F494825

General Info

Members Datasets Scaffolds Average Seq Length
1571 472 1570 358

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10215905|Ga0207678_102159051
Length 407
Sequence MCASKVSPVNPGVRYSSCSGWRPPLPLMGRSTKLFVLTRVLTSVDSVFRAGVAAETVTLSVTVTSSRLRSKPTIPAMATVTALLISLLFGSRVIEKLAEMKFGQEIREEGPASHQEKRGTPTMGGILIIFAVTLSTLLWADISRPHIWLVLSATLGFCAIGFVDDYLKFIKARSKGLSASQKFTAQITIALIVALILYSLPGYNTKLSMPFFKNFMPDLGWFYVVFAVLVIVGSSNAVNLTDGLDGLAIGPVMIAALAYTVVAYVTGHRLMSEYLLIPHIDGAGELAVFTAAILGSSLGFLWFNTYPASVFMGDVGSLPLGAALGTVAVISKHELLLLMVGGVFVIEAVSVIFQVASYKSRGKRIFLMAPIHHHFEMKGWEEPKVVVRLWIIAILLALLSLSTLKLR

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
213 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
214 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
220 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
221 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
235 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
239 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
263 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
269 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
270 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
278 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
281 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
282 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
283 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
286 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
287 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
288 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
289 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
290 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
291 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
292 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
293 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
294 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
297 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
298 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
299 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
300 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
301 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
302 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
303 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
304 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
310 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
311 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
312 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
313 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
314 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
315 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
316 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
317 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
320 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
331 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
332 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
333 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
354 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
355 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
356 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
357 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
358 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
359 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
360 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
361 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
362 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
363 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
364 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
365 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
385 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
386 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
387 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
388 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
389 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
390 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
391 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
392 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
393 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
394 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
395 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
396 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
397 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
398 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
399 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
400 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
401 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
402 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
403 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
404 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
405 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
406 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
407 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
408 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
409 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
410 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
411 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
412 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
413 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
414 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
415 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
416 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
417 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
418 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
419 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
425 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
426 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
427 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
428 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
429 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
430 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
431 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
432 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
433 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
434 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
435 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
436 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
437 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
447 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
448 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
449 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
450 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
451 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
452 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
453 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
454 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
457 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
458 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
459 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
460 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
461 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
462 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
463 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
464 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
465 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
466 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
467 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
468 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
469 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
470 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
471 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
472 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.13
Isolates 0.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 2.23
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10025421 3300003215 Bacteria 2116
2 JGI26145J50221_1002531 3300003371 Bacteria 1440
3 JGI26141J51220_1000265 3300003503 Bacteria 2766
4 Ga0065715_10132415 3300005293 Bacteria 1991
5 Ga0065715_10163679 3300005293 Bacteria 1605
6 Ga0065707_10000785 3300005295 Bacteria 19949
7 Ga0065707_10183925 3300005295 Bacteria 1401
8 Ga0070658_10028548 3300005327 Bacteria 4480
9 Ga0070658_10063301 3300005327 Bacteria 3015
10 Ga0070676_10001079 3300005328 Bacteria 13597
11 Ga0070676_10011919 3300005328 Bacteria 4737
12 Ga0070676_10169732 3300005328 Bacteria 1410
13 Ga0070690_100009599 3300005330 Bacteria 5610
14 Ga0070690_100033354 3300005330 Bacteria 3222
15 Ga0070690_100108534 3300005330 Bacteria 1849
16 Ga0070690_100203790 3300005330 Bacteria 1378
17 Ga0070670_100002783 3300005331 Bacteria 14463
18 Ga0070670_100021259 3300005331 Bacteria 5583
19 Ga0070677_10002570 3300005333 Bacteria 5808
20 Ga0068869_100000489 3300005334 Bacteria 21984
21 Ga0068869_100109271 3300005334 Bacteria 2102
22 Ga0068869_100206311 3300005334 Bacteria 1552
23 Ga0070666_10094378 3300005335 Bacteria 2058
24 Ga0070680_100000350 3300005336 Bacteria 30958
25 Ga0070680_100000714 3300005336 Bacteria 23074
26 Ga0070680_100011285 3300005336 Bacteria 6911
27 Ga0070680_100067592 3300005336 Bacteria 2932
28 Ga0070680_100120857 3300005336 Bacteria 2187
29 Ga0070680_100164016 3300005336 Bacteria 1868
30 Ga0070682_100000427 3300005337 Bacteria 27263
31 Ga0070682_100002300 3300005337 Bacteria 10567
32 Ga0070682_100005218 3300005337 Bacteria 7228
33 Ga0070682_100104513 3300005337 Bacteria 1876
34 Ga0068868_100236644 3300005338 Bacteria 1533
35 Ga0068868_100250795 3300005338 Bacteria 1490
36 Ga0070660_100000553 3300005339 Bacteria 25074
37 Ga0070660_100041563 3300005339 Bacteria 3505
38 Ga0070660_100045875 3300005339 Bacteria 3348
39 Ga0070689_100000013 3300005340 Bacteria 206982
40 Ga0070689_100005158 3300005340 Bacteria 8888
41 Ga0070689_100007543 3300005340 Bacteria 7617
42 Ga0070689_100085722 3300005340 Bacteria 2477
43 Ga0070689_100168068 3300005340 Bacteria 1776
44 Ga0070691_10000946 3300005341 Bacteria 11808
45 Ga0070687_100008427 3300005343 Bacteria 4367
46 Ga0070687_100010457 3300005343 Bacteria 4015
47 Ga0070687_100024444 3300005343 Bacteria 2885
48 Ga0070661_100001457 3300005344 Bacteria 16420
49 Ga0070661_100001616 3300005344 Bacteria 15591
50 Ga0070661_100012698 3300005344 Bacteria 5893
51 Ga0070661_100092135 3300005344 Bacteria 2245
52 Ga0070692_10002516 3300005345 Bacteria 7134
53 Ga0070668_100056056 3300005347 Bacteria 3043
54 Ga0070668_100087485 3300005347 Bacteria 2452
55 Ga0070668_100095670 3300005347 Bacteria 2346
56 Ga0070668_100346633 3300005347 Bacteria 1256
