082571 Ga0496106_0082571_1438_1701 87
1290 3300048909 Ga0496106_0118035 Ga0496106_0118035_427_705 87
1291 3300048909 Ga0496106_0249318 Ga0496106_0249318_793_1071 87
1292 3300048909 Ga0496106_0268600 Ga0496106_0268600_906_1169 87
1293 3300048909 Ga0496106_0269585 Ga0496106_0269585_615_878 87
1294 3300048909 Ga0496106_1146929 Ga0496106_1146929_147_425 87
1295 3300048910 Ga0496107_0002095 Ga0496107_0002095_2822_3085 87
1296 3300048910 Ga0496107_0037002 Ga0496107_0037002_1707_1985 87
1297 3300048910 Ga0496107_0101070 Ga0496107_0101070_248_511 87
1298 3300048910 Ga0496107_0149565 Ga0496107_0149565_289_552 87
1299 3300048910 Ga0496107_0405892 Ga0496107_0405892_304_582 87
1300 3300048910 Ga0496107_1042523 Ga0496107_1042523_165_428 87
1301 3300048911 Ga0496108_0107049 Ga0496108_0107049_2084_2347 87
1302 3300048911 Ga0496108_0199841 Ga0496108_0199841_1045_1323 87
1303 3300048911 Ga0496108_0223260 Ga0496108_0223260_346_609 87
1304 3300048911 Ga0496108_1379248 Ga0496108_1379248_56_319 87
1305 3300048912 Ga0496109_0024900 Ga0496109_0024900_2116_2379 87
1306 3300048912 Ga0496109_0051840 Ga0496109_0051840_1611_1874 87
1307 3300048912 Ga0496109_0082541 Ga0496109_0082541_2521_2799 87
1308 3300048912 Ga0496109_1382162 Ga0496109_1382162_150_413 87
1309 3300048912 Ga0496109_1486818 Ga0496109_1486818_166_459 87
1310 3300048912 Ga0496109_1630133 Ga0496109_1630133_87_350 87
1311 3300048913 Ga0496110_0045663 Ga0496110_0045663_3201_3464 87
1312 3300048913 Ga0496110_0052068 Ga0496110_0052068_76_339 87
1313 3300048913 Ga0496110_0109226 Ga0496110_0109226_1690_1953 87
1314 3300048913 Ga0496110_0370162 Ga0496110_0370162_700_963 87
1315 3300048913 Ga0496110_0673092 Ga0496110_0673092_400_663 87
1316 3300048913 Ga0496110_0840828 Ga0496110_0840828_146_409 87
1317 3300048913 Ga0496110_1385849 Ga0496110_1385849_161_439 87
1318 3300048913 Ga0496110_1643176 Ga0496110_1643176_162_425 87
1319 3300048914 Ga0496111_0007619 Ga0496111_0007619_205_483 87
1320 3300048914 Ga0496111_0029517 Ga0496111_0029517_2773_3036 87
1321 3300048914 Ga0496111_0599340 Ga0496111_0599340_75_338 87
1322 3300048914 Ga0496111_0621193 Ga0496111_0621193_148_441 87
1323 3300048914 Ga0496111_0834118 Ga0496111_0834118_168_431 87
1324 3300048914 Ga0496111_1040622 Ga0496111_1040622_267_530 87
1325 3300048915 Ga0496112_0000142 Ga0496112_0000142_21196_21459 87
1326 3300048915 Ga0496112_0070420 Ga0496112_0070420_3061_3324 87
1327 3300048915 Ga0496112_0126064 Ga0496112_0126064_1098_1361 87
1328 3300048915 Ga0496112_0126574 Ga0496112_0126574_838_1101 87
1329 3300048915 Ga0496112_0219035 Ga0496112_0219035_1260_1523 87
1330 3300048916 Ga0496113_0136243 Ga0496113_0136243_205_483 87
1331 3300048916 Ga0496113_0471879 Ga0496113_0471879_88_351 87
1332 3300048916 Ga0496113_0661320 Ga0496113_0661320_172_435 87
