F494827

General Info

Members Datasets Scaffolds Average Seq Length
1571 485 1571 325

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0243528|Ga0501034_0243528_316_1452
Length 378
Sequence LNVCYRERQAASQAARRGDFIAWRFALNTAPSSAPRSSDVDTFAAAAIRSMGKERRMAGRKITRDDLRQAAEKYKNWGKWGPDDEIGTLNFTSPEDIVAACRLVKKGKVISLALNFDHTGPQGAKSNYPTMGRTNAIHTMIRTGTDAYSGVLDNRGIRAADDMVTMPLQCGTQWDGLGHVFYEDKMWNGYDCREVTSAGAQKCGIEKTKNKMVGRGVLLDVARYKGVDCLEDGYGITNEDLYETAKKQGVELKRGDYIVVRTGMMERCKKAKSWDGYPGGDAPGLAFETLDFVQKTELAALATDTWGAEVRPNNTEGINQPWHWITIPIMGMTMGEIFDVKELADDCAADKTNEYLFVAPAIPITGAVGSPVNPLAIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
100 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
110 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
128 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
129 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
130 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
131 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
133 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
144 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
145 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
146 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
147 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
244 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
253 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
254 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
265 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
266 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
267 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
268 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
269 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
270 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
271 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
272 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
273 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
274 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
275 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
276 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
277 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
278 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
281 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
286 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
287 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
288 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
289 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
290 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
291 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
292 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
293 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
294 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
295 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
296 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
297 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
298 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
314 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
315 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
316 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
317 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
318 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
319 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
320 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
321 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
322 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
332 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
333 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
334 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
338 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
339 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
340 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
362 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
363 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
364 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
365 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
366 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
367 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
368 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
369 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
370 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
371 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
372 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
375 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
376 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
379 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
380 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
381 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
382 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
387 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
388 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
399 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
417 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
418 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
435 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
438 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
439 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
440 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
443 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
444 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
445 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
446 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
451 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
452 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
453 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
454 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
455 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
456 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
457 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
458 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
459 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
460 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
461 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
462 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
463 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
464 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
465 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
466 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
467 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
468 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
476 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
477 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
480 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
481 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
482 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
483 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
484 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
485 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 6.37
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2283477 2162886007 Bacteria 1504
2 2214761879 2209111006 Bacteria 2942
3 ARSoilYngRDRAFT_c00072 3300000042 Bacteria 16897
4 ARcpr5yngRDRAFT_c000051 3300000043 Bacteria 18515
5 ARSoilOldRDRAFT_c000078 3300000044 Bacteria 18538
6 ARCol0yngRDRAFT_1000056 3300000652 Bacteria 20075
7 JGI24739J22299_10000758 3300001989 Bacteria 11749
8 JGI24737J22298_10000192 3300001990 Bacteria 19781
9 JGI24737J22298_10013263 3300001990 Bacteria 2684
10 JGI24737J22298_10016795 3300001990 Bacteria 2362
11 JGI24745J21846_1000940 3300002073 Bacteria 2718
12 JGI24738J21930_10000228 3300002075 Bacteria 15272
13 JGI24749J21850_1004141 3300002076 Bacteria 2026
14 JGI24744J21845_10002515 3300002077 Bacteria 3741
15 JGI24744J21845_10018418 3300002077 Bacteria 1384
16 JGI24035J26624_1000004 3300002126 Bacteria 15166
17 JGI24033J26618_1001964 3300002155 Bacteria 2062
18 JGI24742J22300_10000280 3300002244 Bacteria 7685
19 JGI25406J46586_10011227 3300003203 Bacteria 3937
20 JGI25153J46596_10001339 3300003215 Bacteria 14727
21 JGI26145J50221_1002003 3300003371 Bacteria 1600
22 JGI25405J52794_10017859 3300003911 Bacteria 1413
23 Ga0065716_1001681 3300005277 Bacteria 4222
24 Ga0065704_10091392 3300005289 Bacteria 2673
25 Ga0065712_10001853 3300005290 Bacteria 6353
26 Ga0065712_10068579 3300005290 Bacteria 9792
27 Ga0065712_10092864 3300005290 Bacteria 2315
28 Ga0065715_10000703 3300005293 Bacteria 21468
29 Ga0065715_10089046 3300005293 Bacteria 15655
30 Ga0065707_10008288 3300005295 Bacteria 3280
31 Ga0065707_10115406 3300005295 Bacteria 2268
32 Ga0070658_10005628 3300005327 Bacteria 10166
33 Ga0070658_10006316 3300005327 Bacteria 9600
34 Ga0070676_10000092 3300005328 Bacteria 31160
35 Ga0070676_10049119 3300005328 Bacteria 2469
36 Ga0070683_100000314 3300005329 Bacteria 33370
37 Ga0070683_100016906 3300005329 Bacteria 6437
38 Ga0070683_100304325 3300005329 Bacteria 1517
39 Ga0070690_100042717 3300005330 Bacteria 2871
40 Ga0070690_100086935 3300005330 Bacteria 2053
41 Ga0070670_100050469 3300005331 Bacteria 3575
42 Ga0070670_100166944 3300005331 Bacteria 1909
43 Ga0068869_100000904 3300005334 Bacteria 17095
44 Ga0068869_100050831 3300005334 Bacteria 3005
45 Ga0068869_100137127 3300005334 Bacteria 1886
46 Ga0070666_10034905 3300005335 Bacteria 3333
47 Ga0070680_100001262 3300005336 Bacteria 18281
48 Ga0070680_100009556 3300005336 Bacteria 7449
49 Ga0070680_100021492 3300005336 Bacteria 5129
50 Ga0070680_100026796 3300005336 Bacteria 4610
51 Ga0070680_100029631 3300005336 Bacteria 4395
52 Ga0070680_100128960 3300005336 Bacteria 2115
53 Ga0070680_100153518 3300005336 Bacteria 1934
54 Ga0070680_100429233 3300005336 Bacteria 1128
55 Ga0070682_100000230 3300005337 Bacteria 40502
56 Ga0070682_100011914 3300005337 Bacteria 4974
57 Ga0070682_100033163 3300005337 Bacteria 3136
58 Ga0070682_100213597 3300005337 Bacteria 1369
59 Ga0068868_100000973 3300005338 Bacteria 19502
60 Ga0068868_100017567 3300005338 Bacteria 5333
61 Ga0068868_100048149 3300005338 Bacteria 3343
62 Ga0068868_100136642 3300005338 Bacteria 2010
63 Ga0070660_100010653 3300005339 Bacteria 6502
64 Ga0070660_100012116 3300005339 Bacteria 6157
65 Ga0070660_100021744 3300005339 Bacteria 4734
66 Ga0070660_100097243 3300005339 Bacteria 2329
67 Ga0070660_100102580 3300005339 Bacteria 2267
68 Ga0070660_100250644 3300005339 Bacteria 1444
69 Ga0070689_100000145 3300005340 Bacteria 40970
70 Ga0070689_100004756 3300005340 Bacteria 9211
71 Ga0070689_100035175 3300005340 Bacteria 3826
72 Ga0070689_100042241 3300005340 Bacteria 3501
73 Ga0070689_100084240 3300005340 Bacteria 2498
74 Ga0070689_100172013 3300005340 Bacteria 1755
75 Ga0070691_10001660 3300005341 Bacteria 9648
76 Ga0070691_10085142 3300005341 Bacteria 1553
77 Ga0070687_100000496 3300005343 Bacteria 13107
78 Ga0070687_100106456 3300005343 Bacteria 1579
79 Ga0070687_100145634 3300005343 Bacteria 1384
80 Ga0070687_100155813 3300005343 Bacteria 1345
81 Ga0070661_100000808 3300005344 Bacteria 22497
82 Ga0070661_100037160 3300005344 Bacteria 3542
83 Ga0070661_100048854 3300005344 Bacteria 3098
84 Ga0070692_10000115 3300005345 Bacteria 18618
85 Ga0070692_10011691 3300005345 Bacteria 4037
86 Ga0070692_10012341 3300005345 Bacteria 3951
87 Ga0070692_10093303 3300005345 Bacteria 1639
88 Ga0070668_100001616 3300005347 Bacteria 16309
89 Ga0070668_100048334 3300005347 Bacteria 3271
90 Ga0070668_100116840 3300005347 Bacteria 2128
91 Ga0070668_100139188 3300005347 Bacteria 1955
92 Ga0070668_100417250 3300005347 Bacteria 1149
93 Ga0070669_100000343 3300005353 Bacteria 36254
94 Ga0070669_100005282 3300005353 Bacteria 9326
95 Ga0070669_100015915 3300005353 Bacteria 5365
96 Ga0070669_100035524 3300005353 Bacteria 3612
97 Ga0070669_100198995 3300005353 Bacteria 1575
98 Ga0070675_100000210 3300005354 Bacteria 37423
99 Ga0070675_100111668 3300005354 Bacteria 2313
100 Ga0070675_100397833 3300005354 Bacteria 1228
101 Ga0070671_100007711 3300005355 Bacteria 8599
102 Ga0070671_100013098 3300005355 Bacteria 6681
103 Ga0070674_100000733 3300005356 Bacteria 16737
104 Ga0070674_100027408 3300005356 Bacteria 3733
105 Ga0070674_100050102 3300005356 Bacteria 2874
106 Ga0070674_100098307 3300005356 Bacteria 2127
107 Ga0070673_100000130 3300005364 Bacteria 35440
108 Ga0070673_100049011 3300005364 Bacteria 3296
109 Ga0070673_100146254 3300005364 Bacteria 1998
110 Ga0070688_100001035 3300005365 Bacteria 13972
111 Ga0070688_100013726 3300005365 Bacteria 4577
112 Ga0070688_100094678 3300005365 Bacteria 1958
113 Ga0070659_100040327 3300005366 Bacteria 3648
114 Ga0070659_100332754 3300005366 Bacteria 1271
115 Ga0070667_100001673 3300005367 Bacteria 19816
116 Ga0070667_100060991 3300005367 Bacteria 3193
117 Ga0070667_100093563 3300005367 Bacteria 2588
118 Ga0070667_100276956 3300005367 Bacteria 1506
119 Ga0070703_10010226 3300005406 Bacteria 2645
120 Ga0070709_10003656 3300005434 Bacteria 8255
121 Ga0070709_10140909 3300005434 Bacteria 1657
122 Ga0070714_100012550 3300005435 Bacteria 6770
123 Ga0070714_100020155 3300005435 Bacteria 5442
124 Ga0070714_100072245 3300005435 Bacteria 2986
125 Ga0070714_100075238 3300005435 Bacteria 2930
126 Ga0070714_100138952 3300005435 Bacteria 2178
127 Ga0070714_100240249 3300005435 Bacteria 1671
128 Ga0070713_100000742 3300005436 Bacteria 20887
129 Ga0070713_100007771 3300005436 Bacteria 7554
130 Ga0070713_100012709 3300005436 Bacteria 6186
131 Ga0070713_100017722 3300005436 Bacteria 5397
132 Ga0070713_100148247 3300005436 Bacteria 2085
133 Ga0070713_100151328 3300005436 Bacteria 2064
134 Ga0070713_100186983 3300005436 Bacteria 1865
135 Ga0070710_10003673 3300005437 Bacteria 7256
136 Ga0070710_10038306 3300005437 Bacteria 2632
137 Ga0070710_10070623 3300005437 Bacteria 2012
138 Ga0070710_10101605 3300005437 Unclassified 1713
139 Ga0070701_10000012 3300005438 Bacteria 46531
140 Ga0070701_10004661 3300005438 Bacteria 5581
141 Ga0070701_10055305 3300005438 Bacteria 2073
142 Ga0070701_10135693 3300005438 Bacteria 1402
143 Ga0070711_100066210 3300005439 Bacteria 2530
144 Ga0070711_100136541 3300005439 Bacteria 1833
145 Ga0070711_100145812 3300005439 Bacteria 1780
146 Ga0070711_100208724 3300005439 Bacteria 1511
147 Ga0070705_100000280 3300005440 Bacteria 30477
148 Ga0070705_100000341 3300005440 Bacteria 27488
149 Ga0070705_100014226 3300005440 Bacteria 4089
150 Ga0070705_100030270 3300005440 Bacteria 2986
151 Ga0070705_100119226 3300005440 Bacteria 1700
152 Ga0070705_100252081 3300005440 Bacteria 1240
153 Ga0070700_100000800 3300005441 Bacteria 15435
154 Ga0070700_100001845 3300005441 Bacteria 10690
155 Ga0070700_100003630 3300005441 Bacteria 7984
156 Ga0070694_100001081 3300005444 Bacteria 15608
157 Ga0070694_100003068 3300005444 Bacteria 9940
158 Ga0070694_100015908 3300005444 Bacteria 4733
159 Ga0070708_100003444 3300005445 Bacteria 12383
160 Ga0070708_100025386 3300005445 Bacteria 5065
161 Ga0070708_100427786 3300005445 Bacteria 1249
162 Ga0070663_100000097 3300005455 Bacteria 39662
163 Ga0070663_100058431 3300005455 Bacteria 2769
164 Ga0070678_100000452 3300005456 Bacteria 19516
165 Ga0070678_100157050 3300005456 Bacteria 1838
166 Ga0070678_100157268 3300005456 Bacteria 1837
167 Ga0070678_100197657 3300005456 Bacteria 1657
168 Ga0070662_100015603 3300005457 Bacteria 5092
169 Ga0070662_100063866 3300005457 Bacteria 2694
170 Ga0070681_10006652 3300005458 Bacteria 11252
171 Ga0070681_10009132 3300005458 Bacteria 9741
172 Ga0070681_10044914 3300005458 Bacteria 4422
173 Ga0070681_10256345 3300005458 Bacteria 1661
174 Ga0070681_10354795 3300005458 Bacteria 1377
175 Ga0068867_100000731 3300005459 Bacteria 22005
176 Ga0068867_100001793 3300005459 Bacteria 14929
177 Ga0068867_100102017 3300005459 Bacteria 2193
178 Ga0068867_100353154 3300005459 Bacteria 1227
179 Ga0070685_10001019 3300005466 Bacteria 15068
180 Ga0070706_100144582 3300005467 Bacteria 2221
181 Ga0070707_100021957 3300005468 Bacteria 6035
182 Ga0070707_100194251 3300005468 Bacteria 1979
183 Ga0070698_100010391 3300005471 Bacteria 9941
184 Ga0070699_100145447 3300005518 Bacteria 2094
185 Ga0070699_100192977 3300005518 Bacteria 1810
186 Ga0070699_100229168 3300005518 Bacteria 1656
187 Ga0070679_100006070 3300005530 Bacteria 11241
188 Ga0070679_100011066 3300005530 Bacteria 8583
189 Ga0070679_100018327 3300005530 Bacteria 6792
190 Ga0070679_100025086 3300005530 Bacteria 5847
191 Ga0070679_100040460 3300005530 Bacteria 4637
192 Ga0070679_100075598 3300005530 Bacteria 3358
193 Ga0070679_100195437 3300005530 Bacteria 1991
194 Ga0070684_100000157 3300005535 Bacteria 46152
195 Ga0070684_100010989 3300005535 Bacteria 7199
196 Ga0070684_100142001 3300005535 Bacteria 2171
197 Ga0070684_100177606 3300005535 Bacteria 1936
198 Ga0070684_100247239 3300005535 Bacteria 1630
199 Ga0070697_100000662 3300005536 Bacteria 25954
200 Ga0070697_100029236 3300005536 Bacteria 4417
201 Ga0070697_100049080 3300005536 Bacteria 3424
202 Ga0070697_100110456 3300005536 Bacteria 2291
203 Ga0070697_100146355 3300005536 Bacteria 1989
204 Ga0070697_100270089 3300005536 Bacteria 1457
205 Ga0068853_100001479 3300005539 Bacteria 17079
206 Ga0068853_100135195 3300005539 Bacteria 2209
207 Ga0068853_100135563 3300005539 Bacteria 2207
208 Ga0070672_100001119 3300005543 Bacteria 16354
209 Ga0070672_100017010 3300005543 Bacteria 5222
210 Ga0070672_100238329 3300005543 Bacteria 1529
211 Ga0070686_100000127 3300005544 Bacteria 53295
212 Ga0070686_100004451 3300005544 Bacteria 7730
213 Ga0070686_100005369 3300005544 Bacteria 7088
214 Ga0070686_100008849 3300005544 Bacteria 5641
215 Ga0070695_100002680 3300005545 Bacteria 10305
216 Ga0070695_100007601 3300005545 Bacteria 6421
217 Ga0070695_100025649 3300005545 Bacteria 3641
218 Ga0070695_100028348 3300005545 Bacteria 3474
219 Ga0070695_100106539 3300005545 Bacteria 1896
220 Ga0070696_100000013 3300005546 Bacteria 78718
221 Ga0070696_100000219 3300005546 Bacteria 34543
222 Ga0070696_100000420 3300005546 Bacteria 26506
223 Ga0070696_100020633 3300005546 Bacteria 4465
224 Ga0070696_100064873 3300005546 Bacteria 2559
225 Ga0070696_100067819 3300005546 Bacteria 2504
226 Ga0070696_100140834 3300005546 Bacteria 1763
227 Ga0070696_100347482 3300005546 Bacteria 1148
228 Ga0070693_100000513 3300005547 Bacteria 17324
229 Ga0070693_100004642 3300005547 Bacteria 6522
230 Ga0070693_100014115 3300005547 Bacteria 4085
231 Ga0070665_100034712 3300005548 Bacteria 5073
232 Ga0070665_100043936 3300005548 Bacteria 4488
233 Ga0070704_100007011 3300005549 Bacteria 6685
234 Ga0070704_100011536 3300005549 Bacteria 5420
235 Ga0070704_100032242 3300005549 Bacteria 3532
236 Ga0070704_100077824 3300005549 Bacteria 2431
237 Ga0070704_100153414 3300005549 Bacteria 1814
238 Ga0068855_100004578 3300005563 Bacteria 16892
239 Ga0068855_100045601 3300005563 Bacteria 5185
240 Ga0070664_100000326 3300005564 Bacteria 34609
241 Ga0070664_100381147 3300005564 Unclassified 1287
242 Ga0068857_100000063 3300005577 Bacteria 60089
243 Ga0068857_100381174 3300005577 Bacteria 1309
244 Ga0068857_100447151 3300005577 Bacteria 1208
245 Ga0068854_100000220 3300005578 Bacteria 38637
246 Ga0068854_100159716 3300005578 Bacteria 1744
247 Ga0068856_100118343 3300005614 Bacteria 2650
248 Ga0068856_100203415 3300005614 Bacteria 1995
249 Ga0068856_100328903 3300005614 Bacteria 1546
250 Ga0070702_100003995 3300005615 Bacteria 6691
251 Ga0070702_100017330 3300005615 Bacteria 3713
252 Ga0070702_100021454 3300005615 Bacteria 3398
253 Ga0070702_100026740 3300005615 Bacteria 3104
254 Ga0068852_100001063 3300005616 Bacteria 18125
255 Ga0068852_100002195 3300005616 Bacteria 13392
256 Ga0068852_100082342 3300005616 Bacteria 2859
257 Ga0068859_100005597 3300005617 Bacteria 12800
258 Ga0068859_100051799 3300005617 Bacteria 4127
259 Ga0068859_100115460 3300005617 Bacteria 2749
260 Ga0068859_100244261 3300005617 Bacteria 1885
261 Ga0068859_100574966 3300005617 Bacteria 1220
262 Ga0068864_100005737 3300005618 Bacteria 10181
263 Ga0068864_100027488 3300005618 Bacteria 4805
264 Ga0068864_100114423 3300005618 Bacteria 2406
265 Ga0068864_100151635 3300005618 Bacteria 2100
266 Ga0068864_100188300 3300005618 Bacteria 1890
267 Ga0068866_10001331 3300005718 Bacteria 10697
268 Ga0068866_10014540 3300005718 Bacteria 3478
269 Ga0068861_100000101 3300005719 Bacteria 42384
270 Ga0068861_100062452 3300005719 Bacteria 2862
271 Ga0068861_100126279 3300005719 Bacteria 2070
272 Ga0068870_10000028 3300005840 Bacteria 45368
273 Ga0068870_10044600 3300005840 Bacteria 2317
274 Ga0068863_100000386 3300005841 Bacteria 44817
275 Ga0068863_100047708 3300005841 Bacteria 4062
276 Ga0068863_100347059 3300005841 Bacteria 1445
277 Ga0068858_100001144 3300005842 Bacteria 27440
278 Ga0068858_100019509 3300005842 Bacteria 6341
279 Ga0068858_100074574 3300005842 Bacteria 3150
280 Ga0068858_100310827 3300005842 Bacteria 1505
281 Ga0068858_100480727 3300005842 Bacteria 1199
282 Ga0068860_100001254 3300005843 Bacteria 27668
283 Ga0068860_100001979 3300005843 Bacteria 21661
284 Ga0068860_100164537 3300005843 Bacteria 2140
285 Ga0068860_100302330 3300005843 Bacteria 1567
286 Ga0068860_100446328 3300005843 Bacteria 1286
287 Ga0068862_100002105 3300005844 Bacteria 17935
288 Ga0068862_100020980 3300005844 Bacteria 5459
289 Ga0068862_100021368 3300005844 Bacteria 5407
290 Ga0068862_100081103 3300005844 Bacteria 2814
291 Ga0081455_10000695 3300005937 Bacteria 43608
292 Ga0081455_10001514 3300005937 Bacteria 28648
293 Ga0081455_10003644 3300005937 Bacteria 17647
294 Ga0081455_10005867 3300005937 Bacteria 13349
295 Ga0081455_10009771 3300005937 Bacteria 9824
296 Ga0081455_10035751 3300005937 Bacteria 4433
297 Ga0081455_10036594 3300005937 Bacteria 4367
298 Ga0081455_10073090 3300005937 Bacteria 2836
299 Ga0081538_10008218 3300005981 Bacteria 8900
300 Ga0081538_10024316 3300005981 Bacteria 4319
301 Ga0081538_10029366 3300005981 Bacteria 3758
302 Ga0081538_10052930 3300005981 Bacteria 2419
303 Ga0081538_10053616 3300005981 Bacteria 2395
304 Ga0081540_1010389 3300005983 Bacteria 6310
305 Ga0081539_10008460 3300005985 Bacteria 8954
306 Ga0081539_10017738 3300005985 Bacteria 4980
307 Ga0070717_10000362 3300006028 Bacteria 29222
308 Ga0070717_10106201 3300006028 Bacteria 2391
309 Ga0070717_10208721 3300006028 Bacteria 1713
310 Ga0075365_10002433 3300006038 Bacteria 9131
311 Ga0075368_10001831 3300006042 Bacteria 6836
312 Ga0075363_100005920 3300006048 Bacteria 5508
313 Ga0075364_10084515 3300006051 Bacteria 2102
314 Ga0075432_10005143 3300006058 Bacteria 4456
315 Ga0070715_10005613 3300006163 Bacteria 4199
316 Ga0070715_10017658 3300006163 Bacteria 2704
317 Ga0070712_100010379 3300006175 Bacteria 5876
318 Ga0070712_100018769 3300006175 Bacteria 4498
319 Ga0070712_100022227 3300006175 Bacteria 4175
320 Ga0070712_100026888 3300006175 Bacteria 3838
321 Ga0070712_100106708 3300006175 Bacteria 2083
322 Ga0075362_10011968 3300006177 Bacteria 3431