57 Ga0070669_100010791 3300005353 Bacteria 6485
58 Ga0070669_100074789 3300005353 Bacteria 2511
59 Ga0070675_100024682 3300005354 Bacteria 4815
60 Ga0070675_100083137 3300005354 Bacteria 2672
61 Ga0070675_100086193 3300005354 Bacteria 2625
62 Ga0070675_100099581 3300005354 Bacteria 2447
63 Ga0070675_100189835 3300005354 Bacteria 1780
64 Ga0070675_100196399 3300005354 Bacteria 1750
65 Ga0070671_100020159 3300005355 Bacteria 5434
66 Ga0070671_100090566 3300005355 Bacteria 2561
67 Ga0070671_100315840 3300005355 Bacteria 1331
68 Ga0070674_100000416 3300005356 Bacteria 21452
69 Ga0070674_100009929 3300005356 Bacteria 5730
70 Ga0070674_100041806 3300005356 Bacteria 3110
71 Ga0070674_100096079 3300005356 Bacteria 2149
72 Ga0070674_100097643 3300005356 Bacteria 2134
73 Ga0070673_100004710 3300005364 Bacteria 8657
74 Ga0070673_100020950 3300005364 Bacteria 4727
75 Ga0070659_100000361 3300005366 Bacteria 34618
76 Ga0070667_100007693 3300005367 Bacteria 8934
77 Ga0070667_100017771 3300005367 Bacteria 5895
78 Ga0070703_10012003 3300005406 Bacteria 2452
79 Ga0070709_10070917 3300005434 Bacteria 2248
80 Ga0070713_100283630 3300005436 Bacteria 1520
81 Ga0070701_10001936 3300005438 Bacteria 7844
82 Ga0070701_10006093 3300005438 Bacteria 5046
83 Ga0070701_10023634 3300005438 Bacteria 2964
84 Ga0070701_10027759 3300005438 Bacteria 2777
85 Ga0070701_10090568 3300005438 Bacteria 1675
86 Ga0070701_10130626 3300005438 Bacteria 1426
87 Ga0070705_100000749 3300005440 Bacteria 18426
88 Ga0070705_100005299 3300005440 Bacteria 6272
89 Ga0070705_100012634 3300005440 Bacteria 4298
90 Ga0070705_100020374 3300005440 Bacteria 3508
91 Ga0070705_100059340 3300005440 Bacteria 2265
92 Ga0070705_100145639 3300005440 Bacteria 1565
93 Ga0070700_100120674 3300005441 Bacteria 1756
94 Ga0070700_100208461 3300005441 Bacteria 1377
95 Ga0070694_100002050 3300005444 Bacteria 11949
96 Ga0070694_100006124 3300005444 Bacteria 7296
97 Ga0070694_100017612 3300005444 Bacteria 4517
98 Ga0070694_100105901 3300005444 Bacteria 1996
99 Ga0070708_100001538 3300005445 Bacteria 17642
100 Ga0070708_100004626 3300005445 Bacteria 10839
101 Ga0070708_100010375 3300005445 Bacteria 7548
102 Ga0070708_100014216 3300005445 Bacteria 6541
103 Ga0070708_100036969 3300005445 Bacteria 4258
104 Ga0070708_100048473 3300005445 Bacteria 3755
105 Ga0070708_100053137 3300005445 Bacteria 3594
106 Ga0070708_100092020 3300005445 Bacteria 2762
107 Ga0070708_100097966 3300005445 Bacteria 2681
108 Ga0070708_100107869 3300005445 Bacteria 2557
109 Ga0070708_100114046 3300005445 Bacteria 2486
110 Ga0070708_100259164 3300005445 Bacteria 1635
111 Ga0070708_100321845 3300005445 Bacteria 1457
112 Ga0070663_100003646 3300005455 Bacteria 8918
113 Ga0070663_100055639 3300005455 Bacteria 2833
114 Ga0070678_100006207 3300005456 Bacteria 6990
115 Ga0070662_100074496 3300005457 Bacteria 2511
116 Ga0070681_10000414 3300005458 Bacteria 34629
117 Ga0070681_10001753 3300005458 Bacteria 19441
118 Ga0070681_10004948 3300005458 Bacteria 12813
119 Ga0070681_10021082 3300005458 Bacteria 6529
120 Ga0070681_10109610 3300005458 Bacteria 2701
121 Ga0070681_10352196 3300005458 Bacteria 1383
122 Ga0068867_100001801 3300005459 Bacteria 14908
123 Ga0068867_100005692 3300005459 Bacteria 8834
124 Ga0068867_100080978 3300005459 Bacteria 2447
125 Ga0068867_100104103 3300005459 Bacteria 2172
126 Ga0070685_10212395 3300005466 Bacteria 1264
127 Ga0070706_100002460 3300005467 Bacteria 18675
128 Ga0070706_100014801 3300005467 Bacteria 7210
129 Ga0070706_100021148 3300005467 Bacteria 5991
130 Ga0070706_100028077 3300005467 Bacteria 5179
131 Ga0070706_100043376 3300005467 Bacteria 4156
132 Ga0070706_100043420 3300005467 Bacteria 4154
133 Ga0070706_100060205 3300005467 Bacteria 3505
134 Ga0070706_100102444 3300005467 Bacteria 2661
135 Ga0070706_100176533 3300005467 Bacteria 1994
136 Ga0070706_100181262 3300005467 Bacteria 1966
137 Ga0070706_100193929 3300005467 Bacteria 1898
138 Ga0070706_100219267 3300005467 Bacteria 1776
139 Ga0070706_100221547 3300005467 Bacteria 1766
140 Ga0070706_100255424 3300005467 Bacteria 1636
141 Ga0070706_100295734 3300005467 Bacteria 1511
142 Ga0070707_100000018 3300005468 Bacteria 137542
143 Ga0070707_100001411 3300005468 Bacteria 23569
144 Ga0070707_100002048 3300005468 Bacteria 19307
145 Ga0070707_100003191 3300005468 Bacteria 15511
146 Ga0070707_100004567 3300005468 Bacteria 12961
147 Ga0070707_100037471 3300005468 Bacteria 4628
148 Ga0070707_100047514 3300005468 Bacteria 4109
149 Ga0070707_100106350 3300005468 Bacteria 2721
150 Ga0070707_100364707 3300005468 Bacteria 1403
151 Ga0070707_100412757 3300005468 Bacteria 1310
152 Ga0070698_100000895 3300005471 Bacteria 32719
153 Ga0070698_100003375 3300005471 Bacteria 17573
154 Ga0070698_100003431 3300005471 Bacteria 17422
155 Ga0070698_100010709 3300005471 Bacteria 9765
156 Ga0070698_100011560 3300005471 Bacteria 9365
157 Ga0070698_100018461 3300005471 Bacteria 7344
158 Ga0070698_100087809 3300005471 Bacteria 3095
159 Ga0070698_100123030 3300005471 Bacteria 2552
160 Ga0070698_100160335 3300005471 Bacteria 2193
161 Ga0070699_100002466 3300005518 Bacteria 16639
162 Ga0070699_100002663 3300005518 Bacteria 15953
163 Ga0070699_100003215 3300005518 Bacteria 14449
164 Ga0070699_100008240 3300005518 Bacteria 9040
165 Ga0070699_100008261 3300005518 Bacteria 9027
166 Ga0070699_100014268 3300005518 Bacteria 6832
167 Ga0070699_100017283 3300005518 Bacteria 6194
168 Ga0070699_100021910 3300005518 Bacteria 5507
169 Ga0070699_100029367 3300005518 Bacteria 4740
170 Ga0070699_100035846 3300005518 Bacteria 4289
171 Ga0070699_100051324 3300005518 Bacteria 3570
172 Ga0070699_100068155 3300005518 Bacteria 3089
173 Ga0070699_100166162 3300005518 Bacteria 1954
174 Ga0070699_100214738 3300005518 Bacteria 1713
175 Ga0070679_100002812 3300005530 Bacteria 15817
176 Ga0070679_100005619 3300005530 Bacteria 11613
177 Ga0070679_100008403 3300005530 Bacteria 9715
178 Ga0070679_100045681 3300005530 Bacteria 4364
179 Ga0070679_100098611 3300005530 Bacteria 2909
180 Ga0070679_100105605 3300005530 Bacteria 2803
181 Ga0070679_100109519 3300005530 Bacteria 2748
182 Ga0070684_100012770 3300005535 Bacteria 6745
183 Ga0070684_100367834 3300005535 Bacteria 1324
184 Ga0070697_100002969 3300005536 Bacteria 13044
185 Ga0070697_100003324 3300005536 Bacteria 12352
186 Ga0070697_100006928 3300005536 Bacteria 8812
187 Ga0070697_100014714 3300005536 Bacteria 6144
188 Ga0070697_100016789 3300005536 Bacteria 5758
189 Ga0070697_100023092 3300005536 Bacteria 4945
190 Ga0070697_100048114 3300005536 Bacteria 3458
191 Ga0070697_100060358 3300005536 Bacteria 3091
192 Ga0070697_100206960 3300005536 Bacteria 1669
193 Ga0070697_100234349 3300005536 Bacteria 1566
194 Ga0070697_100309327 3300005536 Bacteria 1359
195 Ga0068853_100001019 3300005539 Bacteria 19740
196 Ga0068853_100001998 3300005539 Bacteria 15067
197 Ga0070672_100001791 3300005543 Bacteria 13441
198 Ga0070672_100057865 3300005543 Bacteria 3045
199 Ga0070686_100003770 3300005544 Bacteria 8332
200 Ga0070695_100004520 3300005545 Bacteria 8165
201 Ga0070695_100012945 3300005545 Bacteria 5008
202 Ga0070695_100025121 3300005545 Bacteria 3676
203 Ga0070695_100258475 3300005545 Bacteria 1271
204 Ga0070696_100000431 3300005546 Bacteria 26345
205 Ga0070696_100075054 3300005546 Bacteria 2385
206 Ga0070696_100184451 3300005546 Bacteria 1550
207 Ga0070696_100198650 3300005546 Bacteria 1496
208 Ga0070693_100010740 3300005547 Bacteria 4593
209 Ga0070665_100003738 3300005548 Bacteria 16120
210 Ga0070665_100027443 3300005548 Bacteria 5735
211 Ga0070665_100033575 3300005548 Bacteria 5163
212 Ga0070665_100137853 3300005548 Bacteria 2443
213 Ga0070704_100000606 3300005549 Bacteria 17262
214 Ga0070704_100004113 3300005549 Bacteria 8400
215 Ga0070704_100017966 3300005549 Bacteria 4511
216 Ga0070704_100031063 3300005549 Bacteria 3587
217 Ga0070704_100036470 3300005549 Bacteria 3351
218 Ga0070704_100059854 3300005549 Bacteria 2719
219 Ga0068855_100000004 3300005563 Bacteria 340133
220 Ga0068855_100001782 3300005563 Bacteria 26913
221 Ga0068855_100010883 3300005563 Bacteria 10981
222 Ga0068855_100021008 3300005563 Bacteria 7829
223 Ga0068855_100022343 3300005563 Bacteria 7580
224 Ga0068855_100049389 3300005563 Bacteria 4962
225 Ga0068855_100241848 3300005563 Bacteria 2016
226 Ga0070664_100001912 3300005564 Bacteria 16728
227 Ga0070664_100041338 3300005564 Bacteria 3890
228 Ga0070664_100061123 3300005564 Bacteria 3210
229 Ga0068857_100092310 3300005577 Bacteria 2711
230 Ga0068854_100000767 3300005578 Bacteria 19063
231 Ga0068856_100000390 3300005614 Bacteria 47957
232 Ga0068856_100008599 3300005614 Bacteria 9927
233 Ga0068856_100075782 3300005614 Bacteria 3332
234 Ga0070702_100031545 3300005615 Bacteria 2901
235 Ga0068859_100036578 3300005617 Bacteria 4929
236 Ga0068859_100043179 3300005617 Bacteria 4531
237 Ga0068859_100071419 3300005617 Bacteria 3507
238 Ga0068859_100276604 3300005617 Bacteria 1771
239 Ga0068864_100007911 3300005618 Bacteria 8759
240 Ga0068864_100091705 3300005618 Bacteria 2681
241 Ga0068864_100245376 3300005618 Bacteria 1661
242 Ga0068866_10133955 3300005718 Bacteria 1413
243 Ga0068861_100003765 3300005719 Bacteria 10123
244 Ga0068861_100003920 3300005719 Bacteria 9948
245 Ga0068861_100022575 3300005719 Bacteria 4535
246 Ga0068861_100147603 3300005719 Bacteria 1926
247 Ga0068861_100172038 3300005719 Bacteria 1796
248 Ga0068870_10000449 3300005840 Bacteria 15562
249 Ga0068870_10078342 3300005840 Bacteria 1820
250 Ga0068870_10137066 3300005840 Bacteria 1428
251 Ga0068863_100012644 3300005841 Bacteria 8143
252 Ga0068863_100014689 3300005841 Bacteria 7537
253 Ga0068863_100044137 3300005841 Bacteria 4232
254 Ga0068863_100057508 3300005841 Bacteria 3681
255 Ga0068863_100343400 3300005841 Bacteria 1452
256 Ga0068858_100019944 3300005842 Bacteria 6269
257 Ga0068860_100008259 3300005843 Bacteria 10359
258 Ga0068860_100059103 3300005843 Bacteria 3646
259 Ga0068860_100061811 3300005843 Bacteria 3559
260 Ga0068860_100086261 3300005843 Bacteria 2988
261 Ga0068860_100123499 3300005843 Bacteria 2481
262 Ga0068860_100281031 3300005843 Bacteria 1627
263 Ga0068862_100002840 3300005844 Bacteria 15195
264 Ga0068862_100015163 3300005844 Bacteria 6400
265 Ga0068862_100046960 3300005844 Bacteria 3684
266 Ga0068862_100195869 3300005844 Bacteria 1820
267 Ga0081455_10000594 3300005937 Bacteria 46883
268 Ga0081455_10001275 3300005937 Bacteria 31421
269 Ga0081455_10002633 3300005937 Bacteria 21273
270 Ga0081455_10006844 3300005937 Bacteria 12147
271 Ga0081455_10008966 3300005937 Bacteria 10336
272 Ga0081455_10061928 3300005937 Bacteria 3147
273 Ga0081455_10096654 3300005937 Bacteria 2381
274 Ga0081455_10108173 3300005937 Bacteria 2215
275 Ga0081538_10020977 3300005981 Bacteria 4790