1333 3300048916 Ga0496113_1054137 Ga0496113_1054137_113_376 87
1334 3300048916 Ga0496113_1597535 Ga0496113_1597535_196_459 87
1335 3300048917 Ga0496114_0140308 Ga0496114_0140308_403_666 87
1336 3300048917 Ga0496114_0164625 Ga0496114_0164625_22_315 87
1337 3300048917 Ga0496114_0633547 Ga0496114_0633547_391_654 87
1338 3300048917 Ga0496114_0678809 Ga0496114_0678809_100_363 87
1339 3300048917 Ga0496114_1756436 Ga0496114_1756436_141_404 87
1340 3300048918 Ga0496115_0008444 Ga0496115_0008444_3046_3309 87
1341 3300048918 Ga0496115_0023426 Ga0496115_0023426_653_916 87
1342 3300048918 Ga0496115_0170574 Ga0496115_0170574_1245_1523 87
1343 3300048918 Ga0496115_0186686 Ga0496115_0186686_510_773 87
1344 3300048918 Ga0496115_0407115 Ga0496115_0407115_750_1013 87
1345 3300048918 Ga0496115_0589998 Ga0496115_0589998_349_627 87
1346 3300048918 Ga0496115_0783863 Ga0496115_0783863_172_435 87
1347 3300048918 Ga0496115_0935919 Ga0496115_0935919_299_562 87
1348 3300048918 Ga0496115_1153158 Ga0496115_1153158_260_523 87
1349 3300048919 Ga0496116_0280195 Ga0496116_0280195_436_699 87
1350 3300048920 Ga0496117_0063557 Ga0496117_0063557_697_960 87
1351 3300048920 Ga0496117_0255088 Ga0496117_0255088_412_675 87
1352 3300048920 Ga0496117_0456721 Ga0496117_0456721_259_522 87
1353 3300048921 Ga0496118_0078432 Ga0496118_0078432_508_771 87
1354 3300048921 Ga0496118_0100325 Ga0496118_0100325_1567_1830 87
1355 3300048921 Ga0496118_0126830 Ga0496118_0126830_967_1230 87
1356 3300048922 Ga0496119_0039804 Ga0496119_0039804_2151_2414 87
1357 3300048922 Ga0496119_0514944 Ga0496119_0514944_102_365 87
1358 3300048923 Ga0496120_0097426 Ga0496120_0097426_968_1231 87
1359 3300048923 Ga0496120_0325430 Ga0496120_0325430_165_428 87
1360 3300048924 Ga0496121_0000365 Ga0496121_0000365_53566_53829 87
1361 3300048924 Ga0496121_0044807 Ga0496121_0044807_1694_1957 87
1362 3300048924 Ga0496121_0049914 Ga0496121_0049914_2308_2571 87
1363 3300048924 Ga0496121_0061871 Ga0496121_0061871_2173_2436 87
1364 3300048924 Ga0496121_0068003 Ga0496121_0068003_835_1098 87
1365 3300048924 Ga0496121_0240431 Ga0496121_0240431_91_354 87
1366 3300048924 Ga0496121_0276243 Ga0496121_0276243_41_304 87
1367 3300048924 Ga0496121_0386034 Ga0496121_0386034_592_855 87
1368 3300048924 Ga0496121_0494961 Ga0496121_0494961_82_345 87
1369 3300048925 Ga0496122_0075294 Ga0496122_0075294_321_584 87
1370 3300048925 Ga0496122_0573552 Ga0496122_0573552_83_346 87
1371 3300048926 Ga0496123_0089507 Ga0496123_0089507_1123_1386 87
1372 3300048926 Ga0496123_0270332 Ga0496123_0270332_40_303 87
1373 3300048927 Ga0496124_0105179 Ga0496124_0105179_1338_1601 87
1374 3300048927 Ga0496124_0260208 Ga0496124_0260208_448_711 87
1375 3300048927 Ga0496124_0330108 Ga0496124_0330108_755_1018 87
1376 3300048927 Ga0496124_0398566 Ga0496124_0398566_75_338 87