323 Ga0075367_10005350 3300006178 Bacteria 6360
324 Ga0075366_10004444 3300006195 Bacteria 7525
325 Ga0097621_100000024 3300006237 Bacteria 81390
326 Ga0097621_100000577 3300006237 Bacteria 25806
327 Ga0097621_100002663 3300006237 Bacteria 12217
328 Ga0097621_100026237 3300006237 Bacteria 4568
329 Ga0097621_100050001 3300006237 Bacteria 3398
330 Ga0097621_100272893 3300006237 Bacteria 1486
331 Ga0075370_10026829 3300006353 Bacteria 3193
332 Ga0075370_10050573 3300006353 Bacteria 2357
333 Ga0075370_10145853 3300006353 Bacteria 1385
334 Ga0068871_100000298 3300006358 Bacteria 34572
335 Ga0068871_100011775 3300006358 Bacteria 6428
336 Ga0068871_100017662 3300006358 Bacteria 5403
337 Ga0068871_100049575 3300006358 Bacteria 3394
338 Ga0068871_100127376 3300006358 Bacteria 2156
339 Ga0075428_100004286 3300006844 Bacteria 15706
340 Ga0075428_100005533 3300006844 Bacteria 14053
341 Ga0075428_100032237 3300006844 Bacteria 5787
342 Ga0075428_100040443 3300006844 Bacteria 5129
343 Ga0075428_100047522 3300006844 Bacteria 4713
344 Ga0075428_100179628 3300006844 Bacteria 2291
345 Ga0075428_100288240 3300006844 Bacteria 1766
346 Ga0075428_100305362 3300006844 Bacteria 1711
347 Ga0075430_100000263 3300006846 Bacteria 36938
348 Ga0075430_100044069 3300006846 Bacteria 3773
349 Ga0075430_100127144 3300006846 Bacteria 2124
350 Ga0075431_100038681 3300006847 Bacteria 4913
351 Ga0075431_100074545 3300006847 Bacteria 3501
352 Ga0075431_100104470 3300006847 Bacteria 2923
353 Ga0075431_100135659 3300006847 Bacteria 2537
354 Ga0075431_100136259 3300006847 Bacteria 2531
355 Ga0075431_100163857 3300006847 Bacteria 2286
356 Ga0075431_100227825 3300006847 Bacteria 1900
357 Ga0075431_100350030 3300006847 Bacteria 1485
358 Ga0075433_10001797 3300006852 Bacteria 16081
359 Ga0075433_10005891 3300006852 Bacteria 9653
360 Ga0075433_10114401 3300006852 Bacteria 2394
361 Ga0075433_10134618 3300006852 Bacteria 2197
362 Ga0075433_10201182 3300006852 Bacteria 1771
363 Ga0075434_100006810 3300006871 Bacteria 10513
364 Ga0075434_100016928 3300006871 Bacteria 7013
365 Ga0075434_100033118 3300006871 Bacteria 5099
366 Ga0075434_100066035 3300006871 Bacteria 3603
367 Ga0075434_100264935 3300006871 Bacteria 1738
368 Ga0075429_100000683 3300006880 Bacteria 26402
369 Ga0075429_100002564 3300006880 Bacteria 15314
370 Ga0075429_100093476 3300006880 Bacteria 2623
371 Ga0075429_100154989 3300006880 Bacteria 2006
372 Ga0075429_100260608 3300006880 Bacteria 1518
373 Ga0075429_100362333 3300006880 Bacteria 1269
374 Ga0068865_100000125 3300006881 Bacteria 39482
375 Ga0068865_100000578 3300006881 Bacteria 20510
376 Ga0068865_100042109 3300006881 Bacteria 3112
377 Ga0075436_100009383 3300006914 Bacteria 6691
378 Ga0075436_100009667 3300006914 Bacteria 6601
379 Ga0075436_100012422 3300006914 Bacteria 5837
380 Ga0075436_100043807 3300006914 Bacteria 3086
381 Ga0075436_100043922 3300006914 Bacteria 3081
382 Ga0075436_100045947 3300006914 Bacteria 3012
383 Ga0075436_100089561 3300006914 Bacteria 2138
384 Ga0075436_100195258 3300006914 Bacteria 1433
385 Ga0075436_100224749 3300006914 Bacteria 1332
386 Ga0097620_100005597 3300006931 Bacteria 12800
387 Ga0097620_100051799 3300006931 Bacteria 4127
388 Ga0097620_100115455 3300006931 Bacteria 2749
389 Ga0097620_100244260 3300006931 Bacteria 1885
390 Ga0097620_100574951 3300006931 Bacteria 1220
391 Ga0075435_100006012 3300007076 Bacteria 8543
392 Ga0075435_100028795 3300007076 Bacteria 4358
393 Ga0075435_100104829 3300007076 Bacteria 2346
394 Ga0075435_100216468 3300007076 Bacteria 1626
395 Ga0075435_100220781 3300007076 Bacteria 1609
396 Ga0099794_10004112 3300007265 Bacteria 5668
397 Ga0099794_10015536 3300007265 Bacteria 3363
398 Ga0099794_10101765 3300007265 Bacteria 1434
399 Ga0099795_10066103 3300007788 Bacteria 1353
400 Ga0105251_10022919 3300009011 Bacteria 3232
401 Ga0105251_10051476 3300009011 Bacteria 1964
402 Ga0105250_10032348 3300009092 Bacteria 2100
403 Ga0105240_10008260 3300009093 Bacteria 14901
404 Ga0105240_10012247 3300009093 Bacteria 11849
405 Ga0105240_10060094 3300009093 Bacteria 4739
406 Ga0105240_10270749 3300009093 Bacteria 1956
407 Ga0111539_10000548 3300009094 Bacteria 47926
408 Ga0111539_10007739 3300009094 Bacteria 13721
409 Ga0111539_10088284 3300009094 Bacteria 3643
410 Ga0111539_10107018 3300009094 Bacteria 3281
411 Ga0111539_10120552 3300009094 Bacteria 3073
412 Ga0111539_10170459 3300009094 Bacteria 2543
413 Ga0111539_10255286 3300009094 Bacteria 2041
414 Ga0105245_10000173 3300009098 Bacteria 61528
415 Ga0105247_10010178 3300009101 Bacteria 5695
416 Ga0105247_10018360 3300009101 Bacteria 4197
417 Ga0105247_10078781 3300009101 Bacteria 2073
418 Ga0114129_10010899 3300009147 Bacteria 12950
419 Ga0114129_10037461 3300009147 Bacteria 6846
420 Ga0114129_10060974 3300009147 Bacteria 5273
421 Ga0114129_10148960 3300009147 Bacteria 3203
422 Ga0114129_10168064 3300009147 Bacteria 2992
423 Ga0114129_10216573 3300009147 Bacteria 2586
424 Ga0114129_10222591 3300009147 Bacteria 2545
425 Ga0114129_10491268 3300009147 Bacteria 1604
426 Ga0114129_10536669 3300009147 Bacteria 1523
427 Ga0105243_10000377 3300009148 Bacteria 47825
428 Ga0105243_10130408 3300009148 Bacteria 2132
429 Ga0105243_10177832 3300009148 Bacteria 1848
430 Ga0105241_10001249 3300009174 Bacteria 19401
431 Ga0105241_10050624 3300009174 Bacteria 3166
432 Ga0105241_10090738 3300009174 Bacteria 2410
433 Ga0105241_10166892 3300009174 Bacteria 1815
434 Ga0105242_10000419 3300009176 Bacteria 33812
435 Ga0105242_10003223 3300009176 Bacteria 12720
436 Ga0105242_10018898 3300009176 Bacteria 5396
437 Ga0105242_10019401 3300009176 Bacteria 5327
438 Ga0105242_10232565 3300009176 Bacteria 1652
439 Ga0105248_10001498 3300009177 Bacteria 25979
440 Ga0105248_10005453 3300009177 Bacteria 13978
441 Ga0105248_10030229 3300009177 Bacteria 6047
442 Ga0105248_10060632 3300009177 Bacteria 4248
443 Ga0105248_10066775 3300009177 Bacteria 4038
444 Ga0105237_10018823 3300009545 Bacteria 7142
445 Ga0105237_10051338 3300009545 Bacteria 4142
446 Ga0105237_10052618 3300009545 Bacteria 4087
447 Ga0105237_10071358 3300009545 Bacteria 3468
448 Ga0105238_10009168 3300009551 Bacteria 9905
449 Ga0105238_10060357 3300009551 Bacteria 3797
450 Ga0105238_10173375 3300009551 Bacteria 2133
451 Ga0105249_10001416 3300009553 Bacteria 20980
452 Ga0105249_10037157 3300009553 Bacteria 4420
453 Ga0105249_10069953 3300009553 Bacteria 3239
454 Ga0105249_10205014 3300009553 Bacteria 1932
455 Ga0105249_10443499 3300009553 Bacteria 1336
456 Ga0105239_10023302 3300010375 Bacteria 6819
457 Ga0105239_10093407 3300010375 Bacteria 3322
458 Ga0105239_10106854 3300010375 Bacteria 3100
459 Ga0105246_10000819 3300011119 Bacteria 17695
460 Ga0157335_1001577 3300012492 Bacteria 1267
461 Ga0157341_1000385 3300012494 Bacteria 2180
462 Ga0157319_1001735 3300012497 Bacteria 1167
463 Ga0157338_1001655 3300012515 Bacteria 1634
464 Ga0157371_10044396 3300013102 Bacteria 3165
465 Ga0157371_10178225 3300013102 Bacteria 1520
466 Ga0157370_10033007 3300013104 Bacteria 5048
467 Ga0157370_10302090 3300013104 Bacteria 1477
468 Ga0157369_10052824 3300013105 Bacteria 4394
469 Ga0157369_10126571 3300013105 Bacteria 2708
470 Ga0157374_10000410 3300013296 Bacteria 38820
471 Ga0157374_10044993 3300013296 Bacteria 4084
472 Ga0157378_10000993 3300013297 Bacteria 25998
473 Ga0157378_10001410 3300013297 Bacteria 21595
474 Ga0157378_10042383 3300013297 Bacteria 4040
475 Ga0157378_10046245 3300013297 Bacteria 3869
476 Ga0157378_10059979 3300013297 Bacteria 3395
477 Ga0163162_10001508 3300013306 Bacteria 21697
478 Ga0163162_10089436 3300013306 Bacteria 3160
479 Ga0163162_10099712 3300013306 Bacteria 2996
480 Ga0157372_10007010 3300013307 Bacteria 12005
481 Ga0157372_10009504 3300013307 Bacteria 10341
482 Ga0157372_10026237 3300013307 Bacteria 6339
483 Ga0157375_10000283 3300013308 Bacteria 46225
484 Ga0157375_10157269 3300013308 Bacteria 2412
485 Ga0157375_10178388 3300013308 Bacteria 2275
486 Ga0163163_10000757 3300014325 Bacteria 27476
487 Ga0163163_10014362 3300014325 Bacteria 7280
488 Ga0163163_10139115 3300014325 Bacteria 2470
489 Ga0163163_10280137 3300014325 Bacteria 1719
490 Ga0163163_10380817 3300014325 Bacteria 1468
491 Ga0157380_10000095 3300014326 Bacteria 48588
492 Ga0157380_10087567 3300014326 Bacteria 2561
493 Ga0157380_10188531 3300014326 Bacteria 1818
494 Ga0157377_10068280 3300014745 Bacteria 2048
495 Ga0157379_10014320 3300014968 Bacteria 6958
496 Ga0157376_10002003 3300014969 Bacteria 13650
497 Ga0182007_10030378 3300015262 Bacteria 1847
498 Ga0163161_10001324 3300017792 Bacteria 18424
499 Ga0163161_10051420 3300017792 Bacteria 2984
500 Ga0163161_10266938 3300017792 Bacteria 1338
501 Ga0224572_1013092 3300024225 Bacteria 1581
502 Ga0207666_1000045 3300025271 Bacteria 24475
503 Ga0207673_1000430 3300025290 Bacteria 4343
504 Ga0209758_1000435 3300025297 Bacteria 70539
505 Ga0207426_1024338 3300025302 Bacteria 2056
506 Ga0207697_10000551 3300025315 Bacteria 21235
507 Ga0207697_10005406 3300025315 Bacteria 5939
508 Ga0207697_10054727 3300025315 Bacteria 1654
509 Ga0207653_10006164 3300025885 Bacteria 3737
510 Ga0207653_10008081 3300025885 Bacteria 3280
511 Ga0207682_10000065 3300025893 Bacteria 46642
512 Ga0207682_10000594 3300025893 Bacteria 16787
513 Ga0207692_10010364 3300025898 Bacteria 3926
514 Ga0207692_10024632 3300025898 Bacteria 2800
515 Ga0207692_10088606 3300025898 Unclassified 1673
516 Ga0207642_10000599 3300025899 Bacteria 11075
517 Ga0207642_10002207 3300025899 Bacteria 6037
518 Ga0207710_10001154 3300025900 Bacteria 13449
519 Ga0207710_10004887 3300025900 Bacteria 5812
520 Ga0207710_10006311 3300025900 Bacteria 5069
521 Ga0207688_10000039 3300025901 Bacteria 44849
522 Ga0207688_10005353 3300025901 Bacteria 6969
523 Ga0207688_10030901 3300025901 Bacteria 2955
524 Ga0207688_10133572 3300025901 Bacteria 1456
525 Ga0207688_10147991 3300025901 Bacteria 1385
526 Ga0207680_10001632 3300025903 Bacteria 10603
527 Ga0207680_10053905 3300025903 Bacteria 2416
528 Ga0207680_10074569 3300025903 Bacteria 2113
529 Ga0207680_10084516 3300025903 Bacteria 2003
530 Ga0207680_10128583 3300025903 Bacteria 1667
531 Ga0207647_10003499 3300025904 Bacteria 11777
532 Ga0207647_10007379 3300025904 Bacteria 7949
533 Ga0207647_10065269 3300025904 Bacteria 2210
534 Ga0207685_10072764 3300025905 Bacteria 1398
535 Ga0207699_10013894 3300025906 Bacteria 4135
536 Ga0207699_10015406 3300025906 Bacteria 3970
537 Ga0207699_10053999 3300025906 Bacteria 2385
538 Ga0207699_10080133 3300025906 Bacteria 2022
539 Ga0207645_10000080 3300025907 Bacteria 68968
540 Ga0207645_10017153 3300025907 Bacteria 4782
541 Ga0207645_10018253 3300025907 Bacteria 4620
542 Ga0207643_10000135 3300025908 Bacteria 49853
543 Ga0207643_10001614 3300025908 Bacteria 12707
544 Ga0207643_10028527 3300025908 Bacteria 3100
545 Ga0207643_10061174 3300025908 Bacteria 2150
546 Ga0207705_10003149 3300025909 Bacteria 12561
547 Ga0207705_10138572 3300025909 Bacteria 1815
548 Ga0207684_10027586 3300025910 Bacteria 4837
549 Ga0207684_10260557 3300025910 Bacteria 1496
550 Ga0207684_10444112 3300025910 Bacteria 1114
551 Ga0207654_10005733 3300025911 Bacteria 6270
552 Ga0207707_10002157 3300025912 Bacteria 17788
553 Ga0207707_10021172 3300025912 Bacteria 5683
554 Ga0207707_10051017 3300025912 Bacteria 3602
555 Ga0207707_10102769 3300025912 Bacteria 2498
556 Ga0207707_10144987 3300025912 Bacteria 2076
557 Ga0207707_10186687 3300025912 Bacteria 1809
558 Ga0207707_10259289 3300025912 Bacteria 1509
559 Ga0207695_10110083 3300025913 Bacteria 2735
560 Ga0207695_10142163 3300025913 Bacteria 2347
561 Ga0207695_10339849 3300025913 Bacteria 1389
562 Ga0207671_10166641 3300025914 Bacteria 1709
563 Ga0207693_10000413 3300025915 Bacteria 38842
564 Ga0207693_10029119 3300025915 Bacteria 4365
565 Ga0207693_10032155 3300025915 Bacteria 4142
566 Ga0207693_10034921 3300025915 Bacteria 3966
567 Ga0207693_10043111 3300025915 Bacteria 3552
568 Ga0207693_10069328 3300025915 Bacteria 2760
569 Ga0207693_10162264 3300025915 Bacteria 1758
570 Ga0207663_10073383 3300025916 Bacteria 2214
571 Ga0207663_10088547 3300025916 Bacteria 2048
572 Ga0207663_10116217 3300025916 Bacteria 1824
573 Ga0207660_10002018 3300025917 Bacteria 13496
574 Ga0207660_10030506 3300025917 Bacteria 3706
575 Ga0207660_10050645 3300025917 Bacteria 2950
576 Ga0207660_10185059 3300025917 Bacteria 1620
577 Ga0207662_10000336 3300025918 Bacteria 21233
578 Ga0207662_10003204 3300025918 Bacteria 8372
579 Ga0207662_10088080 3300025918 Bacteria 1906
580 Ga0207657_10002336 3300025919 Bacteria 20569
581 Ga0207657_10024700 3300025919 Bacteria 5557
582 Ga0207657_10026894 3300025919 Bacteria 5276
583 Ga0207657_10066940 3300025919 Bacteria 3057
584 Ga0207657_10083433 3300025919 Bacteria 2681
585 Ga0207657_10101584 3300025919 Bacteria 2386
586 Ga0207657_10286238 3300025919 Bacteria 1308
587 Ga0207649_10000571 3300025920 Bacteria 25261
588 Ga0207652_10023619 3300025921 Bacteria 5095
589 Ga0207652_10042607 3300025921 Bacteria 3864
590 Ga0207652_10050672 3300025921 Bacteria 3557
591 Ga0207652_10055691 3300025921 Bacteria 3402
592 Ga0207652_10065771 3300025921 Bacteria 3141
593 Ga0207652_10226436 3300025921 Bacteria 1685
594 Ga0207646_10094063 3300025922 Bacteria 2684
595 Ga0207681_10001830 3300025923 Bacteria 13634
596 Ga0207681_10006234 3300025923 Bacteria 7313
597 Ga0207681_10087108 3300025923 Bacteria 2221
598 Ga0207681_10089811 3300025923 Bacteria 2191
599 Ga0207681_10200152 3300025923 Bacteria 1533
600 Ga0207694_10008926 3300025924 Bacteria 7569
601 Ga0207694_10038805 3300025924 Bacteria 3662
602 Ga0207694_10090378 3300025924 Bacteria 2416
603 Ga0207650_10002774 3300025925 Bacteria 12100
604 Ga0207650_10071126 3300025925 Bacteria 2616
605 Ga0207659_10000127 3300025926 Bacteria 44761
606 Ga0207659_10071309 3300025926 Bacteria 2536
607 Ga0207659_10213502 3300025926 Bacteria 1548
608 Ga0207687_10000843 3300025927 Bacteria 20732
609 Ga0207687_10004064 3300025927 Bacteria 9802
610 Ga0207687_10023518 3300025927 Unclassified 4108
611 Ga0207687_10106622 3300025927 Bacteria 2072
612 Ga0207700_10104675 3300025928 Bacteria 2264
613 Ga0207700_10233312 3300025928 Bacteria 1565
614 Ga0207664_10017034 3300025929 Archaea 5315
615 Ga0207664_10063892 3300025929 Bacteria 2943
616 Ga0207664_10063965 3300025929 Bacteria 2941
617 Ga0207644_10067862 3300025931 Bacteria 2600
618 Ga0207644_10249315 3300025931 Bacteria 1416
619 Ga0207644_10287372 3300025931 Bacteria 1322
620 Ga0207706_10001765 3300025933 Bacteria 21233
621 Ga0207706_10007810 3300025933 Bacteria 9874
622 Ga0207706_10009896 3300025933 Bacteria 8743
623 Ga0207706_10072703 3300025933 Bacteria 3024
624 Ga0207686_10000297 3300025934 Bacteria 36292
625 Ga0207686_10014883 3300025934 Bacteria 4342
626 Ga0207686_10050836 3300025934 Bacteria 2579
627 Ga0207686_10070478 3300025934 Bacteria 2246
628 Ga0207686_10079279 3300025934 Bacteria 2138
629 Ga0207709_10000257 3300025935 Bacteria 63623
630 Ga0207709_10006905 3300025935 Bacteria 6353
631 Ga0207709_10029300 3300025935 Bacteria 3191
632 Ga0207670_10000371 3300025936 Bacteria 25929
633 Ga0207670_10005799 3300025936 Bacteria 6816
634 Ga0207670_10088093 3300025936 Bacteria 2188
635 Ga0207670_10103405 3300025936 Bacteria 2038
636 Ga0207669_10000089 3300025937 Bacteria 46184
637 Ga0207669_10008043 3300025937 Bacteria 4929
638 Ga0207669_10032805 3300025937 Bacteria 2922
639 Ga0207669_10076140 3300025937 Bacteria 2129
640 Ga0207669_10078186 3300025937 Bacteria 2107
641 Ga0207669_10261736 3300025937 Bacteria 1294
642 Ga0207704_10000355 3300025938 Bacteria 21359
643 Ga0207704_10037413 3300025938 Bacteria 2803
644 Ga0207665_10000341 3300025939 Bacteria 32356
645 Ga0207665_10033454 3300025939 Bacteria 3407
646 Ga0207691_10001737 3300025940 Bacteria 21481
647 Ga0207691_10011088 3300025940 Bacteria 8651
648 Ga0207691_10039801 3300025940 Bacteria 4348
649 Ga0207711_10003607 3300025941 Bacteria 13386
650 Ga0207711_10036181 3300025941 Bacteria 4188
651 Ga0207711_10109821 3300025941 Bacteria 2451
652 Ga0207711_10409463 3300025941 Bacteria 1260
653 Ga0207689_10000095 3300025942 Bacteria 71568
654 Ga0207689_10010011 3300025942 Bacteria 8172
655 Ga0207689_10091217 3300025942 Bacteria 2504
656 Ga0207689_10153900 3300025942 Bacteria 1896
657 Ga0207661_10000366 3300025944 Bacteria 29023
658 Ga0207679_10000073 3300025945 Bacteria 89687
659 Ga0207679_10148024 3300025945 Bacteria 1907
660 Ga0207667_10495715 3300025949 Bacteria 1239
661 Ga0207651_10006763 3300025960 Bacteria 6042
662 Ga0207651_10056752 3300025960 Bacteria 2697
663 Ga0207651_10223375 3300025960 Bacteria 1524
664 Ga0207712_10000457 3300025961 Bacteria 34730
665 Ga0207712_10002513 3300025961 Bacteria 11800
666 Ga0207712_10164004 3300025961 Bacteria 1730
667 Ga0207712_10222568 3300025961 Bacteria 1510
668 Ga0207668_10000971 3300025972 Bacteria 17231
669 Ga0207668_10068909 3300025972 Bacteria 2517
670 Ga0207668_10116162 3300025972 Bacteria 2017
671 Ga0207668_10191141 3300025972 Bacteria 1622
672 Ga0207640_10004127 3300025981 Bacteria 7849
673 Ga0207658_10007105 3300025986 Bacteria 7626
674 Ga0207658_10041977 3300025986 Bacteria 3316
675 Ga0207658_10121013 3300025986 Bacteria 2087
676 Ga0207677_10006524 3300026023 Bacteria 6407
677 Ga0207677_10033835 3300026023 Bacteria 3302
678 Ga0207677_10063598 3300026023 Bacteria 2566
679 Ga0207677_10105882 3300026023 Bacteria 2082
680 Ga0207677_10167496 3300026023 Bacteria 1714
681 Ga0207703_10005066 3300026035 Bacteria 10666
682 Ga0207703_10280555 3300026035 Bacteria 1513
683 Ga0207639_10005440 3300026041 Bacteria 8599
684 Ga0207639_10112688 3300026041 Bacteria 2220
685 Ga0207639_10301505 3300026041 Bacteria 1417
686 Ga0207678_10000426 3300026067 Bacteria 38181
687 Ga0207678_10021821 3300026067 Bacteria 5616
688 Ga0207708_10000114 3300026075 Bacteria 61971
689 Ga0207708_10000991 3300026075 Bacteria 21233
690 Ga0207708_10002182 3300026075 Bacteria 14441
691 Ga0207708_10004283 3300026075 Bacteria 10507
692 Ga0207708_10021214 3300026075 Bacteria 4898
693 Ga0207702_10103528 3300026078 Bacteria 2518
694 Ga0207702_10442281 3300026078 Bacteria 1260
695 Ga0207641_10006162 3300026088 Bacteria 10147
696 Ga0207641_10065242 3300026088 Bacteria 3114
697 Ga0207641_10083539 3300026088 Bacteria 2777
698 Ga0207641_10121032 3300026088 Bacteria 2336
699 Ga0207641_10300391 3300026088 Bacteria 1516
700 Ga0207648_10000207 3300026089 Bacteria 62972
701 Ga0207648_10000911 3300026089 Bacteria 33297
702 Ga0207648_10002119 3300026089 Bacteria 21585
703 Ga0207648_10011847 3300026089 Bacteria 8196
704 Ga0207648_10019639 3300026089 Bacteria 6098
705 Ga0207648_10044318 3300026089 Bacteria 3903
706 Ga0207648_10073925 3300026089 Bacteria 2970
707 Ga0207676_10019696 3300026095 Bacteria 4926
708 Ga0207676_10182121 3300026095 Bacteria 1840
709 Ga0207674_10001021 3300026116 Bacteria 36545
710 Ga0207674_10011221 3300026116 Bacteria 10069
711 Ga0207674_10053829 3300026116 Bacteria 4100
712 Ga0207675_100001849 3300026118 Bacteria 21247
713 Ga0207675_100006096 3300026118 Bacteria 11470
714 Ga0207675_100015304 3300026118 Bacteria 7157
715 Ga0207675_100045640 3300026118 Bacteria 4094
716 Ga0207675_100206893 3300026118 Bacteria 1886
717 Ga0207683_10000096 3300026121 Bacteria 71829
718 Ga0207683_10001255 3300026121 Bacteria 23021
719 Ga0207683_10023112 3300026121 Bacteria 5343
720 Ga0207698_10004379 3300026142 Bacteria 8599
721 Ga0207698_10033198 3300026142 Bacteria 3748
722 Ga0209973_1002178 3300027252 Bacteria 1801
723 Ga0209969_1002269 3300027360 Bacteria 2649
724 Ga0209969_1014275 3300027360 Bacteria 1156
725 Ga0209982_1009002 3300027552 Bacteria 1471
726 Ga0209970_1004647 3300027614 Bacteria 2272
727 Ga0209983_1013903 3300027665 Bacteria 1656
728 Ga0209588_1000523 3300027671 Bacteria 9843
729 Ga0209971_1006304 3300027682 Bacteria 2809
730 Ga0209966_1004674 3300027695 Bacteria 2328
731 Ga0209998_10002847 3300027717 Bacteria 3887
732 Ga0209998_10008685 3300027717 Bacteria 2106
733 Ga0209813_10002360 3300027866 Bacteria 4327
734 Ga0209974_10003040 3300027876 Bacteria 6063
735 Ga0209974_10040991 3300027876 Bacteria 1541
736 Ga0209974_10047065 3300027876 Bacteria 1444
737 Ga0207428_10000160 3300027907 Bacteria 92379
738 Ga0207428_10001473 3300027907 Bacteria 24641
739 Ga0207428_10003619 3300027907 Bacteria 14910
740 Ga0207428_10011893 3300027907 Bacteria 7664
741 Ga0207428_10033934 3300027907 Bacteria 4186
742 Ga0207428_10149577 3300027907 Bacteria 1778
743 Ga0268266_10014066 3300028379 Bacteria 6887
744 Ga0268265_10000291 3300028380 Bacteria 56604
745 Ga0268265_10001718 3300028380 Bacteria 17722
746 Ga0268265_10003071 3300028380 Bacteria 12178
747 Ga0268265_10062765 3300028380 Bacteria 2856
748 Ga0268265_10148899 3300028380 Bacteria 1971
749 Ga0268264_10001803 3300028381 Bacteria 19576
750 Ga0268264_10043118 3300028381 Bacteria 3737
751 Ga0268264_10061594 3300028381 Bacteria 3148
752 Ga0268264_10193969 3300028381 Bacteria 1853
753 Ga0268264_10340710 3300028381 Bacteria 1424
754 Ga0265763_1000340 3300030763 Bacteria 2670
755 Ga0265330_10007843 3300031235 Bacteria 5177
756 Ga0265330_10043972 3300031235 Bacteria 1974
757 Ga0265332_10001040 3300031238 Bacteria 16304
758 Ga0265320_10021565 3300031240 Bacteria 3460
759 Ga0265320_10066218 3300031240 Bacteria 1712
760 Ga0265325_10000004 3300031241 Bacteria 347347
761 Ga0265325_10000337 3300031241 Bacteria 33222
762 Ga0265325_10011448 3300031241 Bacteria 5098
763 Ga0265329_10021002 3300031242 Bacteria 2197
764 Ga0265329_10043331 3300031242 Bacteria 1440
765 Ga0265340_10000678 3300031247 Bacteria 19097
766 Ga0265340_10014852 3300031247 Bacteria 4056
767 Ga0265339_10000051 3300031249 Bacteria 101716
768 Ga0265339_10001278 3300031249 Bacteria 18833
769 Ga0265339_10002503 3300031249 Bacteria 13127
770 Ga0265339_10016545 3300031249 Bacteria 4393
771 Ga0265339_10044420 3300031249 Bacteria 2451
772 Ga0265339_10060772 3300031249 Bacteria 2036
773 Ga0265331_10003566 3300031250 Bacteria 9974
774 Ga0265331_10059380 3300031250 Bacteria 1809
775 Ga0265316_10115968 3300031344 Bacteria 2025
776 Ga0265316_10130984 3300031344 Bacteria 1889
777 Ga0307513_10250076 3300031456 Bacteria 1570
778 Ga0265313_10000011 3300031595 Bacteria 166182
779 Ga0265313_10003047 3300031595 Bacteria 13904
780 Ga0265313_10049869 3300031595 Bacteria 2012
781 Ga0316579_10035701 3300031691 Bacteria 2292
782 Ga0265314_10001524 3300031711 Bacteria 25572
783 Ga0265314_10005064 3300031711 Bacteria 12008
784 Ga0265314_10048659 3300031711 Bacteria 2973
785 Ga0265314_10064077 3300031711 Bacteria 2491
786 Ga0265342_10000137 3300031712 Bacteria 81963
787 Ga0265342_10001200 3300031712 Bacteria 24613
788 Ga0265342_10056992 3300031712 Bacteria 2314
789 Ga0265342_10115721 3300031712 Bacteria 1513
790 Ga0307407_10231985 3300031903 Bacteria 1254
791 Ga0307411_10121786 3300032005 Bacteria 1889
792 Ga0373930_0000168 3300034816 Bacteria 7619
793 Ga0373930_0004456 3300034816 Bacteria 2280
794 Ga0373930_0014488 3300034816 Bacteria 1469
795 Ga0373948_0006095 3300034817 Bacteria 1980
796 Ga0373948_0011386 3300034817 Bacteria 1571