276 Ga0081538_10039031 3300005981 Bacteria 3051
277 Ga0081540_1007784 3300005983 Bacteria 7583
278 Ga0081539_10001199 3300005985 Bacteria 46742
279 Ga0081539_10001564 3300005985 Bacteria 37970
280 Ga0081539_10002068 3300005985 Bacteria 30068
281 Ga0081539_10021436 3300005985 Bacteria 4318
282 Ga0081539_10026676 3300005985 Bacteria 3678
283 Ga0070717_10113455 3300006028 Bacteria 2314
284 Ga0075365_10016282 3300006038 Bacteria 4519
285 Ga0075365_10040808 3300006038 Bacteria 3028
286 Ga0075432_10043455 3300006058 Bacteria 1574
287 Ga0070715_10050825 3300006163 Bacteria 1781
288 Ga0070716_100047274 3300006173 Bacteria 2426
289 Ga0070712_100002171 3300006175 Bacteria 12069
290 Ga0075362_10003508 3300006177 Bacteria 5504
291 Ga0075362_10013780 3300006177 Bacteria 3245
292 Ga0075362_10050642 3300006177 Bacteria 1857
293 Ga0075366_10013770 3300006195 Bacteria 4609
294 Ga0097621_100009993 3300006237 Bacteria 6916
295 Ga0097621_100016968 3300006237 Bacteria 5519
296 Ga0097621_100134688 3300006237 Bacteria 2106
297 Ga0097621_100169018 3300006237 Bacteria 1884
298 Ga0075370_10016890 3300006353 Bacteria 3935
299 Ga0075370_10135691 3300006353 Bacteria 1438
300 Ga0068871_100002252 3300006358 Bacteria 13115
301 Ga0068871_100016996 3300006358 Bacteria 5494
302 Ga0075428_100000620 3300006844 Bacteria 36286
303 Ga0075428_100000795 3300006844 Bacteria 32906
304 Ga0075428_100003882 3300006844 Bacteria 16431
305 Ga0075428_100008653 3300006844 Bacteria 11289
306 Ga0075428_100015464 3300006844 Bacteria 8461
307 Ga0075428_100022633 3300006844 Bacteria 6957
308 Ga0075428_100045235 3300006844 Bacteria 4837
309 Ga0075428_100052255 3300006844 Bacteria 4480
310 Ga0075428_100073386 3300006844 Bacteria 3737
311 Ga0075428_100121683 3300006844 Bacteria 2842
312 Ga0075428_100185782 3300006844 Bacteria 2249
313 Ga0075430_100000586 3300006846 Bacteria 27612
314 Ga0075430_100001325 3300006846 Bacteria 19981
315 Ga0075430_100001373 3300006846 Bacteria 19749
316 Ga0075430_100029980 3300006846 Bacteria 4619
317 Ga0075430_100041273 3300006846 Bacteria 3904
318 Ga0075430_100060279 3300006846 Bacteria 3189
319 Ga0075430_100067241 3300006846 Bacteria 3009
320 Ga0075430_100071678 3300006846 Bacteria 2906
321 Ga0075430_100091683 3300006846 Bacteria 2541
322 Ga0075430_100139045 3300006846 Bacteria 2022
323 Ga0075431_100000643 3300006847 Bacteria 29600
324 Ga0075431_100002074 3300006847 Bacteria 19135
325 Ga0075431_100002078 3300006847 Bacteria 19121
326 Ga0075431_100002624 3300006847 Bacteria 17390
327 Ga0075431_100010928 3300006847 Bacteria 9133
328 Ga0075431_100013279 3300006847 Bacteria 8322
329 Ga0075431_100015426 3300006847 Bacteria 7739
330 Ga0075431_100016364 3300006847 Bacteria 7525
331 Ga0075431_100064699 3300006847 Bacteria 3776
332 Ga0075431_100086759 3300006847 Bacteria 3230
333 Ga0075431_100203342 3300006847 Bacteria 2026
334 Ga0075433_10000107 3300006852 Bacteria 41007
335 Ga0075433_10000960 3300006852 Bacteria 20385
336 Ga0075433_10001347 3300006852 Bacteria 17999
337 Ga0075433_10001847 3300006852 Bacteria 15912
338 Ga0075433_10003862 3300006852 Bacteria 11600
339 Ga0075433_10013281 3300006852 Bacteria 6691
340 Ga0075433_10048944 3300006852 Bacteria 3676
341 Ga0075433_10099863 3300006852 Bacteria 2569
342 Ga0075433_10207887 3300006852 Bacteria 1740
343 Ga0075433_10366422 3300006852 Bacteria 1272
344 Ga0075434_100001606 3300006871 Bacteria 19191
345 Ga0075434_100001618 3300006871 Bacteria 19138
346 Ga0075434_100002846 3300006871 Bacteria 15337
347 Ga0075434_100005702 3300006871 Bacteria 11371
348 Ga0075434_100017941 3300006871 Bacteria 6828
349 Ga0075434_100029217 3300006871 Bacteria 5421
350 Ga0075434_100032751 3300006871 Bacteria 5125
351 Ga0075434_100046998 3300006871 Bacteria 4283
352 Ga0075434_100081386 3300006871 Bacteria 3236
353 Ga0075434_100098501 3300006871 Bacteria 2929
354 Ga0075434_100144486 3300006871 Bacteria 2399
355 Ga0075434_100172754 3300006871 Bacteria 2181
356 Ga0075434_100239892 3300006871 Bacteria 1833
357 Ga0075429_100000268 3300006880 Bacteria 36304
358 Ga0075429_100003751 3300006880 Bacteria 12956
359 Ga0075429_100014968 3300006880 Bacteria 6728
360 Ga0075429_100024998 3300006880 Bacteria 5185
361 Ga0075429_100041443 3300006880 Bacteria 4010
362 Ga0075429_100055621 3300006880 Bacteria 3443
363 Ga0075429_100056339 3300006880 Bacteria 3421
364 Ga0075429_100072724 3300006880 Bacteria 2994
365 Ga0075429_100114363 3300006880 Bacteria 2359
366 Ga0075429_100144286 3300006880 Bacteria 2084
367 Ga0075429_100267880 3300006880 Bacteria 1496
368 Ga0075429_100310239 3300006880 Bacteria 1381
369 Ga0068865_100050747 3300006881 Bacteria 2868
370 Ga0068865_100185709 3300006881 Bacteria 1604
371 Ga0075436_100001281 3300006914 Bacteria 17072
372 Ga0075436_100014868 3300006914 Bacteria 5333
373 Ga0075436_100038258 3300006914 Bacteria 3311
374 Ga0075436_100041145 3300006914 Bacteria 3189
375 Ga0075436_100067387 3300006914 Bacteria 2474
376 Ga0097620_100036579 3300006931 Bacteria 4929
377 Ga0097620_100043178 3300006931 Bacteria 4531
378 Ga0097620_100071424 3300006931 Bacteria 3507
379 Ga0097620_100276624 3300006931 Bacteria 1771
380 Ga0075435_100005401 3300007076 Bacteria 8911
381 Ga0075435_100032115 3300007076 Bacteria 4144
382 Ga0075435_100038045 3300007076 Bacteria 3835
383 Ga0075435_100052521 3300007076 Bacteria 3285
384 Ga0075435_100057110 3300007076 Bacteria 3156
385 Ga0075435_100084928 3300007076 Bacteria 2605
386 Ga0075435_100110969 3300007076 Bacteria 2281
387 Ga0075435_100164654 3300007076 Bacteria 1869
388 Ga0075435_100363306 3300007076 Bacteria 1242
389 Ga0099794_10014353 3300007265 Bacteria 3470
390 Ga0099794_10015243 3300007265 Bacteria 3389
391 Ga0099794_10021496 3300007265 Bacteria 2932
392 Ga0099794_10062265 3300007265 Bacteria 1814
393 Ga0099794_10062329 3300007265 Bacteria 1813
394 Ga0099794_10079703 3300007265 Bacteria 1613
395 Ga0099794_10108250 3300007265 Bacteria 1391
396 Ga0105240_10001929 3300009093 Bacteria 34458
397 Ga0105240_10066545 3300009093 Bacteria 4469
398 Ga0111539_10000318 3300009094 Bacteria 58792
399 Ga0111539_10000334 3300009094 Bacteria 57820
400 Ga0111539_10004422 3300009094 Bacteria 18377
401 Ga0111539_10014897 3300009094 Bacteria 9693
402 Ga0111539_10023005 3300009094 Bacteria 7653
403 Ga0111539_10058841 3300009094 Bacteria 4558
404 Ga0111539_10073184 3300009094 Bacteria 4040
405 Ga0111539_10090121 3300009094 Bacteria 3604
406 Ga0111539_10375173 3300009094 Bacteria 1656
407 Ga0105245_10003582 3300009098 Bacteria 13863
408 Ga0105245_10005830 3300009098 Bacteria 10811
409 Ga0114129_10001627 3300009147 Bacteria 30482
410 Ga0114129_10002104 3300009147 Bacteria 27400
411 Ga0114129_10005728 3300009147 Bacteria 17602
412 Ga0114129_10012915 3300009147 Bacteria 11885
413 Ga0114129_10013635 3300009147 Bacteria 11581
414 Ga0114129_10014404 3300009147 Bacteria 11270
415 Ga0114129_10019349 3300009147 Bacteria 9697
416 Ga0114129_10019679 3300009147 Bacteria 9609
417 Ga0114129_10039856 3300009147 Bacteria 6626
418 Ga0114129_10046632 3300009147 Bacteria 6089
419 Ga0114129_10050242 3300009147 Bacteria 5858
420 Ga0114129_10061150 3300009147 Bacteria 5264
421 Ga0114129_10062274 3300009147 Bacteria 5212
422 Ga0114129_10066004 3300009147 Bacteria 5048
423 Ga0114129_10069400 3300009147 Bacteria 4912
424 Ga0114129_10092487 3300009147 Bacteria 4190
425 Ga0114129_10103150 3300009147 Bacteria 3943
426 Ga0114129_10108015 3300009147 Bacteria 3842
427 Ga0114129_10113816 3300009147 Bacteria 3731
428 Ga0114129_10139168 3300009147 Bacteria 3329
429 Ga0114129_10232363 3300009147 Bacteria 2483
430 Ga0114129_10268783 3300009147 Bacteria 2282
431 Ga0114129_10480568 3300009147 Bacteria 1626
432 Ga0114129_10618182 3300009147 Bacteria 1402
433 Ga0105243_10003345 3300009148 Bacteria 13008
434 Ga0105243_10017751 3300009148 Bacteria 5383
435 Ga0105243_10111474 3300009148 Bacteria 2290
436 Ga0105243_10326700 3300009148 Bacteria 1400
437 Ga0105241_10004001 3300009174 Bacteria 10894
438 Ga0105241_10287459 3300009174 Bacteria 1406
439 Ga0105242_10002043 3300009176 Bacteria 15905
440 Ga0105242_10040299 3300009176 Bacteria 3764
441 Ga0105242_10061955 3300009176 Bacteria 3078
442 Ga0105242_10128646 3300009176 Bacteria 2183
443 Ga0105242_10225061 3300009176 Bacteria 1678
444 Ga0105248_10000908 3300009177 Bacteria 33049
445 Ga0105248_10233469 3300009177 Bacteria 2071
446 Ga0105237_10000139 3300009545 Bacteria 102251
447 Ga0105237_10140440 3300009545 Bacteria 2410
448 Ga0105238_10002511 3300009551 Bacteria 18359
449 Ga0105249_10042860 3300009553 Bacteria 4116
450 Ga0105249_10070771 3300009553 Bacteria 3221
451 Ga0105249_10153338 3300009553 Bacteria 2220
452 Ga0105249_10179463 3300009553 Bacteria 2059
453 Ga0105249_10281580 3300009553 Bacteria 1661
454 Ga0105249_10282786 3300009553 Bacteria 1657
455 Ga0099796_10058664 3300010159 Bacteria 1357
456 Ga0105239_10179584 3300010375 Bacteria 2368
457 Ga0105239_10427815 3300010375 Bacteria 1500
458 Ga0105246_10115615 3300011119 Bacteria 1979
459 Ga0157373_10000619 3300013100 Bacteria 27828
460 Ga0157371_10014280 3300013102 Bacteria 6000
461 Ga0157371_10177543 3300013102 Bacteria 1523
462 Ga0157369_10063065 3300013105 Bacteria 3993
463 Ga0157369_10220931 3300013105 Bacteria 1983
464 Ga0157374_10008705 3300013296 Bacteria 8679
465 Ga0157374_10051313 3300013296 Bacteria 3838
466 Ga0157374_10066266 3300013296 Bacteria 3394
467 Ga0157378_10000040 3300013297 Bacteria 113406
468 Ga0157378_10002668 3300013297 Bacteria 15883
469 Ga0157378_10131593 3300013297 Bacteria 2316
470 Ga0157378_10135362 3300013297 Bacteria 2284
471 Ga0157378_10463111 3300013297 Bacteria 1260
472 Ga0163162_10004254 3300013306 Bacteria 13771
473 Ga0163162_10082703 3300013306 Bacteria 3283
474 Ga0163162_10200124 3300013306 Bacteria 2126
475 Ga0157372_10000405 3300013307 Bacteria 47348
476 Ga0157372_10411679 3300013307 Bacteria 1576
477 Ga0157372_10666854 3300013307 Bacteria 1211
478 Ga0157375_10008877 3300013308 Bacteria 8796
479 Ga0157375_10442038 3300013308 Bacteria 1466
480 Ga0163163_10069879 3300014325 Bacteria 3496
481 Ga0157380_10013334 3300014326 Bacteria 5991
482 Ga0157380_10056310 3300014326 Bacteria 3126
483 Ga0157380_10071230 3300014326 Bacteria 2812
484 Ga0157377_10001674 3300014745 Bacteria 9664
485 Ga0157379_10000523 3300014968 Bacteria 31101
486 Ga0157376_10051065 3300014969 Bacteria 3434
487 Ga0157376_10055270 3300014969 Bacteria 3312
488 Ga0163161_10047209 3300017792 Bacteria 3110
489 Ga0163161_10229416 3300017792 Bacteria 1440
490 Ga0206354_11053466 3300020081 Bacteria 1266
491 Ga0209758_1000186 3300025297 Bacteria 138804
492 Ga0209758_1029347 3300025297 Bacteria 2302
493 Ga0207426_1004647 3300025302 Bacteria 6602
494 Ga0207697_10027579 3300025315 Bacteria 2322
495 Ga0207653_10002535 3300025885 Bacteria 5800
496 Ga0207642_10005219 3300025899 Bacteria 4231