1377 3300048927 Ga0496124_0722749 Ga0496124_0722749_50_313 87
1378 3300048928 Ga0496125_0023958 Ga0496125_0023958_488_751 87
1379 3300048928 Ga0496125_0215167 Ga0496125_0215167_23_286 87
1380 3300048928 Ga0496125_0490000 Ga0496125_0490000_126_389 87
1381 3300048928 Ga0496125_0539463 Ga0496125_0539463_326_589 87
1382 3300048928 Ga0496125_0742785 Ga0496125_0742785_151_414 87
1383 3300048929 Ga0496126_0001612 Ga0496126_0001612_7976_8239 87
1384 3300048929 Ga0496126_0010859 Ga0496126_0010859_7204_7467 87
1385 3300048929 Ga0496126_0045532 Ga0496126_0045532_2331_2594 87
1386 3300048929 Ga0496126_0214192 Ga0496126_0214192_407_670 87
1387 3300048929 Ga0496126_0316703 Ga0496126_0316703_70_333 87
1388 3300048929 Ga0496126_0381422 Ga0496126_0381422_801_1064 87
1389 3300048929 Ga0496126_1102541 Ga0496126_1102541_35_298 87
1390 3300048929 Ga0496126_1183727 Ga0496126_1183727_74_337 87
1391 3300049459 Ga0495678_136639 Ga0495678_136639_486_749 87
1392 3300049460 Ga0495682_0055317 Ga0495682_0055317_67_330 87
1393 3300049460 Ga0495682_0164353 Ga0495682_0164353_478_741 87
1394 3300049568 Ga0501031_0002596 Ga0501031_0002596_3662_3925 87
1395 3300049569 Ga0501032_0000366 Ga0501032_0000366_18132_18395 87
1396 3300049570 Ga0501033_0012013 Ga0501033_0012013_4560_4823 87
1397 3300049571 Ga0501034_0000332 Ga0501034_0000332_31933_32196 87
1398 3300049572 Ga0501036_0000220 Ga0501036_0000220_37452_37715 87
1399 3300049572 Ga0501036_0257814 Ga0501036_0257814_53_316 87
1400 3300049572 Ga0501036_0825729 Ga0501036_0825729_115_378 87
1401 3300049573 Ga0501037_0000054 Ga0501037_0000054_105587_105850 87
1402 3300049573 Ga0501037_0340439 Ga0501037_0340439_57_320 87
1403 3300049574 Ga0501038_0009813 Ga0501038_0009813_7369_7632 87
1404 3300049574 Ga0501038_0076510 Ga0501038_0076510_753_1016 87
1405 3300049574 Ga0501038_1204814 Ga0501038_1204814_201_464 87
1406 3300049575 Ga0501039_0016571 Ga0501039_0016571_1902_2165 87
1407 3300049576 Ga0501040_0154974 Ga0501040_0154974_855_1118 87
1408 3300049577 Ga0501041_0666616 Ga0501041_0666616_112_375 87
1409 3300049578 Ga0501042_0075958 Ga0501042_0075958_1225_1488 87
1410 3300049578 Ga0501042_0120612 Ga0501042_0120612_389_652 87
1411 3300049579 Ga0501043_0000338 Ga0501043_0000338_29146_29409 87
1412 3300049580 Ga0501046_0000087 Ga0501046_0000087_69542_69805 87
1413 3300049581 Ga0501047_0001092 Ga0501047_0001092_3922_4185 87
1414 3300049582 Ga0501048_0001217 Ga0501048_0001217_16389_16652 87
1415 3300049582 Ga0501048_0201835 Ga0501048_0201835_75_338 87
1416 3300049583 Ga0501067_0001618 Ga0501067_0001618_4870_5133 87
1417 3300049584 Ga0501068_0000069 Ga0501068_0000069_14046_14309 87
1418 3300049585 Ga0501069_0352058 Ga0501069_0352058_528_791 87
1419 3300049586 Ga0501070_0032173 Ga0501070_0032173_3789_4052 87