797 Ga0373950_0000167 3300034818 Bacteria 9380
798 Ga0373950_0000765 3300034818 Bacteria 4008
799 Ga0373958_0000254 3300034819 Bacteria 6270
800 Ga0373959_0000454 3300034820 Bacteria 7625
801 Ga0373938_0000028 3300034957 Bacteria 18996
802 Ga0373938_0018829 3300034957 Bacteria 1375
803 Ga0373926_0005103 3300035083 Bacteria 4311
804 Ga0373926_0020195 3300035083 Bacteria 2300
805 Ga0373928_0000334 3300035084 Bacteria 9420
806 Ga0373928_0002262 3300035084 Bacteria 3751
807 Ga0373929_0002550 3300035085 Bacteria 3347
808 Ga0373934_0000768 3300035086 Bacteria 11523
809 Ga0373934_0020100 3300035086 Bacteria 2567
810 Ga0373934_0021882 3300035086 Bacteria 2464
811 Ga0373940_0000035 3300035088 Bacteria 14792
812 Ga0373940_0025303 3300035088 Bacteria 1545
813 Ga0373944_0002335 3300035089 Bacteria 4829
814 Ga0373944_0017735 3300035089 Bacteria 2025
815 Ga0373944_0059390 3300035089 Bacteria 1223
816 Ga0373949_0005274 3300035090 Bacteria 2890
817 Ga0373949_0022180 3300035090 Bacteria 1462
818 Ga0373951_0001519 3300035091 Bacteria 6071
819 Ga0373952_0000412 3300035092 Bacteria 7377
820 Ga0373952_0001851 3300035092 Bacteria 3841
821 Ga0373952_0003242 3300035092 Bacteria 2928
822 Ga0373923_0000172 3300035111 Bacteria 12891
823 Ga0373923_0004862 3300035111 Bacteria 4504
824 Ga0373923_0012241 3300035111 Bacteria 3165
825 Ga0373932_0001412 3300035112 Bacteria 6729
826 Ga0373932_0003882 3300035112 Bacteria 3564
827 Ga0373936_0001267 3300035113 Bacteria 9126
828 Ga0373936_0002470 3300035113 Bacteria 6915
829 Ga0373936_0071305 3300035113 Bacteria 1432
830 Ga0373936_0089996 3300035113 Bacteria 1286
831 Ga0373936_0136135 3300035113 Bacteria 1058
832 Ga0373939_0003020 3300035114 Bacteria 3950
833 Ga0373939_0005310 3300035114 Bacteria 3065
834 Ga0373939_0005800 3300035114 Bacteria 2950
835 Ga0373939_0034079 3300035114 Bacteria 1492
836 Ga0373941_0001305 3300035115 Bacteria 5242
837 Ga0373945_0001667 3300035116 Bacteria 6822
838 Ga0373945_0005102 3300035116 Bacteria 4189
839 Ga0373945_0009493 3300035116 Bacteria 3189
840 Ga0373953_0001914 3300035117 Bacteria 6174
841 Ga0373953_0005816 3300035117 Bacteria 4031
842 Ga0373953_0008617 3300035117 Bacteria 3471
843 Ga0373953_0014941 3300035117 Bacteria 2802
844 Ga0373954_0000001 3300035118 Bacteria 158201
845 Ga0373954_0002854 3300035118 Bacteria 7285
846 Ga0373954_0002859 3300035118 Bacteria 7280
847 Ga0373954_0006729 3300035118 Bacteria 5014
848 Ga0373954_0050922 3300035118 Bacteria 1944
849 Ga0373956_0015202 3300035119 Bacteria 3221
850 Ga0373956_0015568 3300035119 Bacteria 3186
851 Ga0373956_0039620 3300035119 Bacteria 2089
852 Ga0373956_0042273 3300035119 Bacteria 2025
853 Ga0373956_0057346 3300035119 Bacteria 1759
854 Ga0373957_0001412 3300035120 Bacteria 6495
855 Ga0373957_0010382 3300035120 Bacteria 3077
856 Ga0373957_0019972 3300035120 Bacteria 2363
857 Ga0373960_0001936 3300035121 Bacteria 4643
858 Ga0373943_0003253 3300035170 Bacteria 7374
859 Ga0373943_0004683 3300035170 Bacteria 6189
860 Ga0373943_0006816 3300035170 Bacteria 5125
861 Ga0373943_0008136 3300035170 Bacteria 4704
862 Ga0373946_0000559 3300035171 Bacteria 12253
863 Ga0373946_0003106 3300035171 Bacteria 5884
864 Ga0373946_0022545 3300035171 Bacteria 2452
865 Ga0373946_0050197 3300035171 Bacteria 1742
866 Ga0373955_0001609 3300035172 Bacteria 9672
867 Ga0373955_0004071 3300035172 Bacteria 6453
868 Ga0373955_0004884 3300035172 Bacteria 5981
869 Ga0373955_0005003 3300035172 Bacteria 5922
870 Ga0373955_0011991 3300035172 Bacteria 4154
871 Ga0373955_0064297 3300035172 Bacteria 2033
872 Ga0373942_0001919 3300035207 Bacteria 5215
873 Ga0373942_0008293 3300035207 Bacteria 2421
874 Ga0373961_0000433 3300035241 Bacteria 17272
875 Ga0373961_0003870 3300035241 Bacteria 3653
876 Ga0373962_0001003 3300035242 Bacteria 6527
877 Ga0373962_0004617 3300035242 Bacteria 3328
878 Ga0373962_0005430 3300035242 Bacteria 3085
879 Ga0373962_0016764 3300035242 Bacteria 1892
880 Ga0373924_0001700 3300035410 Bacteria 7257
881 Ga0373924_0034625 3300035410 Bacteria 2045
882 Ga0373931_0000337 3300035691 Bacteria 19385
883 Ga0373931_0003505 3300035691 Bacteria 7065
884 Ga0373931_0008342 3300035691 Bacteria 4907
885 Ga0373931_0014117 3300035691 Bacteria 3901
886 Ga0373931_0031786 3300035691 Bacteria 2727
887 Ga0373931_0057400 3300035691 Bacteria 2087
888 Ga0373931_0190810 3300035691 Bacteria 1219
889 Ga0373935_0000045 3300035692 Bacteria 48915
890 Ga0373935_0004283 3300035692 Bacteria 8373
891 Ga0373935_0005363 3300035692 Bacteria 7552
892 Ga0373935_0014279 3300035692 Bacteria 4793
893 Ga0373935_0023744 3300035692 Bacteria 3767
894 Ga0373935_0040909 3300035692 Bacteria 2910
895 Ga0373935_0044043 3300035692 Bacteria 2811
896 Ga0373927_0005968 3300035695 Bacteria 8342
897 Ga0373927_0009251 3300035695 Bacteria 6609
898 Ga0373927_0010016 3300035695 Bacteria 6349
899 Ga0373927_0019339 3300035695 Bacteria 4466
900 Ga0373927_0023361 3300035695 Bacteria 4049
901 Ga0373927_0031994 3300035695 Bacteria 3426
902 Ga0373927_0125869 3300035695 Bacteria 1673
903 Ga0373927_0130430 3300035695 Bacteria 1642
904 Ga0373933_0001288 3300035724 Bacteria 14774
905 Ga0373933_0001649 3300035724 Bacteria 12987
906 Ga0373933_0005631 3300035724 Bacteria 6825
907 Ga0373933_0011892 3300035724 Bacteria 4805
908 Ga0373933_0112276 3300035724 Bacteria 1701
909 Ga0373933_0131214 3300035724 Bacteria 1576
910 Ga0373933_0213119 3300035724 Bacteria 1238
911 Ga0373947_0004104 3300035725 Bacteria 8568
912 Ga0373947_0004981 3300035725 Bacteria 7773
913 Ga0373947_0007212 3300035725 Bacteria 6442
914 Ga0373947_0008452 3300035725 Bacteria 5932
915 Ga0373947_0019275 3300035725 Bacteria 3932
916 Ga0373947_0136009 3300035725 Bacteria 1572
917 Ga0373937_0000369 3300036401 Bacteria 41814
918 Ga0373937_0001643 3300036401 Bacteria 18796
919 Ga0373937_0001794 3300036401 Bacteria 18033
920 Ga0373937_0002088 3300036401 Bacteria 16721
921 Ga0373937_0002336 3300036401 Bacteria 15811
922 Ga0373937_0003155 3300036401 Bacteria 13799
923 Ga0373937_0004936 3300036401 Bacteria 11339
924 Ga0373937_0010769 3300036401 Bacteria 8003
925 Ga0373937_0042006 3300036401 Bacteria 4172
926 Ga0373937_0056107 3300036401 Bacteria 3617
927 Ga0373937_0077789 3300036401 Bacteria 3065
928 Ga0373937_0132467 3300036401 Unclassified 2329
929 Ga0373937_0156190 3300036401 Bacteria 2138
930 Ga0373937_0283168 3300036401 Bacteria 1565
931 Ga0373937_0429758 3300036401 Bacteria 1254
932 Ga0373937_0522701 3300036401 Bacteria 1128
933 Ga0373925_0000178 3300037068 Bacteria 69362
934 Ga0373925_0003205 3300037068 Bacteria 12794
935 Ga0373925_0004574 3300037068 Bacteria 10455
936 Ga0373925_0010148 3300037068 Bacteria 6838
937 Ga0373925_0010176 3300037068 Bacteria 6829
938 Ga0373925_0010983 3300037068 Bacteria 6574
939 Ga0373925_0029726 3300037068 Bacteria 4009
940 Ga0373925_0044257 3300037068 Bacteria 3305
941 Ga0373925_0083755 3300037068 Bacteria 2429
942 Ga0395899_0020489 3300037312 Bacteria 5012
943 Ga0395900_0002147 3300037418 Bacteria 22057
944 Ga0395900_0489684 3300037418 Bacteria 1181
945 Ga0395898_0004269 3300037466 Bacteria 15673
946 Ga0395898_0054345 3300037466 Bacteria 3908
947 Ga0395898_0082419 3300037466 Bacteria 3100
948 Ga0395905_0372354 3300037471 Bacteria 1322
949 Ga0436364_1069864 3300037853 Bacteria 1602
950 Ga0395901_0059722 3300038443 Bacteria 3967
951 Ga0395901_0060715 3300038443 Bacteria 3934
952 Ga0395901_0313125 3300038443 Bacteria 1625
953 Ga0436365_0022253 3300039437 Bacteria 2809
954 Ga0436365_0695771 3300039437 Bacteria 1293
955 Ga0436365_1267930 3300039437 Bacteria 1183
956 Ga0436361_0402758 3300039447 Bacteria 15309
957 Ga0439453_0009448 3300041408 Bacteria 1589
958 Ga0439453_0013579 3300041408 Bacteria 1386
959 Ga0439443_001551 3300042003 Bacteria 2566
960 Ga0439448_0011470 3300042005 Bacteria 2643
961 Ga0439455_0010597 3300042012 Bacteria 2031
962 Ga0450923_002744 3300042125 Bacteria 2569
963 Ga0439435_0001415 3300042436 Bacteria 4425
964 Ga0439444_0024021 3300042437 Bacteria 1099
965 Ga0439444_0030556 3300042437 Bacteria 1009
966 Ga0439460_0008276 3300042461 Bacteria 2624
967 Ga0439440_0032658 3300042993 Bacteria 1237
968 Ga0466966_0029988 3300044684 Bacteria 3536
969 Ga0466957_0107032 3300044842 Bacteria 1769
970 Ga0451576_0000220 3300045051 Bacteria 141261
971 Ga0451576_0011312 3300045051 Bacteria 10154
972 Ga0451576_0012520 3300045051 Bacteria 9524
973 Ga0451576_0083017 3300045051 Bacteria 3333
974 Ga0451576_0084560 3300045051 Bacteria 3300
975 Ga0451576_0401318 3300045051 Bacteria 1437
976 Ga0466958_0022095 3300045836 Bacteria 3723
977 Ga0466967_0117739 3300045976 Bacteria 2449
978 Ga0466967_0231526 3300045976 Bacteria 1759
979 Ga0495592_0000118 3300046454 Bacteria 69831
980 Ga0495592_0000589 3300046454 Bacteria 25846
981 Ga0495592_0006116 3300046454 Bacteria 8950
982 Ga0495592_0012726 3300046454 Bacteria 6396
983 Ga0495592_0046851 3300046454 Unclassified 3222
984 Ga0495603_0023654 3300046455 Bacteria 3716
985 Ga0495629_0000107 3300046459 Bacteria 74043
986 Ga0495629_0058403 3300046459 Bacteria 2697
987 Ga0495629_0070443 3300046459 Bacteria 2440
988 Ga0495629_0184579 3300046459 Bacteria 1445
989 Ga0495638_0005571 3300046460 Bacteria 9306
990 Ga0495641_0001910 3300046461 Bacteria 17010
991 Ga0495641_0009860 3300046461 Bacteria 5623
992 Ga0495651_0000529 3300046462 Bacteria 29571
993 Ga0495651_0000819 3300046462 Bacteria 24135
994 Ga0495651_0001232 3300046462 Bacteria 19780
995 Ga0495651_0002956 3300046462 Bacteria 13134
996 Ga0495651_0007599 3300046462 Bacteria 8286
997 Ga0495651_0010196 3300046462 Bacteria 7214
998 Ga0495651_0071333 3300046462 Bacteria 2641
999 Ga0495651_0247116 3300046462 Bacteria 1220
1000 Ga0495653_0000155 3300046463 Bacteria 56764
1001 Ga0495653_0002252 3300046463 Bacteria 15258
1002 Ga0495653_0005360 3300046463 Bacteria 10436
1003 Ga0495653_0013476 3300046463 Bacteria 6661
1004 Ga0495653_0015476 3300046463 Bacteria 6217
1005 Ga0495653_0020230 3300046463 Bacteria 5396
1006 Ga0495653_0043303 3300046463 Bacteria 3501
1007 Ga0495580_0009794 3300046472 Bacteria 7515
1008 Ga0495580_0012043 3300046472 Bacteria 6658
1009 Ga0495580_0019164 3300046472 Bacteria 5085
1010 Ga0495580_0048824 3300046472 Unclassified 2994
1011 Ga0495580_0064303 3300046472 Bacteria 2572
1012 Ga0495580_0075909 3300046472 Bacteria 2344
1013 Ga0495582_0002609 3300046473 Bacteria 10032
1014 Ga0495582_0008958 3300046473 Bacteria 5522
1015 Ga0495605_0047976 3300046474 Bacteria 2093
1016 Ga0495639_0001237 3300046475 Bacteria 11511
1017 Ga0495639_0010684 3300046475 Bacteria 3953
1018 Ga0495662_0000946 3300046476 Bacteria 14225
1019 Ga0495662_0003166 3300046476 Bacteria 8306
1020 Ga0495662_0008118 3300046476 Bacteria 5171
1021 Ga0495662_0015201 3300046476 Bacteria 3740
1022 Ga0495662_0061373 3300046476 Bacteria 1816
1023 Ga0495664_0000005 3300046477 Bacteria 439635
1024 Ga0495664_0000214 3300046477 Bacteria 27629
1025 Ga0495664_0007330 3300046477 Bacteria 6123
1026 Ga0495584_0014233 3300046491 Bacteria 4054
1027 Ga0495585_0015795 3300046492 Bacteria 4383
1028 Ga0495594_0013023 3300046499 Bacteria 4337
1029 Ga0495594_0043253 3300046499 Bacteria 2468
1030 Ga0495607_0004511 3300046501 Bacteria 10217
1031 Ga0495608_0000083 3300046511 Bacteria 69238
1032 Ga0495608_0002614 3300046511 Bacteria 12937
1033 Ga0495608_0003829 3300046511 Bacteria 10814
1034 Ga0495608_0006604 3300046511 Bacteria 8234
1035 Ga0495608_0013146 3300046511 Bacteria 5744
1036 Ga0495608_0141321 3300046511 Bacteria 1536
1037 Ga0495616_0053246 3300046513 Bacteria 2012
1038 Ga0495618_0000079 3300046514 Bacteria 69375
1039 Ga0495618_0003754 3300046514 Bacteria 9398
1040 Ga0495618_0006097 3300046514 Bacteria 7312
1041 Ga0495618_0011842 3300046514 Bacteria 5293
1042 Ga0495618_0015138 3300046514 Bacteria 4704
1043 Ga0495620_0106641 3300046515 Bacteria 1113
1044 Ga0495628_0000033 3300046516 Bacteria 118203
1045 Ga0495628_0021325 3300046516 Bacteria 5331
1046 Ga0495628_0022301 3300046516 Bacteria 5202
1047 Ga0495628_0037540 3300046516 Bacteria 3884
1048 Ga0495628_0071425 3300046516 Bacteria 2706
1049 Ga0495628_0093595 3300046516 Bacteria 2324
1050 Ga0495630_0014224 3300046517 Bacteria 5794
1051 Ga0495630_0024667 3300046517 Bacteria 4444
1052 Ga0495630_0030250 3300046517 Unclassified 4027
1053 Ga0495630_0150831 3300046517 Bacteria 1768
1054 Ga0495630_0169617 3300046517 Bacteria 1662
1055 Ga0495630_0252173 3300046517 Bacteria 1348
1056 Ga0495630_0259063 3300046517 Bacteria 1329
1057 Ga0495631_0137529 3300046518 Bacteria 1049
1058 Ga0495637_0049076 3300046520 Bacteria 1775
1059 Ga0495648_0000756 3300046524 Bacteria 34518
1060 Ga0495663_0038442 3300046525 Bacteria 1447
1061 Ga0495666_0001319 3300046526 Bacteria 12001
1062 Ga0495666_0027631 3300046526 Bacteria 2793
1063 Ga0495666_0070767 3300046526 Bacteria 1658
1064 Ga0495666_0105692 3300046526 Unclassified 1325
1065 Ga0495652_0000001 3300046529 Bacteria 1045081
1066 Ga0495652_0010464 3300046529 Bacteria 8406
1067 Ga0495652_0021890 3300046529 Bacteria 5682
1068 Ga0495652_0022247 3300046529 Bacteria 5626
1069 Ga0495665_0000336 3300046531 Bacteria 23763
1070 Ga0495665_0030679 3300046531 Bacteria 2878
1071 Ga0495665_0034147 3300046531 Bacteria 2720
1072 Ga0495665_0041259 3300046531 Bacteria 2456
1073 Ga0495665_0112407 3300046531 Bacteria 1428
1074 Ga0495640_0000010 3300046533 Bacteria 214167
1075 Ga0495640_0005141 3300046533 Bacteria 10396
1076 Ga0495640_0012446 3300046533 Bacteria 6498
1077 Ga0495640_0038926 3300046533 Bacteria 3340
1078 Ga0495586_0007420 3300046535 Bacteria 5849
1079 Ga0495586_0010662 3300046535 Bacteria 4888
1080 Ga0495586_0019621 3300046535 Bacteria 3600
1081 Ga0495586_0031196 3300046535 Unclassified 2853
1082 Ga0495586_0037067 3300046535 Bacteria 2617
1083 Ga0495587_0000090 3300046536 Bacteria 69871
1084 Ga0495587_0001998 3300046536 Bacteria 13592
1085 Ga0495587_0002816 3300046536 Bacteria 11642
1086 Ga0495587_0015214 3300046536 Unclassified 4808
1087 Ga0495587_0021157 3300046536 Bacteria 4011
1088 Ga0495587_0025575 3300046536 Bacteria 3607
1089 Ga0495587_0163109 3300046536 Bacteria 1268
1090 Ga0495598_0000806 3300046537 Bacteria 5996
1091 Ga0495598_0034255 3300046537 Bacteria 1446
1092 Ga0495609_0017720 3300046538 Bacteria 3305
1093 Ga0495609_0105979 3300046538 Bacteria 1216
1094 Ga0495621_0014347 3300046539 Bacteria 2506
1095 Ga0495645_0000005 3300046543 Bacteria 443917
1096 Ga0495645_0004724 3300046543 Bacteria 9309
1097 Ga0495645_0006219 3300046543 Bacteria 8270
1098 Ga0495645_0007615 3300046543 Bacteria 7534
1099 Ga0495645_0030855 3300046543 Bacteria 3904
1100 Ga0495645_0040486 3300046543 Bacteria 3399
1101 Ga0495645_0118305 3300046543 Bacteria 1868
1102 Ga0495622_0004793 3300046557 Bacteria 6267
1103 Ga0495622_0035462 3300046557 Bacteria 2326
1104 Ga0495633_0010198 3300046558 Bacteria 5140
1105 Ga0495667_0000079 3300046559 Bacteria 69267
1106 Ga0495667_0002476 3300046559 Bacteria 12331
1107 Ga0495667_0008400 3300046559 Bacteria 7006
1108 Ga0495667_0008600 3300046559 Bacteria 6928
1109 Ga0495667_0030274 3300046559 Bacteria 3639
1110 Ga0495667_0088819 3300046559 Unclassified 2003
1111 Ga0495667_0097290 3300046559 Bacteria 1905
1112 Ga0495667_0310525 3300046559 Bacteria 998
1113 Ga0495656_0003112 3300046615 Bacteria 5580
1114 Ga0495668_0051811 3300046616 Bacteria 2272
1115 Ga0495634_0000166 3300046642 Bacteria 60485
1116 Ga0495634_0003507 3300046642 Bacteria 12566
1117 Ga0495634_0007374 3300046642 Bacteria 8275
1118 Ga0495634_0007626 3300046642 Bacteria 8107
1119 Ga0495634_0010998 3300046642 Bacteria 6604
1120 Ga0495634_0103798 3300046642 Bacteria 1834
1121 Ga0495634_0144082 3300046642 Bacteria 1510
1122 Ga0495635_0000055 3300046663 Bacteria 69432
1123 Ga0495635_0000409 3300046663 Bacteria 27280
1124 Ga0495635_0000600 3300046663 Bacteria 23208
1125 Ga0495635_0008198 3300046663 Bacteria 7297
1126 Ga0495635_0022335 3300046663 Bacteria 4405
1127 Ga0495635_0044627 3300046663 Bacteria 3058
1128 Ga0495635_0219427 3300046663 Bacteria 1286
1129 Ga0495635_0335580 3300046663 Bacteria 1010
1130 Ga0495659_0041406 3300046664 Bacteria 1645
1131 Ga0495588_0012769 3300046674 Bacteria 3980
1132 Ga0495588_0013779 3300046674 Bacteria 3857
1133 Ga0495657_0000124 3300046675 Bacteria 69346
1134 Ga0495657_0001218 3300046675 Bacteria 22573
1135 Ga0495657_0004623 3300046675 Bacteria 10992
1136 Ga0495657_0028249 3300046675 Bacteria 3948
1137 Ga0495657_0088909 3300046675 Bacteria 1985
1138 Ga0495599_0000075 3300046678 Bacteria 69327
1139 Ga0495599_0000970 3300046678 Bacteria 16055
1140 Ga0495599_0001117 3300046678 Bacteria 15124
1141 Ga0495599_0006912 3300046678 Bacteria 6859
1142 Ga0495599_0028669 3300046678 Bacteria 3488
1143 Ga0495599_0102170 3300046678 Bacteria 1787
1144 Ga0495623_0000003 3300046679 Bacteria 147316
1145 Ga0495623_0000758 3300046679 Bacteria 21662
1146 Ga0495623_0006189 3300046679 Bacteria 7779
1147 Ga0495623_0086614 3300046679 Bacteria 1930
1148 Ga0495646_0000042 3300046680 Bacteria 69329
1149 Ga0495646_0000300 3300046680 Bacteria 25296
1150 Ga0495646_0009235 3300046680 Bacteria 6256
1151 Ga0495646_0023348 3300046680 Bacteria 3895
1152 Ga0495647_0001743 3300046681 Bacteria 6748
1153 Ga0495647_0002414 3300046681 Bacteria 5882
1154 Ga0495647_0014006 3300046681 Bacteria 2788
1155 Ga0495658_0000517 3300046683 Bacteria 21136
1156 Ga0495658_0016813 3300046683 Bacteria 3769
1157 Ga0495658_0023188 3300046683 Bacteria 3292
1158 Ga0495658_0070438 3300046683 Bacteria 2029
1159 Ga0495669_0008276 3300046684 Bacteria 4367
1160 Ga0495669_0069974 3300046684 Bacteria 1598
1161 Ga0495669_0095569 3300046684 Bacteria 1376
1162 Ga0495613_0001790 3300046689 Bacteria 16334
1163 Ga0495613_0004550 3300046689 Bacteria 10401
1164 Ga0495613_0018022 3300046689 Bacteria 5262
1165 Ga0495613_0037448 3300046689 Unclassified 3596
1166 Ga0495613_0164642 3300046689 Bacteria 1576
1167 Ga0495613_0279088 3300046689 Bacteria 1160
1168 Ga0495624_0005864 3300046690 Bacteria 8783
1169 Ga0495624_0010233 3300046690 Bacteria 6467
1170 Ga0495624_0014021 3300046690 Bacteria 5453
1171 Ga0495670_0001321 3300046691 Bacteria 12084
1172 Ga0495649_0043554 3300046694 Bacteria 2450
1173 Ga0495600_0000052 3300046809 Bacteria 69430
1174 Ga0495600_0000426 3300046809 Bacteria 21586
1175 Ga0495600_0012951 3300046809 Bacteria 5228
1176 Ga0495600_0014693 3300046809 Bacteria 4936
1177 Ga0495600_0071856 3300046809 Bacteria 2261
1178 Ga0495600_0094801 3300046809 Bacteria 1946
1179 Ga0495600_0107174 3300046809 Bacteria 1820
1180 Ga0495581_0001977 3300047315 Bacteria 11494
1181 Ga0495604_0000010 3300047317 Bacteria 312236
1182 Ga0495604_0000930 3300047317 Bacteria 24387
1183 Ga0495604_0001425 3300047317 Bacteria 19626
1184 Ga0495604_0080702 3300047317 Bacteria 2437
1185 Ga0495636_0010835 3300047318 Bacteria 3605
1186 Ga0495674_0000013 3300047319 Bacteria 248475
1187 Ga0495674_0012823 3300047319 Bacteria 7892
1188 Ga0495674_0029899 3300047319 Bacteria 4956
1189 Ga0495674_0054626 3300047319 Bacteria 3507
1190 Ga0495674_0155353 3300047319 Bacteria 1917
1191 Ga0495672_0069565 3300047320 Bacteria 1998
1192 Ga0495680_0000275 3300047322 Bacteria 57457
1193 Ga0495680_0000400 3300047322 Bacteria 48589
1194 Ga0495680_0017000 3300047322 Bacteria 6226
1195 Ga0495680_0017709 3300047322 Bacteria 6068
1196 Ga0495680_0059142 3300047322 Bacteria 2960
1197 Ga0495680_0069787 3300047322 Unclassified 2680
1198 Ga0495680_0102462 3300047322 Bacteria 2131
1199 Ga0495680_0339004 3300047322 Bacteria 1049
1200 Ga0495680_0341136 3300047322 Bacteria 1045
1201 Ga0495675_0000297 3300047444 Bacteria 35718
1202 Ga0495675_0007916 3300047444 Bacteria 6566
1203 Ga0495675_0009621 3300047444 Bacteria 6020
1204 Ga0495675_0015732 3300047444 Bacteria 4784
1205 Ga0495675_0112994 3300047444 Bacteria 1694
1206 Ga0495679_045710 3300047446 Bacteria 1336
1207 Ga0495681_0073279 3300047470 Bacteria 1547
1208 Ga0495684_0000008 3300047471 Bacteria 201370
1209 Ga0495684_0001567 3300047471 Bacteria 18316
1210 Ga0495684_0002067 3300047471 Bacteria 16129
1211 Ga0495684_0007476 3300047471 Bacteria 8462
1212 Ga0495684_0009543 3300047471 Bacteria 7481
1213 Ga0495684_0014077 3300047471 Bacteria 6152
1214 Ga0495684_0050613 3300047471 Bacteria 3171
1215 Ga0495593_0004361 3300047673 Bacteria 8418
1216 Ga0495593_0013732 3300047673 Bacteria 4612
1217 Ga0495593_0020151 3300047673 Bacteria 3735
1218 Ga0495593_0166140 3300047673 Bacteria 1113
1219 Ga0495602_0000134 3300048088 Bacteria 69349
1220 Ga0495602_0009237 3300048088 Bacteria 10260
1221 Ga0495602_0011524 3300048088 Bacteria 9135
1222 Ga0495602_0298992 3300048088 Unclassified 1178
1223 Ga0495614_0016404 3300048089 Bacteria 3223
1224 Ga0495614_0049812 3300048089 Bacteria 1795
1225 Ga0495615_0006228 3300048090 Bacteria 2196
1226 Ga0496100_0008713 3300048903 Bacteria 5667
1227 Ga0496100_0011272 3300048903 Bacteria 5085
1228 Ga0496100_0059674 3300048903 Bacteria 2507
1229 Ga0496100_0125998 3300048903 Bacteria 1797
1230 Ga0496100_0262344 3300048903 Bacteria 1282
1231 Ga0496100_0296964 3300048903 Bacteria 1208
1232 Ga0496101_0002099 3300048904 Bacteria 12152
1233 Ga0496101_0017101 3300048904 Bacteria 4913
1234 Ga0496101_0029946 3300048904 Bacteria 3811
1235 Ga0496101_0080733 3300048904 Bacteria 2403
1236 Ga0496101_0126175 3300048904 Bacteria 1939
1237 Ga0496101_0143886 3300048904 Bacteria 1819
1238 Ga0496101_0148359 3300048904 Bacteria 1792
1239 Ga0496102_0011311 3300048905 Bacteria 7688
1240 Ga0496102_0011632 3300048905 Bacteria 7595
1241 Ga0496102_0013890 3300048905 Bacteria 6987
1242 Ga0496102_0018719 3300048905 Bacteria 6090
1243 Ga0496102_0057698 3300048905 Bacteria 3546
1244 Ga0496102_0110564 3300048905 Bacteria 2561
1245 Ga0496102_0300106 3300048905 Bacteria 1514
1246 Ga0496103_0005229 3300048906 Bacteria 7796
1247 Ga0496103_0007241 3300048906 Bacteria 6614
1248 Ga0496103_0030647 3300048906 Bacteria 3274
1249 Ga0496103_0034792 3300048906 Bacteria 3082
1250 Ga0496103_0112980 3300048906 Bacteria 1726
1251 Ga0496104_0000515 3300048907 Bacteria 33122
1252 Ga0496104_0001124 3300048907 Bacteria 22893
1253 Ga0496104_0003330 3300048907 Bacteria 13866
1254 Ga0496104_0003945 3300048907 Bacteria 12841
1255 Ga0496104_0023384 3300048907 Bacteria 5682
1256 Ga0496104_0026980 3300048907 Bacteria 5310
1257 Ga0496104_0029246 3300048907 Bacteria 5110
1258 Ga0496104_0042832 3300048907 Bacteria 4251
1259 Ga0496104_0049991 3300048907 Bacteria 3944
1260 Ga0496104_0074629 3300048907 Bacteria 3228
1261 Ga0496104_0089281 3300048907 Bacteria 2944
1262 Ga0496105_0001298 3300048908 Bacteria 17483
1263 Ga0496105_0001827 3300048908 Bacteria 15239
1264 Ga0496105_0065676 3300048908 Bacteria 2994
1265 Ga0496105_0171026 3300048908 Bacteria 1781
1266 Ga0496105_0177033 3300048908 Bacteria 1747
1267 Ga0496105_0219775 3300048908 Bacteria 1547
1268 Ga0496106_0006540 3300048909 Bacteria 8628
1269 Ga0496106_0011903 3300048909 Bacteria 6422
1270 Ga0496106_0017500 3300048909 Bacteria 5302
1271 Ga0496106_0034499 3300048909 Bacteria 3779
1272 Ga0496106_0114947 3300048909 Bacteria 2098
1273 Ga0496106_0401710 3300048909 Bacteria 1101
1274 Ga0496107_0001687 3300048910 Bacteria 13829
1275 Ga0496107_0008396 3300048910 Bacteria 7148