497 Ga0207688_10003494 3300025901 Bacteria 8574
498 Ga0207688_10095397 3300025901 Bacteria 1712
499 Ga0207680_10003106 3300025903 Bacteria 7800
500 Ga0207680_10037104 3300025903 Bacteria 2812
501 Ga0207647_10012299 3300025904 Bacteria 5962
502 Ga0207699_10192782 3300025906 Bacteria 1376
503 Ga0207645_10000192 3300025907 Bacteria 49583
504 Ga0207645_10000808 3300025907 Bacteria 26186
505 Ga0207645_10010592 3300025907 Bacteria 6326
506 Ga0207643_10001002 3300025908 Bacteria 16824
507 Ga0207643_10066697 3300025908 Bacteria 2064
508 Ga0207705_10007157 3300025909 Bacteria 8224
509 Ga0207705_10059370 3300025909 Bacteria 2760
510 Ga0207684_10000198 3300025910 Bacteria 95038
511 Ga0207684_10000508 3300025910 Bacteria 48513
512 Ga0207684_10000866 3300025910 Bacteria 34575
513 Ga0207684_10001042 3300025910 Bacteria 30996
514 Ga0207684_10010730 3300025910 Bacteria 8043
515 Ga0207684_10015123 3300025910 Bacteria 6644
516 Ga0207684_10021146 3300025910 Bacteria 5555
517 Ga0207684_10056350 3300025910 Bacteria 3334
518 Ga0207684_10108326 3300025910 Bacteria 2378
519 Ga0207684_10112922 3300025910 Bacteria 2326
520 Ga0207684_10172847 3300025910 Bacteria 1862
521 Ga0207684_10362989 3300025910 Bacteria 1246
522 Ga0207654_10004026 3300025911 Bacteria 7395
523 Ga0207707_10000171 3300025912 Bacteria 67484
524 Ga0207707_10004721 3300025912 Bacteria 11954
525 Ga0207707_10023722 3300025912 Bacteria 5365
526 Ga0207707_10081674 3300025912 Bacteria 2822
527 Ga0207707_10096984 3300025912 Bacteria 2576
528 Ga0207695_10003714 3300025913 Bacteria 21251
529 Ga0207695_10011470 3300025913 Bacteria 10731
530 Ga0207695_10237495 3300025913 Bacteria 1725
531 Ga0207671_10000120 3300025914 Bacteria 120786
532 Ga0207671_10147990 3300025914 Bacteria 1813
533 Ga0207671_10279731 3300025914 Bacteria 1316
534 Ga0207663_10016951 3300025916 Bacteria 4050
535 Ga0207663_10037378 3300025916 Bacteria 2927
536 Ga0207660_10000651 3300025917 Bacteria 23409
537 Ga0207660_10004820 3300025917 Bacteria 8779
538 Ga0207660_10021834 3300025917 Bacteria 4307
539 Ga0207660_10087992 3300025917 Bacteria 2296
540 Ga0207662_10016959 3300025918 Bacteria 4115
541 Ga0207662_10078053 3300025918 Bacteria 2015
542 Ga0207657_10000085 3300025919 Bacteria 89158
543 Ga0207657_10002541 3300025919 Bacteria 19730
544 Ga0207657_10020299 3300025919 Bacteria 6283
545 Ga0207657_10027458 3300025919 Bacteria 5213
546 Ga0207649_10144123 3300025920 Bacteria 1633
547 Ga0207652_10000264 3300025921 Bacteria 54769
548 Ga0207652_10018935 3300025921 Bacteria 5652
549 Ga0207652_10045109 3300025921 Bacteria 3757
550 Ga0207652_10398950 3300025921 Bacteria 1241
551 Ga0207646_10000072 3300025922 Bacteria 141756
552 Ga0207646_10000181 3300025922 Bacteria 85931
553 Ga0207646_10001790 3300025922 Bacteria 26010
554 Ga0207646_10002033 3300025922 Bacteria 24299
555 Ga0207646_10011683 3300025922 Bacteria 8489
556 Ga0207646_10072731 3300025922 Bacteria 3071
557 Ga0207646_10112712 3300025922 Bacteria 2441
558 Ga0207646_10306357 3300025922 Bacteria 1435
559 Ga0207681_10022459 3300025923 Bacteria 4024
560 Ga0207650_10036866 3300025925 Bacteria 3559
561 Ga0207650_10098021 3300025925 Bacteria 2251
562 Ga0207650_10358642 3300025925 Bacteria 1201
563 Ga0207659_10096897 3300025926 Bacteria 2215
564 Ga0207659_10104182 3300025926 Bacteria 2145
565 Ga0207659_10134574 3300025926 Bacteria 1912
566 Ga0207659_10188866 3300025926 Bacteria 1638
567 Ga0207687_10002407 3300025927 Bacteria 12684
568 Ga0207700_10041605 3300025928 Bacteria 3363
569 Ga0207700_10184869 3300025928 Bacteria 1747
570 Ga0207644_10060037 3300025931 Bacteria 2751
571 Ga0207690_10001217 3300025932 Bacteria 16225
572 Ga0207706_10001096 3300025933 Bacteria 27537
573 Ga0207706_10003246 3300025933 Bacteria 15585
574 Ga0207706_10113197 3300025933 Bacteria 2387
575 Ga0207706_10212236 3300025933 Bacteria 1696
576 Ga0207686_10066034 3300025934 Bacteria 2309
577 Ga0207709_10020922 3300025935 Bacteria 3697
578 Ga0207709_10064847 3300025935 Bacteria 2295
579 Ga0207709_10074769 3300025935 Bacteria 2163
580 Ga0207709_10078287 3300025935 Bacteria 2122
581 Ga0207670_10000004 3300025936 Bacteria 707262
582 Ga0207670_10000032 3300025936 Bacteria 112426
583 Ga0207670_10000760 3300025936 Bacteria 16979
584 Ga0207670_10004196 3300025936 Bacteria 7726
585 Ga0207670_10013259 3300025936 Bacteria 4853
586 Ga0207669_10004616 3300025937 Bacteria 6081
587 Ga0207669_10005720 3300025937 Bacteria 5608
588 Ga0207669_10026928 3300025937 Bacteria 3137
589 Ga0207669_10083144 3300025937 Bacteria 2058
590 Ga0207704_10061710 3300025938 Bacteria 2327
591 Ga0207704_10160703 3300025938 Bacteria 1598
592 Ga0207665_10036912 3300025939 Bacteria 3251
593 Ga0207665_10048662 3300025939 Bacteria 2847
594 Ga0207665_10094258 3300025939 Bacteria 2079
595 Ga0207691_10000007 3300025940 Bacteria 151515
596 Ga0207691_10001064 3300025940 Bacteria 27290
597 Ga0207691_10016311 3300025940 Bacteria 7053
598 Ga0207691_10026780 3300025940 Bacteria 5410
599 Ga0207691_10074614 3300025940 Bacteria 3059
600 Ga0207691_10078234 3300025940 Bacteria 2977
601 Ga0207711_10001788 3300025941 Bacteria 19690
602 Ga0207711_10071385 3300025941 Bacteria 3013
603 Ga0207689_10001095 3300025942 Bacteria 26112
604 Ga0207689_10001346 3300025942 Bacteria 23649
605 Ga0207689_10015506 3300025942 Bacteria 6454
606 Ga0207689_10167699 3300025942 Bacteria 1809
607 Ga0207679_10000724 3300025945 Bacteria 21897
608 Ga0207679_10029295 3300025945 Bacteria 3831
609 Ga0207679_10029785 3300025945 Bacteria 3804
610 Ga0207667_10000264 3300025949 Bacteria 72896
611 Ga0207667_10001063 3300025949 Bacteria 34810
612 Ga0207667_10026473 3300025949 Bacteria 6336
613 Ga0207667_10040434 3300025949 Bacteria 4965
614 Ga0207667_10118850 3300025949 Bacteria 2724
615 Ga0207667_10405102 3300025949 Bacteria 1389
616 Ga0207651_10000138 3300025960 Bacteria 31825
617 Ga0207651_10007047 3300025960 Bacteria 5961
618 Ga0207712_10015802 3300025961 Bacteria 4876
619 Ga0207712_10105931 3300025961 Bacteria 2099
620 Ga0207712_10118357 3300025961 Bacteria 2000
621 Ga0207712_10123115 3300025961 Bacteria 1965
622 Ga0207668_10058657 3300025972 Bacteria 2692
623 Ga0207668_10064022 3300025972 Bacteria 2597
624 Ga0207668_10190607 3300025972 Bacteria 1624
625 Ga0207640_10001932 3300025981 Bacteria 11153
626 Ga0207640_10134646 3300025981 Bacteria 1792
627 Ga0207640_10223424 3300025981 Bacteria 1443
628 Ga0207658_10347316 3300025986 Bacteria 1291
629 Ga0207677_10113300 3300026023 Bacteria 2024
630 Ga0207703_10026664 3300026035 Bacteria 4551
631 Ga0207703_10144242 3300026035 Bacteria 2069
632 Ga0207703_10349667 3300026035 Bacteria 1360
633 Ga0207639_10001968 3300026041 Bacteria 13815
634 Ga0207678_10000868 3300026067 Bacteria 27729
635 Ga0207678_10044575 3300026067 Bacteria 3836
636 Ga0207678_10215905 3300026067 Bacteria 1641
637 Ga0207708_10000051 3300026075 Bacteria 108519
638 Ga0207708_10000413 3300026075 Bacteria 33516
639 Ga0207708_10065773 3300026075 Bacteria 2771
640 Ga0207708_10074313 3300026075 Bacteria 2605
641 Ga0207708_10267335 3300026075 Bacteria 1382
642 Ga0207702_10002106 3300026078 Bacteria 19165
643 Ga0207702_10043452 3300026078 Bacteria 3773
644 Ga0207641_10020018 3300026088 Bacteria 5494
645 Ga0207641_10024604 3300026088 Bacteria 4962
646 Ga0207641_10057236 3300026088 Bacteria 3315
647 Ga0207648_10000101 3300026089 Bacteria 82654
648 Ga0207648_10001871 3300026089 Bacteria 23013
649 Ga0207648_10007881 3300026089 Bacteria 10391
650 Ga0207648_10041813 3300026089 Bacteria 4025
651 Ga0207648_10057876 3300026089 Bacteria 3381
652 Ga0207648_10064047 3300026089 Bacteria 3204
653 Ga0207648_10065146 3300026089 Bacteria 3177
654 Ga0207648_10142915 3300026089 Bacteria 2110
655 Ga0207648_10215327 3300026089 Bacteria 1706
656 Ga0207648_10356831 3300026089 Bacteria 1319
657 Ga0207676_10010777 3300026095 Bacteria 6520
658 Ga0207674_10000702 3300026116 Bacteria 43629
659 Ga0207674_10020561 3300026116 Bacteria 7127
660 Ga0207674_10158794 3300026116 Bacteria 2216
661 Ga0207674_10181165 3300026116 Bacteria 2058
662 Ga0207674_10286055 3300026116 Bacteria 1597
663 Ga0207675_100003318 3300026118 Bacteria 15756
664 Ga0207675_100007470 3300026118 Bacteria 10328
665 Ga0207675_100070313 3300026118 Bacteria 3271
666 Ga0207675_100184859 3300026118 Bacteria 1997
667 Ga0207675_100195484 3300026118 Bacteria 1941
668 Ga0207683_10000229 3300026121 Bacteria 49529
669 Ga0207683_10007424 3300026121 Bacteria 9401
670 Ga0207683_10213247 3300026121 Bacteria 1758
671 Ga0209969_1000130 3300027360 Bacteria 9692
672 Ga0209969_1007506 3300027360 Bacteria 1540
673 Ga0209967_1000043 3300027364 Bacteria 16255
674 Ga0209967_1002715 3300027364 Bacteria 2303
675 Ga0209967_1006257 3300027364 Bacteria 1612
676 Ga0209981_1000074 3300027378 Bacteria 10839
677 Ga0209981_1006337 3300027378 Bacteria 1581
678 Ga0209996_1000042 3300027395 Bacteria 18590
679 Ga0209996_1004057 3300027395 Bacteria 1856
680 Ga0209984_1000006 3300027424 Bacteria 23947
681 Ga0209984_1005788 3300027424 Bacteria 1497
682 Ga0210000_1000039 3300027462 Bacteria 19582
683 Ga0210000_1002243 3300027462 Bacteria 2743
684 Ga0209995_1000776 3300027471 Bacteria 4902
685 Ga0209968_1000027 3300027526 Bacteria 28287
686 Ga0209968_1000974 3300027526 Bacteria 4405
687 Ga0209999_1000034 3300027543 Bacteria 14819
688 Ga0209999_1004012 3300027543 Bacteria 2650
689 Ga0209982_1000426 3300027552 Bacteria 5189
690 Ga0209982_1009046 3300027552 Bacteria 1467
691 Ga0209970_1000118 3300027614 Bacteria 11640
692 Ga0209970_1000394 3300027614 Bacteria 7379
693 Ga0209983_1000603 3300027665 Bacteria 7715
694 Ga0209588_1004363 3300027671 Bacteria 3984
695 Ga0209588_1035841 3300027671 Bacteria 1595
696 Ga0209588_1058965 3300027671 Bacteria 1241
697 Ga0209971_1000104 3300027682 Bacteria 24919
698 Ga0209971_1000642 3300027682 Bacteria 9100
699 Ga0209971_1002702 3300027682 Bacteria 4241
700 Ga0209966_1000016 3300027695 Bacteria 73256
701 Ga0209966_1000032 3300027695 Bacteria 60752
702 Ga0209966_1002173 3300027695 Bacteria 3271
703 Ga0209998_10000021 3300027717 Bacteria 70520
704 Ga0209998_10000162 3300027717 Bacteria 24625
705 Ga0209974_10000003 3300027876 Bacteria 65938
706 Ga0209974_10001085 3300027876 Bacteria 9640
707 Ga0209974_10002485 3300027876 Bacteria 6675
708 Ga0207428_10000399 3300027907 Bacteria 53984
709 Ga0207428_10000489 3300027907 Bacteria 47382
710 Ga0207428_10000598 3300027907 Bacteria 42670
711 Ga0207428_10022918 3300027907 Bacteria 5261
712 Ga0207428_10031416 3300027907 Bacteria 4379
713 Ga0207428_10054905 3300027907 Bacteria 3170
714 Ga0207428_10183323 3300027907 Bacteria 1581
715 Ga0268266_10007683 3300028379 Bacteria 9682
716 Ga0268266_10037604 3300028379 Bacteria 4122
717 Ga0268266_10057784 3300028379 Bacteria 3339
718 Ga0268266_10100250 3300028379 Bacteria 2551
719 Ga0268266_10225019 3300028379 Bacteria 1726