1420 3300049586 Ga0501070_0319870 Ga0501070_0319870_774_1037 87
1421 3300049587 Ga0501071_0046123 Ga0501071_0046123_1792_2055 87
1422 3300049587 Ga0501071_0434237 Ga0501071_0434237_623_886 87
1423 3300049588 Ga0501072_0010024 Ga0501072_0010024_1149_1412 87
1424 3300049589 Ga0501073_0000112 Ga0501073_0000112_15965_16228 87
1425 3300049590 Ga0501074_0000225 Ga0501074_0000225_29252_29515 87
1426 3300049592 Ga0501076_1683090 Ga0501076_1683090_195_458 87
1427 3300049741 Ga0501079_0001029 Ga0501079_0001029_17020_17283 87
1428 3300049741 Ga0501079_0148761 Ga0501079_0148761_565_828 87
1429 3300049742 Ga0501080_0001351 Ga0501080_0001351_18429_18692 87
1430 3300049742 Ga0501080_1124482 Ga0501080_1124482_30_293 87
1431 3300049743 Ga0501081_0646690 Ga0501081_0646690_429_692 87
1432 3300049744 Ga0501083_0008891 Ga0501083_0008891_6329_6592 87
1433 3300049761 Ga0501264_023375 Ga0501264_023375_151_414 87
1434 3300049822 Ga0501035_0001855 Ga0501035_0001855_872_1135 87
1435 3300049822 Ga0501035_1061921 Ga0501035_1061921_78_341 87
1436 3300049823 Ga0501044_0000163 Ga0501044_0000163_13227_13490 87
1437 3300049823 Ga0501044_0887203 Ga0501044_0887203_318_581 87
1438 3300049823 Ga0501044_0976201 Ga0501044_0976201_267_530 87
1439 3300049824 Ga0501045_0005738 Ga0501045_0005738_2703_2966 87
1440 3300049824 Ga0501045_0879210 Ga0501045_0879210_46_309 87
1441 3300050489 nmdc:mga03683_181702_c1 nmdc:mga03683_181702_c1_265_528 87
1442 3300050489 nmdc:mga03683_391022_c1 nmdc:mga03683_391022_c1_92_355 87
1443 3300050489 nmdc:mga03683_452661_c1 nmdc:mga03683_452661_c1_253_531 87
1444 3300050489 nmdc:mga03683_514888_c1 nmdc:mga03683_514888_c1_50_313 87
1445 3300050490 nmdc:mga03n38_10398_c1 nmdc:mga03n38_10398_c1_1559_1822 87
1446 3300050490 nmdc:mga03n38_117725_c1 nmdc:mga03n38_117725_c1_76_357 87
1447 3300050490 nmdc:mga03n38_207573_c1 nmdc:mga03n38_207573_c1_256_519 87
1448 3300050491 nmdc:mga00v17_25695_c1 nmdc:mga00v17_25695_c1_340_603 87
1449 3300050491 nmdc:mga00v17_336897_c1 nmdc:mga00v17_336897_c1_451_714 87
1450 3300050491 nmdc:mga00v17_544419_c1 nmdc:mga00v17_544419_c1_416_679 87
1451 3300050491 nmdc:mga00v17_92435_c1 nmdc:mga00v17_92435_c1_1280_1543 87
1452 3300050492 nmdc:mga0yw44_1183844_c1 nmdc:mga0yw44_1183844_c1_211_504 87
1453 3300050492 nmdc:mga0yw44_140348_c1 nmdc:mga0yw44_140348_c1_1064_1327 87
1454 3300050492 nmdc:mga0yw44_26922_c1 nmdc:mga0yw44_26922_c1_603_866 87
1455 3300050492 nmdc:mga0yw44_765421_c1 nmdc:mga0yw44_765421_c1_226_519 87
1456 3300050492 nmdc:mga0yw44_915226_c1 nmdc:mga0yw44_915226_c1_108_371 87
1457 3300050493 nmdc:mga0k408_186686_c1 nmdc:mga0k408_186686_c1_167_430 87
1458 3300050493 nmdc:mga0k408_214824_c1 nmdc:mga0k408_214824_c1_248_511 87
1459 3300050493 nmdc:mga0k408_440120_c1 nmdc:mga0k408_440120_c1_254_532 87
1460 3300050493 nmdc:mga0k408_486440_c1 nmdc:mga0k408_486440_c1_431_694 87