1276 Ga0496107_0020991 3300048910 Bacteria 4616
1277 Ga0496107_0118228 3300048910 Bacteria 1952
1278 Ga0496108_0001712 3300048911 Bacteria 17379
1279 Ga0496108_0019295 3300048911 Bacteria 5597
1280 Ga0496108_0091794 3300048911 Bacteria 2581
1281 Ga0496108_0231991 3300048911 Bacteria 1605
1282 Ga0496108_0295717 3300048911 Bacteria 1410
1283 Ga0496109_0001689 3300048912 Bacteria 18384
1284 Ga0496109_0020370 3300048912 Bacteria 5858
1285 Ga0496109_0024226 3300048912 Bacteria 5393
1286 Ga0496109_0097128 3300048912 Bacteria 2730
1287 Ga0496109_0176099 3300048912 Bacteria 2008
1288 Ga0496109_0200068 3300048912 Bacteria 1878
1289 Ga0496110_0007946 3300048913 Bacteria 8496
1290 Ga0496110_0022253 3300048913 Bacteria 5379
1291 Ga0496110_0027496 3300048913 Bacteria 4877
1292 Ga0496110_0035097 3300048913 Bacteria 4349
1293 Ga0496110_0046689 3300048913 Bacteria 3789
1294 Ga0496110_0160928 3300048913 Bacteria 2035
1295 Ga0496110_0272434 3300048913 Bacteria 1541
1296 Ga0496111_0024033 3300048914 Bacteria 4285
1297 Ga0496111_0026065 3300048914 Bacteria 4126
1298 Ga0496112_0004477 3300048915 Bacteria 11851
1299 Ga0496112_0007707 3300048915 Bacteria 9576
1300 Ga0496112_0024797 3300048915 Bacteria 5751
1301 Ga0496112_0117912 3300048915 Bacteria 2625
1302 Ga0496112_0135193 3300048915 Bacteria 2436
1303 Ga0496112_0279878 3300048915 Bacteria 1615
1304 Ga0496112_0280571 3300048915 Bacteria 1613
1305 Ga0496112_0403119 3300048915 Bacteria 1307
1306 Ga0496113_0004800 3300048916 Bacteria 8356
1307 Ga0496113_0009107 3300048916 Bacteria 6505
1308 Ga0496113_0071782 3300048916 Bacteria 2634
1309 Ga0496113_0171847 3300048916 Bacteria 1716
1310 Ga0496114_0013020 3300048917 Bacteria 6665
1311 Ga0496114_0023496 3300048917 Bacteria 5031
1312 Ga0496114_0057724 3300048917 Bacteria 3240
1313 Ga0496114_0072525 3300048917 Bacteria 2896
1314 Ga0496114_0096852 3300048917 Bacteria 2512
1315 Ga0496114_0170546 3300048917 Bacteria 1896
1316 Ga0496114_0206682 3300048917 Bacteria 1721
1317 Ga0496115_0000935 3300048918 Bacteria 21173
1318 Ga0496115_0015039 3300048918 Bacteria 5865
1319 Ga0496115_0027636 3300048918 Bacteria 4440
1320 Ga0496115_0036188 3300048918 Bacteria 3907
1321 Ga0496115_0038269 3300048918 Bacteria 3806
1322 Ga0496115_0064786 3300048918 Bacteria 2951
1323 Ga0496115_0067923 3300048918 Bacteria 2884
1324 Ga0496115_0087300 3300048918 Bacteria 2545
1325 Ga0496115_0356574 3300048918 Bacteria 1192
1326 Ga0496118_0019389 3300048921 Bacteria 6080
1327 Ga0496121_0003205 3300048924 Bacteria 23550
1328 Ga0501299_011159 3300049522 Bacteria 1513
1329 Ga0501031_0090912 3300049568 Bacteria 1991
1330 Ga0501031_0113872 3300049568 Bacteria 1766
1331 Ga0501032_0129080 3300049569 Bacteria 1668
1332 Ga0501033_0002811 3300049570 Bacteria 14566
1333 Ga0501033_0030715 3300049570 Bacteria 4036
1334 Ga0501034_0048374 3300049571 Bacteria 4292
1335 Ga0501034_0058198 3300049571 Bacteria 3884
1336 Ga0501034_0243528 3300049571 Bacteria 1744
1337 Ga0501036_0002126 3300049572 Bacteria 15456
1338 Ga0501036_0046141 3300049572 Bacteria 3690
1339 Ga0501036_0122074 3300049572 Bacteria 2200
1340 Ga0501036_0313317 3300049572 Bacteria 1312
1341 Ga0501037_0011909 3300049573 Bacteria 6406
1342 Ga0501037_0076110 3300049573 Bacteria 2437
1343 Ga0501038_0002601 3300049574 Bacteria 16865
1344 Ga0501038_0081818 3300049574 Bacteria 2720
1345 Ga0501038_0367611 3300049574 Bacteria 1118
1346 Ga0501039_0000671 3300049575 Bacteria 24660
1347 Ga0501039_0052846 3300049575 Bacteria 3143
1348 Ga0501039_0270811 3300049575 Bacteria 1335
1349 Ga0501039_0357808 3300049575 Bacteria 1147
1350 Ga0501040_0000560 3300049576 Bacteria 22514
1351 Ga0501040_0013811 3300049576 Bacteria 5316
1352 Ga0501040_0021061 3300049576 Bacteria 4348
1353 Ga0501040_0057871 3300049576 Bacteria 2662
1354 Ga0501041_0000424 3300049577 Bacteria 21388
1355 Ga0501041_0010500 3300049577 Bacteria 5458
1356 Ga0501041_0020372 3300049577 Bacteria 3965
1357 Ga0501042_0002768 3300049578 Bacteria 10832
1358 Ga0501042_0043879 3300049578 Bacteria 3185
1359 Ga0501042_0055667 3300049578 Bacteria 2823
1360 Ga0501043_0022180 3300049579 Bacteria 4981
1361 Ga0501043_0038157 3300049579 Bacteria 3777
1362 Ga0501043_0180647 3300049579 Bacteria 1644
1363 Ga0501046_0002471 3300049580 Bacteria 17326
1364 Ga0501046_0004653 3300049580 Bacteria 12401
1365 Ga0501046_0045922 3300049580 Bacteria 3467
1366 Ga0501046_0133406 3300049580 Bacteria 1882
1367 Ga0501046_0390326 3300049580 Bacteria 1006
1368 Ga0501047_0035626 3300049581 Bacteria 4807
1369 Ga0501047_0042254 3300049581 Bacteria 4405
1370 Ga0501047_0068890 3300049581 Bacteria 3408
1371 Ga0501048_0021266 3300049582 Bacteria 4751
1372 Ga0501048_0241277 3300049582 Bacteria 1282
1373 Ga0501068_0048374 3300049584 Bacteria 2567
1374 Ga0501069_0091797 3300049585 Bacteria 1718
1375 Ga0501070_0024688 3300049586 Bacteria 5041
1376 Ga0501070_0097762 3300049586 Bacteria 2428
1377 Ga0501070_0231298 3300049586 Bacteria 1514
1378 Ga0501071_0008838 3300049587 Bacteria 6678
1379 Ga0501071_0078735 3300049587 Bacteria 2409
1380 Ga0501072_0001763 3300049588 Bacteria 16084
1381 Ga0501072_0004960 3300049588 Bacteria 10123
1382 Ga0501072_0009737 3300049588 Bacteria 7309
1383 Ga0501072_0167324 3300049588 Bacteria 1754
1384 Ga0501074_0002893 3300049590 Bacteria 12045
1385 Ga0501074_0090506 3300049590 Bacteria 2191
1386 Ga0501074_0324529 3300049590 Bacteria 1093
1387 Ga0501075_0001273 3300049591 Bacteria 16347
1388 Ga0501075_0020363 3300049591 Bacteria 4825
1389 Ga0501076_0001098 3300049592 Bacteria 17813
1390 Ga0501076_0015281 3300049592 Bacteria 5799
1391 Ga0501076_0044398 3300049592 Bacteria 3505
1392 Ga0501077_0003932 3300049593 Bacteria 8952
1393 Ga0501077_0151791 3300049593 Bacteria 1470
1394 Ga0501077_0251620 3300049593 Bacteria 1124
1395 Ga0501225_0025307 3300049705 Bacteria 1633
1396 Ga0501079_0000510 3300049741 Bacteria 25226
1397 Ga0501079_0006102 3300049741 Bacteria 9033
1398 Ga0501079_0054536 3300049741 Bacteria 3083
1399 Ga0501079_0144026 3300049741 Bacteria 1857
1400 Ga0501080_0014773 3300049742 Bacteria 7192
1401 Ga0501080_0023610 3300049742 Bacteria 5698
1402 Ga0501080_0060956 3300049742 Bacteria 3512
1403 Ga0501080_0347510 3300049742 Bacteria 1340
1404 Ga0501080_0549004 3300049742 Bacteria 1029
1405 Ga0501081_0003197 3300049743 Bacteria 10405
1406 Ga0501081_0008351 3300049743 Bacteria 6721
1407 Ga0501081_0010300 3300049743 Bacteria 6105
1408 Ga0501081_0167165 3300049743 Bacteria 1587
1409 Ga0501081_0318162 3300049743 Bacteria 1143
1410 Ga0501083_0020589 3300049744 Bacteria 4588
1411 Ga0501083_0087445 3300049744 Bacteria 2061
1412 Ga0501035_0071105 3300049822 Bacteria 3081
1413 Ga0501044_0002106 3300049823 Bacteria 22903
1414 Ga0501044_0008102 3300049823 Bacteria 11533
1415 Ga0501044_0125307 3300049823 Bacteria 2566
1416 Ga0501044_0143944 3300049823 Bacteria 2371
1417 Ga0501045_0001653 3300049824 Bacteria 14982
1418 Ga0501045_0021833 3300049824 Bacteria 4581
1419 Ga0501045_0040335 3300049824 Bacteria 3398
1420 nmdc:mga03683_3879_c1 3300050489 Bacteria 4887
1421 nmdc:mga03n38_97751_c1 3300050490 Bacteria 1411
1422 nmdc:mga00v17_142987_c1 3300050491 Bacteria 1242
1423 nmdc:mga00v17_41993_c1 3300050491 Bacteria 2749
1424 nmdc:mga0yw44_15574_c1 3300050492 Bacteria 4078
1425 nmdc:mga0yw44_2410_c1 3300050492 Bacteria 7959
1426 nmdc:mga0yw44_32026_c1 3300050492 Bacteria 3062
1427 nmdc:mga0k408_55463_c1 3300050493 Bacteria 2298
1428 nmdc:mga06z11_2208_c1 3300050494 Bacteria 4339
1429 nmdc:mga06z11_44877_c1 3300050494 Bacteria 2232
1430 nmdc:mga04h51_13369_c1 3300050495 Bacteria 2322
1431 nmdc:mga04h51_6938_c1 3300050495 Bacteria 2967
1432 nmdc:mga04h51_892_c1 3300050495 Bacteria 6869
1433 nmdc:mga07m45_81072_c1 3300050496 Bacteria 1853
1434 nmdc:mga05p37_125996_c1 3300050507 Bacteria 3145
1435 nmdc:mga05p37_1613_c1 3300050507 Bacteria 26137
1436 nmdc:mga05p37_184134_c1 3300050507 Bacteria 2540
1437 nmdc:mga05p37_20948_c1 3300050507 Bacteria 7914
1438 nmdc:mga05p37_26660_c1 3300050507 Bacteria 7027
1439 nmdc:mga05p37_2740_c1 3300050507 Bacteria 20479
1440 nmdc:mga05p37_327531_c1 3300050507 Bacteria 1811
1441 nmdc:mga05p37_346336_c1 3300050507 Bacteria 1751
1442 nmdc:mga05p37_371340_c1 3300050507 Bacteria 1679
1443 nmdc:mga05p37_53120_c1 3300050507 Bacteria 4983
1444 nmdc:mga05p37_66298_c1 3300050507 Bacteria 4441
1445 nmdc:mga05p37_90515_c1 3300050507 Bacteria 3770
1446 nmdc:mga09592_181176_c1 3300050508 Bacteria 1822
1447 nmdc:mga09592_253245_c1 3300050508 Bacteria 1526
1448 nmdc:mga09592_25575_c1 3300050508 Bacteria 4888
1449 nmdc:mga09592_3135_c1 3300050508 Bacteria 13431
1450 nmdc:mga09592_332512_c1 3300050508 Bacteria 1315
1451 nmdc:mga09592_46190_c1 3300050508 Bacteria 3669
1452 nmdc:mga09592_58665_c1 3300050508 Bacteria 3255
1453 nmdc:mga09592_58_c1 3300050508 Bacteria 61599
1454 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
1455 nmdc:mga0qj67_210205_c1 3300050509 Bacteria 1581
1456 nmdc:mga0qj67_233963_c1 3300050509 Bacteria 1491
1457 nmdc:mga0qj67_249420_c1 3300050509 Bacteria 1440
1458 nmdc:mga0qj67_64525_c1 3300050509 Bacteria 2913
1459 nmdc:mga06r32_117962_c1 3300050510 Bacteria 2616
1460 nmdc:mga06r32_1897_c1 3300050510 Bacteria 18623
1461 nmdc:mga06r32_193736_c1 3300050510 Bacteria 2019
1462 nmdc:mga06r32_223984_c1 3300050510 Bacteria 1869
1463 nmdc:mga06r32_25300_c1 3300050510 Bacteria 5522
1464 nmdc:mga06r32_2762_c1 3300050510 Bacteria 15703
1465 nmdc:mga06r32_69985_c1 3300050510 Bacteria 3392
1466 nmdc:mga06r32_84170_c1 3300050510 Bacteria 3099
1467 nmdc:mga08y16_14377_c1 3300050511 Bacteria 8332
1468 nmdc:mga08y16_166737_c1 3300050511 Bacteria 2288
1469 nmdc:mga08y16_25002_c1 3300050511 Bacteria 6301
1470 nmdc:mga08y16_287307_c1 3300050511 Bacteria 1696
1471 nmdc:mga08y16_4966_c1 3300050511 Bacteria 13903
1472 nmdc:mga08y16_80447_c1 3300050511 Bacteria 3397
1473 nmdc:mga08y16_82255_c1 3300050511 Bacteria 3357
1474 nmdc:mga0n895_10623_c1 3300050512 Bacteria 8152
1475 nmdc:mga0n895_135577_c1 3300050512 Bacteria 2488
1476 nmdc:mga0n895_176750_c1 3300050512 Bacteria 2166
1477 nmdc:mga0n895_268801_c1 3300050512 Bacteria 1730
1478 nmdc:mga0n895_3347_c1 3300050512 Bacteria 12892
1479 nmdc:mga0n895_40359_c1 3300050512 Bacteria 4533
1480 nmdc:mga0n895_7117_c1 3300050512 Bacteria 9565
1481 nmdc:mga0n895_87594_c1 3300050512 Bacteria 3112
1482 nmdc:mga0rr50_1082_c1 3300050513 Bacteria 14794
1483 nmdc:mga0rr50_128673_c1 3300050513 Bacteria 2025
1484 nmdc:mga0rr50_154003_c1 3300050513 Bacteria 1860
1485 nmdc:mga0rr50_235001_c1 3300050513 Bacteria 1518
1486 nmdc:mga0rr50_260817_c1 3300050513 Bacteria 1442
1487 nmdc:mga0rr50_270053_c1 3300050513 Bacteria 1417
1488 nmdc:mga0rr50_56422_c1 3300050513 Bacteria 2935
1489 nmdc:mga0rr50_61380_c1 3300050513 Bacteria 2832
1490 nmdc:mga0rr50_97635_c1 3300050513 Bacteria 2301
1491 nmdc:mga08x19_133932_c1 3300050514 Bacteria 1669
1492 nmdc:mga08x19_33126_c1 3300050514 Bacteria 3260
1493 nmdc:mga08x19_57532_c1 3300050514 Bacteria 2513
1494 nmdc:mga08x19_73505_c1 3300050514 Bacteria 2232
1495 nmdc:mga08x19_76652_c1 3300050514 Bacteria 2188
1496 nmdc:mga08x19_8149_c1 3300050514 Bacteria 6227
1497 nmdc:mga0a205_135728_c1 3300050515 Bacteria 2361
1498 nmdc:mga0a205_186991_c1 3300050515 Bacteria 1964
1499 nmdc:mga0a205_193381_c1 3300050515 Bacteria 1926
1500 nmdc:mga0a205_193580_c1 3300050515 Bacteria 1925
1501 nmdc:mga0a205_34546_c1 3300050515 Bacteria 4850
1502 nmdc:mga0a205_4041_c1 3300050515 Bacteria 13118
1503 nmdc:mga0a205_55435_c1 3300050515 Bacteria 3829
1504 nmdc:mga0sz30_13967_c1 3300050516 Bacteria 3153
1505 nmdc:mga0sz30_42815_c1 3300050516 Bacteria 1905
1506 Ga0495601_0000003 3300053077 Bacteria 493642
1507 Ga0495601_0000731 3300053077 Bacteria 17670
1508 Ga0495601_0001063 3300053077 Bacteria 15049
1509 Ga0495601_0003729 3300053077 Bacteria 8770
1510 Ga0495601_0005091 3300053077 Bacteria 7631
1511 Ga0495601_0016660 3300053077 Bacteria 4456
1512 Ga0495601_0022789 3300053077 Bacteria 3847
1513 Ga0495601_0030646 3300053077 Bacteria 3340
1514 Ga0495601_0044813 3300053077 Bacteria 2780
1515 Ga0495601_0069405 3300053077 Bacteria 2248
1516 Ga0495601_0084972 3300053077 Bacteria 2033
1517 Ga0495601_0229871 3300053077 Bacteria 1211
1518 Ga0495612_0000077 3300053078 Bacteria 44609
1519 Ga0495612_0000121 3300053078 Bacteria 32966
1520 Ga0495612_0001446 3300053078 Bacteria 9783
1521 Ga0495612_0001765 3300053078 Bacteria 8869
1522 Ga0495612_0003440 3300053078 Bacteria 6563
1523 Ga0495612_0019740 3300053078 Bacteria 2700
1524 Ga0495612_0035309 3300053078 Bacteria 2027
1525 Ga0495612_0067499 3300053078 Bacteria 1487
1526 Ga0495595_0000094 3300053084 Bacteria 41985
1527 Ga0495595_0000451 3300053084 Bacteria 15516
1528 Ga0495595_0001116 3300053084 Bacteria 10391
1529 Ga0495595_0026652 3300053084 Bacteria 2569
1530 Ga0495595_0027533 3300053084 Bacteria 2533
1531 Ga0495619_0000091 3300053085 Bacteria 69370
1532 Ga0495619_0000811 3300053085 Bacteria 20399
1533 Ga0495619_0001094 3300053085 Bacteria 17821
1534 Ga0495619_0002558 3300053085 Bacteria 11899
1535 Ga0495619_0002667 3300053085 Bacteria 11671
1536 Ga0495619_0003273 3300053085 Bacteria 10470
1537 Ga0495619_0004373 3300053085 Bacteria 9012
1538 Ga0495619_0006164 3300053085 Bacteria 7597
1539 Ga0495619_0019271 3300053085 Bacteria 4336
1540 Ga0495619_0034244 3300053085 Bacteria 3301
1541 Ga0495619_0056400 3300053085 Bacteria 2604
1542 Ga0495619_0059584 3300053085 Bacteria 2536
1543 Ga0495619_0126271 3300053085 Bacteria 1756
1544 Ga0495619_0150341 3300053085 Bacteria 1606
1545 Ga0495619_0178665 3300053085 Bacteria 1468
1546 Ga0500644_0002475 3300053088 Bacteria 4616
1547 Ga0500566_0034504 3300053094 Bacteria 2944
1548 Ga0500595_000001 3300053119 Bacteria 1088438
1549 Ga0500595_003340 3300053119 Bacteria 7536
1550 Ga0500658_0104549 3300053134 Bacteria 1240
1551 Ga0500559_0000120 3300053136 Bacteria 61423
1552 Ga0500616_0000001 3300053153 Bacteria 1986011
1553 Ga0500616_0089327 3300053153 Bacteria 1529
1554 Ga0500639_003192 3300053163 Bacteria 8278
1555 Ga0500645_000270 3300053730 Bacteria 37382
1556 Ga0500596_003565 3300053735 Bacteria 2938
1557 Ga0501084_0001036 3300054114 Bacteria 21606
1558 Ga0501084_0001690 3300054114 Bacteria 17532
1559 Ga0501084_0062886 3300054114 Bacteria 3107
1560 Ga0501084_0189553 3300054114 Bacteria 1735
1561 Ga0501084_0201440 3300054114 Bacteria 1679
1562 Ga0590077_003823 3300059426 Bacteria 3106
1563 Ga0501082_0002341 3300060353 Bacteria 16587
1564 Ga0501082_0245435 3300060353 Bacteria 1558
1565 Ga0501082_0426478 3300060353 Bacteria 1158
1566 Ga0530510_0000149 3300061734 Bacteria 41720
1567 Ga0530510_0016544 3300061734 Bacteria 5222
1568 Ga0530510_0018261 3300061734 Bacteria 4972
1569 Ga0530510_0067376 3300061734 Bacteria 2597
1570 Ga0530510_0167956 3300061734 Bacteria 1625
1571 Ga0530510_0184223 3300061734 Bacteria 1549

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0143944 Ga0501044_0143944_668_1585 305
2 3300053085 Ga0495619_0019271 Ga0495619_0019271_1673_2611 312
3 3300035691 Ga0373931_0008342 Ga0373931_0008342_3952_4893 313
4 3300035695 Ga0373927_0031994 Ga0373927_0031994_2456_3397 313
5 3300038443 Ga0395901_0059722 Ga0395901_0059722_811_1758 313
6 3300046517 Ga0495630_0150831 Ga0495630_0150831_29_970 313
7 3300046462 Ga0495651_0000819 Ga0495651_0000819_406_1353 315
8 3300046543 Ga0495645_0118305 Ga0495645_0118305_553_1500 315
9 3300046559 Ga0495667_0088819 Ga0495667_0088819_233_1180 315
10 3300046809 Ga0495600_0107174 Ga0495600_0107174_469_1416 315
11 3300047322 Ga0495680_0000400 Ga0495680_0000400_47250_48197 315
12 3300005564 Ga0070664_100381147 Ga0070664_1003811471 316
13 3300031238 Ga0265332_10001040 Ga0265332_1000104011 316
14 3300031242 Ga0265329_10021002 Ga0265329_100210022 316
15 3300031247 Ga0265340_10000678 Ga0265340_1000067820 316
16 3300031249 Ga0265339_10002503 Ga0265339_100025037 316
17 3300031344 Ga0265316_10130984 Ga0265316_101309843 316
18 3300031712 Ga0265342_10000137 Ga0265342_1000013745 316
19 3300006042 Ga0075368_10001831 Ga0075368_100018312 320
20 3300006048 Ga0075363_100005920 Ga0075363_1000059201 320
21 3300006177 Ga0075362_10011968 Ga0075362_100119682 320
22 3300006178 Ga0075367_10005350 Ga0075367_100053505 320
23 3300006195 Ga0075366_10004444 Ga0075366_100044448 320
24 3300006353 Ga0075370_10050573 Ga0075370_100505732 320
25 3300009147 Ga0114129_10491268 Ga0114129_104912682 320
26 3300027866 Ga0209813_10002360 Ga0209813_100023604 320
27 3300050489 nmdc:mga03683_3879_c1 nmdc:mga03683_3879_c1_2659_3627 320
28 3300050490 nmdc:mga03n38_97751_c1 nmdc:mga03n38_97751_c1_122_1090 320
29 3300050491 nmdc:mga00v17_41993_c1 nmdc:mga00v17_41993_c1_258_1226 320
30 3300050492 nmdc:mga0yw44_15574_c1 nmdc:mga0yw44_15574_c1_518_1486 320
31 3300050495 nmdc:mga04h51_892_c1 nmdc:mga04h51_892_c1_2686_3654 320
32 3300050516 nmdc:mga0sz30_13967_c1 nmdc:mga0sz30_13967_c1_1409_2377 320
33 3300005339 Ga0070660_100097243 Ga0070660_1000972432 321
34 3300005435 Ga0070714_100072245 Ga0070714_1000722452 321
35 3300005436 Ga0070713_100186983 Ga0070713_1001869831 321
36 3300005439 Ga0070711_100145812 Ga0070711_1001458122 321
37 3300005563 Ga0068855_100045601 Ga0068855_1000456014 321
38 3300009093 Ga0105240_10008260 Ga0105240_100082603 321
39 3300025913 Ga0207695_10339849 Ga0207695_103398491 321
40 3300025916 Ga0207663_10116217 Ga0207663_101162172 321
41 3300025919 Ga0207657_10026894 Ga0207657_100268943 321
42 3300025928 Ga0207700_10233312 Ga0207700_102333122 321
43 3300025929 Ga0207664_10063892 Ga0207664_100638922 321
44 3300030763 Ga0265763_1000340 Ga0265763_10003402 321
45 3300046642 Ga0495634_0103798 Ga0495634_0103798_342_1310 321
46 3300046689 Ga0495613_0164642 Ga0495613_0164642_27_995 321
47 3300048903 Ga0496100_0011272 Ga0496100_0011272_717_1685 321
48 3300048904 Ga0496101_0080733 Ga0496101_0080733_683_1651 321
49 3300048905 Ga0496102_0013890 Ga0496102_0013890_3098_4066 321
50 3300048906 Ga0496103_0112980 Ga0496103_0112980_178_1146 321
51 3300048908 Ga0496105_0171026 Ga0496105_0171026_234_1202 321
52 3300048909 Ga0496106_0011903 Ga0496106_0011903_4064_5032 321
53 3300048910 Ga0496107_0001687 Ga0496107_0001687_1766_2734 321
54 3300048911 Ga0496108_0091794 Ga0496108_0091794_1484_2452 321
55 3300048912 Ga0496109_0097128 Ga0496109_0097128_565_1530 321
56 3300048915 Ga0496112_0004477 Ga0496112_0004477_10077_11045 321
57 3300048915 Ga0496112_0403119 Ga0496112_0403119_237_1205 321
58 3300048916 Ga0496113_0171847 Ga0496113_0171847_695_1663 321
59 3300048917 Ga0496114_0206682 Ga0496114_0206682_126_1094 321
60 3300048918 Ga0496115_0356574 Ga0496115_0356574_52_1020 321
61 3300049585 Ga0501069_0091797 Ga0501069_0091797_375_1343 321
62 3300053077 Ga0495601_0022789 Ga0495601_0022789_1021_1989 321
63 3300003215 JGI25153J46596_10001339 JGI25153J46596_100013393 322
64 3300005327 Ga0070658_10005628 Ga0070658_100056282 322
65 3300005327 Ga0070658_10006316 Ga0070658_100063164 322
66 3300005336 Ga0070680_100009556 Ga0070680_1000095566 322
67 3300005336 Ga0070680_100029631 Ga0070680_1000296313 322
68 3300005336 Ga0070680_100128960 Ga0070680_1001289602 322
69 3300005336 Ga0070680_100153518 Ga0070680_1001535182 322
70 3300005339 Ga0070660_100012116 Ga0070660_1000121162 322
71 3300005339 Ga0070660_100250644 Ga0070660_1002506441 322
72 3300005343 Ga0070687_100155813 Ga0070687_1001558132 322
73 3300005435 Ga0070714_100075238 Ga0070714_1000752382 322
74 3300005435 Ga0070714_100138952 Ga0070714_1001389522 322
75 3300005440 Ga0070705_100119226 Ga0070705_1001192262 322
76 3300005456 Ga0070678_100157050 Ga0070678_1001570501 322
77 3300005458 Ga0070681_10006652 Ga0070681_100066525 322
78 3300005459 Ga0068867_100353154 Ga0068867_1003531541 322
79 3300005518 Ga0070699_100229168 Ga0070699_1002291682 322
80 3300005530 Ga0070679_100006070 Ga0070679_1000060707 322
81 3300005530 Ga0070679_100075598 Ga0070679_1000755983 322
82 3300005536 Ga0070697_100049080 Ga0070697_1000490802 322
83 3300005543 Ga0070672_100017010 Ga0070672_1000170102 322
84 3300005549 Ga0070704_100153414 Ga0070704_1001534142 322
85 3300005577 Ga0068857_100447151 Ga0068857_1004471511 322
86 3300006358 Ga0068871_100127376 Ga0068871_1001273762 322
87 3300006844 Ga0075428_100047522 Ga0075428_1000475225 322
88 3300006847 Ga0075431_100038681 Ga0075431_1000386818 322
89 3300006852 Ga0075433_10134618 Ga0075433_101346182 322
90 3300006871 Ga0075434_100006810 Ga0075434_10000681010 322
91 3300006914 Ga0075436_100089561 Ga0075436_1000895612 322
92 3300006914 Ga0075436_100195258 Ga0075436_1001952582 322
93 3300007076 Ga0075435_100028795 Ga0075435_1000287952 322
94 3300007076 Ga0075435_100104829 Ga0075435_1001048292 322
95 3300009093 Ga0105240_10012247 Ga0105240_1001224711 322
96 3300009094 Ga0111539_10107018 Ga0111539_101070182 322
97 3300009177 Ga0105248_10001498 Ga0105248_100014982 322
98 3300009551 Ga0105238_10173375 Ga0105238_101733751 322
99 3300013104 Ga0157370_10033007 Ga0157370_100330072 322
100 3300013297 Ga0157378_10001410 Ga0157378_100014102 322
101 3300015262 Ga0182007_10030378 Ga0182007_100303782 322
102 3300025297 Ga0209758_1000435 Ga0209758_100043526 322
103 3300025302 Ga0207426_1024338 Ga0207426_10243382 322
104 3300025315 Ga0207697_10054727 Ga0207697_100547272 322
105 3300025906 Ga0207699_10015406 Ga0207699_100154061 322
106 3300025909 Ga0207705_10003149 Ga0207705_1000314911 322
107 3300025909 Ga0207705_10138572 Ga0207705_101385722 322
108 3300025912 Ga0207707_10021172 Ga0207707_100211723 322
109 3300025912 Ga0207707_10144987 Ga0207707_101449872 322
110 3300025913 Ga0207695_10110083 Ga0207695_101100832 322
111 3300025917 Ga0207660_10050645 Ga0207660_100506452 322
112 3300025917 Ga0207660_10185059 Ga0207660_101850592 322
113 3300025919 Ga0207657_10286238 Ga0207657_102862382 322
114 3300025921 Ga0207652_10042607 Ga0207652_100426072 322
115 3300025921 Ga0207652_10050672 Ga0207652_100506724 322
116 3300025921 Ga0207652_10065771 Ga0207652_100657712 322
117 3300025921 Ga0207652_10226436 Ga0207652_102264362 322
118 3300025927 Ga0207687_10023518 Ga0207687_100235182 322
119 3300025934 Ga0207686_10079279 Ga0207686_100792792 322
120 3300025937 Ga0207669_10032805 Ga0207669_100328053 322
121 3300025938 Ga0207704_10037413 Ga0207704_100374132 322
122 3300025941 Ga0207711_10036181 Ga0207711_100361812 322
123 3300025949 Ga0207667_10495715 Ga0207667_104957152 322
124 3300026142 Ga0207698_10033198 Ga0207698_100331982 322
125 3300028381 Ga0268264_10043118 Ga0268264_100431182 322
126 3300031235 Ga0265330_10007843 Ga0265330_100078435 322
127 3300031241 Ga0265325_10000337 Ga0265325_1000033724 322
128 3300031242 Ga0265329_10043331 Ga0265329_100433311 322
129 3300031249 Ga0265339_10001278 Ga0265339_100012786 322
130 3300031249 Ga0265339_10044420 Ga0265339_100444201 322
131 3300031250 Ga0265331_10003566 Ga0265331_100035664 322
132 3300031456 Ga0307513_10250076 Ga0307513_102500762 322
133 3300031711 Ga0265314_10001524 Ga0265314_1000152412 322
134 3300031711 Ga0265314_10048659 Ga0265314_100486593 322
135 3300031712 Ga0265342_10001200 Ga0265342_100012009 322
136 3300032005 Ga0307411_10121786 Ga0307411_101217861 322
137 3300035118 Ga0373954_0000001 Ga0373954_0000001_53593_54561 322