720 Ga0268265_10002229 3300028380 Bacteria 14899
721 Ga0268265_10005189 3300028380 Bacteria 8925
722 Ga0268265_10032719 3300028380 Bacteria 3772
723 Ga0268265_10361250 3300028380 Bacteria 1329
724 Ga0268265_10416630 3300028380 Bacteria 1246
725 Ga0268264_10232007 3300028381 Bacteria 1705
726 Ga0268264_10238289 3300028381 Bacteria 1684
727 Ga0265337_1004025 3300028556 Bacteria 6209
728 Ga0265337_1020130 3300028556 Bacteria 2093
729 Ga0265334_10004065 3300028573 Bacteria 6565
730 Ga0265334_10009181 3300028573 Bacteria 4189
731 Ga0265318_10000027 3300028577 Bacteria 153682
732 Ga0265318_10023573 3300028577 Bacteria 2452
733 Ga0265323_10000685 3300028653 Bacteria 18436
734 Ga0265323_10009474 3300028653 Bacteria 3976
735 Ga0265323_10010814 3300028653 Bacteria 3695
736 Ga0265323_10017135 3300028653 Bacteria 2818
737 Ga0265323_10038073 3300028653 Bacteria 1760
738 Ga0265338_10014435 3300028800 Bacteria 8793
739 Ga0265338_10121728 3300028800 Bacteria 2078
740 Ga0265338_10128194 3300028800 Bacteria 2009
741 Ga0265324_10000134 3300029957 Bacteria 58308
742 Ga0265324_10036653 3300029957 Bacteria 1705
743 Ga0307511_10026258 3300030521 Bacteria 5346
744 Ga0265760_10023910 3300031090 Bacteria 1777
745 Ga0265330_10000036 3300031235 Bacteria 121416
746 Ga0265330_10000152 3300031235 Bacteria 55579
747 Ga0265330_10000421 3300031235 Bacteria 28723
748 Ga0265330_10000768 3300031235 Bacteria 20102
749 Ga0265330_10001825 3300031235 Bacteria 11919
750 Ga0265330_10007357 3300031235 Bacteria 5370
751 Ga0265330_10014266 3300031235 Bacteria 3689
752 Ga0265330_10036525 3300031235 Bacteria 2189
753 Ga0265332_10000267 3300031238 Bacteria 41437
754 Ga0265332_10001625 3300031238 Bacteria 12306
755 Ga0265332_10034428 3300031238 Bacteria 2201
756 Ga0265328_10000909 3300031239 Bacteria 13671
757 Ga0265328_10000918 3300031239 Bacteria 13562
758 Ga0265320_10000018 3300031240 Bacteria 183411
759 Ga0265320_10002159 3300031240 Bacteria 13800
760 Ga0265325_10000855 3300031241 Bacteria 21943
761 Ga0265325_10007980 3300031241 Bacteria 6282
762 Ga0265325_10010359 3300031241 Bacteria 5402
763 Ga0265325_10013720 3300031241 Bacteria 4602
764 Ga0265325_10037066 3300031241 Bacteria 2579
765 Ga0265329_10000004 3300031242 Bacteria 108465
766 Ga0265329_10000067 3300031242 Bacteria 46423
767 Ga0265329_10003724 3300031242 Bacteria 6572
768 Ga0265329_10009439 3300031242 Bacteria 3643
769 Ga0265329_10029597 3300031242 Bacteria 1788
770 Ga0265340_10000043 3300031247 Bacteria 57790
771 Ga0265340_10012930 3300031247 Bacteria 4397
772 Ga0265339_10000010 3300031249 Bacteria 214721
773 Ga0265339_10002404 3300031249 Bacteria 13421
774 Ga0265339_10002786 3300031249 Bacteria 12420
775 Ga0265339_10016729 3300031249 Bacteria 4364
776 Ga0265339_10033047 3300031249 Bacteria 2916
777 Ga0265331_10000046 3300031250 Bacteria 183360
778 Ga0265331_10000321 3300031250 Bacteria 52188
779 Ga0265331_10000408 3300031250 Bacteria 44052
780 Ga0265327_10016003 3300031251 Unclassified 4798
781 Ga0265327_10056670 3300031251 Bacteria 2018
782 Ga0265316_10000046 3300031344 Bacteria 129393
783 Ga0265316_10000645 3300031344 Bacteria 38776
784 Ga0265316_10000921 3300031344 Bacteria 32083
785 Ga0265316_10001017 3300031344 Bacteria 30451
786 Ga0265316_10001498 3300031344 Bacteria 25054
787 Ga0265316_10005674 3300031344 Bacteria 12077
788 Ga0265316_10011444 3300031344 Bacteria 8001
789 Ga0265316_10016519 3300031344 Bacteria 6397
790 Ga0265316_10060279 3300031344 Bacteria 2949
791 Ga0265316_10110608 3300031344 Bacteria 2081
792 Ga0307513_10192879 3300031456 Bacteria 1887
793 Ga0307408_100014384 3300031548 Bacteria 5257
794 Ga0307408_100027981 3300031548 Bacteria 3891
795 Ga0307408_100035887 3300031548 Bacteria 3481
796 Ga0307408_100266143 3300031548 Bacteria 1421
797 Ga0265313_10000075 3300031595 Bacteria 97534
798 Ga0265313_10003304 3300031595 Bacteria 13203
799 Ga0265313_10033228 3300031595 Bacteria 2625
800 Ga0307508_10006597 3300031616 Bacteria 10896
801 Ga0307508_10109264 3300031616 Bacteria 2365
802 Ga0316575_10011631 3300031665 Bacteria 3260
803 Ga0316575_10024235 3300031665 Bacteria 2348
804 Ga0316575_10025480 3300031665 Bacteria 2293
805 Ga0316579_10001478 3300031691 Bacteria 8547
806 Ga0316579_10003415 3300031691 Bacteria 6185
807 Ga0316579_10009552 3300031691 Bacteria 4082
808 Ga0265314_10000002 3300031711 Bacteria 2092193
809 Ga0265314_10000008 3300031711 Bacteria 485166
810 Ga0265314_10000137 3300031711 Bacteria 109629
811 Ga0265314_10000866 3300031711 Bacteria 35970
812 Ga0265314_10001571 3300031711 Bacteria 25113
813 Ga0265314_10028462 3300031711 Bacteria 4166
814 Ga0265314_10065047 3300031711 Bacteria 2465
815 Ga0265314_10119898 3300031711 Bacteria 1658
816 Ga0265314_10135957 3300031711 Bacteria 1526
817 Ga0265342_10000048 3300031712 Bacteria 126158
818 Ga0265342_10001561 3300031712 Bacteria 21197
819 Ga0265342_10002055 3300031712 Bacteria 17872
820 Ga0265342_10002610 3300031712 Bacteria 15436
821 Ga0265342_10002987 3300031712 Bacteria 14188
822 Ga0265342_10004273 3300031712 Bacteria 11316
823 Ga0265342_10024762 3300031712 Bacteria 3784
824 Ga0265342_10067715 3300031712 Bacteria 2088
825 Ga0316576_10000590 3300031727 Bacteria 17317
826 Ga0316576_10001636 3300031727 Bacteria 12254
827 Ga0316576_10005318 3300031727 Bacteria 7843
828 Ga0316576_10007679 3300031727 Bacteria 6804
829 Ga0316576_10009931 3300031727 Bacteria 6161
830 Ga0316576_10010305 3300031727 Bacteria 6066
831 Ga0316576_10011887 3300031727 Bacteria 5727
832 Ga0316576_10014555 3300031727 Bacteria 5257
833 Ga0316576_10028127 3300031727 Bacteria 3959
834 Ga0316576_10066793 3300031727 Bacteria 2646
835 Ga0316576_10098325 3300031727 Bacteria 2185
836 Ga0316576_10114400 3300031727 Bacteria 2024
837 Ga0316576_10128671 3300031727 Bacteria 1904
838 Ga0316576_10307305 3300031727 Bacteria 1185
839 Ga0316578_10000716 3300031728 Bacteria 12028
840 Ga0316578_10001635 3300031728 Bacteria 9291
841 Ga0316578_10004926 3300031728 Bacteria 6393
842 Ga0316578_10007028 3300031728 Bacteria 5605
843 Ga0316578_10017085 3300031728 Bacteria 3942
844 Ga0316578_10026780 3300031728 Bacteria 3253
845 Ga0316578_10027605 3300031728 Bacteria 3209
846 Ga0316578_10028198 3300031728 Bacteria 3178
847 Ga0316578_10030928 3300031728 Bacteria 3046
848 Ga0307516_10009436 3300031730 Bacteria 10876
849 Ga0307405_10002064 3300031731 Bacteria 8741
850 Ga0307405_10106827 3300031731 Bacteria 1889
851 Ga0307405_10114780 3300031731 Bacteria 1831
852 Ga0316577_10007022 3300031733 Bacteria 5987
853 Ga0316577_10010473 3300031733 Bacteria 5008
854 Ga0316577_10020032 3300031733 Bacteria 3706
855 Ga0316577_10025984 3300031733 Bacteria 3258
856 Ga0316577_10032349 3300031733 Bacteria 2922
857 Ga0316577_10063098 3300031733 Bacteria 2069
858 Ga0316577_10088380 3300031733 Bacteria 1734
859 Ga0307413_10010101 3300031824 Bacteria 4558
860 Ga0307413_10063160 3300031824 Bacteria 2295
861 Ga0307410_10001718 3300031852 Bacteria 10111
862 Ga0307410_10018924 3300031852 Bacteria 4175
863 Ga0307410_10045685 3300031852 Bacteria 2918
864 Ga0307406_10013012 3300031901 Bacteria 4756
865 Ga0307406_10022251 3300031901 Bacteria 3758
866 Ga0307406_10059558 3300031901 Bacteria 2459
867 Ga0307406_10089849 3300031901 Bacteria 2065
868 Ga0307407_10004264 3300031903 Bacteria 6037
869 Ga0307407_10013864 3300031903 Bacteria 3927
870 Ga0307407_10157891 3300031903 Bacteria 1481
871 Ga0307407_10187004 3300031903 Bacteria 1377
872 Ga0307412_10000625 3300031911 Bacteria 20667
873 Ga0307409_100001073 3300031995 Bacteria 12884
874 Ga0307409_100008071 3300031995 Bacteria 6355
875 Ga0307409_100031249 3300031995 Bacteria 3840
876 Ga0307409_100105064 3300031995 Bacteria 2354
877 Ga0307409_100110516 3300031995 Bacteria 2304
878 Ga0307409_100158240 3300031995 Bacteria 1977
879 Ga0307416_100000367 3300032002 Bacteria 23487
880 Ga0307416_100004333 3300032002 Bacteria 8532
881 Ga0307416_100019537 3300032002 Bacteria 4807
882 Ga0307416_100043362 3300032002 Bacteria 3522
883 Ga0307416_100055450 3300032002 Bacteria 3192
884 Ga0307416_100122701 3300032002 Bacteria 2320
885 Ga0307414_10003836 3300032004 Bacteria 8090
886 Ga0307414_10098993 3300032004 Bacteria 2189
887 Ga0307414_10348727 3300032004 Bacteria 1270
888 Ga0307411_10003939 3300032005 Bacteria 7007
889 Ga0307411_10091848 3300032005 Bacteria 2122
890 Ga0316583_10001322 3300032133 Bacteria 8191
891 Ga0316585_10000212 3300032137 Bacteria 12013
892 Ga0316585_10000276 3300032137 Bacteria 11246
893 Ga0316580_10004268 3300032139 Bacteria 4133
894 Ga0316580_10006874 3300032139 Bacteria 3370
895 Ga0316580_10030778 3300032139 Bacteria 1662
896 Ga0316580_10033725 3300032139 Bacteria 1584
897 Ga0373950_0000020 3300034818 Bacteria 209621
898 Ga0373950_0000089 3300034818 Bacteria 25034
899 Ga0373926_0003654 3300035083 Bacteria 4996
900 Ga0373940_0014138 3300035088 Bacteria 1942
901 Ga0373940_0021750 3300035088 Bacteria 1643
902 Ga0373949_0006693 3300035090 Bacteria 2531
903 Ga0373951_0027989 3300035091 Bacteria 1319
904 Ga0373932_0017719 3300035112 Bacteria 1832
905 Ga0373941_0013027 3300035115 Bacteria 2190
906 Ga0373954_0000932 3300035118 Bacteria 11373
907 Ga0373954_0017115 3300035118 Bacteria 3251
908 Ga0373954_0020324 3300035118 Bacteria 3003
909 Ga0373956_0005379 3300035119 Bacteria 5125
910 Ga0373960_0004851 3300035121 Bacteria 3097
911 Ga0373943_0013945 3300035170 Bacteria 3635
912 Ga0373946_0029802 3300035171 Bacteria 2175
913 Ga0373946_0071022 3300035171 Bacteria 1504
914 Ga0373955_0014622 3300035172 Bacteria 3823
915 Ga0373961_0002268 3300035241 Bacteria 5035
916 Ga0373962_0020166 3300035242 Bacteria 1749
917 Ga0316574_0002631 3300035398 Bacteria 9055
918 Ga0316574_0004793 3300035398 Bacteria 7152
919 Ga0316574_0020998 3300035398 Bacteria 3871
920 Ga0316574_0031736 3300035398 Bacteria 3206
921 Ga0316574_0060957 3300035398 Bacteria 2369
922 Ga0316574_0081320 3300035398 Bacteria 2057
923 Ga0373931_0010872 3300035691 Bacteria 4380
924 Ga0373931_0025238 3300035691 Bacteria 3018
925 Ga0373931_0026409 3300035691 Bacteria 2955
926 Ga0373931_0040486 3300035691 Bacteria 2445
927 Ga0373935_0030350 3300035692 Bacteria 3350
928 Ga0373935_0035961 3300035692 Bacteria 3093
929 Ga0373935_0097496 3300035692 Bacteria 1934
930 Ga0373927_0000866 3300035695 Bacteria 23058
931 Ga0373927_0018305 3300035695 Bacteria 4604
932 Ga0373927_0054183 3300035695 Bacteria 2594
933 Ga0373927_0212369 3300035695 Bacteria 1271
934 Ga0373933_0001302 3300035724 Bacteria 14689
935 Ga0373933_0162781 3300035724 Bacteria 1417
936 Ga0373947_0001959 3300035725 Bacteria 12600
937 Ga0373947_0035137 3300035725 Bacteria 2967
938 Ga0373947_0039476 3300035725 Bacteria 2809
939 Ga0373937_0005888 3300036401 Bacteria 10547
940 Ga0373937_0007303 3300036401 Bacteria 9565
941 Ga0373937_0012910 3300036401 Bacteria 7359