1461 3300050493 nmdc:mga0k408_769293_c1 nmdc:mga0k408_769293_c1_169_432 87
1462 3300050494 nmdc:mga06z11_276119_c1 nmdc:mga06z11_276119_c1_428_691 87
1463 3300050494 nmdc:mga06z11_434920_c1 nmdc:mga06z11_434920_c1_330_593 87
1464 3300050494 nmdc:mga06z11_523537_c1 nmdc:mga06z11_523537_c1_324_587 87
1465 3300050494 nmdc:mga06z11_554276_c1 nmdc:mga06z11_554276_c1_401_664 87
1466 3300050495 nmdc:mga04h51_128210_c1 nmdc:mga04h51_128210_c1_197_460 87
1467 3300050495 nmdc:mga04h51_266893_c1 nmdc:mga04h51_266893_c1_351_614 87
1468 3300050496 nmdc:mga07m45_384351_c1 nmdc:mga07m45_384351_c1_289_552 87
1469 3300050496 nmdc:mga07m45_58342_c1 nmdc:mga07m45_58342_c1_1255_1518 87
1470 3300050507 nmdc:mga05p37_173532_c1 nmdc:mga05p37_173532_c1_610_873 87
1471 3300050508 nmdc:mga09592_185406_c1 nmdc:mga09592_185406_c1_390_653 87
1472 3300050509 nmdc:mga0qj67_876932_c1 nmdc:mga0qj67_876932_c1_190_453 87
1473 3300050510 nmdc:mga06r32_509030_c1 nmdc:mga06r32_509030_c1_889_1152 87
1474 3300050511 nmdc:mga08y16_283079_c1 nmdc:mga08y16_283079_c1_1250_1528 87
1475 3300050511 nmdc:mga08y16_493333_c1 nmdc:mga08y16_493333_c1_949_1212 87
1476 3300050511 nmdc:mga08y16_883096_c1 nmdc:mga08y16_883096_c1_370_633 87
1477 3300050512 nmdc:mga0n895_1101968_c1 nmdc:mga0n895_1101968_c1_415_678 87
1478 3300050512 nmdc:mga0n895_271163_c1 nmdc:mga0n895_271163_c1_354_632 87
1479 3300050512 nmdc:mga0n895_551657_c1 nmdc:mga0n895_551657_c1_86_349 87
1480 3300050512 nmdc:mga0n895_573543_c1 nmdc:mga0n895_573543_c1_32_295 87
1481 3300050513 nmdc:mga0rr50_237140_c1 nmdc:mga0rr50_237140_c1_1127_1390 87
1482 3300050513 nmdc:mga0rr50_36950_c1 nmdc:mga0rr50_36950_c1_2149_2427 87
1483 3300050513 nmdc:mga0rr50_409196_c1 nmdc:mga0rr50_409196_c1_323_586 87
1484 3300050514 nmdc:mga08x19_133398_c1 nmdc:mga08x19_133398_c1_573_836 87
1485 3300050515 nmdc:mga0a205_252505_c1 nmdc:mga0a205_252505_c1_836_1099 87
1486 3300050515 nmdc:mga0a205_596368_c1 nmdc:mga0a205_596368_c1_197_460 87
1487 3300050516 nmdc:mga0sz30_191930_c1 nmdc:mga0sz30_191930_c1_265_528 87
1488 3300050516 nmdc:mga0sz30_209315_c1 nmdc:mga0sz30_209315_c1_494_787 87
1489 3300050516 nmdc:mga0sz30_24939_c1 nmdc:mga0sz30_24939_c1_1165_1428 87
1490 3300050516 nmdc:mga0sz30_550891_c1 nmdc:mga0sz30_550891_c1_36_299 87
1491 3300050516 nmdc:mga0sz30_586922_c1 nmdc:mga0sz30_586922_c1_61_324 87
1492 3300050516 nmdc:mga0sz30_8011_c3 nmdc:mga0sz30_8011_c3_485_748 87
1493 3300053077 Ga0495601_0518683 Ga0495601_0518683_462_740 87
1494 3300053079 Ga0500610_0341235 Ga0500610_0341235_199_462 87
1495 3300053083 Ga0495655_0232042 Ga0495655_0232042_240_503 87
1496 3300053084 Ga0495595_0046016 Ga0495595_0046016_933_1211 87
1497 3300053085 Ga0495619_0018611 Ga0495619_0018611_1750_2028 87