138 3300035241 Ga0373961_0003870 Ga0373961_0003870_1958_2926 322
139 3300035691 Ga0373931_0031786 Ga0373931_0031786_1056_2024 322
140 3300035695 Ga0373927_0125869 Ga0373927_0125869_371_1339 322
141 3300035695 Ga0373927_0130430 Ga0373927_0130430_579_1547 322
142 3300035724 Ga0373933_0001288 Ga0373933_0001288_3164_4132 322
143 3300036401 Ga0373937_0002088 Ga0373937_0002088_3706_4674 322
144 3300036401 Ga0373937_0132467 Ga0373937_0132467_807_1790 322
145 3300037068 Ga0373925_0010148 Ga0373925_0010148_976_1944 322
146 3300037312 Ga0395899_0020489 Ga0395899_0020489_290_1264 322
147 3300037418 Ga0395900_0002147 Ga0395900_0002147_1869_2843 322
148 3300037418 Ga0395900_0489684 Ga0395900_0489684_38_1012 322
149 3300037466 Ga0395898_0004269 Ga0395898_0004269_12490_13464 322
150 3300037466 Ga0395898_0082419 Ga0395898_0082419_213_1187 322
151 3300037471 Ga0395905_0372354 Ga0395905_0372354_223_1191 322
152 3300038443 Ga0395901_0313125 Ga0395901_0313125_552_1526 322
153 3300039437 Ga0436365_0695771 Ga0436365_0695771_163_1131 322
154 3300041408 Ga0439453_0013579 Ga0439453_0013579_213_1181 322
155 3300042125 Ga0450923_002744 Ga0450923_002744_437_1405 322
156 3300042437 Ga0439444_0030556 Ga0439444_0030556_18_986 322
157 3300045836 Ga0466958_0022095 Ga0466958_0022095_2529_3497 322
158 3300045976 Ga0466967_0117739 Ga0466967_0117739_231_1205 322
159 3300046454 Ga0495592_0046851 Ga0495592_0046851_1602_2585 322
160 3300046462 Ga0495651_0247116 Ga0495651_0247116_207_1190 322
161 3300046463 Ga0495653_0013476 Ga0495653_0013476_3975_4958 322
162 3300046472 Ga0495580_0048824 Ga0495580_0048824_1886_2869 322
163 3300046491 Ga0495584_0014233 Ga0495584_0014233_557_1525 322
164 3300046511 Ga0495608_0002614 Ga0495608_0002614_7182_8165 322
165 3300046511 Ga0495608_0013146 Ga0495608_0013146_4652_5635 322
166 3300046516 Ga0495628_0071425 Ga0495628_0071425_783_1751 322
167 3300046517 Ga0495630_0030250 Ga0495630_0030250_2716_3699 322
168 3300046524 Ga0495648_0000756 Ga0495648_0000756_12430_13413 322
169 3300046526 Ga0495666_0105692 Ga0495666_0105692_321_1304 322
170 3300046535 Ga0495586_0031196 Ga0495586_0031196_759_1742 322
171 3300046535 Ga0495586_0037067 Ga0495586_0037067_281_1264 322
172 3300046536 Ga0495587_0015214 Ga0495587_0015214_3692_4675 322
173 3300046536 Ga0495587_0163109 Ga0495587_0163109_33_1016 322
174 3300046559 Ga0495667_0030274 Ga0495667_0030274_884_1867 322
175 3300046642 Ga0495634_0010998 Ga0495634_0010998_147_1130 322
176 3300046663 Ga0495635_0335580 Ga0495635_0335580_16_999 322
177 3300046675 Ga0495657_0028249 Ga0495657_0028249_415_1398 322
178 3300046679 Ga0495623_0086614 Ga0495623_0086614_395_1378 322
179 3300046680 Ga0495646_0023348 Ga0495646_0023348_2061_3044 322
180 3300046689 Ga0495613_0037448 Ga0495613_0037448_949_1932 322
181 3300047322 Ga0495680_0069787 Ga0495680_0069787_1657_2640 322
182 3300047322 Ga0495680_0341136 Ga0495680_0341136_45_1028 322
183 3300047444 Ga0495675_0009621 Ga0495675_0009621_4820_5803 322
184 3300047444 Ga0495675_0112994 Ga0495675_0112994_408_1391 322
185 3300047471 Ga0495684_0002067 Ga0495684_0002067_8394_9377 322
186 3300048088 Ga0495602_0298992 Ga0495602_0298992_110_1093 322
187 3300048904 Ga0496101_0017101 Ga0496101_0017101_2557_3525 322
188 3300048904 Ga0496101_0148359 Ga0496101_0148359_765_1733 322
189 3300048907 Ga0496104_0074629 Ga0496104_0074629_964_1932 322
190 3300048908 Ga0496105_0177033 Ga0496105_0177033_747_1715 322
191 3300048909 Ga0496106_0401710 Ga0496106_0401710_70_1038 322
192 3300048912 Ga0496109_0020370 Ga0496109_0020370_3736_4704 322
193 3300048913 Ga0496110_0035097 Ga0496110_0035097_1273_2241 322
194 3300048917 Ga0496114_0023496 Ga0496114_0023496_1331_2299 322
195 3300048917 Ga0496114_0072525 Ga0496114_0072525_33_1001 322
196 3300048918 Ga0496115_0036188 Ga0496115_0036188_2909_3877 322
197 3300048918 Ga0496115_0067923 Ga0496115_0067923_1884_2852 322
198 3300048921 Ga0496118_0019389 Ga0496118_0019389_1917_2903 322
199 3300048924 Ga0496121_0003205 Ga0496121_0003205_11307_12293 322
200 3300049568 Ga0501031_0113872 Ga0501031_0113872_149_1117 322
201 3300049569 Ga0501032_0129080 Ga0501032_0129080_102_1070 322
202 3300049570 Ga0501033_0030715 Ga0501033_0030715_627_1595 322
203 3300049571 Ga0501034_0048374 Ga0501034_0048374_192_1166 322
204 3300049571 Ga0501034_0058198 Ga0501034_0058198_632_1600 322
205 3300049571 Ga0501034_0243528 Ga0501034_0243528_316_1452 322
206 3300049573 Ga0501037_0076110 Ga0501037_0076110_872_1846 322
207 3300049574 Ga0501038_0081818 Ga0501038_0081818_1261_2235 322
208 3300049574 Ga0501038_0367611 Ga0501038_0367611_60_1034 322
209 3300049579 Ga0501043_0038157 Ga0501043_0038157_1203_2171 322
210 3300049579 Ga0501043_0180647 Ga0501043_0180647_600_1574 322
211 3300049580 Ga0501046_0045922 Ga0501046_0045922_1509_2477 322
212 3300049580 Ga0501046_0390326 Ga0501046_0390326_21_992 322
213 3300049581 Ga0501047_0035626 Ga0501047_0035626_689_1663 322
214 3300049581 Ga0501047_0042254 Ga0501047_0042254_1193_2161 322
215 3300049581 Ga0501047_0068890 Ga0501047_0068890_2269_3243 322
216 3300049582 Ga0501048_0241277 Ga0501048_0241277_195_1163 322
217 3300049584 Ga0501068_0048374 Ga0501068_0048374_1197_2165 322
218 3300049586 Ga0501070_0024688 Ga0501070_0024688_891_1859 322
219 3300049586 Ga0501070_0097762 Ga0501070_0097762_733_1701 322
220 3300049586 Ga0501070_0231298 Ga0501070_0231298_397_1365 322
221 3300049587 Ga0501071_0078735 Ga0501071_0078735_1400_2368 322
222 3300049588 Ga0501072_0009737 Ga0501072_0009737_4073_5044 322
223 3300049590 Ga0501074_0090506 Ga0501074_0090506_177_1148 322
224 3300049590 Ga0501074_0324529 Ga0501074_0324529_97_1068 322
225 3300049741 Ga0501079_0006102 Ga0501079_0006102_3820_4791 322
226 3300049741 Ga0501079_0054536 Ga0501079_0054536_1008_1976 322
227 3300049742 Ga0501080_0060956 Ga0501080_0060956_627_1595 322
228 3300049744 Ga0501083_0020589 Ga0501083_0020589_3204_4178 322
229 3300049744 Ga0501083_0087445 Ga0501083_0087445_211_1179 322
230 3300049822 Ga0501035_0071105 Ga0501035_0071105_632_1600 322
231 3300049823 Ga0501044_0002106 Ga0501044_0002106_1018_1986 322
232 3300049823 Ga0501044_0008102 Ga0501044_0008102_10223_11191 322
233 3300050493 nmdc:mga0k408_55463_c1 nmdc:mga0k408_55463_c1_206_1174 322
234 3300050507 nmdc:mga05p37_327531_c1 nmdc:mga05p37_327531_c1_34_1002 322
235 3300050511 nmdc:mga08y16_166737_c1 nmdc:mga08y16_166737_c1_438_1406 322
236 3300050511 nmdc:mga08y16_80447_c1 nmdc:mga08y16_80447_c1_2129_3097 322
237 3300050512 nmdc:mga0n895_10623_c1 nmdc:mga0n895_10623_c1_2680_3648 322
238 3300050513 nmdc:mga0rr50_1082_c1 nmdc:mga0rr50_1082_c1_358_1326 322
239 3300050513 nmdc:mga0rr50_270053_c1 nmdc:mga0rr50_270053_c1_20_988 322
240 3300050513 nmdc:mga0rr50_61380_c1 nmdc:mga0rr50_61380_c1_132_1100 322
241 3300050514 nmdc:mga08x19_57532_c1 nmdc:mga08x19_57532_c1_660_1628 322
242 3300050515 nmdc:mga0a205_186991_c1 nmdc:mga0a205_186991_c1_129_1097 322
243 3300053077 Ga0495601_0016660 Ga0495601_0016660_2169_3137 322
244 3300053078 Ga0495612_0001765 Ga0495612_0001765_58_1041 322
245 3300053078 Ga0495612_0035309 Ga0495612_0035309_124_1092 322
246 3300053085 Ga0495619_0178665 Ga0495619_0178665_366_1340 322
247 3300053088 Ga0500644_0002475 Ga0500644_0002475_2443_3417 322
248 3300053094 Ga0500566_0034504 Ga0500566_0034504_128_1102 322
249 3300053119 Ga0500595_000001 Ga0500595_000001_98282_99256 322
250 3300053119 Ga0500595_003340 Ga0500595_003340_1720_2706 322
251 3300053136 Ga0500559_0000120 Ga0500559_0000120_26177_27160 322
252 3300053153 Ga0500616_0000001 Ga0500616_0000001_1873311_1874285 322
253 3300053153 Ga0500616_0089327 Ga0500616_0089327_451_1425 322
254 3300053163 Ga0500639_003192 Ga0500639_003192_7144_8127 322
255 3300053730 Ga0500645_000270 Ga0500645_000270_15849_16823 322
256 3300053735 Ga0500596_003565 Ga0500596_003565_1198_2181 322
257 3300054114 Ga0501084_0001690 Ga0501084_0001690_14875_15846 322
258 3300054114 Ga0501084_0062886 Ga0501084_0062886_1256_2224 322
259 3300060353 Ga0501082_0245435 Ga0501082_0245435_76_1047 322
260 3300060353 Ga0501082_0426478 Ga0501082_0426478_42_1010 322
261 3300061734 Ga0530510_0016544 Ga0530510_0016544_1446_2417 322
262 2162886007 SwRhRL2b_contig_2283477 SwRhRL2b_0436.00001510 323
263 2209111006 2214761879 2213777742 323
264 3300000042 ARSoilYngRDRAFT_c00072 ARSoilYngRDRAFT_0007210 323
265 3300000043 ARcpr5yngRDRAFT_c000051 ARcpr5yngRDRAFT_00005111 323
266 3300000044 ARSoilOldRDRAFT_c000078 ARSoilOldRDRAFT_00007810 323
267 3300000652 ARCol0yngRDRAFT_1000056 ARCol0yngRDRAFT_100005611 323
268 3300001989 JGI24739J22299_10000758 JGI24739J22299_100007589 323
269 3300001990 JGI24737J22298_10000192 JGI24737J22298_100001924 323
270 3300001990 JGI24737J22298_10013263 JGI24737J22298_100132632 323
271 3300001990 JGI24737J22298_10016795 JGI24737J22298_100167954 323
272 3300002073 JGI24745J21846_1000940 JGI24745J21846_10009402 323
273 3300002075 JGI24738J21930_10000228 JGI24738J21930_100002284 323
274 3300002076 JGI24749J21850_1004141 JGI24749J21850_10041413 323
275 3300002077 JGI24744J21845_10002515 JGI24744J21845_100025153 323
276 3300002077 JGI24744J21845_10018418 JGI24744J21845_100184182 323
277 3300002126 JGI24035J26624_1000004 JGI24035J26624_10000044 323
278 3300002155 JGI24033J26618_1001964 JGI24033J26618_10019643 323
279 3300002244 JGI24742J22300_10000280 JGI24742J22300_100002806 323
280 3300003203 JGI25406J46586_10011227 JGI25406J46586_100112273 323
281 3300003371 JGI26145J50221_1002003 JGI26145J50221_10020032 323
282 3300003911 JGI25405J52794_10017859 JGI25405J52794_100178592 323
283 3300005277 Ga0065716_1001681 Ga0065716_10016814 323
284 3300005289 Ga0065704_10091392 Ga0065704_100913922 323
285 3300005290 Ga0065712_10001853 Ga0065712_100018533 323
286 3300005290 Ga0065712_10068579 Ga0065712_100685795 323
287 3300005290 Ga0065712_10092864 Ga0065712_100928642 323
288 3300005293 Ga0065715_10000703 Ga0065715_1000070317 323
289 3300005293 Ga0065715_10089046 Ga0065715_100890463 323
290 3300005295 Ga0065707_10008288 Ga0065707_100082882 323
291 3300005295 Ga0065707_10115406 Ga0065707_101154062 323
292 3300005328 Ga0070676_10000092 Ga0070676_1000009223 323
293 3300005328 Ga0070676_10049119 Ga0070676_100491193 323
294 3300005329 Ga0070683_100000314 Ga0070683_10000031411 323
295 3300005329 Ga0070683_100016906 Ga0070683_1000169065 323
296 3300005329 Ga0070683_100304325 Ga0070683_1003043251 323
297 3300005330 Ga0070690_100042717 Ga0070690_1000427173 323
298 3300005330 Ga0070690_100086935 Ga0070690_1000869352 323
299 3300005331 Ga0070670_100050469 Ga0070670_1000504691 323
300 3300005331 Ga0070670_100166944 Ga0070670_1001669442 323
301 3300005334 Ga0068869_100000904 Ga0068869_1000009049 323
302 3300005334 Ga0068869_100050831 Ga0068869_1000508312 323
303 3300005334 Ga0068869_100137127 Ga0068869_1001371271 323
304 3300005335 Ga0070666_10034905 Ga0070666_100349053 323
305 3300005336 Ga0070680_100001262 Ga0070680_10000126215 323
306 3300005336 Ga0070680_100021492 Ga0070680_1000214923 323
307 3300005336 Ga0070680_100026796 Ga0070680_1000267963 323
308 3300005336 Ga0070680_100429233 Ga0070680_1004292331 323
309 3300005337 Ga0070682_100000230 Ga0070682_1000002306 323
310 3300005337 Ga0070682_100011914 Ga0070682_1000119144 323
311 3300005337 Ga0070682_100033163 Ga0070682_1000331632 323
312 3300005337 Ga0070682_100213597 Ga0070682_1002135972 323
313 3300005338 Ga0068868_100000973 Ga0068868_10000097311 323
314 3300005338 Ga0068868_100017567 Ga0068868_1000175675 323
315 3300005338 Ga0068868_100048149 Ga0068868_1000481493 323
316 3300005338 Ga0068868_100136642 Ga0068868_1001366422 323
317 3300005339 Ga0070660_100010653 Ga0070660_1000106536 323
318 3300005339 Ga0070660_100021744 Ga0070660_1000217444 323
319 3300005339 Ga0070660_100102580 Ga0070660_1001025802 323
320 3300005340 Ga0070689_100000145 Ga0070689_1000001451 323
321 3300005340 Ga0070689_100004756 Ga0070689_1000047566 323
322 3300005340 Ga0070689_100035175 Ga0070689_1000351753 323
323 3300005340 Ga0070689_100042241 Ga0070689_1000422412 323
324 3300005340 Ga0070689_100084240 Ga0070689_1000842402 323
325 3300005340 Ga0070689_100172013 Ga0070689_1001720132 323
326 3300005341 Ga0070691_10001660 Ga0070691_100016608 323
327 3300005341 Ga0070691_10085142 Ga0070691_100851422 323
328 3300005343 Ga0070687_100000496 Ga0070687_1000004966 323
329 3300005343 Ga0070687_100106456 Ga0070687_1001064562 323
330 3300005343 Ga0070687_100145634 Ga0070687_1001456341 323
331 3300005344 Ga0070661_100000808 Ga0070661_1000008086 323
332 3300005344 Ga0070661_100037160 Ga0070661_1000371603 323
333 3300005344 Ga0070661_100048854 Ga0070661_1000488542 323
334 3300005345 Ga0070692_10000115 Ga0070692_100001155 323
335 3300005345 Ga0070692_10011691 Ga0070692_100116912 323
336 3300005345 Ga0070692_10012341 Ga0070692_100123412 323
337 3300005345 Ga0070692_10093303 Ga0070692_100933031 323
338 3300005347 Ga0070668_100001616 Ga0070668_1000016164 323
339 3300005347 Ga0070668_100048334 Ga0070668_1000483341 323
340 3300005347 Ga0070668_100116840 Ga0070668_1001168403 323
341 3300005347 Ga0070668_100139188 Ga0070668_1001391881 323
342 3300005347 Ga0070668_100417250 Ga0070668_1004172501 323
343 3300005353 Ga0070669_100000343 Ga0070669_1000003436 323
344 3300005353 Ga0070669_100005282 Ga0070669_1000052822 323
345 3300005353 Ga0070669_100015915 Ga0070669_1000159155 323
346 3300005353 Ga0070669_100035524 Ga0070669_1000355242 323
347 3300005353 Ga0070669_100198995 Ga0070669_1001989952 323
348 3300005354 Ga0070675_100000210 Ga0070675_1000002106 323
349 3300005354 Ga0070675_100111668 Ga0070675_1001116682 323
350 3300005354 Ga0070675_100397833 Ga0070675_1003978331 323
351 3300005355 Ga0070671_100007711 Ga0070671_1000077115 323
352 3300005355 Ga0070671_100013098 Ga0070671_1000130983 323
353 3300005356 Ga0070674_100000733 Ga0070674_1000007336 323
354 3300005356 Ga0070674_100027408 Ga0070674_1000274083 323
355 3300005356 Ga0070674_100050102 Ga0070674_1000501023 323
356 3300005356 Ga0070674_100098307 Ga0070674_1000983072 323
357 3300005364 Ga0070673_100000130 Ga0070673_1000001307 323
358 3300005364 Ga0070673_100049011 Ga0070673_1000490113 323
359 3300005364 Ga0070673_100146254 Ga0070673_1001462542 323
360 3300005365 Ga0070688_100001035 Ga0070688_1000010356 323
361 3300005365 Ga0070688_100013726 Ga0070688_1000137265 323
362 3300005365 Ga0070688_100094678 Ga0070688_1000946782 323
363 3300005366 Ga0070659_100040327 Ga0070659_1000403273 323
364 3300005366 Ga0070659_100332754 Ga0070659_1003327541 323
365 3300005367 Ga0070667_100001673 Ga0070667_10000167314 323
366 3300005367 Ga0070667_100060991 Ga0070667_1000609913 323
367 3300005367 Ga0070667_100093563 Ga0070667_1000935632 323
368 3300005367 Ga0070667_100276956 Ga0070667_1002769561 323
369 3300005406 Ga0070703_10010226 Ga0070703_100102263 323
370 3300005434 Ga0070709_10003656 Ga0070709_100036564 323
371 3300005434 Ga0070709_10140909 Ga0070709_101409092 323
372 3300005435 Ga0070714_100012550 Ga0070714_1000125505 323
373 3300005435 Ga0070714_100020155 Ga0070714_1000201554 323
374 3300005435 Ga0070714_100240249 Ga0070714_1002402492 323
375 3300005436 Ga0070713_100000742 Ga0070713_10000074216 323
376 3300005436 Ga0070713_100007771 Ga0070713_1000077714 323
377 3300005436 Ga0070713_100012709 Ga0070713_1000127094 323
378 3300005436 Ga0070713_100017722 Ga0070713_1000177226 323
379 3300005436 Ga0070713_100148247 Ga0070713_1001482472 323
380 3300005436 Ga0070713_100151328 Ga0070713_1001513282 323
381 3300005437 Ga0070710_10003673 Ga0070710_100036734 323
382 3300005437 Ga0070710_10038306 Ga0070710_100383062 323
383 3300005437 Ga0070710_10070623 Ga0070710_100706232 323
384 3300005437 Ga0070710_10101605 Ga0070710_101016052 323
385 3300005438 Ga0070701_10000012 Ga0070701_100000126 323
386 3300005438 Ga0070701_10004661 Ga0070701_100046613 323
387 3300005438 Ga0070701_10055305 Ga0070701_100553053 323
388 3300005438 Ga0070701_10135693 Ga0070701_101356931 323
389 3300005439 Ga0070711_100066210 Ga0070711_1000662102 323
390 3300005439 Ga0070711_100136541 Ga0070711_1001365412 323
391 3300005439 Ga0070711_100208724 Ga0070711_1002087241 323
392 3300005440 Ga0070705_100000280 Ga0070705_10000028018 323
393 3300005440 Ga0070705_100000341 Ga0070705_10000034123 323
394 3300005440 Ga0070705_100014226 Ga0070705_1000142263 323
395 3300005440 Ga0070705_100030270 Ga0070705_1000302702 323
396 3300005440 Ga0070705_100252081 Ga0070705_1002520811 323
397 3300005441 Ga0070700_100000800 Ga0070700_1000008003 323
398 3300005441 Ga0070700_100001845 Ga0070700_1000018452 323
399 3300005441 Ga0070700_100003630 Ga0070700_1000036305 323
400 3300005444 Ga0070694_100001081 Ga0070694_10000108113 323
401 3300005444 Ga0070694_100003068 Ga0070694_1000030685 323
402 3300005444 Ga0070694_100015908 Ga0070694_1000159082 323
403 3300005445 Ga0070708_100003444 Ga0070708_1000034444 323
404 3300005445 Ga0070708_100025386 Ga0070708_1000253862 323
405 3300005445 Ga0070708_100427786 Ga0070708_1004277861 323
406 3300005455 Ga0070663_100000097 Ga0070663_1000000976 323
407 3300005455 Ga0070663_100058431 Ga0070663_1000584311 323
408 3300005456 Ga0070678_100000452 Ga0070678_10000045212 323
409 3300005456 Ga0070678_100157268 Ga0070678_1001572682 323
410 3300005456 Ga0070678_100197657 Ga0070678_1001976571 323
411 3300005457 Ga0070662_100015603 Ga0070662_1000156032 323
412 3300005457 Ga0070662_100063866 Ga0070662_1000638662 323
413 3300005458 Ga0070681_10009132 Ga0070681_100091326 323
414 3300005458 Ga0070681_10044914 Ga0070681_100449144 323
415 3300005458 Ga0070681_10256345 Ga0070681_102563452 323
416 3300005458 Ga0070681_10354795 Ga0070681_103547951 323
417 3300005459 Ga0068867_100000731 Ga0068867_10000073117 323
418 3300005459 Ga0068867_100001793 Ga0068867_10000179317 323
419 3300005459 Ga0068867_100102017 Ga0068867_1001020173 323
420 3300005466 Ga0070685_10001019 Ga0070685_100010192 323
421 3300005467 Ga0070706_100144582 Ga0070706_1001445822 323
422 3300005468 Ga0070707_100021957 Ga0070707_1000219575 323
423 3300005468 Ga0070707_100194251 Ga0070707_1001942512 323
424 3300005471 Ga0070698_100010391 Ga0070698_1000103913 323
425 3300005518 Ga0070699_100145447 Ga0070699_1001454471 323
426 3300005518 Ga0070699_100192977 Ga0070699_1001929772 323
427 3300005530 Ga0070679_100011066 Ga0070679_1000110664 323
428 3300005530 Ga0070679_100018327 Ga0070679_1000183273 323
429 3300005530 Ga0070679_100025086 Ga0070679_1000250865 323
430 3300005530 Ga0070679_100040460 Ga0070679_1000404604 323
431 3300005530 Ga0070679_100195437 Ga0070679_1001954371 323
432 3300005535 Ga0070684_100000157 Ga0070684_10000015733 323
433 3300005535 Ga0070684_100010989 Ga0070684_1000109896 323
434 3300005535 Ga0070684_100142001 Ga0070684_1001420013 323
435 3300005535 Ga0070684_100177606 Ga0070684_1001776061 323
436 3300005535 Ga0070684_100247239 Ga0070684_1002472392 323
437 3300005536 Ga0070697_100000662 Ga0070697_10000066228 323
438 3300005536 Ga0070697_100029236 Ga0070697_1000292362 323
439 3300005536 Ga0070697_100110456 Ga0070697_1001104562 323
440 3300005536 Ga0070697_100146355 Ga0070697_1001463553 323
441 3300005536 Ga0070697_100270089 Ga0070697_1002700892 323
442 3300005539 Ga0068853_100001479 Ga0068853_1000014795 323
443 3300005539 Ga0068853_100135195 Ga0068853_1001351952 323
444 3300005539 Ga0068853_100135563 Ga0068853_1001355632 323
445 3300005543 Ga0070672_100001119 Ga0070672_10000111912 323
446 3300005543 Ga0070672_100238329 Ga0070672_1002383292 323
447 3300005544 Ga0070686_100000127 Ga0070686_10000012741 323
448 3300005544 Ga0070686_100004451 Ga0070686_1000044514 323
449 3300005544 Ga0070686_100005369 Ga0070686_1000053694 323
450 3300005544 Ga0070686_100008849 Ga0070686_1000088493 323
451 3300005545 Ga0070695_100002680 Ga0070695_1000026808 323
452 3300005545 Ga0070695_100007601 Ga0070695_1000076013 323
453 3300005545 Ga0070695_100025649 Ga0070695_1000256493 323
454 3300005545 Ga0070695_100028348 Ga0070695_1000283482 323
455 3300005545 Ga0070695_100106539 Ga0070695_1001065392 323
456 3300005546 Ga0070696_100000013 Ga0070696_10000001312 323
457 3300005546 Ga0070696_100000219 Ga0070696_10000021923 323
458 3300005546 Ga0070696_100000420 Ga0070696_10000042021 323
459 3300005546 Ga0070696_100020633 Ga0070696_1000206333 323
460 3300005546 Ga0070696_100064873 Ga0070696_1000648732 323
461 3300005546 Ga0070696_100067819 Ga0070696_1000678192 323
462 3300005546 Ga0070696_100140834 Ga0070696_1001408342 323
463 3300005546 Ga0070696_100347482 Ga0070696_1003474821 323
464 3300005547 Ga0070693_100000513 Ga0070693_10000051318 323
465 3300005547 Ga0070693_100004642 Ga0070693_1000046426 323
466 3300005547 Ga0070693_100014115 Ga0070693_1000141153 323
467 3300005548 Ga0070665_100034712 Ga0070665_1000347124 323
468 3300005548 Ga0070665_100043936 Ga0070665_1000439364 323
469 3300005549 Ga0070704_100007011 Ga0070704_1000070114 323
470 3300005549 Ga0070704_100011536 Ga0070704_1000115364 323
471 3300005549 Ga0070704_100032242 Ga0070704_1000322422 323
472 3300005549 Ga0070704_100077824 Ga0070704_1000778242 323
473 3300005563 Ga0068855_100004578 Ga0068855_10000457811 323
474 3300005564 Ga0070664_100000326 Ga0070664_10000032635 323
475 3300005577 Ga0068857_100000063 Ga0068857_1000000635 323
476 3300005577 Ga0068857_100381174 Ga0068857_1003811742 323
477 3300005578 Ga0068854_100000220 Ga0068854_1000002206 323
478 3300005578 Ga0068854_100159716 Ga0068854_1001597162 323
479 3300005614 Ga0068856_100118343 Ga0068856_1001183431 323
480 3300005614 Ga0068856_100203415 Ga0068856_1002034152 323
481 3300005614 Ga0068856_100328903 Ga0068856_1003289032 323
482 3300005615 Ga0070702_100003995 Ga0070702_1000039953 323
483 3300005615 Ga0070702_100017330 Ga0070702_1000173304 323
484 3300005615 Ga0070702_100021454 Ga0070702_1000214543 323
485 3300005615 Ga0070702_100026740 Ga0070702_1000267402 323
486 3300005616 Ga0068852_100001063 Ga0068852_10000106313 323
487 3300005616 Ga0068852_100002195 Ga0068852_1000021958 323
488 3300005616 Ga0068852_100082342 Ga0068852_1000823421 323
489 3300005617 Ga0068859_100005597 Ga0068859_1000055974 323
490 3300005617 Ga0068859_100051799 Ga0068859_1000517994 323
491 3300005617 Ga0068859_100115460 Ga0068859_1001154602 323
492 3300005617 Ga0068859_100244261 Ga0068859_1002442612 323
493 3300005617 Ga0068859_100574966 Ga0068859_1005749661 323
494 3300005618 Ga0068864_100005737 Ga0068864_10000573710 323
495 3300005618 Ga0068864_100027488 Ga0068864_1000274884 323
496 3300005618 Ga0068864_100114423 Ga0068864_1001144232 323
497 3300005618 Ga0068864_100151635 Ga0068864_1001516351 323
498 3300005618 Ga0068864_100188300 Ga0068864_1001883002 323
499 3300005718 Ga0068866_10001331 Ga0068866_100013317 323
500 3300005718 Ga0068866_10014540 Ga0068866_100145403 323
501 3300005719 Ga0068861_100000101 Ga0068861_1000001018 323
502 3300005719 Ga0068861_100062452 Ga0068861_1000624522 323
503 3300005719 Ga0068861_100126279 Ga0068861_1001262793 323
504 3300005840 Ga0068870_10000028 Ga0068870_1000002842 323
505 3300005840 Ga0068870_10044600 Ga0068870_100446002 323
506 3300005841 Ga0068863_100000386 Ga0068863_10000038641 323
507 3300005841 Ga0068863_100047708 Ga0068863_1000477083 323
508 3300005841 Ga0068863_100347059 Ga0068863_1003470592 323