942 Ga0373937_0057448 3300036401 Bacteria 3574
943 Ga0373937_0086937 3300036401 Bacteria 2893
944 Ga0316582_0003926 3300036647 Bacteria 7418
945 Ga0316582_0004517 3300036647 Bacteria 7045
946 Ga0316582_0004972 3300036647 Bacteria 6793
947 Ga0316582_0010738 3300036647 Bacteria 5029
948 Ga0316582_0023731 3300036647 Bacteria 3659
949 Ga0316582_0025174 3300036647 Bacteria 3571
950 Ga0316582_0046689 3300036647 Bacteria 2731
951 Ga0316582_0062574 3300036647 Bacteria 2390
952 Ga0316582_0094459 3300036647 Bacteria 1973
953 Ga0316582_0185242 3300036647 Bacteria 1417
954 Ga0316582_0194361 3300036647 Bacteria 1383
955 Ga0316584_0000608 3300036712 Bacteria 19444
956 Ga0316584_0011784 3300036712 Bacteria 6155
957 Ga0316584_0020379 3300036712 Bacteria 4807
958 Ga0316584_0030945 3300036712 Bacteria 3956
959 Ga0316584_0047592 3300036712 Bacteria 3203
960 Ga0316584_0057534 3300036712 Bacteria 2910
961 Ga0316584_0063843 3300036712 Bacteria 2757
962 Ga0316584_0078408 3300036712 Bacteria 2474
963 Ga0316584_0086442 3300036712 Bacteria 2347
964 Ga0316584_0100447 3300036712 Bacteria 2166
965 Ga0373925_0002133 3300037068 Bacteria 16165
966 Ga0373925_0015514 3300037068 Bacteria 5510
967 Ga0373925_0053562 3300037068 Bacteria 3017
968 Ga0395899_0002397 3300037312 Bacteria 15228
969 Ga0395899_0008397 3300037312 Bacteria 7952
970 Ga0395900_0017281 3300037418 Bacteria 7362
971 Ga0395900_0044429 3300037418 Bacteria 4578
972 Ga0395900_0107404 3300037418 Bacteria 2867
973 Ga0395900_0600690 3300037418 Bacteria 1041
974 Ga0395898_0002760 3300037466 Bacteria 20226
975 Ga0395898_0006268 3300037466 Bacteria 12719
976 Ga0395898_0125062 3300037466 Bacteria 2463
977 Ga0395905_0022419 3300037471 Bacteria 5973
978 Ga0395905_0027876 3300037471 Bacteria 5326
979 Ga0395905_0094759 3300037471 Bacteria 2801
980 Ga0395901_0000384 3300038443 Bacteria 52947
981 Ga0395901_0002282 3300038443 Bacteria 19553
982 Ga0395901_0004667 3300038443 Bacteria 13812
983 Ga0395901_0004796 3300038443 Bacteria 13643
984 Ga0395901_0012183 3300038443 Bacteria 8726
985 Ga0395901_0613905 3300038443 Bacteria 1095
986 Ga0400484_34638 3300038725 Bacteria 9432
987 Ga0400484_40454 3300038725 Bacteria 2246
988 Ga0400490_32774 3300038726 Bacteria 6887
989 Ga0400490_41208 3300038726 Bacteria 101235
990 Ga0400491_22990 3300038727 Bacteria 2234
991 Ga0400485_20517 3300038735 Bacteria 45673
992 Ga0400488_18032 3300038741 Bacteria 2529
993 Ga0400488_44983 3300038741 Bacteria 4431
994 Ga0400488_54927 3300038741 Bacteria 1146
995 Ga0400486_04466 3300038742 Bacteria 30371
996 Ga0400486_13683 3300038742 Bacteria 28516
997 Ga0400486_22390 3300038742 Bacteria 15149
998 Ga0242420_008801 3300038996 Bacteria 1645
999 Ga0400483_016424 3300039062 Bacteria 6117
1000 Ga0400483_022887 3300039062 Bacteria 5557
1001 Ga0400483_072467 3300039062 Bacteria 2011
1002 Ga0400483_075863 3300039062 Bacteria 91295
1003 Ga0400483_162550 3300039062 Bacteria 3626
1004 Ga0400483_262255 3300039062 Bacteria 2659
1005 Ga0400483_266651 3300039062 Bacteria 2886
1006 Ga0400489_01372 3300039093 Bacteria 76476
1007 Ga0400489_27790 3300039093 Bacteria 84913
1008 Ga0400489_35047 3300039093 Bacteria 73845
1009 Ga0400487_12749 3300039110 Bacteria 2225
1010 Ga0400487_65568 3300039110 Bacteria 13389
1011 Ga0436365_1640466 3300039437 Bacteria 1977
1012 Ga0436360_0039635 3300039438 Bacteria 3684
1013 Ga0436360_0949586 3300039438 Bacteria 14614
1014 Ga0436361_0475510 3300039447 Bacteria 1917
1015 Ga0439447_007486 3300041407 Bacteria 3463
1016 Ga0439461_0002413 3300041410 Bacteria 2980
1017 Ga0439466_0051774 3300041411 Bacteria 1344
1018 Ga0439465_0034926 3300041413 Bacteria 1611
1019 Ga0451797_1478612 3300041453 Bacteria 1679
1020 Ga0451800_0196302 3300041459 Bacteria 1507
1021 Ga0451807_0085809 3300041486 Bacteria 4741
1022 Ga0451843_0821208 3300041509 Bacteria 1232
1023 Ga0439445_0010053 3300042004 Bacteria 2234
1024 Ga0439448_0001005 3300042005 Bacteria 7033
1025 Ga0439448_0018144 3300042005 Bacteria 2153
1026 Ga0439449_0032474 3300042007 Bacteria 1946
1027 Ga0439450_007804 3300042008 Bacteria 1974
1028 Ga0439452_001836 3300042010 Bacteria 8227
1029 Ga0439454_004315 3300042011 Bacteria 1633
1030 Ga0450902_018235 3300042137 Bacteria 1150
1031 Ga0439446_0003240 3300042156 Bacteria 4014
1032 Ga0439434_0004098 3300042435 Bacteria 4257
1033 Ga0439434_0052353 3300042435 Bacteria 1267
1034 Ga0439435_0020982 3300042436 Bacteria 1691
1035 Ga0439464_0016251 3300042439 Bacteria 2010
1036 Ga0439460_0003121 3300042461 Bacteria 4006
1037 Ga0451577_0000055 3300042876 Bacteria 276883
1038 Ga0451577_0001410 3300042876 Bacteria 32119
1039 Ga0451577_0002326 3300042876 Bacteria 22924
1040 Ga0451577_0005061 3300042876 Bacteria 13611
1041 Ga0451577_0007075 3300042876 Bacteria 11069
1042 Ga0451577_0015048 3300042876 Bacteria 7197
1043 Ga0451577_0043694 3300042876 Bacteria 4014
1044 Ga0451577_0067492 3300042876 Bacteria 3190
1045 Ga0451577_0072334 3300042876 Bacteria 3076
1046 Ga0451577_0075812 3300042876 Bacteria 2999
1047 Ga0451577_0078930 3300042876 Bacteria 2934
1048 Ga0451577_0089244 3300042876 Bacteria 2751
1049 Ga0451577_0092909 3300042876 Bacteria 2694
1050 Ga0451577_0174959 3300042876 Bacteria 1934
1051 Ga0451577_0390124 3300042876 Bacteria 1264
1052 Ga0451577_0422420 3300042876 Bacteria 1211
1053 Ga0451577_0422892 3300042876 Bacteria 1210
1054 Ga0453683_0000001 3300044673 Bacteria 1384965
1055 Ga0453683_0000076 3300044673 Bacteria 149358
1056 Ga0453683_0000110 3300044673 Bacteria 123480
1057 Ga0453683_0000132 3300044673 Bacteria 108582
1058 Ga0453683_0000154 3300044673 Bacteria 101194
1059 Ga0453683_0000255 3300044673 Bacteria 70114
1060 Ga0453683_0000355 3300044673 Bacteria 55441
1061 Ga0453683_0002410 3300044673 Bacteria 14557
1062 Ga0453683_0004099 3300044673 Bacteria 10471
1063 Ga0453683_0008407 3300044673 Bacteria 6929
1064 Ga0453683_0010171 3300044673 Bacteria 6247
1065 Ga0453683_0016098 3300044673 Bacteria 4832
1066 Ga0453683_0113330 3300044673 Bacteria 1706
1067 Ga0453683_0114636 3300044673 Bacteria 1695
1068 Ga0453683_0136322 3300044673 Bacteria 1548
1069 Ga0453683_0187768 3300044673 Bacteria 1311
1070 Ga0466963_0106525 3300044694 Bacteria 1922
1071 Ga0453684_0000034 3300044712 Bacteria 728457
1072 Ga0453684_0000183 3300044712 Bacteria 277052
1073 Ga0453684_0000242 3300044712 Bacteria 234895
1074 Ga0453684_0000254 3300044712 Bacteria 229888
1075 Ga0453684_0000403 3300044712 Bacteria 178315
1076 Ga0453684_0002601 3300044712 Bacteria 43133
1077 Ga0453684_0004620 3300044712 Bacteria 28652
1078 Ga0453684_0006130 3300044712 Bacteria 23152
1079 Ga0453684_0008034 3300044712 Bacteria 19091
1080 Ga0453684_0008974 3300044712 Bacteria 17665
1081 Ga0453684_0009290 3300044712 Bacteria 17256
1082 Ga0453684_0013077 3300044712 Bacteria 13557
1083 Ga0453684_0020619 3300044712 Bacteria 9921
1084 Ga0453684_0021895 3300044712 Bacteria 9513
1085 Ga0453684_0026442 3300044712 Bacteria 8380
1086 Ga0453684_0060854 3300044712 Bacteria 4852
1087 Ga0453684_0076505 3300044712 Bacteria 4201
1088 Ga0453684_0101896 3300044712 Bacteria 3511
1089 Ga0453684_0108818 3300044712 Bacteria 3373
1090 Ga0453684_0137101 3300044712 Bacteria 2928
1091 Ga0453684_0181299 3300044712 Bacteria 2472
1092 Ga0453684_0182007 3300044712 Bacteria 2466
1093 Ga0453684_0303929 3300044712 Bacteria 1812
1094 Ga0453684_0335244 3300044712 Bacteria 1709
1095 Ga0453684_0349870 3300044712 Bacteria 1667
1096 Ga0453684_0381320 3300044712 Bacteria 1583
1097 Ga0453684_0390020 3300044712 Bacteria 1562
1098 Ga0453684_0437649 3300044712 Bacteria 1458
1099 Ga0453684_0454528 3300044712 Bacteria 1425
1100 Ga0453684_0552328 3300044712 Bacteria 1268
1101 Ga0466957_0114590 3300044842 Bacteria 1713
1102 Ga0451576_0000248 3300045051 Bacteria 132398
1103 Ga0451576_0000462 3300045051 Bacteria 91935
1104 Ga0451576_0000933 3300045051 Bacteria 55087
1105 Ga0451576_0003322 3300045051 Bacteria 22294
1106 Ga0451576_0005102 3300045051 Bacteria 16643
1107 Ga0451576_0005282 3300045051 Bacteria 16249
1108 Ga0451576_0006913 3300045051 Bacteria 13737
1109 Ga0451576_0008791 3300045051 Bacteria 11814
1110 Ga0451576_0014820 3300045051 Bacteria 8665
1111 Ga0451576_0056512 3300045051 Bacteria 4104
1112 Ga0451576_0076296 3300045051 Bacteria 3488
1113 Ga0451576_0088009 3300045051 Bacteria 3230
1114 Ga0451576_0105945 3300045051 Bacteria 2925
1115 Ga0451576_0118013 3300045051 Bacteria 2762
1116 Ga0451576_0135262 3300045051 Bacteria 2570
1117 Ga0451576_0159287 3300045051 Bacteria 2355
1118 Ga0451576_0210331 3300045051 Bacteria 2031
1119 Ga0451576_0214272 3300045051 Bacteria 2011
1120 Ga0451576_0216737 3300045051 Bacteria 1999
1121 Ga0451576_0404829 3300045051 Bacteria 1431
1122 Ga0451576_0413525 3300045051 Bacteria 1415
1123 Ga0466967_0082562 3300045976 Bacteria 2904
1124 Ga0466967_0128859 3300045976 Bacteria 2347
1125 Ga0495629_0013071 3300046459 Bacteria 5999
1126 Ga0495580_0000604 3300046472 Bacteria 30332
1127 Ga0495580_0062032 3300046472 Bacteria 2623
1128 Ga0495580_0134066 3300046472 Bacteria 1717
1129 Ga0495594_0030566 3300046499 Bacteria 2916
1130 Ga0495594_0055468 3300046499 Bacteria 2185
1131 Ga0495656_0000003 3300046615 Bacteria 338227
1132 Ga0495659_0022728 3300046664 Bacteria 2125
1133 Ga0495659_0027554 3300046664 Bacteria 1961
1134 Ga0495658_0170126 3300046683 Bacteria 1348
1135 Ga0495669_0004248 3300046684 Bacteria 5902
1136 Ga0495624_0045406 3300046690 Bacteria 2797
1137 Ga0495670_0029735 3300046691 Bacteria 2713
1138 Ga0495670_0106724 3300046691 Bacteria 1447
1139 Ga0495589_0050545 3300046794 Bacteria 2056
1140 Ga0495636_0023197 3300047318 Bacteria 2511
1141 Ga0495674_0242004 3300047319 Bacteria 1487
1142 Ga0495686_0007377 3300047472 Bacteria 8249
1143 Ga0495686_0038273 3300047472 Bacteria 3068
1144 Ga0496101_0149518 3300048904 Bacteria 1785
1145 Ga0496102_0007528 3300048905 Bacteria 9309
1146 Ga0496102_0076649 3300048905 Bacteria 3076
1147 Ga0496102_0152284 3300048905 Bacteria 2174
1148 Ga0496102_0172833 3300048905 Bacteria 2034
1149 Ga0496102_0272161 3300048905 Bacteria 1597
1150 Ga0496103_0315796 3300048906 Bacteria 1005
1151 Ga0496104_0075028 3300048907 Bacteria 3220
1152 Ga0496104_0149545 3300048907 Bacteria 2242
1153 Ga0496105_0122474 3300048908 Bacteria 2144
1154 Ga0496106_0041831 3300048909 Bacteria 3435
1155 Ga0496106_0152770 3300048909 Bacteria 1822
1156 Ga0496106_0193295 3300048909 Bacteria 1618
1157 Ga0496107_0044779 3300048910 Bacteria 3182
1158 Ga0496107_0070006 3300048910 Bacteria 2547
1159 Ga0496107_0123622 3300048910 Bacteria 1907
1160 Ga0496107_0208329 3300048910 Bacteria 1454
1161 Ga0496108_0022854 3300048911 Bacteria 5146
1162 Ga0496108_0125296 3300048911 Bacteria 2205
1163 Ga0496109_0031239 3300048912 Bacteria 4778
1164 Ga0496109_0065381 3300048912 Bacteria 3329
1165 Ga0496109_0275887 3300048912 Bacteria 1584
1166 Ga0496110_0026159 3300048913 Bacteria 4990