1498 3300053085 Ga0495619_0243635 Ga0495619_0243635_602_895 87
1499 3300053085 Ga0495619_0569325 Ga0495619_0569325_217_480 87
1500 3300053085 Ga0495619_0651863 Ga0495619_0651863_14_277 87
1501 3300053088 Ga0500644_0476671 Ga0500644_0476671_132_395 87
1502 3300053089 Ga0500581_301251 Ga0500581_301251_356_619 87
1503 3300053090 Ga0500646_0290787 Ga0500646_0290787_298_561 87
1504 3300053093 Ga0500651_0005851 Ga0500651_0005851_1424_1687 87
1505 3300053093 Ga0500651_0086963 Ga0500651_0086963_52_315 87
1506 3300053093 Ga0500651_0094249 Ga0500651_0094249_311_574 87
1507 3300053093 Ga0500651_0600647 Ga0500651_0600647_234_497 87
1508 3300053094 Ga0500566_0001887 Ga0500566_0001887_5550_5813 87
1509 3300053094 Ga0500566_0041032 Ga0500566_0041032_1598_1861 87
1510 3300053094 Ga0500566_0413794 Ga0500566_0413794_250_513 87
1511 3300053096 Ga0500641_0005771 Ga0500641_0005771_2528_2791 87
1512 3300053096 Ga0500641_0009492 Ga0500641_0009492_2437_2700 87
1513 3300053098 Ga0500650_0166342 Ga0500650_0166342_342_605 87
1514 3300053102 Ga0500554_001030 Ga0500554_001030_2673_2936 87
1515 3300053102 Ga0500554_023572 Ga0500554_023572_359_622 87
1516 3300053103 Ga0500555_041975 Ga0500555_041975_775_1038 87
1517 3300053103 Ga0500555_134239 Ga0500555_134239_311_574 87
1518 3300053104 Ga0500556_0151586 Ga0500556_0151586_602_865 87
1519 3300053105 Ga0500557_074278 Ga0500557_074278_668_931 87
1520 3300053108 Ga0500562_059119 Ga0500562_059119_39_302 87
1521 3300053108 Ga0500562_132140 Ga0500562_132140_151_414 87
1522 3300053109 Ga0500569_008708 Ga0500569_008708_2034_2297 87
1523 3300053118 Ga0500594_0047027 Ga0500594_0047027_149_412 87
1524 3300053119 Ga0500595_001597 Ga0500595_001597_8214_8477 87
1525 3300053119 Ga0500595_004850 Ga0500595_004850_4209_4472 87
1526 3300053119 Ga0500595_005773 Ga0500595_005773_2191_2454 87
1527 3300053119 Ga0500595_007229 Ga0500595_007229_2061_2324 87
1528 3300053119 Ga0500595_007341 Ga0500595_007341_1819_2082 87
1529 3300053119 Ga0500595_207828 Ga0500595_207828_67_330 87
1530 3300053121 Ga0500607_223857 Ga0500607_223857_249_512 87
1531 3300053122 Ga0500608_069719 Ga0500608_069719_1198_1461 87
1532 3300053123 Ga0500614_248254 Ga0500614_248254_226_489 87
1533 3300053124 Ga0500617_099031 Ga0500617_099031_405_668 87
1534 3300053125 Ga0500618_011413 Ga0500618_011413_129_392 87
1535 3300053125 Ga0500618_022971 Ga0500618_022971_78_341 87
1536 3300053126 Ga0500621_114244 Ga0500621_114244_733_996 87
1537 3300053129 Ga0500628_232751 Ga0500628_232751_177_464 87
1538 3300053130 Ga0500642_0004029 Ga0500642_0004029_1793_2056 87
1539 3300053134 Ga0500658_0154941 Ga0500658_0154941_53_316 87
1540 3300053134 Ga0500658_0210695 Ga0500658_0210695_318_611 87
1541 3300053136 Ga0500559_0006649 Ga0500559_0006649_2997_3260 87
1542 3300053136 Ga0500559_0123354 Ga0500559_0123354_899_1162 87