509 3300005842 Ga0068858_100001144 Ga0068858_1000011449 323
510 3300005842 Ga0068858_100019509 Ga0068858_1000195094 323
511 3300005842 Ga0068858_100074574 Ga0068858_1000745743 323
512 3300005842 Ga0068858_100310827 Ga0068858_1003108272 323
513 3300005842 Ga0068858_100480727 Ga0068858_1004807272 323
514 3300005843 Ga0068860_100001254 Ga0068860_10000125416 323
515 3300005843 Ga0068860_100001979 Ga0068860_1000019795 323
516 3300005843 Ga0068860_100164537 Ga0068860_1001645372 323
517 3300005843 Ga0068860_100302330 Ga0068860_1003023302 323
518 3300005843 Ga0068860_100446328 Ga0068860_1004463281 323
519 3300005844 Ga0068862_100002105 Ga0068862_10000210513 323
520 3300005844 Ga0068862_100020980 Ga0068862_1000209804 323
521 3300005844 Ga0068862_100021368 Ga0068862_1000213685 323
522 3300005844 Ga0068862_100081103 Ga0068862_1000811032 323
523 3300005937 Ga0081455_10000695 Ga0081455_1000069517 323
524 3300005937 Ga0081455_10001514 Ga0081455_1000151412 323
525 3300005937 Ga0081455_10003644 Ga0081455_100036442 323
526 3300005937 Ga0081455_10005867 Ga0081455_100058676 323
527 3300005937 Ga0081455_10009771 Ga0081455_100097717 323
528 3300005937 Ga0081455_10035751 Ga0081455_100357512 323
529 3300005937 Ga0081455_10036594 Ga0081455_100365944 323
530 3300005937 Ga0081455_10073090 Ga0081455_100730901 323
531 3300005981 Ga0081538_10008218 Ga0081538_100082182 323
532 3300005981 Ga0081538_10024316 Ga0081538_100243164 323
533 3300005981 Ga0081538_10029366 Ga0081538_100293661 323
534 3300005981 Ga0081538_10052930 Ga0081538_100529302 323
535 3300005981 Ga0081538_10053616 Ga0081538_100536162 323
536 3300005983 Ga0081540_1010389 Ga0081540_10103891 323
537 3300005985 Ga0081539_10008460 Ga0081539_100084606 323
538 3300005985 Ga0081539_10017738 Ga0081539_100177382 323
539 3300006028 Ga0070717_10000362 Ga0070717_1000036217 323
540 3300006028 Ga0070717_10106201 Ga0070717_101062012 323
541 3300006028 Ga0070717_10208721 Ga0070717_102087212 323
542 3300006038 Ga0075365_10002433 Ga0075365_100024334 323
543 3300006051 Ga0075364_10084515 Ga0075364_100845151 323
544 3300006058 Ga0075432_10005143 Ga0075432_100051432 323
545 3300006163 Ga0070715_10005613 Ga0070715_100056134 323
546 3300006163 Ga0070715_10017658 Ga0070715_100176582 323
547 3300006175 Ga0070712_100010379 Ga0070712_1000103794 323
548 3300006175 Ga0070712_100018769 Ga0070712_1000187694 323
549 3300006175 Ga0070712_100022227 Ga0070712_1000222274 323
550 3300006175 Ga0070712_100026888 Ga0070712_1000268883 323
551 3300006175 Ga0070712_100106708 Ga0070712_1001067082 323
552 3300006237 Ga0097621_100000024 Ga0097621_10000002490 323
553 3300006237 Ga0097621_100000577 Ga0097621_10000057715 323
554 3300006237 Ga0097621_100002663 Ga0097621_1000026635 323
555 3300006237 Ga0097621_100026237 Ga0097621_1000262373 323
556 3300006237 Ga0097621_100050001 Ga0097621_1000500013 323
557 3300006237 Ga0097621_100272893 Ga0097621_1002728932 323
558 3300006353 Ga0075370_10026829 Ga0075370_100268293 323
559 3300006353 Ga0075370_10145853 Ga0075370_101458532 323
560 3300006358 Ga0068871_100000298 Ga0068871_1000002984 323
561 3300006358 Ga0068871_100011775 Ga0068871_1000117756 323
562 3300006358 Ga0068871_100017662 Ga0068871_1000176627 323
563 3300006358 Ga0068871_100049575 Ga0068871_1000495752 323
564 3300006844 Ga0075428_100004286 Ga0075428_10000428616 323
565 3300006844 Ga0075428_100005533 Ga0075428_10000553314 323
566 3300006844 Ga0075428_100032237 Ga0075428_1000322373 323
567 3300006844 Ga0075428_100040443 Ga0075428_1000404435 323
568 3300006844 Ga0075428_100179628 Ga0075428_1001796282 323
569 3300006844 Ga0075428_100288240 Ga0075428_1002882402 323
570 3300006844 Ga0075428_100305362 Ga0075428_1003053622 323
571 3300006846 Ga0075430_100000263 Ga0075430_10000026321 323
572 3300006846 Ga0075430_100044069 Ga0075430_1000440694 323
573 3300006846 Ga0075430_100127144 Ga0075430_1001271441 323
574 3300006847 Ga0075431_100074545 Ga0075431_1000745451 323
575 3300006847 Ga0075431_100104470 Ga0075431_1001044703 323
576 3300006847 Ga0075431_100135659 Ga0075431_1001356593 323
577 3300006847 Ga0075431_100136259 Ga0075431_1001362592 323
578 3300006847 Ga0075431_100163857 Ga0075431_1001638571 323
579 3300006847 Ga0075431_100227825 Ga0075431_1002278252 323
580 3300006847 Ga0075431_100350030 Ga0075431_1003500302 323
581 3300006852 Ga0075433_10001797 Ga0075433_100017971 323
582 3300006852 Ga0075433_10005891 Ga0075433_100058918 323
583 3300006852 Ga0075433_10114401 Ga0075433_101144013 323
584 3300006852 Ga0075433_10201182 Ga0075433_102011823 323
585 3300006871 Ga0075434_100016928 Ga0075434_1000169283 323
586 3300006871 Ga0075434_100033118 Ga0075434_1000331182 323
587 3300006871 Ga0075434_100066035 Ga0075434_1000660352 323
588 3300006871 Ga0075434_100264935 Ga0075434_1002649352 323
589 3300006880 Ga0075429_100000683 Ga0075429_10000068326 323
590 3300006880 Ga0075429_100002564 Ga0075429_10000256417 323
591 3300006880 Ga0075429_100093476 Ga0075429_1000934762 323
592 3300006880 Ga0075429_100154989 Ga0075429_1001549892 323
593 3300006880 Ga0075429_100260608 Ga0075429_1002606082 323
594 3300006880 Ga0075429_100362333 Ga0075429_1003623331 323
595 3300006881 Ga0068865_100000125 Ga0068865_10000012536 323
596 3300006881 Ga0068865_100000578 Ga0068865_10000057822 323
597 3300006881 Ga0068865_100042109 Ga0068865_1000421092 323
598 3300006914 Ga0075436_100009383 Ga0075436_1000093836 323
599 3300006914 Ga0075436_100009667 Ga0075436_1000096675 323
600 3300006914 Ga0075436_100012422 Ga0075436_1000124223 323
601 3300006914 Ga0075436_100043807 Ga0075436_1000438072 323
602 3300006914 Ga0075436_100043922 Ga0075436_1000439222 323
603 3300006914 Ga0075436_100045947 Ga0075436_1000459472 323
604 3300006914 Ga0075436_100224749 Ga0075436_1002247492 323
605 3300006931 Ga0097620_100005597 Ga0097620_1000055974 323
606 3300006931 Ga0097620_100051799 Ga0097620_1000517994 323
607 3300006931 Ga0097620_100115455 Ga0097620_1001154553 323
608 3300006931 Ga0097620_100244260 Ga0097620_1002442602 323
609 3300006931 Ga0097620_100574951 Ga0097620_1005749512 323
610 3300007076 Ga0075435_100006012 Ga0075435_1000060126 323
611 3300007076 Ga0075435_100216468 Ga0075435_1002164681 323
612 3300007076 Ga0075435_100220781 Ga0075435_1002207812 323
613 3300007265 Ga0099794_10004112 Ga0099794_100041125 323
614 3300007265 Ga0099794_10015536 Ga0099794_100155363 323
615 3300007265 Ga0099794_10101765 Ga0099794_101017652 323
616 3300007788 Ga0099795_10066103 Ga0099795_100661032 323
617 3300009011 Ga0105251_10022919 Ga0105251_100229193 323
618 3300009011 Ga0105251_10051476 Ga0105251_100514762 323
619 3300009092 Ga0105250_10032348 Ga0105250_100323482 323
620 3300009093 Ga0105240_10060094 Ga0105240_100600945 323
621 3300009093 Ga0105240_10270749 Ga0105240_102707492 323
622 3300009094 Ga0111539_10000548 Ga0111539_1000054815 323
623 3300009094 Ga0111539_10007739 Ga0111539_1000773911 323
624 3300009094 Ga0111539_10088284 Ga0111539_100882843 323
625 3300009094 Ga0111539_10120552 Ga0111539_101205522 323
626 3300009094 Ga0111539_10170459 Ga0111539_101704592 323
627 3300009094 Ga0111539_10255286 Ga0111539_102552862 323
628 3300009098 Ga0105245_10000173 Ga0105245_1000017330 323
629 3300009101 Ga0105247_10010178 Ga0105247_100101783 323
630 3300009101 Ga0105247_10018360 Ga0105247_100183603 323
631 3300009101 Ga0105247_10078781 Ga0105247_100787812 323
632 3300009147 Ga0114129_10010899 Ga0114129_1001089912 323
633 3300009147 Ga0114129_10037461 Ga0114129_100374613 323
634 3300009147 Ga0114129_10060974 Ga0114129_100609745 323
635 3300009147 Ga0114129_10148960 Ga0114129_101489603 323
636 3300009147 Ga0114129_10168064 Ga0114129_101680642 323
637 3300009147 Ga0114129_10216573 Ga0114129_102165733 323
638 3300009147 Ga0114129_10222591 Ga0114129_102225912 323
639 3300009147 Ga0114129_10536669 Ga0114129_105366692 323
640 3300009148 Ga0105243_10000377 Ga0105243_1000037738 323
641 3300009148 Ga0105243_10130408 Ga0105243_101304082 323
642 3300009148 Ga0105243_10177832 Ga0105243_101778322 323
643 3300009174 Ga0105241_10001249 Ga0105241_100012497 323
644 3300009174 Ga0105241_10050624 Ga0105241_100506243 323
645 3300009174 Ga0105241_10090738 Ga0105241_100907382 323
646 3300009174 Ga0105241_10166892 Ga0105241_101668922 323
647 3300009176 Ga0105242_10000419 Ga0105242_1000041927 323
648 3300009176 Ga0105242_10003223 Ga0105242_100032235 323
649 3300009176 Ga0105242_10018898 Ga0105242_100188983 323
650 3300009176 Ga0105242_10019401 Ga0105242_100194014 323
651 3300009176 Ga0105242_10232565 Ga0105242_102325651 323
652 3300009177 Ga0105248_10005453 Ga0105248_1000545314 323
653 3300009177 Ga0105248_10030229 Ga0105248_100302292 323
654 3300009177 Ga0105248_10060632 Ga0105248_100606323 323
655 3300009177 Ga0105248_10066775 Ga0105248_100667754 323
656 3300009545 Ga0105237_10018823 Ga0105237_100188233 323
657 3300009545 Ga0105237_10051338 Ga0105237_100513383 323
658 3300009545 Ga0105237_10052618 Ga0105237_100526184 323
659 3300009545 Ga0105237_10071358 Ga0105237_100713582 323
660 3300009551 Ga0105238_10009168 Ga0105238_100091685 323
661 3300009551 Ga0105238_10060357 Ga0105238_100603573 323
662 3300009553 Ga0105249_10001416 Ga0105249_1000141613 323
663 3300009553 Ga0105249_10037157 Ga0105249_100371575 323
664 3300009553 Ga0105249_10069953 Ga0105249_100699532 323
665 3300009553 Ga0105249_10205014 Ga0105249_102050142 323
666 3300009553 Ga0105249_10443499 Ga0105249_104434992 323
667 3300010375 Ga0105239_10023302 Ga0105239_100233023 323
668 3300010375 Ga0105239_10093407 Ga0105239_100934072 323
669 3300010375 Ga0105239_10106854 Ga0105239_101068542 323
670 3300011119 Ga0105246_10000819 Ga0105246_100008195 323
671 3300012492 Ga0157335_1001577 Ga0157335_10015772 323
672 3300012494 Ga0157341_1000385 Ga0157341_10003852 323
673 3300012497 Ga0157319_1001735 Ga0157319_10017352 323
674 3300012515 Ga0157338_1001655 Ga0157338_10016553 323
675 3300013102 Ga0157371_10044396 Ga0157371_100443962 323
676 3300013102 Ga0157371_10178225 Ga0157371_101782252 323
677 3300013104 Ga0157370_10302090 Ga0157370_103020902 323
678 3300013105 Ga0157369_10052824 Ga0157369_100528242 323
679 3300013105 Ga0157369_10126571 Ga0157369_101265712 323
680 3300013296 Ga0157374_10000410 Ga0157374_100004108 323
681 3300013296 Ga0157374_10044993 Ga0157374_100449931 323
682 3300013297 Ga0157378_10000993 Ga0157378_100009937 323
683 3300013297 Ga0157378_10042383 Ga0157378_100423832 323
684 3300013297 Ga0157378_10046245 Ga0157378_100462453 323
685 3300013297 Ga0157378_10059979 Ga0157378_100599793 323
686 3300013306 Ga0163162_10001508 Ga0163162_100015087 323
687 3300013306 Ga0163162_10089436 Ga0163162_100894362 323
688 3300013306 Ga0163162_10099712 Ga0163162_100997122 323
689 3300013307 Ga0157372_10007010 Ga0157372_100070107 323
690 3300013307 Ga0157372_10009504 Ga0157372_100095045 323
691 3300013307 Ga0157372_10026237 Ga0157372_100262374 323
692 3300013308 Ga0157375_10000283 Ga0157375_1000028334 323
693 3300013308 Ga0157375_10157269 Ga0157375_101572693 323
694 3300013308 Ga0157375_10178388 Ga0157375_101783882 323
695 3300014325 Ga0163163_10000757 Ga0163163_100007574 323
696 3300014325 Ga0163163_10014362 Ga0163163_100143625 323
697 3300014325 Ga0163163_10139115 Ga0163163_101391151 323
698 3300014325 Ga0163163_10280137 Ga0163163_102801371 323
699 3300014325 Ga0163163_10380817 Ga0163163_103808172 323
700 3300014326 Ga0157380_10000095 Ga0157380_1000009515 323
701 3300014326 Ga0157380_10087567 Ga0157380_100875671 323
702 3300014326 Ga0157380_10188531 Ga0157380_101885312 323
703 3300014745 Ga0157377_10068280 Ga0157377_100682802 323
704 3300014968 Ga0157379_10014320 Ga0157379_100143205 323
705 3300014969 Ga0157376_10002003 Ga0157376_100020038 323
706 3300017792 Ga0163161_10001324 Ga0163161_1000132412 323
707 3300017792 Ga0163161_10051420 Ga0163161_100514203 323
708 3300017792 Ga0163161_10266938 Ga0163161_102669382 323
709 3300024225 Ga0224572_1013092 Ga0224572_10130922 323
710 3300025271 Ga0207666_1000045 Ga0207666_100004520 323
711 3300025290 Ga0207673_1000430 Ga0207673_10004301 323
712 3300025315 Ga0207697_10000551 Ga0207697_100005515 323
713 3300025315 Ga0207697_10005406 Ga0207697_100054063 323
714 3300025885 Ga0207653_10006164 Ga0207653_100061643 323
715 3300025885 Ga0207653_10008081 Ga0207653_100080813 323
716 3300025893 Ga0207682_10000065 Ga0207682_1000006513 323
717 3300025893 Ga0207682_10000594 Ga0207682_100005949 323
718 3300025898 Ga0207692_10010364 Ga0207692_100103643 323
719 3300025898 Ga0207692_10024632 Ga0207692_100246321 323
720 3300025898 Ga0207692_10088606 Ga0207692_100886062 323
721 3300025899 Ga0207642_10000599 Ga0207642_100005999 323
722 3300025899 Ga0207642_10002207 Ga0207642_100022072 323
723 3300025900 Ga0207710_10001154 Ga0207710_100011544 323
724 3300025900 Ga0207710_10004887 Ga0207710_100048873 323
725 3300025900 Ga0207710_10006311 Ga0207710_100063113 323
726 3300025901 Ga0207688_10000039 Ga0207688_100000395 323
727 3300025901 Ga0207688_10005353 Ga0207688_100053537 323
728 3300025901 Ga0207688_10030901 Ga0207688_100309012 323
729 3300025901 Ga0207688_10133572 Ga0207688_101335722 323
730 3300025901 Ga0207688_10147991 Ga0207688_101479911 323
731 3300025903 Ga0207680_10001632 Ga0207680_100016324 323
732 3300025903 Ga0207680_10053905 Ga0207680_100539053 323
733 3300025903 Ga0207680_10074569 Ga0207680_100745691 323
734 3300025903 Ga0207680_10084516 Ga0207680_100845162 323
735 3300025903 Ga0207680_10128583 Ga0207680_101285833 323
736 3300025904 Ga0207647_10003499 Ga0207647_100034994 323
737 3300025904 Ga0207647_10007379 Ga0207647_100073795 323
738 3300025904 Ga0207647_10065269 Ga0207647_100652692 323
739 3300025905 Ga0207685_10072764 Ga0207685_100727642 323
740 3300025906 Ga0207699_10013894 Ga0207699_100138944 323
741 3300025906 Ga0207699_10053999 Ga0207699_100539992 323
742 3300025906 Ga0207699_10080133 Ga0207699_100801332 323
743 3300025907 Ga0207645_10000080 Ga0207645_1000008037 323
744 3300025907 Ga0207645_10017153 Ga0207645_100171533 323
745 3300025907 Ga0207645_10018253 Ga0207645_100182533 323
746 3300025908 Ga0207643_10000135 Ga0207643_1000013510 323
747 3300025908 Ga0207643_10001614 Ga0207643_100016147 323
748 3300025908 Ga0207643_10028527 Ga0207643_100285271 323
749 3300025908 Ga0207643_10061174 Ga0207643_100611742 323
750 3300025910 Ga0207684_10027586 Ga0207684_100275863 323
751 3300025910 Ga0207684_10260557 Ga0207684_102605572 323
752 3300025910 Ga0207684_10444112 Ga0207684_104441121 323
753 3300025911 Ga0207654_10005733 Ga0207654_100057336 323
754 3300025912 Ga0207707_10002157 Ga0207707_1000215712 323
755 3300025912 Ga0207707_10051017 Ga0207707_100510172 323
756 3300025912 Ga0207707_10102769 Ga0207707_101027692 323
757 3300025912 Ga0207707_10186687 Ga0207707_101866872 323
758 3300025912 Ga0207707_10259289 Ga0207707_102592891 323
759 3300025913 Ga0207695_10142163 Ga0207695_101421632 323
760 3300025914 Ga0207671_10166641 Ga0207671_101666412 323
761 3300025915 Ga0207693_10000413 Ga0207693_1000041336 323
762 3300025915 Ga0207693_10029119 Ga0207693_100291192 323
763 3300025915 Ga0207693_10032155 Ga0207693_100321554 323
764 3300025915 Ga0207693_10034921 Ga0207693_100349212 323
765 3300025915 Ga0207693_10043111 Ga0207693_100431113 323
766 3300025915 Ga0207693_10069328 Ga0207693_100693282 323
767 3300025915 Ga0207693_10162264 Ga0207693_101622642 323
768 3300025916 Ga0207663_10073383 Ga0207663_100733833 323
769 3300025916 Ga0207663_10088547 Ga0207663_100885472 323
770 3300025917 Ga0207660_10002018 Ga0207660_100020188 323
771 3300025917 Ga0207660_10030506 Ga0207660_100305061 323
772 3300025918 Ga0207662_10000336 Ga0207662_1000033617 323
773 3300025918 Ga0207662_10003204 Ga0207662_100032045 323
774 3300025918 Ga0207662_10088080 Ga0207662_100880802 323
775 3300025919 Ga0207657_10002336 Ga0207657_100023364 323
776 3300025919 Ga0207657_10024700 Ga0207657_100247005 323
777 3300025919 Ga0207657_10066940 Ga0207657_100669402 323
778 3300025919 Ga0207657_10083433 Ga0207657_100834333 323
779 3300025919 Ga0207657_10101584 Ga0207657_101015841 323
780 3300025920 Ga0207649_10000571 Ga0207649_1000057118 323
781 3300025921 Ga0207652_10023619 Ga0207652_100236194 323
782 3300025921 Ga0207652_10055691 Ga0207652_100556913 323
783 3300025922 Ga0207646_10094063 Ga0207646_100940633 323
784 3300025923 Ga0207681_10001830 Ga0207681_100018302 323
785 3300025923 Ga0207681_10006234 Ga0207681_100062349 323
786 3300025923 Ga0207681_10087108 Ga0207681_100871082 323
787 3300025923 Ga0207681_10089811 Ga0207681_100898113 323
788 3300025923 Ga0207681_10200152 Ga0207681_102001522 323
789 3300025924 Ga0207694_10008926 Ga0207694_100089266 323
790 3300025924 Ga0207694_10038805 Ga0207694_100388053 323
791 3300025924 Ga0207694_10090378 Ga0207694_100903783 323
792 3300025925 Ga0207650_10002774 Ga0207650_1000277412 323
793 3300025925 Ga0207650_10071126 Ga0207650_100711263 323
794 3300025926 Ga0207659_10000127 Ga0207659_100001275 323
795 3300025926 Ga0207659_10071309 Ga0207659_100713091 323
796 3300025926 Ga0207659_10213502 Ga0207659_102135022 323
797 3300025927 Ga0207687_10000843 Ga0207687_1000084313 323
798 3300025927 Ga0207687_10004064 Ga0207687_100040642 323
799 3300025927 Ga0207687_10106622 Ga0207687_101066222 323
800 3300025928 Ga0207700_10104675 Ga0207700_101046753 323
801 3300025929 Ga0207664_10017034 Ga0207664_100170342 323
802 3300025929 Ga0207664_10063965 Ga0207664_100639653 323
803 3300025931 Ga0207644_10067862 Ga0207644_100678621 323
804 3300025931 Ga0207644_10249315 Ga0207644_102493152 323
805 3300025931 Ga0207644_10287372 Ga0207644_102873722 323
806 3300025933 Ga0207706_10001765 Ga0207706_100017655 323
807 3300025933 Ga0207706_10007810 Ga0207706_100078102 323
808 3300025933 Ga0207706_10009896 Ga0207706_100098964 323
809 3300025933 Ga0207706_10072703 Ga0207706_100727033 323
810 3300025934 Ga0207686_10000297 Ga0207686_100002975 323
811 3300025934 Ga0207686_10014883 Ga0207686_100148833 323
812 3300025934 Ga0207686_10050836 Ga0207686_100508362 323
813 3300025934 Ga0207686_10070478 Ga0207686_100704783 323
814 3300025935 Ga0207709_10000257 Ga0207709_1000025727 323
815 3300025935 Ga0207709_10006905 Ga0207709_100069054 323
816 3300025935 Ga0207709_10029300 Ga0207709_100293003 323
817 3300025936 Ga0207670_10000371 Ga0207670_1000037120 323
818 3300025936 Ga0207670_10005799 Ga0207670_100057992 323
819 3300025936 Ga0207670_10088093 Ga0207670_100880932 323
820 3300025936 Ga0207670_10103405 Ga0207670_101034052 323
821 3300025937 Ga0207669_10000089 Ga0207669_100000897 323
822 3300025937 Ga0207669_10008043 Ga0207669_100080437 323
823 3300025937 Ga0207669_10076140 Ga0207669_100761403 323
824 3300025937 Ga0207669_10078186 Ga0207669_100781862 323
825 3300025937 Ga0207669_10261736 Ga0207669_102617362 323
826 3300025938 Ga0207704_10000355 Ga0207704_1000035515 323
827 3300025939 Ga0207665_10000341 Ga0207665_100003413 323
828 3300025939 Ga0207665_10033454 Ga0207665_100334541 323
829 3300025940 Ga0207691_10001737 Ga0207691_1000173717 323
830 3300025940 Ga0207691_10011088 Ga0207691_100110881 323
831 3300025940 Ga0207691_10039801 Ga0207691_100398013 323
832 3300025941 Ga0207711_10003607 Ga0207711_1000360713 323
833 3300025941 Ga0207711_10109821 Ga0207711_101098213 323
834 3300025941 Ga0207711_10409463 Ga0207711_104094632 323
835 3300025942 Ga0207689_10000095 Ga0207689_1000009538 323
836 3300025942 Ga0207689_10010011 Ga0207689_100100117 323
837 3300025942 Ga0207689_10091217 Ga0207689_100912171 323
838 3300025942 Ga0207689_10153900 Ga0207689_101539002 323
839 3300025944 Ga0207661_10000366 Ga0207661_1000036615 323
840 3300025945 Ga0207679_10000073 Ga0207679_1000007355 323
841 3300025945 Ga0207679_10148024 Ga0207679_101480242 323
842 3300025960 Ga0207651_10006763 Ga0207651_100067634 323
843 3300025960 Ga0207651_10056752 Ga0207651_100567522 323
844 3300025960 Ga0207651_10223375 Ga0207651_102233752 323
845 3300025961 Ga0207712_10000457 Ga0207712_1000045732 323
846 3300025961 Ga0207712_10002513 Ga0207712_100025132 323
847 3300025961 Ga0207712_10164004 Ga0207712_101640042 323
848 3300025961 Ga0207712_10222568 Ga0207712_102225682 323
849 3300025972 Ga0207668_10000971 Ga0207668_100009716 323
850 3300025972 Ga0207668_10068909 Ga0207668_100689092 323
851 3300025972 Ga0207668_10116162 Ga0207668_101161622 323
852 3300025972 Ga0207668_10191141 Ga0207668_101911412 323
853 3300025981 Ga0207640_10004127 Ga0207640_100041276 323
854 3300025986 Ga0207658_10007105 Ga0207658_100071057 323
855 3300025986 Ga0207658_10041977 Ga0207658_100419772 323
856 3300025986 Ga0207658_10121013 Ga0207658_101210132 323
857 3300026023 Ga0207677_10006524 Ga0207677_100065242 323
858 3300026023 Ga0207677_10033835 Ga0207677_100338352 323
859 3300026023 Ga0207677_10063598 Ga0207677_100635982 323
860 3300026023 Ga0207677_10105882 Ga0207677_101058822 323
861 3300026023 Ga0207677_10167496 Ga0207677_101674962 323
862 3300026035 Ga0207703_10005066 Ga0207703_1000506611 323
863 3300026035 Ga0207703_10280555 Ga0207703_102805552 323
864 3300026041 Ga0207639_10005440 Ga0207639_100054403 323
865 3300026041 Ga0207639_10112688 Ga0207639_101126882 323
866 3300026041 Ga0207639_10301505 Ga0207639_103015052 323
867 3300026067 Ga0207678_10000426 Ga0207678_1000042632 323
868 3300026067 Ga0207678_10021821 Ga0207678_100218211 323
869 3300026075 Ga0207708_10000114 Ga0207708_1000011413 323
870 3300026075 Ga0207708_10000991 Ga0207708_100009915 323
871 3300026075 Ga0207708_10002182 Ga0207708_1000218211 323
872 3300026075 Ga0207708_10004283 Ga0207708_100042835 323
873 3300026075 Ga0207708_10021214 Ga0207708_100212143 323
874 3300026078 Ga0207702_10103528 Ga0207702_101035282 323
875 3300026078 Ga0207702_10442281 Ga0207702_104422812 323
876 3300026088 Ga0207641_10006162 Ga0207641_100061622 323
877 3300026088 Ga0207641_10065242 Ga0207641_100652424 323
878 3300026088 Ga0207641_10083539 Ga0207641_100835392 323
879 3300026088 Ga0207641_10121032 Ga0207641_101210322 323
880 3300026088 Ga0207641_10300391 Ga0207641_103003912 323
881 3300026089 Ga0207648_10000207 Ga0207648_1000020719 323
882 3300026089 Ga0207648_10000911 Ga0207648_1000091136 323
883 3300026089 Ga0207648_10002119 Ga0207648_100021192 323
884 3300026089 Ga0207648_10011847 Ga0207648_100118475 323
885 3300026089 Ga0207648_10019639 Ga0207648_100196396 323
886 3300026089 Ga0207648_10044318 Ga0207648_100443183 323
887 3300026089 Ga0207648_10073925 Ga0207648_100739252 323
888 3300026095 Ga0207676_10019696 Ga0207676_100196965 323
889 3300026095 Ga0207676_10182121 Ga0207676_101821211 323
890 3300026116 Ga0207674_10001021 Ga0207674_1000102117 323
891 3300026116 Ga0207674_10011221 Ga0207674_100112214 323
892 3300026116 Ga0207674_10053829 Ga0207674_100538293 323
893 3300026118 Ga0207675_100001849 Ga0207675_10000184917 323
894 3300026118 Ga0207675_100006096 Ga0207675_1000060967 323
895 3300026118 Ga0207675_100015304 Ga0207675_1000153044 323
896 3300026118 Ga0207675_100045640 Ga0207675_1000456403 323
897 3300026118 Ga0207675_100206893 Ga0207675_1002068932 323
898 3300026121 Ga0207683_10000096 Ga0207683_1000009630 323
899 3300026121 Ga0207683_10001255 Ga0207683_100012553 323
900 3300026121 Ga0207683_10023112 Ga0207683_100231123 323