1167 Ga0496110_0276558 3300048913 Bacteria 1529
1168 Ga0496110_0308694 3300048913 Bacteria 1441
1169 Ga0496111_0098344 3300048914 Bacteria 2149
1170 Ga0496112_0031377 3300048915 Bacteria 5154
1171 Ga0496112_0034724 3300048915 Bacteria 4909
1172 Ga0496114_0002536 3300048917 Bacteria 13939
1173 Ga0496114_0028257 3300048917 Bacteria 4601
1174 Ga0496114_0093442 3300048917 Bacteria 2557
1175 Ga0496115_0152335 3300048918 Bacteria 1909
1176 Ga0496126_0013736 3300048929 Bacteria 8213
1177 Ga0501290_000073 3300049513 Bacteria 14087
1178 Ga0501291_000019 3300049514 Bacteria 22541
1179 Ga0501292_000081 3300049515 Bacteria 17519
1180 Ga0501293_000364 3300049516 Bacteria 3403
1181 Ga0501295_000011 3300049518 Bacteria 23617
1182 Ga0501296_000020 3300049519 Bacteria 19501
1183 Ga0501297_000006 3300049520 Bacteria 21954
1184 Ga0501298_000012 3300049521 Bacteria 19378
1185 Ga0501299_000055 3300049522 Bacteria 12273
1186 Ga0501300_000036 3300049523 Bacteria 19283
1187 Ga0501301_000035 3300049524 Bacteria 6117
1188 Ga0501302_000536 3300049525 Bacteria 2018
1189 Ga0501031_0002612 3300049568 Bacteria 11469
1190 Ga0501031_0013249 3300049568 Bacteria 5381
1191 Ga0501032_0011926 3300049569 Bacteria 6225
1192 Ga0501032_0031422 3300049569 Bacteria 3641
1193 Ga0501032_0064688 3300049569 Bacteria 2448
1194 Ga0501033_0074009 3300049570 Bacteria 2501
1195 Ga0501034_0000026 3300049571 Bacteria 261125
1196 Ga0501034_0000138 3300049571 Bacteria 136415
1197 Ga0501034_0003688 3300049571 Bacteria 17304
1198 Ga0501034_0020469 3300049571 Bacteria 6755
1199 Ga0501034_0023687 3300049571 Bacteria 6252
1200 Ga0501034_0060199 3300049571 Bacteria 3815
1201 Ga0501034_0301855 3300049571 Bacteria 1538
1202 Ga0501036_0011110 3300049572 Bacteria 7446
1203 Ga0501036_0042303 3300049572 Bacteria 3858
1204 Ga0501036_0129792 3300049572 Bacteria 2128
1205 Ga0501036_0148902 3300049572 Bacteria 1974
1206 Ga0501037_0022497 3300049573 Bacteria 4663
1207 Ga0501037_0053873 3300049573 Bacteria 2943
1208 Ga0501038_0001888 3300049574 Bacteria 19375
1209 Ga0501038_0020858 3300049574 Bacteria 5890
1210 Ga0501038_0077357 3300049574 Bacteria 2809
1211 Ga0501038_0088825 3300049574 Bacteria 2594
1212 Ga0501038_0097451 3300049574 Bacteria 2453
1213 Ga0501038_0212179 3300049574 Bacteria 1548
1214 Ga0501039_0002225 3300049575 Bacteria 14350
1215 Ga0501039_0003779 3300049575 Bacteria 11377
1216 Ga0501039_0023765 3300049575 Bacteria 4704
1217 Ga0501039_0025895 3300049575 Bacteria 4510
1218 Ga0501039_0026926 3300049575 Bacteria 4420
1219 Ga0501039_0072083 3300049575 Bacteria 2684
1220 Ga0501039_0094541 3300049575 Bacteria 2330
1221 Ga0501039_0332370 3300049575 Bacteria 1194
1222 Ga0501040_0031572 3300049576 Bacteria 3581
1223 Ga0501040_0049735 3300049576 Bacteria 2867
1224 Ga0501040_0063345 3300049576 Bacteria 2544
1225 Ga0501040_0167261 3300049576 Bacteria 1556
1226 Ga0501041_0005293 3300049577 Bacteria 7546
1227 Ga0501041_0006580 3300049577 Bacteria 6806
1228 Ga0501041_0024294 3300049577 Bacteria 3638
1229 Ga0501041_0024326 3300049577 Bacteria 3635
1230 Ga0501041_0043241 3300049577 Bacteria 2739
1231 Ga0501041_0085025 3300049577 Bacteria 1950
1232 Ga0501041_0126356 3300049577 Bacteria 1592
1233 Ga0501042_0001451 3300049578 Bacteria 13959
1234 Ga0501042_0005188 3300049578 Bacteria 8375
1235 Ga0501042_0035882 3300049578 Bacteria 3518
1236 Ga0501042_0036671 3300049578 Bacteria 3479
1237 Ga0501042_0047937 3300049578 Bacteria 3046
1238 Ga0501042_0069215 3300049578 Bacteria 2524
1239 Ga0501042_0102265 3300049578 Bacteria 2061
1240 Ga0501042_0160021 3300049578 Bacteria 1624
1241 Ga0501042_0187498 3300049578 Bacteria 1492
1242 Ga0501042_0196298 3300049578 Bacteria 1456
1243 Ga0501043_0024046 3300049579 Bacteria 4780
1244 Ga0501043_0048294 3300049579 Bacteria 3346
1245 Ga0501043_0073527 3300049579 Bacteria 2685
1246 Ga0501043_0151800 3300049579 Bacteria 1813
1247 Ga0501046_0001137 3300049580 Bacteria 25940
1248 Ga0501046_0001435 3300049580 Bacteria 22922
1249 Ga0501046_0003759 3300049580 Bacteria 13898
1250 Ga0501046_0010965 3300049580 Bacteria 7771
1251 Ga0501046_0021782 3300049580 Bacteria 5283
1252 Ga0501046_0091611 3300049580 Bacteria 2338
1253 Ga0501046_0109765 3300049580 Bacteria 2108
1254 Ga0501046_0144674 3300049580 Bacteria 1796
1255 Ga0501046_0283353 3300049580 Bacteria 1214
1256 Ga0501047_0000017 3300049581 Bacteria 276932
1257 Ga0501047_0005978 3300049581 Bacteria 11439
1258 Ga0501047_0017834 3300049581 Bacteria 6800
1259 Ga0501047_0025965 3300049581 Bacteria 5633
1260 Ga0501047_0149532 3300049581 Bacteria 2212
1261 Ga0501048_0001028 3300049582 Bacteria 20869
1262 Ga0501048_0002502 3300049582 Bacteria 14031
1263 Ga0501048_0007983 3300049582 Bacteria 8014
1264 Ga0501048_0017207 3300049582 Bacteria 5327
1265 Ga0501048_0055705 3300049582 Bacteria 2806
1266 Ga0501067_0000161 3300049583 Bacteria 37831
1267 Ga0501067_0010270 3300049583 Bacteria 5180
1268 Ga0501067_0013654 3300049583 Bacteria 4497
1269 Ga0501067_0083172 3300049583 Bacteria 1775
1270 Ga0501067_0088826 3300049583 Bacteria 1715
1271 Ga0501068_0001274 3300049584 Bacteria 13365
1272 Ga0501068_0011556 3300049584 Bacteria 4986
1273 Ga0501068_0036821 3300049584 Bacteria 2928
1274 Ga0501068_0042474 3300049584 Bacteria 2734
1275 Ga0501068_0053580 3300049584 Bacteria 2443
1276 Ga0501068_0115567 3300049584 Bacteria 1671
1277 Ga0501069_0002016 3300049585 Bacteria 10176
1278 Ga0501069_0036661 3300049585 Bacteria 2705
1279 Ga0501069_0085388 3300049585 Bacteria 1781
1280 Ga0501069_0119025 3300049585 Bacteria 1508
1281 Ga0501070_0003690 3300049586 Bacteria 13236
1282 Ga0501070_0080753 3300049586 Bacteria 2690
1283 Ga0501071_0049057 3300049587 Bacteria 3038
1284 Ga0501071_0059912 3300049587 Bacteria 2755
1285 Ga0501071_0062547 3300049587 Bacteria 2697
1286 Ga0501071_0138205 3300049587 Bacteria 1814
1287 Ga0501071_0324603 3300049587 Bacteria 1169
1288 Ga0501072_0000033 3300049588 Bacteria 125387
1289 Ga0501072_0000151 3300049588 Bacteria 51318
1290 Ga0501072_0005161 3300049588 Bacteria 9935
1291 Ga0501072_0042698 3300049588 Bacteria 3562
1292 Ga0501072_0093308 3300049588 Bacteria 2391
1293 Ga0501072_0098073 3300049588 Bacteria 2329
1294 Ga0501073_0000682 3300049589 Bacteria 23895
1295 Ga0501073_0002534 3300049589 Bacteria 13654
1296 Ga0501073_0005271 3300049589 Bacteria 9697
1297 Ga0501073_0124014 3300049589 Bacteria 1790
1298 Ga0501074_0000360 3300049590 Bacteria 26745
1299 Ga0501074_0000711 3300049590 Bacteria 20839
1300 Ga0501074_0010416 3300049590 Bacteria 6747
1301 Ga0501074_0012245 3300049590 Bacteria 6236
1302 Ga0501074_0061228 3300049590 Bacteria 2712
1303 Ga0501074_0131074 3300049590 Bacteria 1793
1304 Ga0501074_0183423 3300049590 Bacteria 1493
1305 Ga0501075_0005994 3300049591 Bacteria 8325
1306 Ga0501075_0008958 3300049591 Bacteria 6983
1307 Ga0501075_0026987 3300049591 Bacteria 4231
1308 Ga0501075_0045051 3300049591 Bacteria 3310
1309 Ga0501075_0057859 3300049591 Bacteria 2919
1310 Ga0501075_0069843 3300049591 Bacteria 2654
1311 Ga0501075_0145727 3300049591 Bacteria 1805
1312 Ga0501076_0012127 3300049592 Bacteria 6444
1313 Ga0501076_0022969 3300049592 Bacteria 4800
1314 Ga0501076_0025819 3300049592 Bacteria 4548
1315 Ga0501076_0026863 3300049592 Bacteria 4462
1316 Ga0501076_0049430 3300049592 Bacteria 3326
1317 Ga0501076_0058755 3300049592 Bacteria 3057
1318 Ga0501076_0098120 3300049592 Bacteria 2360
1319 Ga0501076_0155286 3300049592 Bacteria 1862
1320 Ga0501076_0167626 3300049592 Bacteria 1790
1321 Ga0501077_0002036 3300049593 Bacteria 12192
1322 Ga0501077_0022122 3300049593 Bacteria 4026
1323 Ga0501077_0096659 3300049593 Bacteria 1872
1324 Ga0501077_0109888 3300049593 Bacteria 1747
1325 Ga0501199_000074 3300049650 Bacteria 6873
1326 Ga0501201_000136 3300049651 Bacteria 6144
1327 Ga0501202_000450 3300049652 Bacteria 5822
1328 Ga0501206_000101 3300049653 Bacteria 8964
1329 Ga0501207_004072 3300049654 Bacteria 1975
1330 Ga0501211_002470 3300049658 Bacteria 1951
1331 Ga0501216_000012 3300049660 Bacteria 18602
1332 Ga0501217_000078 3300049661 Bacteria 11882
1333 Ga0501228_001757 3300049666 Bacteria 1628
1334 Ga0501233_000046 3300049668 Bacteria 16450
1335 Ga0501235_001026 3300049669 Bacteria 5823
1336 Ga0501236_000099 3300049670 Bacteria 8133
1337 Ga0501239_000961 3300049672 Bacteria 2366
1338 Ga0501243_000230 3300049675 Bacteria 6958
1339 Ga0501243_008507 3300049675 Unclassified 1583
1340 Ga0501246_000223 3300049676 Bacteria 3790
1341 Ga0501248_000415 3300049678 Bacteria 2274
1342 Ga0501249_000187 3300049679 Bacteria 18921
1343 Ga0501251_000333 3300049681 Bacteria 4153
1344 Ga0501252_002390 3300049682 Bacteria 1860
1345 Ga0501253_001835 3300049683 Bacteria 2268
1346 Ga0501257_000193 3300049686 Bacteria 12269
1347 Ga0501259_010090 3300049688 Bacteria 1540
1348 Ga0501260_000182 3300049689 Bacteria 4815
1349 Ga0501261_000123 3300049690 Bacteria 11578
1350 Ga0501219_001002 3300049703 Bacteria 3332
1351 Ga0501221_000143 3300049704 Bacteria 9387
1352 Ga0501225_0000158 3300049705 Bacteria 20689
1353 Ga0501229_000031 3300049706 Bacteria 15324
1354 Ga0501245_002934 3300049708 Bacteria 2297
1355 Ga0501079_0000607 3300049741 Bacteria 23742
1356 Ga0501079_0002462 3300049741 Bacteria 13444
1357 Ga0501079_0003858 3300049741 Bacteria 11060
1358 Ga0501079_0009206 3300049741 Bacteria 7480
1359 Ga0501079_0024433 3300049741 Bacteria 4636
1360 Ga0501079_0030639 3300049741 Bacteria 4134
1361 Ga0501079_0058496 3300049741 Bacteria 2974
1362 Ga0501079_0060318 3300049741 Bacteria 2926
1363 Ga0501079_0068365 3300049741 Bacteria 2742
1364 Ga0501079_0072674 3300049741 Bacteria 2658
1365 Ga0501080_0003185 3300049742 Bacteria 14470
1366 Ga0501080_0021065 3300049742 Bacteria 6034
1367 Ga0501080_0029621 3300049742 Bacteria 5096
1368 Ga0501080_0039338 3300049742 Bacteria 4414
1369 Ga0501080_0052991 3300049742 Bacteria 3776
1370 Ga0501080_0059658 3300049742 Bacteria 3550
1371 Ga0501080_0326591 3300049742 Bacteria 1388
1372 Ga0501080_0428642 3300049742 Bacteria 1187
1373 Ga0501081_0009676 3300049743 Bacteria 6284
1374 Ga0501081_0011656 3300049743 Bacteria 5755
1375 Ga0501081_0015292 3300049743 Bacteria 5062
1376 Ga0501081_0018690 3300049743 Bacteria 4605
1377 Ga0501081_0045969 3300049743 Bacteria 2999
1378 Ga0501081_0056422 3300049743 Bacteria 2714
1379 Ga0501081_0184335 3300049743 Bacteria 1510
1380 Ga0501083_0000658 3300049744 Bacteria 22385
1381 Ga0501083_0002181 3300049744 Bacteria 13386
1382 Ga0501083_0003816 3300049744 Bacteria 10586
1383 Ga0501083_0011866 3300049744 Bacteria 6106
1384 Ga0501264_000443 3300049761 Bacteria 6350
1385 Ga0501266_000291 3300049763 Bacteria 6615
1386 Ga0501269_004838 3300049766 Bacteria 1620
1387 Ga0501270_000074 3300049767 Bacteria 7674
1388 Ga0501271_000663 3300049768 Bacteria 2941
1389 Ga0501272_000018 3300049769 Bacteria 10634