1543 3300053136 Ga0500559_0532833 Ga0500559_0532833_32_295 87
1544 3300053138 Ga0500564_195924 Ga0500564_195924_91_354 87
1545 3300053139 Ga0500568_0009828 Ga0500568_0009828_2994_3257 87
1546 3300053139 Ga0500568_0129492 Ga0500568_0129492_37_300 87
1547 3300053139 Ga0500568_0134511 Ga0500568_0134511_173_436 87
1548 3300053146 Ga0500588_0402930 Ga0500588_0402930_64_327 87
1549 3300053147 Ga0500589_110958 Ga0500589_110958_384_647 87
1550 3300053148 Ga0500590_044396 Ga0500590_044396_691_954 87
1551 3300053148 Ga0500590_193219 Ga0500590_193219_353_616 87
1552 3300053150 Ga0500603_023551 Ga0500603_023551_602_865 87
1553 3300053151 Ga0500604_0027551 Ga0500604_0027551_1292_1555 87
1554 3300053151 Ga0500604_0208423 Ga0500604_0208423_80_370 87
1555 3300053151 Ga0500604_0252923 Ga0500604_0252923_284_547 87
1556 3300053153 Ga0500616_0000048 Ga0500616_0000048_97192_97455 87
1557 3300053155 Ga0500620_263973 Ga0500620_263973_190_477 87
1558 3300053156 Ga0500622_0029920 Ga0500622_0029920_2577_2840 87
1559 3300053157 Ga0500624_037974 Ga0500624_037974_463_726 87
1560 3300053158 Ga0500627_0046736 Ga0500627_0046736_57_320 87
1561 3300053158 Ga0500627_0209728 Ga0500627_0209728_378_641 87
1562 3300053158 Ga0500627_0385664 Ga0500627_0385664_64_327 87
1563 3300053161 Ga0500634_0026820 Ga0500634_0026820_2655_2918 87
1564 3300053161 Ga0500634_0265218 Ga0500634_0265218_24_287 87
1565 3300053162 Ga0500638_001878 Ga0500638_001878_6617_6880 87
1566 3300053177 Ga0500636_0060938 Ga0500636_0060938_1929_2192 87
1567 3300053178 Ga0500637_0000070 Ga0500637_0000070_34114_34377 87
1568 3300053178 Ga0500637_0089959 Ga0500637_0089959_1426_1689 87
1569 3300053178 Ga0500637_0341081 Ga0500637_0341081_254_517 87
1570 3300053730 Ga0500645_025383 Ga0500645_025383_59_322 87
1571 3300053730 Ga0500645_075112 Ga0500645_075112_482_745 87
1572 3300053731 Ga0500609_006035 Ga0500609_006035_474_737 87
1573 3300053731 Ga0500609_008522 Ga0500609_008522_821_1084 87
1574 3300053732 Ga0500656_034105 Ga0500656_034105_388_651 87
1575 3300053735 Ga0500596_062023 Ga0500596_062023_325_588 87
1576 3300053739 Ga0500587_059540 Ga0500587_059540_154_417 87
1577 3300054114 Ga0501084_0033981 Ga0501084_0033981_1925_2188 87
1578 3300055283 Ga0500661_000547 Ga0500661_000547_6409_6672 87
1579 3300060353 Ga0501082_0059225 Ga0501082_0059225_2699_2962 87
1580 3300060353 Ga0501082_0242365 Ga0501082_0242365_140_403 87
1581 3300060353 Ga0501082_0852811 Ga0501082_0852811_455_718 87
1582 3300060353 Ga0501082_1165193 Ga0501082_1165193_400_663 87
1583 3300061734 Ga0530510_0395187 Ga0530510_0395187_301_564 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19606

DUF6111

Family of unknown function (DUF6111)

1

87

0.99

Feature Viewer

pLDDT pTM Quality
85.56 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map