901 3300026142 Ga0207698_10004379 Ga0207698_100043792 323
902 3300027252 Ga0209973_1002178 Ga0209973_10021781 323
903 3300027360 Ga0209969_1002269 Ga0209969_10022692 323
904 3300027360 Ga0209969_1014275 Ga0209969_10142751 323
905 3300027552 Ga0209982_1009002 Ga0209982_10090022 323
906 3300027614 Ga0209970_1004647 Ga0209970_10046473 323
907 3300027665 Ga0209983_1013903 Ga0209983_10139032 323
908 3300027671 Ga0209588_1000523 Ga0209588_10005232 323
909 3300027682 Ga0209971_1006304 Ga0209971_10063043 323
910 3300027695 Ga0209966_1004674 Ga0209966_10046742 323
911 3300027717 Ga0209998_10002847 Ga0209998_100028473 323
912 3300027717 Ga0209998_10008685 Ga0209998_100086853 323
913 3300027876 Ga0209974_10003040 Ga0209974_100030403 323
914 3300027876 Ga0209974_10040991 Ga0209974_100409911 323
915 3300027876 Ga0209974_10047065 Ga0209974_100470652 323
916 3300027907 Ga0207428_10000160 Ga0207428_1000016026 323
917 3300027907 Ga0207428_10001473 Ga0207428_100014733 323
918 3300027907 Ga0207428_10003619 Ga0207428_100036196 323
919 3300027907 Ga0207428_10011893 Ga0207428_100118934 323
920 3300027907 Ga0207428_10033934 Ga0207428_100339342 323
921 3300027907 Ga0207428_10149577 Ga0207428_101495772 323
922 3300028379 Ga0268266_10014066 Ga0268266_100140662 323
923 3300028380 Ga0268265_10000291 Ga0268265_1000029143 323
924 3300028380 Ga0268265_10001718 Ga0268265_1000171814 323
925 3300028380 Ga0268265_10003071 Ga0268265_100030712 323
926 3300028380 Ga0268265_10062765 Ga0268265_100627652 323
927 3300028380 Ga0268265_10148899 Ga0268265_101488992 323
928 3300028381 Ga0268264_10001803 Ga0268264_100018034 323
929 3300028381 Ga0268264_10061594 Ga0268264_100615942 323
930 3300028381 Ga0268264_10193969 Ga0268264_101939692 323
931 3300028381 Ga0268264_10340710 Ga0268264_103407101 323
932 3300031235 Ga0265330_10043972 Ga0265330_100439722 323
933 3300031240 Ga0265320_10021565 Ga0265320_100215651 323
934 3300031240 Ga0265320_10066218 Ga0265320_100662181 323
935 3300031241 Ga0265325_10000004 Ga0265325_10000004191 323
936 3300031241 Ga0265325_10011448 Ga0265325_100114485 323
937 3300031247 Ga0265340_10014852 Ga0265340_100148521 323
938 3300031249 Ga0265339_10000051 Ga0265339_1000005186 323
939 3300031249 Ga0265339_10016545 Ga0265339_100165453 323
940 3300031249 Ga0265339_10060772 Ga0265339_100607722 323
941 3300031250 Ga0265331_10059380 Ga0265331_100593802 323
942 3300031344 Ga0265316_10115968 Ga0265316_101159682 323
943 3300031595 Ga0265313_10000011 Ga0265313_1000001127 323
944 3300031595 Ga0265313_10003047 Ga0265313_1000304715 323
945 3300031595 Ga0265313_10049869 Ga0265313_100498691 323
946 3300031691 Ga0316579_10035701 Ga0316579_100357012 323
947 3300031711 Ga0265314_10005064 Ga0265314_100050649 323
948 3300031711 Ga0265314_10064077 Ga0265314_100640772 323
949 3300031712 Ga0265342_10056992 Ga0265342_100569922 323
950 3300031712 Ga0265342_10115721 Ga0265342_101157212 323
951 3300031903 Ga0307407_10231985 Ga0307407_102319851 323
952 3300034816 Ga0373930_0000168 Ga0373930_0000168_6435_7406 323
953 3300034816 Ga0373930_0004456 Ga0373930_0004456_611_1594 323
954 3300034816 Ga0373930_0014488 Ga0373930_0014488_464_1435 323
955 3300034817 Ga0373948_0006095 Ga0373948_0006095_720_1691 323
956 3300034817 Ga0373948_0011386 Ga0373948_0011386_81_1052 323
957 3300034818 Ga0373950_0000167 Ga0373950_0000167_5372_6343 323
958 3300034818 Ga0373950_0000765 Ga0373950_0000765_1115_2086 323
959 3300034819 Ga0373958_0000254 Ga0373958_0000254_2355_3326 323
960 3300034820 Ga0373959_0000454 Ga0373959_0000454_1997_2968 323
961 3300034957 Ga0373938_0000028 Ga0373938_0000028_8190_9161 323
962 3300034957 Ga0373938_0018829 Ga0373938_0018829_384_1355 323
963 3300035083 Ga0373926_0005103 Ga0373926_0005103_118_1176 323
964 3300035083 Ga0373926_0020195 Ga0373926_0020195_1174_2145 323
965 3300035084 Ga0373928_0000334 Ga0373928_0000334_910_1881 323
966 3300035084 Ga0373928_0002262 Ga0373928_0002262_1532_2503 323
967 3300035085 Ga0373929_0002550 Ga0373929_0002550_666_1637 323
968 3300035086 Ga0373934_0000768 Ga0373934_0000768_3163_4134 323
969 3300035086 Ga0373934_0020100 Ga0373934_0020100_449_1420 323
970 3300035086 Ga0373934_0021882 Ga0373934_0021882_1394_2365 323
971 3300035088 Ga0373940_0000035 Ga0373940_0000035_769_1740 323
972 3300035088 Ga0373940_0025303 Ga0373940_0025303_258_1241 323
973 3300035089 Ga0373944_0002335 Ga0373944_0002335_3355_4326 323
974 3300035089 Ga0373944_0017735 Ga0373944_0017735_724_1722 323
975 3300035089 Ga0373944_0059390 Ga0373944_0059390_180_1151 323
976 3300035090 Ga0373949_0005274 Ga0373949_0005274_622_1593 323
977 3300035090 Ga0373949_0022180 Ga0373949_0022180_257_1252 323
978 3300035091 Ga0373951_0001519 Ga0373951_0001519_2030_3001 323
979 3300035092 Ga0373952_0000412 Ga0373952_0000412_1282_2253 323
980 3300035092 Ga0373952_0001851 Ga0373952_0001851_2156_3127 323
981 3300035092 Ga0373952_0003242 Ga0373952_0003242_1426_2397 323
982 3300035111 Ga0373923_0000172 Ga0373923_0000172_8091_9062 323
983 3300035111 Ga0373923_0004862 Ga0373923_0004862_1128_2099 323
984 3300035111 Ga0373923_0012241 Ga0373923_0012241_799_1776 323
985 3300035112 Ga0373932_0001412 Ga0373932_0001412_5333_6304 323
986 3300035112 Ga0373932_0003882 Ga0373932_0003882_1947_2918 323
987 3300035113 Ga0373936_0001267 Ga0373936_0001267_4935_5993 323
988 3300035113 Ga0373936_0002470 Ga0373936_0002470_2521_3492 323
989 3300035113 Ga0373936_0071305 Ga0373936_0071305_346_1317 323
990 3300035113 Ga0373936_0089996 Ga0373936_0089996_52_1023 323
991 3300035113 Ga0373936_0136135 Ga0373936_0136135_18_989 323
992 3300035114 Ga0373939_0003020 Ga0373939_0003020_496_1467 323
993 3300035114 Ga0373939_0005310 Ga0373939_0005310_1583_2554 323
994 3300035114 Ga0373939_0005800 Ga0373939_0005800_103_1074 323
995 3300035114 Ga0373939_0034079 Ga0373939_0034079_53_1024 323
996 3300035115 Ga0373941_0001305 Ga0373941_0001305_3786_4757 323
997 3300035116 Ga0373945_0001667 Ga0373945_0001667_3588_4559 323
998 3300035116 Ga0373945_0005102 Ga0373945_0005102_506_1477 323
999 3300035116 Ga0373945_0009493 Ga0373945_0009493_928_1986 323
1000 3300035117 Ga0373953_0001914 Ga0373953_0001914_4675_5646 323
1001 3300035117 Ga0373953_0005816 Ga0373953_0005816_2213_3184 323
1002 3300035117 Ga0373953_0008617 Ga0373953_0008617_1261_2232 323
1003 3300035117 Ga0373953_0014941 Ga0373953_0014941_448_1443 323
1004 3300035118 Ga0373954_0002854 Ga0373954_0002854_6301_7272 323
1005 3300035118 Ga0373954_0002859 Ga0373954_0002859_5140_6111 323
1006 3300035118 Ga0373954_0006729 Ga0373954_0006729_2743_3714 323
1007 3300035118 Ga0373954_0050922 Ga0373954_0050922_582_1553 323
1008 3300035119 Ga0373956_0015202 Ga0373956_0015202_209_1180 323
1009 3300035119 Ga0373956_0015568 Ga0373956_0015568_748_1719 323
1010 3300035119 Ga0373956_0039620 Ga0373956_0039620_710_1681 323
1011 3300035119 Ga0373956_0042273 Ga0373956_0042273_641_1612 323
1012 3300035119 Ga0373956_0057346 Ga0373956_0057346_695_1666 323
1013 3300035120 Ga0373957_0001412 Ga0373957_0001412_3088_4059 323
1014 3300035120 Ga0373957_0010382 Ga0373957_0010382_1562_2533 323
1015 3300035120 Ga0373957_0019972 Ga0373957_0019972_1107_2078 323
1016 3300035121 Ga0373960_0001936 Ga0373960_0001936_262_1233 323
1017 3300035170 Ga0373943_0003253 Ga0373943_0003253_2908_3879 323
1018 3300035170 Ga0373943_0004683 Ga0373943_0004683_3091_4149 323
1019 3300035170 Ga0373943_0006816 Ga0373943_0006816_2515_3486 323
1020 3300035170 Ga0373943_0008136 Ga0373943_0008136_1707_2678 323
1021 3300035171 Ga0373946_0000559 Ga0373946_0000559_5447_6505 323
1022 3300035171 Ga0373946_0003106 Ga0373946_0003106_3080_4051 323
1023 3300035171 Ga0373946_0022545 Ga0373946_0022545_281_1252 323
1024 3300035171 Ga0373946_0050197 Ga0373946_0050197_509_1480 323
1025 3300035172 Ga0373955_0001609 Ga0373955_0001609_6773_7744 323
1026 3300035172 Ga0373955_0004071 Ga0373955_0004071_3663_4634 323
1027 3300035172 Ga0373955_0004884 Ga0373955_0004884_2720_3691 323
1028 3300035172 Ga0373955_0005003 Ga0373955_0005003_3484_4455 323
1029 3300035172 Ga0373955_0011991 Ga0373955_0011991_2296_3267 323
1030 3300035172 Ga0373955_0064297 Ga0373955_0064297_776_1753 323
1031 3300035207 Ga0373942_0001919 Ga0373942_0001919_3586_4557 323
1032 3300035207 Ga0373942_0008293 Ga0373942_0008293_199_1170 323
1033 3300035241 Ga0373961_0000433 Ga0373961_0000433_7633_8604 323
1034 3300035242 Ga0373962_0001003 Ga0373962_0001003_2312_3283 323
1035 3300035242 Ga0373962_0004617 Ga0373962_0004617_1555_2526 323
1036 3300035242 Ga0373962_0005430 Ga0373962_0005430_488_1459 323
1037 3300035242 Ga0373962_0016764 Ga0373962_0016764_38_1021 323
1038 3300035410 Ga0373924_0001700 Ga0373924_0001700_376_1347 323
1039 3300035410 Ga0373924_0034625 Ga0373924_0034625_143_1120 323
1040 3300035691 Ga0373931_0000337 Ga0373931_0000337_12356_13339 323
1041 3300035691 Ga0373931_0003505 Ga0373931_0003505_1900_2871 323
1042 3300035691 Ga0373931_0014117 Ga0373931_0014117_209_1180 323
1043 3300035691 Ga0373931_0057400 Ga0373931_0057400_207_1178 323
1044 3300035691 Ga0373931_0190810 Ga0373931_0190810_106_1077 323
1045 3300035692 Ga0373935_0000045 Ga0373935_0000045_45219_46190 323
1046 3300035692 Ga0373935_0004283 Ga0373935_0004283_6758_7816 323
1047 3300035692 Ga0373935_0005363 Ga0373935_0005363_5564_6535 323
1048 3300035692 Ga0373935_0014279 Ga0373935_0014279_289_1347 323
1049 3300035692 Ga0373935_0023744 Ga0373935_0023744_30_1001 323
1050 3300035692 Ga0373935_0040909 Ga0373935_0040909_722_1720 323
1051 3300035692 Ga0373935_0044043 Ga0373935_0044043_1162_2133 323
1052 3300035695 Ga0373927_0005968 Ga0373927_0005968_1599_2657 323
1053 3300035695 Ga0373927_0009251 Ga0373927_0009251_1589_2560 323
1054 3300035695 Ga0373927_0010016 Ga0373927_0010016_2625_3596 323
1055 3300035695 Ga0373927_0019339 Ga0373927_0019339_296_1354 323
1056 3300035695 Ga0373927_0023361 Ga0373927_0023361_664_1635 323
1057 3300035724 Ga0373933_0001649 Ga0373933_0001649_1517_2488 323
1058 3300035724 Ga0373933_0005631 Ga0373933_0005631_2630_3601 323
1059 3300035724 Ga0373933_0011892 Ga0373933_0011892_2989_3960 323
1060 3300035724 Ga0373933_0112276 Ga0373933_0112276_83_1054 323
1061 3300035724 Ga0373933_0131214 Ga0373933_0131214_473_1444 323
1062 3300035724 Ga0373933_0213119 Ga0373933_0213119_48_1043 323
1063 3300035725 Ga0373947_0004104 Ga0373947_0004104_4063_5061 323
1064 3300035725 Ga0373947_0004981 Ga0373947_0004981_1209_2267 323
1065 3300035725 Ga0373947_0007212 Ga0373947_0007212_4266_5237 323
1066 3300035725 Ga0373947_0008452 Ga0373947_0008452_4503_5474 323
1067 3300035725 Ga0373947_0019275 Ga0373947_0019275_1081_2139 323
1068 3300035725 Ga0373947_0136009 Ga0373947_0136009_115_1086 323
1069 3300036401 Ga0373937_0000369 Ga0373937_0000369_38121_39092 323
1070 3300036401 Ga0373937_0001643 Ga0373937_0001643_14723_15694 323
1071 3300036401 Ga0373937_0001794 Ga0373937_0001794_15012_15983 323
1072 3300036401 Ga0373937_0002336 Ga0373937_0002336_9262_10233 323
1073 3300036401 Ga0373937_0003155 Ga0373937_0003155_2418_3413 323
1074 3300036401 Ga0373937_0004936 Ga0373937_0004936_5162_6133 323
1075 3300036401 Ga0373937_0010769 Ga0373937_0010769_4184_5161 323
1076 3300036401 Ga0373937_0042006 Ga0373937_0042006_1176_2147 323
1077 3300036401 Ga0373937_0056107 Ga0373937_0056107_1014_1985 323
1078 3300036401 Ga0373937_0077789 Ga0373937_0077789_941_1912 323
1079 3300036401 Ga0373937_0156190 Ga0373937_0156190_343_1314 323
1080 3300036401 Ga0373937_0283168 Ga0373937_0283168_343_1314 323
1081 3300036401 Ga0373937_0429758 Ga0373937_0429758_125_1096 323
1082 3300036401 Ga0373937_0522701 Ga0373937_0522701_14_985 323
1083 3300037068 Ga0373925_0000178 Ga0373925_0000178_65666_66637 323
1084 3300037068 Ga0373925_0003205 Ga0373925_0003205_6289_7347 323
1085 3300037068 Ga0373925_0004574 Ga0373925_0004574_5151_6122 323
1086 3300037068 Ga0373925_0010176 Ga0373925_0010176_2337_3335 323
1087 3300037068 Ga0373925_0010983 Ga0373925_0010983_4523_5494 323
1088 3300037068 Ga0373925_0029726 Ga0373925_0029726_488_1462 323
1089 3300037068 Ga0373925_0044257 Ga0373925_0044257_491_1462 323
1090 3300037068 Ga0373925_0083755 Ga0373925_0083755_1278_2336 323
1091 3300037466 Ga0395898_0054345 Ga0395898_0054345_2320_3291 323
1092 3300037853 Ga0436364_1069864 Ga0436364_1069864_573_1544 323
1093 3300038443 Ga0395901_0060715 Ga0395901_0060715_1543_2514 323
1094 3300039437 Ga0436365_0022253 Ga0436365_0022253_174_1145 323
1095 3300039437 Ga0436365_1267930 Ga0436365_1267930_49_1020 323
1096 3300039447 Ga0436361_0402758 Ga0436361_0402758_2034_3005 323
1097 3300041408 Ga0439453_0009448 Ga0439453_0009448_46_1017 323
1098 3300042003 Ga0439443_001551 Ga0439443_001551_711_1682 323
1099 3300042005 Ga0439448_0011470 Ga0439448_0011470_952_1923 323
1100 3300042012 Ga0439455_0010597 Ga0439455_0010597_100_1071 323
1101 3300042436 Ga0439435_0001415 Ga0439435_0001415_1479_2450 323
1102 3300042437 Ga0439444_0024021 Ga0439444_0024021_41_1012 323
1103 3300042461 Ga0439460_0008276 Ga0439460_0008276_1090_2061 323
1104 3300042993 Ga0439440_0032658 Ga0439440_0032658_91_1062 323
1105 3300044684 Ga0466966_0029988 Ga0466966_0029988_1965_2942 323
1106 3300044842 Ga0466957_0107032 Ga0466957_0107032_115_1092 323
1107 3300045051 Ga0451576_0000220 Ga0451576_0000220_69357_70352 323
1108 3300045051 Ga0451576_0011312 Ga0451576_0011312_7053_8036 323
1109 3300045051 Ga0451576_0012520 Ga0451576_0012520_4731_5702 323
1110 3300045051 Ga0451576_0083017 Ga0451576_0083017_439_1410 323
1111 3300045051 Ga0451576_0084560 Ga0451576_0084560_1999_2982 323
1112 3300045051 Ga0451576_0401318 Ga0451576_0401318_249_1220 323
1113 3300045976 Ga0466967_0231526 Ga0466967_0231526_267_1238 323
1114 3300046454 Ga0495592_0000118 Ga0495592_0000118_2710_3681 323
1115 3300046454 Ga0495592_0000589 Ga0495592_0000589_11935_12906 323
1116 3300046454 Ga0495592_0006116 Ga0495592_0006116_3131_4102 323
1117 3300046454 Ga0495592_0012726 Ga0495592_0012726_3372_4343 323
1118 3300046455 Ga0495603_0023654 Ga0495603_0023654_1415_2386 323
1119 3300046459 Ga0495629_0000107 Ga0495629_0000107_41503_42474 323
1120 3300046459 Ga0495629_0058403 Ga0495629_0058403_673_1644 323
1121 3300046459 Ga0495629_0070443 Ga0495629_0070443_1328_2299 323
1122 3300046459 Ga0495629_0184579 Ga0495629_0184579_179_1150 323
1123 3300046460 Ga0495638_0005571 Ga0495638_0005571_5300_6271 323
1124 3300046461 Ga0495641_0001910 Ga0495641_0001910_3599_4570 323
1125 3300046461 Ga0495641_0009860 Ga0495641_0009860_3637_4608 323
1126 3300046462 Ga0495651_0000529 Ga0495651_0000529_8073_9044 323
1127 3300046462 Ga0495651_0001232 Ga0495651_0001232_15078_16049 323
1128 3300046462 Ga0495651_0002956 Ga0495651_0002956_5183_6154 323
1129 3300046462 Ga0495651_0007599 Ga0495651_0007599_2545_3516 323
1130 3300046462 Ga0495651_0010196 Ga0495651_0010196_1983_2954 323
1131 3300046462 Ga0495651_0071333 Ga0495651_0071333_1291_2268 323
1132 3300046463 Ga0495653_0000155 Ga0495653_0000155_51030_52001 323
1133 3300046463 Ga0495653_0002252 Ga0495653_0002252_2265_3236 323
1134 3300046463 Ga0495653_0005360 Ga0495653_0005360_5221_6192 323
1135 3300046463 Ga0495653_0015476 Ga0495653_0015476_3898_4956 323
1136 3300046463 Ga0495653_0020230 Ga0495653_0020230_3299_4270 323
1137 3300046463 Ga0495653_0043303 Ga0495653_0043303_2114_3085 323
1138 3300046472 Ga0495580_0009794 Ga0495580_0009794_2638_3609 323
1139 3300046472 Ga0495580_0012043 Ga0495580_0012043_5590_6573 323
1140 3300046472 Ga0495580_0019164 Ga0495580_0019164_3501_4472 323
1141 3300046472 Ga0495580_0064303 Ga0495580_0064303_945_2003 323
1142 3300046472 Ga0495580_0075909 Ga0495580_0075909_25_996 323
1143 3300046473 Ga0495582_0002609 Ga0495582_0002609_7886_8857 323
1144 3300046473 Ga0495582_0008958 Ga0495582_0008958_4114_5085 323
1145 3300046474 Ga0495605_0047976 Ga0495605_0047976_749_1720 323
1146 3300046475 Ga0495639_0001237 Ga0495639_0001237_7982_8953 323
1147 3300046475 Ga0495639_0010684 Ga0495639_0010684_173_1144 323
1148 3300046476 Ga0495662_0000946 Ga0495662_0000946_467_1438 323
1149 3300046476 Ga0495662_0003166 Ga0495662_0003166_5351_6409 323
1150 3300046476 Ga0495662_0008118 Ga0495662_0008118_4107_5078 323
1151 3300046476 Ga0495662_0015201 Ga0495662_0015201_2288_3259 323
1152 3300046476 Ga0495662_0061373 Ga0495662_0061373_408_1379 323
1153 3300046477 Ga0495664_0000005 Ga0495664_0000005_2748_3719 323
1154 3300046477 Ga0495664_0000214 Ga0495664_0000214_21049_22107 323
1155 3300046477 Ga0495664_0007330 Ga0495664_0007330_1660_2631 323
1156 3300046492 Ga0495585_0015795 Ga0495585_0015795_1235_2206 323
1157 3300046499 Ga0495594_0013023 Ga0495594_0013023_2908_3879 323
1158 3300046499 Ga0495594_0043253 Ga0495594_0043253_563_1534 323
1159 3300046501 Ga0495607_0004511 Ga0495607_0004511_5600_6571 323
1160 3300046511 Ga0495608_0000083 Ga0495608_0000083_2750_3721 323
1161 3300046511 Ga0495608_0003829 Ga0495608_0003829_2090_3061 323
1162 3300046511 Ga0495608_0006604 Ga0495608_0006604_4977_5948 323
1163 3300046511 Ga0495608_0141321 Ga0495608_0141321_417_1388 323
1164 3300046513 Ga0495616_0053246 Ga0495616_0053246_346_1317 323
1165 3300046514 Ga0495618_0000079 Ga0495618_0000079_2746_3717 323
1166 3300046514 Ga0495618_0003754 Ga0495618_0003754_7450_8508 323
1167 3300046514 Ga0495618_0006097 Ga0495618_0006097_3596_4567 323
1168 3300046514 Ga0495618_0011842 Ga0495618_0011842_154_1125 323
1169 3300046514 Ga0495618_0015138 Ga0495618_0015138_472_1443 323
1170 3300046515 Ga0495620_0106641 Ga0495620_0106641_14_985 323
1171 3300046516 Ga0495628_0000033 Ga0495628_0000033_51082_52053 323
1172 3300046516 Ga0495628_0021325 Ga0495628_0021325_3458_4429 323
1173 3300046516 Ga0495628_0022301 Ga0495628_0022301_4190_5161 323
1174 3300046516 Ga0495628_0037540 Ga0495628_0037540_2024_2995 323
1175 3300046516 Ga0495628_0093595 Ga0495628_0093595_1128_2099 323
1176 3300046517 Ga0495630_0014224 Ga0495630_0014224_3275_4246 323
1177 3300046517 Ga0495630_0024667 Ga0495630_0024667_2069_3127 323
1178 3300046517 Ga0495630_0169617 Ga0495630_0169617_339_1310 323
1179 3300046517 Ga0495630_0252173 Ga0495630_0252173_55_1026 323
1180 3300046517 Ga0495630_0259063 Ga0495630_0259063_256_1227 323
1181 3300046518 Ga0495631_0137529 Ga0495631_0137529_39_1010 323
1182 3300046520 Ga0495637_0049076 Ga0495637_0049076_46_1017 323
1183 3300046525 Ga0495663_0038442 Ga0495663_0038442_168_1139 323
1184 3300046526 Ga0495666_0001319 Ga0495666_0001319_410_1381 323
1185 3300046526 Ga0495666_0027631 Ga0495666_0027631_236_1207 323
1186 3300046526 Ga0495666_0070767 Ga0495666_0070767_274_1245 323
1187 3300046529 Ga0495652_0000001 Ga0495652_0000001_65666_66637 323
1188 3300046529 Ga0495652_0010464 Ga0495652_0010464_5935_6906 323
1189 3300046529 Ga0495652_0021890 Ga0495652_0021890_926_1897 323
1190 3300046529 Ga0495652_0022247 Ga0495652_0022247_146_1117 323
1191 3300046531 Ga0495665_0000336 Ga0495665_0000336_4028_4999 323
1192 3300046531 Ga0495665_0030679 Ga0495665_0030679_222_1193 323
1193 3300046531 Ga0495665_0034147 Ga0495665_0034147_1408_2379 323
1194 3300046531 Ga0495665_0041259 Ga0495665_0041259_47_1018 323
1195 3300046531 Ga0495665_0112407 Ga0495665_0112407_111_1169 323
1196 3300046533 Ga0495640_0000010 Ga0495640_0000010_65881_66852 323
1197 3300046533 Ga0495640_0005141 Ga0495640_0005141_1255_2313 323
1198 3300046533 Ga0495640_0012446 Ga0495640_0012446_5019_5990 323
1199 3300046533 Ga0495640_0038926 Ga0495640_0038926_2031_3002 323
1200 3300046535 Ga0495586_0007420 Ga0495586_0007420_3892_4863 323
1201 3300046535 Ga0495586_0010662 Ga0495586_0010662_1760_2731 323
1202 3300046535 Ga0495586_0019621 Ga0495586_0019621_149_1132 323
1203 3300046536 Ga0495587_0000090 Ga0495587_0000090_2750_3721 323
1204 3300046536 Ga0495587_0001998 Ga0495587_0001998_4919_5890 323
1205 3300046536 Ga0495587_0002816 Ga0495587_0002816_5962_6933 323
1206 3300046536 Ga0495587_0021157 Ga0495587_0021157_876_1847 323
1207 3300046536 Ga0495587_0025575 Ga0495587_0025575_1034_2005 323
1208 3300046537 Ga0495598_0000806 Ga0495598_0000806_1074_2045 323
1209 3300046537 Ga0495598_0034255 Ga0495598_0034255_25_996 323
1210 3300046538 Ga0495609_0017720 Ga0495609_0017720_1505_2476 323
1211 3300046538 Ga0495609_0105979 Ga0495609_0105979_186_1157 323
1212 3300046539 Ga0495621_0014347 Ga0495621_0014347_453_1424 323
1213 3300046543 Ga0495645_0000005 Ga0495645_0000005_2719_3690 323
1214 3300046543 Ga0495645_0004724 Ga0495645_0004724_36_1007 323
1215 3300046543 Ga0495645_0006219 Ga0495645_0006219_2040_3098 323
1216 3300046543 Ga0495645_0007615 Ga0495645_0007615_3117_4088 323
1217 3300046543 Ga0495645_0030855 Ga0495645_0030855_2793_3764 323
1218 3300046543 Ga0495645_0040486 Ga0495645_0040486_1523_2494 323
1219 3300046557 Ga0495622_0004793 Ga0495622_0004793_2746_3717 323
1220 3300046557 Ga0495622_0035462 Ga0495622_0035462_284_1255 323
1221 3300046558 Ga0495633_0010198 Ga0495633_0010198_1533_2504 323
1222 3300046559 Ga0495667_0000079 Ga0495667_0000079_65666_66637 323
1223 3300046559 Ga0495667_0002476 Ga0495667_0002476_7982_8953 323
1224 3300046559 Ga0495667_0008400 Ga0495667_0008400_2903_3874 323
1225 3300046559 Ga0495667_0008600 Ga0495667_0008600_903_1874 323
1226 3300046559 Ga0495667_0097290 Ga0495667_0097290_252_1223 323
1227 3300046559 Ga0495667_0310525 Ga0495667_0310525_15_986 323
1228 3300046615 Ga0495656_0003112 Ga0495656_0003112_2592_3563 323
1229 3300046616 Ga0495668_0051811 Ga0495668_0051811_414_1385 323
1230 3300046642 Ga0495634_0000166 Ga0495634_0000166_56767_57738 323
1231 3300046642 Ga0495634_0003507 Ga0495634_0003507_8802_9860 323
1232 3300046642 Ga0495634_0007374 Ga0495634_0007374_4794_5765 323
1233 3300046642 Ga0495634_0007626 Ga0495634_0007626_4511_5482 323
1234 3300046642 Ga0495634_0144082 Ga0495634_0144082_460_1431 323
1235 3300046663 Ga0495635_0000055 Ga0495635_0000055_65734_66705 323
1236 3300046663 Ga0495635_0000409 Ga0495635_0000409_5974_7032 323
1237 3300046663 Ga0495635_0000600 Ga0495635_0000600_21899_22870 323
1238 3300046663 Ga0495635_0008198 Ga0495635_0008198_4906_5877 323
1239 3300046663 Ga0495635_0022335 Ga0495635_0022335_43_1014 323
1240 3300046663 Ga0495635_0044627 Ga0495635_0044627_1673_2644 323
1241 3300046663 Ga0495635_0219427 Ga0495635_0219427_20_991 323
1242 3300046664 Ga0495659_0041406 Ga0495659_0041406_573_1589 323
1243 3300046674 Ga0495588_0012769 Ga0495588_0012769_1403_2374 323
1244 3300046674 Ga0495588_0013779 Ga0495588_0013779_834_1817 323
1245 3300046675 Ga0495657_0000124 Ga0495657_0000124_65657_66628 323
1246 3300046675 Ga0495657_0001218 Ga0495657_0001218_19156_20127 323
1247 3300046675 Ga0495657_0004623 Ga0495657_0004623_1279_2250 323
1248 3300046675 Ga0495657_0088909 Ga0495657_0088909_218_1195 323
1249 3300046678 Ga0495599_0000075 Ga0495599_0000075_2719_3690 323
1250 3300046678 Ga0495599_0000970 Ga0495599_0000970_642_1613 323
1251 3300046678 Ga0495599_0001117 Ga0495599_0001117_9528_10499 323
1252 3300046678 Ga0495599_0006912 Ga0495599_0006912_2211_3182 323
1253 3300046678 Ga0495599_0028669 Ga0495599_0028669_2036_3007 323
1254 3300046678 Ga0495599_0102170 Ga0495599_0102170_558_1529 323
1255 3300046679 Ga0495623_0000003 Ga0495623_0000003_51033_52004 323
1256 3300046679 Ga0495623_0000758 Ga0495623_0000758_13825_14796 323
1257 3300046679 Ga0495623_0006189 Ga0495623_0006189_3157_4128 323
1258 3300046680 Ga0495646_0000042 Ga0495646_0000042_2721_3692 323
1259 3300046680 Ga0495646_0000300 Ga0495646_0000300_7451_8422 323
1260 3300046680 Ga0495646_0009235 Ga0495646_0009235_2663_3634 323
1261 3300046681 Ga0495647_0001743 Ga0495647_0001743_1664_2635 323
1262 3300046681 Ga0495647_0002414 Ga0495647_0002414_1681_2652 323
1263 3300046681 Ga0495647_0014006 Ga0495647_0014006_928_1899 323
1264 3300046683 Ga0495658_0000517 Ga0495658_0000517_5746_6717 323
1265 3300046683 Ga0495658_0016813 Ga0495658_0016813_343_1314 323
1266 3300046683 Ga0495658_0023188 Ga0495658_0023188_1018_1989 323
1267 3300046683 Ga0495658_0070438 Ga0495658_0070438_461_1432 323
1268 3300046684 Ga0495669_0008276 Ga0495669_0008276_325_1296 323
1269 3300046684 Ga0495669_0069974 Ga0495669_0069974_217_1188 323
1270 3300046684 Ga0495669_0095569 Ga0495669_0095569_221_1192 323
1271 3300046689 Ga0495613_0001790 Ga0495613_0001790_15007_15978 323
1272 3300046689 Ga0495613_0004550 Ga0495613_0004550_516_1487 323
1273 3300046689 Ga0495613_0018022 Ga0495613_0018022_1752_2723 323
1274 3300046689 Ga0495613_0279088 Ga0495613_0279088_118_1089 323
1275 3300046690 Ga0495624_0005864 Ga0495624_0005864_5657_6715 323
1276 3300046690 Ga0495624_0010233 Ga0495624_0010233_171_1142 323
1277 3300046690 Ga0495624_0014021 Ga0495624_0014021_2961_3932 323
1278 3300046691 Ga0495670_0001321 Ga0495670_0001321_10750_11721 323
1279 3300046694 Ga0495649_0043554 Ga0495649_0043554_812_1783 323
1280 3300046809 Ga0495600_0000052 Ga0495600_0000052_65741_66712 323
1281 3300046809 Ga0495600_0000426 Ga0495600_0000426_1995_2966 323
1282 3300046809 Ga0495600_0012951 Ga0495600_0012951_4220_5191 323
1283 3300046809 Ga0495600_0014693 Ga0495600_0014693_902_1873 323
1284 3300046809 Ga0495600_0071856 Ga0495600_0071856_747_1718 323
1285 3300046809 Ga0495600_0094801 Ga0495600_0094801_838_1815 323
1286 3300047315 Ga0495581_0001977 Ga0495581_0001977_9965_10936 323
1287 3300047317 Ga0495604_0000010 Ga0495604_0000010_245491_246462 323
1288 3300047317 Ga0495604_0000930 Ga0495604_0000930_15975_16946 323
1289 3300047317 Ga0495604_0001425 Ga0495604_0001425_3586_4557 323
1290 3300047317 Ga0495604_0080702 Ga0495604_0080702_1023_1994 323
1291 3300047318 Ga0495636_0010835 Ga0495636_0010835_2136_3107 323
1292 3300047319 Ga0495674_0000013 Ga0495674_0000013_65666_66637 323
1293 3300047319 Ga0495674_0012823 Ga0495674_0012823_5551_6609 323
1294 3300047319 Ga0495674_0029899 Ga0495674_0029899_41_1012 323
1295 3300047319 Ga0495674_0054626 Ga0495674_0054626_2326_3297 323
1296 3300047319 Ga0495674_0155353 Ga0495674_0155353_256_1227 323
1297 3300047320 Ga0495672_0069565 Ga0495672_0069565_922_1893 323
1298 3300047322 Ga0495680_0000275 Ga0495680_0000275_2747_3718 323
1299 3300047322 Ga0495680_0017000 Ga0495680_0017000_1978_2949 323
1300 3300047322 Ga0495680_0017709 Ga0495680_0017709_3541_4512 323
1301 3300047322 Ga0495680_0059142 Ga0495680_0059142_615_1592 323
1302 3300047322 Ga0495680_0102462 Ga0495680_0102462_756_1727 323
1303 3300047322 Ga0495680_0339004 Ga0495680_0339004_28_1023 323
1304 3300047444 Ga0495675_0000297 Ga0495675_0000297_32012_32983 323
1305 3300047444 Ga0495675_0007916 Ga0495675_0007916_2107_3078 323
1306 3300047444 Ga0495675_0015732 Ga0495675_0015732_2669_3640 323
1307 3300047446 Ga0495679_045710 Ga0495679_045710_238_1209 323
1308 3300047470 Ga0495681_0073279 Ga0495681_0073279_333_1304 323
1309 3300047471 Ga0495684_0000008 Ga0495684_0000008_65666_66637 323
1310 3300047471 Ga0495684_0001567 Ga0495684_0001567_9862_10833 323
1311 3300047471 Ga0495684_0007476 Ga0495684_0007476_5493_6551 323
1312 3300047471 Ga0495684_0009543 Ga0495684_0009543_304_1362 323
1313 3300047471 Ga0495684_0014077 Ga0495684_0014077_3927_4898 323
1314 3300047471 Ga0495684_0050613 Ga0495684_0050613_1713_2684 323
1315 3300047673 Ga0495593_0004361 Ga0495593_0004361_5309_6280 323
1316 3300047673 Ga0495593_0013732 Ga0495593_0013732_1082_2053 323
1317 3300047673 Ga0495593_0020151 Ga0495593_0020151_34_1005 323
1318 3300047673 Ga0495593_0166140 Ga0495593_0166140_116_1087 323
1319 3300048088 Ga0495602_0000134 Ga0495602_0000134_2728_3699 323
1320 3300048088 Ga0495602_0009237 Ga0495602_0009237_4441_5412 323
1321 3300048088 Ga0495602_0011524 Ga0495602_0011524_775_1746 323
1322 3300048089 Ga0495614_0016404 Ga0495614_0016404_285_1256 323
1323 3300048089 Ga0495614_0049812 Ga0495614_0049812_252_1223 323
1324 3300048090 Ga0495615_0006228 Ga0495615_0006228_693_1664 323
1325 3300048903 Ga0496100_0008713 Ga0496100_0008713_3718_4689 323
1326 3300048903 Ga0496100_0059674 Ga0496100_0059674_1125_2096 323
1327 3300048903 Ga0496100_0125998 Ga0496100_0125998_707_1678 323
1328 3300048903 Ga0496100_0262344 Ga0496100_0262344_149_1120 323
1329 3300048903 Ga0496100_0296964 Ga0496100_0296964_54_1025 323
1330 3300048904 Ga0496101_0002099 Ga0496101_0002099_6995_7966 323
1331 3300048904 Ga0496101_0029946 Ga0496101_0029946_334_1305 323
1332 3300048904 Ga0496101_0126175 Ga0496101_0126175_903_1889 323
1333 3300048904 Ga0496101_0143886 Ga0496101_0143886_662_1633 323
1334 3300048905 Ga0496102_0011311 Ga0496102_0011311_4802_5773 323
1335 3300048905 Ga0496102_0011632 Ga0496102_0011632_5208_6194 323
1336 3300048905 Ga0496102_0018719 Ga0496102_0018719_439_1410 323
1337 3300048905 Ga0496102_0057698 Ga0496102_0057698_1242_2213 323
1338 3300048905 Ga0496102_0110564 Ga0496102_0110564_1173_2144 323
1339 3300048905 Ga0496102_0300106 Ga0496102_0300106_349_1320 323
1340 3300048906 Ga0496103_0005229 Ga0496103_0005229_3190_4161 323
1341 3300048906 Ga0496103_0007241 Ga0496103_0007241_4783_5754 323
1342 3300048906 Ga0496103_0030647 Ga0496103_0030647_661_1632 323
1343 3300048906 Ga0496103_0034792 Ga0496103_0034792_1130_2116 323
1344 3300048907 Ga0496104_0000515 Ga0496104_0000515_23355_24326 323
1345 3300048907 Ga0496104_0001124 Ga0496104_0001124_21436_22407 323
1346 3300048907 Ga0496104_0003330 Ga0496104_0003330_8523_9494 323
1347 3300048907 Ga0496104_0003945 Ga0496104_0003945_3070_4041 323
1348 3300048907 Ga0496104_0023384 Ga0496104_0023384_1361_2332 323
1349 3300048907 Ga0496104_0026980 Ga0496104_0026980_2140_3111 323
1350 3300048907 Ga0496104_0029246 Ga0496104_0029246_1800_2771 323
1351 3300048907 Ga0496104_0042832 Ga0496104_0042832_469_1440 323
1352 3300048907 Ga0496104_0049991 Ga0496104_0049991_111_1082 323
1353 3300048907 Ga0496104_0089281 Ga0496104_0089281_1037_2008 323
1354 3300048908 Ga0496105_0001298 Ga0496105_0001298_3872_4843 323
1355 3300048908 Ga0496105_0001827 Ga0496105_0001827_8882_9853 323
1356 3300048908 Ga0496105_0065676 Ga0496105_0065676_1725_2696 323
1357 3300048908 Ga0496105_0219775 Ga0496105_0219775_541_1512 323
1358 3300048909 Ga0496106_0006540 Ga0496106_0006540_2702_3688 323
1359 3300048909 Ga0496106_0017500 Ga0496106_0017500_1507_2478 323
1360 3300048909 Ga0496106_0034499 Ga0496106_0034499_403_1374 323
1361 3300048909 Ga0496106_0114947 Ga0496106_0114947_921_1892 323
1362 3300048910 Ga0496107_0008396 Ga0496107_0008396_2068_3039 323
1363 3300048910 Ga0496107_0020991 Ga0496107_0020991_3159_4130 323
1364 3300048910 Ga0496107_0118228 Ga0496107_0118228_772_1743 323
1365 3300048911 Ga0496108_0001712 Ga0496108_0001712_12624_13595 323
1366 3300048911 Ga0496108_0019295 Ga0496108_0019295_995_1966 323
1367 3300048911 Ga0496108_0231991 Ga0496108_0231991_48_1034 323
1368 3300048911 Ga0496108_0295717 Ga0496108_0295717_360_1331 323
1369 3300048912 Ga0496109_0001689 Ga0496109_0001689_4784_5755 323
1370 3300048912 Ga0496109_0024226 Ga0496109_0024226_3872_4843 323
1371 3300048912 Ga0496109_0176099 Ga0496109_0176099_522_1493 323
1372 3300048912 Ga0496109_0200068 Ga0496109_0200068_368_1354 323
1373 3300048913 Ga0496110_0007946 Ga0496110_0007946_3547_4518 323
1374 3300048913 Ga0496110_0022253 Ga0496110_0022253_3238_4209 323
1375 3300048913 Ga0496110_0027496 Ga0496110_0027496_995_1966 323
1376 3300048913 Ga0496110_0046689 Ga0496110_0046689_70_1041 323
1377 3300048913 Ga0496110_0160928 Ga0496110_0160928_17_988 323
1378 3300048913 Ga0496110_0272434 Ga0496110_0272434_158_1129 323
1379 3300048914 Ga0496111_0024033 Ga0496111_0024033_435_1406 323
1380 3300048914 Ga0496111_0026065 Ga0496111_0026065_3005_3976 323
1381 3300048915 Ga0496112_0007707 Ga0496112_0007707_7611_8582 323
1382 3300048915 Ga0496112_0024797 Ga0496112_0024797_3548_4519 323
1383 3300048915 Ga0496112_0117912 Ga0496112_0117912_620_1591 323
1384 3300048915 Ga0496112_0135193 Ga0496112_0135193_1280_2251 323
1385 3300048915 Ga0496112_0279878 Ga0496112_0279878_15_986 323
1386 3300048915 Ga0496112_0280571 Ga0496112_0280571_273_1244 323
1387 3300048916 Ga0496113_0004800 Ga0496113_0004800_6264_7235 323
1388 3300048916 Ga0496113_0009107 Ga0496113_0009107_1663_2634 323
1389 3300048916 Ga0496113_0071782 Ga0496113_0071782_602_1573 323
1390 3300048917 Ga0496114_0013020 Ga0496114_0013020_1642_2613 323
1391 3300048917 Ga0496114_0057724 Ga0496114_0057724_267_1238 323
1392 3300048917 Ga0496114_0096852 Ga0496114_0096852_178_1149 323
1393 3300048917 Ga0496114_0170546 Ga0496114_0170546_227_1198 323
1394 3300048918 Ga0496115_0000935 Ga0496115_0000935_19536_20507 323
1395 3300048918 Ga0496115_0015039 Ga0496115_0015039_1519_2490 323
1396 3300048918 Ga0496115_0027636 Ga0496115_0027636_1670_2641 323
1397 3300048918 Ga0496115_0038269 Ga0496115_0038269_2163_3134 323
1398 3300048918 Ga0496115_0064786 Ga0496115_0064786_1068_2039 323
1399 3300048918 Ga0496115_0087300 Ga0496115_0087300_965_1951 323
1400 3300049522 Ga0501299_011159 Ga0501299_011159_119_1090 323
1401 3300049568 Ga0501031_0090912 Ga0501031_0090912_561_1532 323
1402 3300049570 Ga0501033_0002811 Ga0501033_0002811_6337_7308 323
1403 3300049572 Ga0501036_0002126 Ga0501036_0002126_7420_8391 323
1404 3300049572 Ga0501036_0046141 Ga0501036_0046141_1386_2357 323
1405 3300049572 Ga0501036_0122074 Ga0501036_0122074_675_1646 323
1406 3300049572 Ga0501036_0313317 Ga0501036_0313317_215_1186 323
1407 3300049573 Ga0501037_0011909 Ga0501037_0011909_1744_2715 323
1408 3300049574 Ga0501038_0002601 Ga0501038_0002601_6454_7425 323
1409 3300049575 Ga0501039_0000671 Ga0501039_0000671_17265_18236 323
1410 3300049575 Ga0501039_0052846 Ga0501039_0052846_371_1342 323
1411 3300049575 Ga0501039_0270811 Ga0501039_0270811_191_1162 323
1412 3300049575 Ga0501039_0357808 Ga0501039_0357808_117_1088 323
1413 3300049576 Ga0501040_0000560 Ga0501040_0000560_9661_10632 323
1414 3300049576 Ga0501040_0013811 Ga0501040_0013811_2537_3508 323
1415 3300049576 Ga0501040_0021061 Ga0501040_0021061_91_1062 323
1416 3300049576 Ga0501040_0057871 Ga0501040_0057871_928_1899 323
1417 3300049577 Ga0501041_0000424 Ga0501041_0000424_12572_13543 323
1418 3300049577 Ga0501041_0010500 Ga0501041_0010500_2334_3305 323
1419 3300049577 Ga0501041_0020372 Ga0501041_0020372_482_1453 323
1420 3300049578 Ga0501042_0002768 Ga0501042_0002768_5772_6743 323
1421 3300049578 Ga0501042_0043879 Ga0501042_0043879_2051_3022 323
1422 3300049578 Ga0501042_0055667 Ga0501042_0055667_775_1746 323
1423 3300049579 Ga0501043_0022180 Ga0501043_0022180_3065_4036 323
1424 3300049580 Ga0501046_0002471 Ga0501046_0002471_8141_9112 323
1425 3300049580 Ga0501046_0004653 Ga0501046_0004653_11377_12348 323
1426 3300049580 Ga0501046_0133406 Ga0501046_0133406_796_1767 323
1427 3300049582 Ga0501048_0021266 Ga0501048_0021266_2546_3517 323
1428 3300049587 Ga0501071_0008838 Ga0501071_0008838_2235_3206 323
1429 3300049588 Ga0501072_0001763 Ga0501072_0001763_7653_8624 323
1430 3300049588 Ga0501072_0004960 Ga0501072_0004960_746_1717 323
1431 3300049588 Ga0501072_0167324 Ga0501072_0167324_165_1136 323
1432 3300049590 Ga0501074_0002893 Ga0501074_0002893_3794_4765 323
1433 3300049591 Ga0501075_0001273 Ga0501075_0001273_8173_9144 323
1434 3300049591 Ga0501075_0020363 Ga0501075_0020363_946_1917 323
1435 3300049592 Ga0501076_0001098 Ga0501076_0001098_10200_11171 323
1436 3300049592 Ga0501076_0015281 Ga0501076_0015281_1663_2634 323
1437 3300049592 Ga0501076_0044398 Ga0501076_0044398_831_1802 323
1438 3300049593 Ga0501077_0003932 Ga0501077_0003932_7411_8382 323
1439 3300049593 Ga0501077_0151791 Ga0501077_0151791_35_1009 323
1440 3300049593 Ga0501077_0251620 Ga0501077_0251620_10_981 323
1441 3300049705 Ga0501225_0025307 Ga0501225_0025307_123_1094 323
1442 3300049741 Ga0501079_0000510 Ga0501079_0000510_8015_8986 323
1443 3300049741 Ga0501079_0144026 Ga0501079_0144026_224_1195 323
1444 3300049742 Ga0501080_0014773 Ga0501080_0014773_2957_3928 323
1445 3300049742 Ga0501080_0023610 Ga0501080_0023610_4575_5546 323
1446 3300049742 Ga0501080_0347510 Ga0501080_0347510_204_1175 323
1447 3300049742 Ga0501080_0549004 Ga0501080_0549004_33_1004 323
1448 3300049743 Ga0501081_0003197 Ga0501081_0003197_2056_3027 323
1449 3300049743 Ga0501081_0008351 Ga0501081_0008351_888_1859 323
1450 3300049743 Ga0501081_0010300 Ga0501081_0010300_3603_4577 323
1451 3300049743 Ga0501081_0167165 Ga0501081_0167165_33_1004 323
1452 3300049743 Ga0501081_0318162 Ga0501081_0318162_30_1001 323
1453 3300049823 Ga0501044_0125307 Ga0501044_0125307_736_1707 323
1454 3300049824 Ga0501045_0001653 Ga0501045_0001653_6868_7839 323
1455 3300049824 Ga0501045_0021833 Ga0501045_0021833_3037_4008 323
1456 3300049824 Ga0501045_0040335 Ga0501045_0040335_1395_2366 323
1457 3300050491 nmdc:mga00v17_142987_c1 nmdc:mga00v17_142987_c1_180_1151 323
1458 3300050492 nmdc:mga0yw44_2410_c1 nmdc:mga0yw44_2410_c1_4929_5900 323
1459 3300050492 nmdc:mga0yw44_32026_c1 nmdc:mga0yw44_32026_c1_745_1716 323
1460 3300050494 nmdc:mga06z11_2208_c1 nmdc:mga06z11_2208_c1_1221_2192 323
1461 3300050494 nmdc:mga06z11_44877_c1 nmdc:mga06z11_44877_c1_673_1644 323
1462 3300050495 nmdc:mga04h51_13369_c1 nmdc:mga04h51_13369_c1_334_1305 323
1463 3300050495 nmdc:mga04h51_6938_c1 nmdc:mga04h51_6938_c1_1030_2001 323
1464 3300050496 nmdc:mga07m45_81072_c1 nmdc:mga07m45_81072_c1_431_1462 323
1465 3300050507 nmdc:mga05p37_125996_c1 nmdc:mga05p37_125996_c1_2053_3024 323
1466 3300050507 nmdc:mga05p37_1613_c1 nmdc:mga05p37_1613_c1_840_1811 323
1467 3300050507 nmdc:mga05p37_184134_c1 nmdc:mga05p37_184134_c1_1374_2345 323
1468 3300050507 nmdc:mga05p37_20948_c1 nmdc:mga05p37_20948_c1_3405_4388 323
1469 3300050507 nmdc:mga05p37_26660_c1 nmdc:mga05p37_26660_c1_3948_4919 323
1470 3300050507 nmdc:mga05p37_2740_c1 nmdc:mga05p37_2740_c1_464_1567 323
1471 3300050507 nmdc:mga05p37_346336_c1 nmdc:mga05p37_346336_c1_534_1634 323
1472 3300050507 nmdc:mga05p37_371340_c1 nmdc:mga05p37_371340_c1_590_1561 323
1473 3300050507 nmdc:mga05p37_53120_c1 nmdc:mga05p37_53120_c1_1888_2874 323
1474 3300050507 nmdc:mga05p37_66298_c1 nmdc:mga05p37_66298_c1_1248_2357 323
1475 3300050507 nmdc:mga05p37_90515_c1 nmdc:mga05p37_90515_c1_2643_3614 323
1476 3300050508 nmdc:mga09592_181176_c1 nmdc:mga09592_181176_c1_792_1763 323
1477 3300050508 nmdc:mga09592_253245_c1 nmdc:mga09592_253245_c1_333_1304 323
1478 3300050508 nmdc:mga09592_25575_c1 nmdc:mga09592_25575_c1_3896_4867 323
1479 3300050508 nmdc:mga09592_3135_c1 nmdc:mga09592_3135_c1_11524_12507 323
1480 3300050508 nmdc:mga09592_332512_c1 nmdc:mga09592_332512_c1_273_1244 323
1481 3300050508 nmdc:mga09592_46190_c1 nmdc:mga09592_46190_c1_20_991 323
1482 3300050508 nmdc:mga09592_58665_c1 nmdc:mga09592_58665_c1_1453_2553 323
1483 3300050508 nmdc:mga09592_58_c1 nmdc:mga09592_58_c1_60211_61182 323
1484 3300050509 nmdc:mga0qj67_129_c1 nmdc:mga0qj67_129_c1_42648_43619 323
1485 3300050509 nmdc:mga0qj67_210205_c1 nmdc:mga0qj67_210205_c1_493_1464 323
1486 3300050509 nmdc:mga0qj67_233963_c1 nmdc:mga0qj67_233963_c1_92_1078 323
1487 3300050509 nmdc:mga0qj67_249420_c1 nmdc:mga0qj67_249420_c1_453_1427 323
1488 3300050509 nmdc:mga0qj67_64525_c1 nmdc:mga0qj67_64525_c1_54_1025 323
1489 3300050510 nmdc:mga06r32_117962_c1 nmdc:mga06r32_117962_c1_399_1385 323
1490 3300050510 nmdc:mga06r32_1897_c1 nmdc:mga06r32_1897_c1_5572_6546 323
1491 3300050510 nmdc:mga06r32_193736_c1 nmdc:mga06r32_193736_c1_803_1921 323
1492 3300050510 nmdc:mga06r32_223984_c1 nmdc:mga06r32_223984_c1_134_1237 323
1493 3300050510 nmdc:mga06r32_25300_c1 nmdc:mga06r32_25300_c1_3693_4664 323
1494 3300050510 nmdc:mga06r32_2762_c1 nmdc:mga06r32_2762_c1_14543_15514 323
1495 3300050510 nmdc:mga06r32_69985_c1 nmdc:mga06r32_69985_c1_2361_3332 323
1496 3300050510 nmdc:mga06r32_84170_c1 nmdc:mga06r32_84170_c1_316_1287 323
1497 3300050511 nmdc:mga08y16_14377_c1 nmdc:mga08y16_14377_c1_6064_7035 323
1498 3300050511 nmdc:mga08y16_25002_c1 nmdc:mga08y16_25002_c1_703_1686 323
1499 3300050511 nmdc:mga08y16_287307_c1 nmdc:mga08y16_287307_c1_606_1577 323
1500 3300050511 nmdc:mga08y16_4966_c1 nmdc:mga08y16_4966_c1_1082_2053 323
1501 3300050511 nmdc:mga08y16_82255_c1 nmdc:mga08y16_82255_c1_183_1154 323
1502 3300050512 nmdc:mga0n895_135577_c1 nmdc:mga0n895_135577_c1_874_1845 323
1503 3300050512 nmdc:mga0n895_176750_c1 nmdc:mga0n895_176750_c1_578_1549 323
1504 3300050512 nmdc:mga0n895_268801_c1 nmdc:mga0n895_268801_c1_445_1548 323
1505 3300050512 nmdc:mga0n895_3347_c1 nmdc:mga0n895_3347_c1_10607_11578 323
1506 3300050512 nmdc:mga0n895_40359_c1 nmdc:mga0n895_40359_c1_2980_3951 323
1507 3300050512 nmdc:mga0n895_7117_c1 nmdc:mga0n895_7117_c1_3326_4297 323
1508 3300050512 nmdc:mga0n895_87594_c1 nmdc:mga0n895_87594_c1_911_1882 323
1509 3300050513 nmdc:mga0rr50_128673_c1 nmdc:mga0rr50_128673_c1_287_1258 323
1510 3300050513 nmdc:mga0rr50_154003_c1 nmdc:mga0rr50_154003_c1_800_1771 323
1511 3300050513 nmdc:mga0rr50_235001_c1 nmdc:mga0rr50_235001_c1_277_1248 323
1512 3300050513 nmdc:mga0rr50_260817_c1 nmdc:mga0rr50_260817_c1_430_1401 323
1513 3300050513 nmdc:mga0rr50_56422_c1 nmdc:mga0rr50_56422_c1_43_1026 323
1514 3300050513 nmdc:mga0rr50_97635_c1 nmdc:mga0rr50_97635_c1_856_1959 323
1515 3300050514 nmdc:mga08x19_133932_c1 nmdc:mga08x19_133932_c1_386_1357 323
1516 3300050514 nmdc:mga08x19_33126_c1 nmdc:mga08x19_33126_c1_1491_2474 323
1517 3300050514 nmdc:mga08x19_73505_c1 nmdc:mga08x19_73505_c1_167_1138 323
1518 3300050514 nmdc:mga08x19_76652_c1 nmdc:mga08x19_76652_c1_181_1152 323
1519 3300050514 nmdc:mga08x19_8149_c1 nmdc:mga08x19_8149_c1_4804_5775 323
1520 3300050515 nmdc:mga0a205_135728_c1 nmdc:mga0a205_135728_c1_1372_2343 323
1521 3300050515 nmdc:mga0a205_193381_c1 nmdc:mga0a205_193381_c1_289_1260 323
1522 3300050515 nmdc:mga0a205_193580_c1 nmdc:mga0a205_193580_c1_23_1006 323
1523 3300050515 nmdc:mga0a205_34546_c1 nmdc:mga0a205_34546_c1_3130_4101 323
1524 3300050515 nmdc:mga0a205_4041_c1 nmdc:mga0a205_4041_c1_8492_9463 323
1525 3300050515 nmdc:mga0a205_55435_c1 nmdc:mga0a205_55435_c1_1757_2857 323
1526 3300050516 nmdc:mga0sz30_42815_c1 nmdc:mga0sz30_42815_c1_357_1334 323
1527 3300053077 Ga0495601_0000003 Ga0495601_0000003_65880_66851 323
1528 3300053077 Ga0495601_0000731 Ga0495601_0000731_6170_7141 323
1529 3300053077 Ga0495601_0001063 Ga0495601_0001063_1014_2072 323
1530 3300053077 Ga0495601_0003729 Ga0495601_0003729_7338_8309 323
1531 3300053077 Ga0495601_0005091 Ga0495601_0005091_4236_5213 323
1532 3300053077 Ga0495601_0030646 Ga0495601_0030646_2031_3002 323
1533 3300053077 Ga0495601_0044813 Ga0495601_0044813_1071_2042 323
1534 3300053077 Ga0495601_0069405 Ga0495601_0069405_1255_2226 323
1535 3300053077 Ga0495601_0084972 Ga0495601_0084972_706_1677 323
1536 3300053077 Ga0495601_0229871 Ga0495601_0229871_206_1177 323
1537 3300053078 Ga0495612_0000077 Ga0495612_0000077_2734_3705 323
1538 3300053078 Ga0495612_0000121 Ga0495612_0000121_7109_8167 323
1539 3300053078 Ga0495612_0001446 Ga0495612_0001446_3258_4229 323
1540 3300053078 Ga0495612_0003440 Ga0495612_0003440_3478_4449 323
1541 3300053078 Ga0495612_0019740 Ga0495612_0019740_178_1155 323
1542 3300053078 Ga0495612_0067499 Ga0495612_0067499_28_999 323
1543 3300053084 Ga0495595_0000094 Ga0495595_0000094_2740_3711 323
1544 3300053084 Ga0495595_0000451 Ga0495595_0000451_6238_7209 323
1545 3300053084 Ga0495595_0001116 Ga0495595_0001116_3919_4890 323
1546 3300053084 Ga0495595_0026652 Ga0495595_0026652_1384_2361 323
1547 3300053084 Ga0495595_0027533 Ga0495595_0027533_403_1374 323
1548 3300053085 Ga0495619_0000091 Ga0495619_0000091_2734_3705 323
1549 3300053085 Ga0495619_0000811 Ga0495619_0000811_6689_7660 323
1550 3300053085 Ga0495619_0001094 Ga0495619_0001094_11963_12934 323
1551 3300053085 Ga0495619_0002558 Ga0495619_0002558_5192_6163 323
1552 3300053085 Ga0495619_0002667 Ga0495619_0002667_8436_9407 323
1553 3300053085 Ga0495619_0003273 Ga0495619_0003273_1526_2584 323
1554 3300053085 Ga0495619_0004373 Ga0495619_0004373_7031_8002 323
1555 3300053085 Ga0495619_0006164 Ga0495619_0006164_4675_5646 323
1556 3300053085 Ga0495619_0034244 Ga0495619_0034244_1546_2517 323
1557 3300053085 Ga0495619_0056400 Ga0495619_0056400_752_1723 323
1558 3300053085 Ga0495619_0059584 Ga0495619_0059584_1232_2203 323
1559 3300053085 Ga0495619_0126271 Ga0495619_0126271_613_1584 323
1560 3300053085 Ga0495619_0150341 Ga0495619_0150341_35_1006 323
1561 3300053134 Ga0500658_0104549 Ga0500658_0104549_176_1147 323
1562 3300054114 Ga0501084_0001036 Ga0501084_0001036_8192_9163 323
1563 3300054114 Ga0501084_0189553 Ga0501084_0189553_176_1147 323
1564 3300054114 Ga0501084_0201440 Ga0501084_0201440_135_1106 323
1565 3300059426 Ga0590077_003823 Ga0590077_003823_1907_2878 323
1566 3300060353 Ga0501082_0002341 Ga0501082_0002341_10084_11055 323
1567 3300061734 Ga0530510_0000149 Ga0530510_0000149_32566_33537 323
1568 3300061734 Ga0530510_0018261 Ga0530510_0018261_1876_2847 323
1569 3300061734 Ga0530510_0067376 Ga0530510_0067376_1296_2267 323
1570 3300061734 Ga0530510_0167956 Ga0530510_0167956_80_1051 323
1571 3300061734 Ga0530510_0184223 Ga0530510_0184223_208_1179 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

94

310

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nnb-assembly2.cif.gz_D isatin hydrolase a (iha) from labrenzia aggregata with isatinate bound 0.7123 154 321
3krv-assembly1.cif.gz_B the structure of potential metal-dependent hydrolase with cyclase activity 0.6906 139 321
5ibz-assembly1.cif.gz_A crystal structure of a novel cyclase (pfam04199). 0.6646 15 323
5ibz-assembly1.cif.gz_D crystal structure of a novel cyclase (pfam04199). 0.6625 18 323
5ibz-assembly1.cif.gz_B crystal structure of a novel cyclase (pfam04199). 0.6577 15 323
ID Description Score Start End Superfamily
3krvB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6906 139 321 3.50.30.50
af_A0A1D6GPF7_81_287_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6652 160 248 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.6474 156 322 3.50.30.50
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.5651 112 321 3.50.30.50
af_O53929_16_261_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.5592 156 322 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A1Q8B2X3-F1-model_v4 Cyclase 0.9594 159 210 GO:0004061
GO:0019441
AF-A0A5D0TLY9-F1-model_v4 Cyclase family protein 0.9233 153 249 GO:0004061
GO:0019441
AF-A0A1Q7MRX9-F1-model_v4 Cyclase 0.9078 155 214 GO:0004061
GO:0019441
AF-A0A383CWK2-F1-model_v4 Protein TolR 0.8655 151 323 GO:0004061
GO:0005886
GO:0019441
GO:0022857
AF-A0A537UIV5-F1-model_v4 Cyclase family protein 0.8436 129 309 GO:0004061
GO:0019441

Feature Viewer

pLDDT pTM Quality
67.49 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map