1390 Ga0501273_000020 3300049770 Bacteria 10969
1391 Ga0501274_000033 3300049771 Bacteria 8313
1392 Ga0501278_000080 3300049774 Bacteria 6606
1393 Ga0501279_000078 3300049775 Bacteria 16453
1394 Ga0501280_001276 3300049776 Bacteria 4857
1395 Ga0501281_00326 3300049777 Bacteria 4888
1396 Ga0501282_000411 3300049778 Bacteria 5112
1397 Ga0501283_000015 3300049779 Bacteria 21880
1398 Ga0501035_0002674 3300049822 Bacteria 17341
1399 Ga0501035_0036272 3300049822 Bacteria 4470
1400 Ga0501035_0094255 3300049822 Bacteria 2633
1401 Ga0501035_0121164 3300049822 Bacteria 2286
1402 Ga0501035_0153133 3300049822 Bacteria 2000
1403 Ga0501035_0158569 3300049822 Bacteria 1960
1404 Ga0501044_0000286 3300049823 Bacteria 64389
1405 Ga0501044_0028651 3300049823 Bacteria 5877
1406 Ga0501044_0104251 3300049823 Bacteria 2850
1407 Ga0501044_0136559 3300049823 Bacteria 2443
1408 Ga0501045_0000228 3300049824 Bacteria 32513
1409 Ga0501045_0027365 3300049824 Bacteria 4108
1410 Ga0501045_0036968 3300049824 Bacteria 3548
1411 Ga0501045_0149239 3300049824 Bacteria 1739
1412 Ga0501212_000346 3300049851 Bacteria 4359
1413 nmdc:mga03683_1943_c1 3300050489 Bacteria 6319
1414 nmdc:mga03683_3057_c1 3300050489 Bacteria 5313
1415 nmdc:mga03683_47320_c1 3300050489 Bacteria 1784
1416 nmdc:mga03683_72395_c1 3300050489 Bacteria 1476
1417 nmdc:mga03683_8533_c2 3300050489 Bacteria 2602
1418 nmdc:mga03n38_18580_c1 3300050490 Bacteria 2747
1419 nmdc:mga0k408_12630_c1 3300050493 Bacteria 4616
1420 nmdc:mga06z11_82391_c1 3300050494 Bacteria 1729
1421 nmdc:mga04h51_42048_c1 3300050495 Bacteria 1496
1422 nmdc:mga07m45_2368_c1 3300050496 Bacteria 2869
1423 nmdc:mga05p37_10465_c1 3300050507 Bacteria 11008
1424 nmdc:mga05p37_115006_c1 3300050507 Bacteria 3307
1425 nmdc:mga05p37_13868_c1 3300050507 Bacteria 9657
1426 nmdc:mga05p37_156768_c1 3300050507 Bacteria 2782
1427 nmdc:mga05p37_1693_c1 3300050507 Bacteria 25677
1428 nmdc:mga05p37_1952_c1 3300050507 Bacteria 24046
1429 nmdc:mga05p37_207882_c1 3300050507 Bacteria 2367
1430 nmdc:mga05p37_2315_c1 3300050507 Bacteria 22184
1431 nmdc:mga05p37_248738_c1 3300050507 Bacteria 2133
1432 nmdc:mga05p37_3059_c2 3300050507 Bacteria 13615
1433 nmdc:mga05p37_374141_c1 3300050507 Bacteria 1671
1434 nmdc:mga05p37_38019_c1 3300050507 Bacteria 5903
1435 nmdc:mga05p37_393266_c1 3300050507 Bacteria 1621
1436 nmdc:mga05p37_418646_c1 3300050507 Bacteria 1560
1437 nmdc:mga05p37_42321_c1 3300050507 Bacteria 5596
1438 nmdc:mga05p37_58690_c1 3300050507 Bacteria 4739
1439 nmdc:mga05p37_6210_c1 3300050507 Bacteria 14071
1440 nmdc:mga05p37_67747_c1 3300050507 Bacteria 4391
1441 nmdc:mga05p37_7013_c1 3300050507 Bacteria 13281
1442 nmdc:mga05p37_86550_c1 3300050507 Bacteria 3227
1443 nmdc:mga05p37_9045_c1 3300050507 Bacteria 11776
1444 nmdc:mga09592_13935_c1 3300050508 Bacteria 6566
1445 nmdc:mga09592_14121_c1 3300050508 Bacteria 6519
1446 nmdc:mga09592_1654_c1 3300050508 Bacteria 17927
1447 nmdc:mga09592_26125_c1 3300050508 Bacteria 4836
1448 nmdc:mga09592_286882_c1 3300050508 Bacteria 1427
1449 nmdc:mga09592_30515_c1 3300050508 Bacteria 4486
1450 nmdc:mga09592_56668_c1 3300050508 Bacteria 3311
1451 nmdc:mga09592_6449_c1 3300050508 Bacteria 9557
1452 nmdc:mga09592_6819_c1 3300050508 Bacteria 9294
1453 nmdc:mga09592_69096_c1 3300050508 Bacteria 2997
1454 nmdc:mga09592_77104_c1 3300050508 Bacteria 2835
1455 nmdc:mga09592_78395_c2 3300050508 Bacteria 1882
1456 nmdc:mga09592_9752_c1 3300050508 Bacteria 7803
1457 nmdc:mga0qj67_12218_c1 3300050509 Bacteria 6464
1458 nmdc:mga0qj67_127_c1 3300050509 Bacteria 50287
1459 nmdc:mga0qj67_1289_c1 3300050509 Bacteria 17564
1460 nmdc:mga0qj67_168384_c1 3300050509 Bacteria 1779
1461 nmdc:mga0qj67_252557_c1 3300050509 Bacteria 1431
1462 nmdc:mga0qj67_4400_c1 3300050509 Bacteria 10201
1463 nmdc:mga0qj67_62775_c1 3300050509 Bacteria 2953
1464 nmdc:mga0qj67_8153_c1 3300050509 Bacteria 7760
1465 nmdc:mga0qj67_84748_c1 3300050509 Bacteria 2541
1466 nmdc:mga06r32_192601_c1 3300050510 Bacteria 2026
1467 nmdc:mga06r32_202032_c1 3300050510 Bacteria 1975
1468 nmdc:mga06r32_20824_c1 3300050510 Bacteria 6043
1469 nmdc:mga06r32_21770_c1 3300050510 Bacteria 3374
1470 nmdc:mga06r32_2863_c1 3300050510 Bacteria 15485
1471 nmdc:mga06r32_321317_c1 3300050510 Bacteria 1533
1472 nmdc:mga06r32_334_c1 3300050510 Bacteria 39182
1473 nmdc:mga06r32_38218_c1 3300050510 Bacteria 4546
1474 nmdc:mga06r32_39383_c1 3300050510 Bacteria 4483
1475 nmdc:mga06r32_48344_c1 3300050510 Bacteria 4065
1476 nmdc:mga06r32_67571_c1 3300050510 Bacteria 3451
1477 nmdc:mga08y16_1215_c1 3300050511 Bacteria 25486
1478 nmdc:mga08y16_128_c1 3300050511 Bacteria 65601
1479 nmdc:mga08y16_13554_c1 3300050511 Bacteria 8580
1480 nmdc:mga08y16_24503_c1 3300050511 Bacteria 6368
1481 nmdc:mga08y16_28104_c1 3300050511 Bacteria 5930
1482 nmdc:mga08y16_31776_c1 3300050511 Bacteria 5551
1483 nmdc:mga08y16_3543_c1 3300050511 Bacteria 16210
1484 nmdc:mga08y16_48420_c1 3300050511 Bacteria 4448
1485 nmdc:mga08y16_88440_c1 3300050511 Bacteria 3228
1486 nmdc:mga0n895_101801_c1 3300050512 Bacteria 2883
1487 nmdc:mga0n895_18895_c1 3300050512 Bacteria 6391
1488 nmdc:mga0n895_215170_c1 3300050512 Bacteria 1951
1489 nmdc:mga0n895_2185_c1 3300050512 Bacteria 15125
1490 nmdc:mga0n895_25617_c1 3300050512 Bacteria 5575
1491 nmdc:mga0n895_27307_c1 3300050512 Bacteria 5421
1492 nmdc:mga0n895_324037_c1 3300050512 Bacteria 1561
1493 nmdc:mga0n895_37542_c1 3300050512 Bacteria 4687
1494 nmdc:mga0n895_4597_c1 3300050512 Bacteria 11371
1495 nmdc:mga0n895_513_c1 3300050512 Bacteria 17604
1496 nmdc:mga0n895_67663_c1 3300050512 Bacteria 3538
1497 nmdc:mga0rr50_124729_c1 3300050513 Bacteria 2054
1498 nmdc:mga0rr50_1639_c1 3300050513 Bacteria 12322
1499 nmdc:mga0rr50_19019_c1 3300050513 Bacteria 4626
1500 nmdc:mga0rr50_22117_c1 3300050513 Bacteria 4357
1501 nmdc:mga0rr50_247211_c1 3300050513 Bacteria 1480
1502 nmdc:mga0rr50_30495_c1 3300050513 Bacteria 3819
1503 nmdc:mga0rr50_37577_c1 3300050513 Bacteria 3497
1504 nmdc:mga0rr50_43348_c1 3300050513 Bacteria 3292
1505 nmdc:mga0rr50_44319_c1 3300050513 Bacteria 3262
1506 nmdc:mga0rr50_516_c1 3300050513 Bacteria 20650
1507 nmdc:mga0rr50_9725_c1 3300050513 Bacteria 6065
1508 nmdc:mga08x19_107854_c1 3300050514 Bacteria 1854
1509 nmdc:mga08x19_1656_c1 3300050514 Bacteria 13744
1510 nmdc:mga08x19_235742_c1 3300050514 Bacteria 1260
1511 nmdc:mga08x19_36554_c1 3300050514 Bacteria 3111
1512 nmdc:mga08x19_52576_c1 3300050514 Bacteria 2620
1513 nmdc:mga08x19_7634_c1 3300050514 Bacteria 6425
1514 nmdc:mga08x19_90404_c1 3300050514 Bacteria 2020
1515 nmdc:mga0a205_101447_c1 3300050515 Bacteria 2777
1516 nmdc:mga0a205_10766_c1 3300050515 Bacteria 8410
1517 nmdc:mga0a205_116585_c1 3300050515 Bacteria 2569
1518 nmdc:mga0a205_1638_c1 3300050515 Bacteria 19222
1519 nmdc:mga0a205_218413_c1 3300050515 Bacteria 1793
1520 nmdc:mga0a205_230184_c1 3300050515 Bacteria 1737
1521 nmdc:mga0a205_2344_c1 3300050515 Bacteria 16708
1522 nmdc:mga0a205_2627_c1 3300050515 Bacteria 15874
1523 nmdc:mga0a205_26998_c1 3300050515 Bacteria 5482
1524 nmdc:mga0a205_30820_c1 3300050515 Bacteria 5137
1525 nmdc:mga0a205_392185_c1 3300050515 Bacteria 1253
1526 nmdc:mga0a205_434318_c1 3300050515 Bacteria 1174
1527 nmdc:mga0a205_434558_c1 3300050515 Bacteria 1174
1528 nmdc:mga0a205_66246_c1 3300050515 Bacteria 3490
1529 nmdc:mga0a205_71444_c1 3300050515 Bacteria 3352
1530 nmdc:mga0a205_72737_c1 3300050515 Bacteria 3321
1531 nmdc:mga0a205_9316_c1 3300050515 Bacteria 8967
1532 nmdc:mga0sz30_30003_c2 3300050516 Bacteria 1353
1533 Ga0495601_0028361 3300053077 Bacteria 3468
1534 Ga0500635_0065829 3300053080 Bacteria 1275
1535 Ga0500643_014061 3300053087 Unclassified 2798
1536 Ga0500644_0003290 3300053088 Bacteria 3995
1537 Ga0500641_0002170 3300053096 Bacteria 6958
1538 Ga0500650_0060750 3300053098 Bacteria 1765
1539 Ga0500555_017352 3300053103 Bacteria 2075
1540 Ga0500642_0034057 3300053130 Bacteria 2152
1541 Ga0500616_0003158 3300053153 Bacteria 12854
1542 Ga0500552_000071 3300053733 Bacteria 8202
1543 Ga0501084_0000003 3300054114 Bacteria 267909
1544 Ga0501084_0000172 3300054114 Bacteria 50211
1545 Ga0501084_0000281 3300054114 Bacteria 38468
1546 Ga0501084_0002669 3300054114 Bacteria 14353
1547 Ga0501084_0004324 3300054114 Bacteria 11576
1548 Ga0501084_0020536 3300054114 Bacteria 5509
1549 Ga0501084_0024166 3300054114 Bacteria 5068
1550 Ga0501084_0029219 3300054114 Bacteria 4611
1551 Ga0501084_0049598 3300054114 Bacteria 3514
1552 Ga0501084_0053140 3300054114 Bacteria 3389
1553 Ga0501084_0087705 3300054114 Bacteria 2612
1554 Ga0590071_009929 3300059421 Bacteria 2232
1555 Ga0590075_005828 3300059424 Bacteria 2912
1556 Ga0501082_0000042 3300060353 Bacteria 89973
1557 Ga0501082_0000359 3300060353 Bacteria 40225
1558 Ga0501082_0018850 3300060353 Bacteria 5945
1559 Ga0501082_0039533 3300060353 Bacteria 4069
1560 Ga0501082_0111483 3300060353 Bacteria 2368
1561 Ga0501082_0238216 3300060353 Bacteria 1583
1562 Ga0530510_0004754 3300061734 Bacteria 9405
1563 Ga0530510_0013719 3300061734 Bacteria 5704
1564 Ga0530510_0019295 3300061734 Bacteria 4839
1565 Ga0530510_0019501 3300061734 Bacteria 4814
1566 Ga0530510_0028583 3300061734 Bacteria 3999
1567 Ga0530510_0028964 3300061734 Bacteria 3972
1568 Ga0530510_0029526 3300061734 Bacteria 3936
1569 Ga0530510_0105047 3300061734 Bacteria 2067
1570 Ga0530510_0181325 3300061734 Bacteria 1562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10057876 Ga0207648_100578762 280
2 3300049587 Ga0501071_0324603 Ga0501071_0324603_47_907 283
3 3300035398 Ga0316574_0002631 Ga0316574_0002631_3666_4595 294
4 3300036647 Ga0316582_0004517 Ga0316582_0004517_920_1849 294
5 3300036712 Ga0316584_0057534 Ga0316584_0057534_696_1625 294
6 3300038726 Ga0400490_32774 Ga0400490_32774_2454_3383 294
7 3300026116 Ga0207674_10158794 Ga0207674_101587942 297
8 3300042876 Ga0451577_0422892 Ga0451577_0422892_155_1144 301
9 3300006846 Ga0075430_100041273 Ga0075430_1000412731 303
10 3300006846 Ga0075430_100139045 Ga0075430_1001390452 303
11 3300031901 Ga0307406_10089849 Ga0307406_100898492 303
12 3300031995 Ga0307409_100110516 Ga0307409_1001105162 303
13 3300032002 Ga0307416_100019537 Ga0307416_1000195373 303
14 3300041411 Ga0439466_0051774 Ga0439466_0051774_279_1274 303
15 3300031548 Ga0307408_100027981 Ga0307408_1000279812 305
16 3300031731 Ga0307405_10114780 Ga0307405_101147801 305
17 3300031824 Ga0307413_10010101 Ga0307413_100101012 305
18 3300031852 Ga0307410_10001718 Ga0307410_100017184 305
19 3300031903 Ga0307407_10013864 Ga0307407_100138643 305
20 3300031995 Ga0307409_100001073 Ga0307409_1000010736 305
21 3300032002 Ga0307416_100000367 Ga0307416_10000036718 305
22 3300032004 Ga0307414_10003836 Ga0307414_100038363 305
23 3300042436 Ga0439435_0020982 Ga0439435_0020982_24_953 307
24 3300050512 nmdc:mga0n895_25617_c1 nmdc:mga0n895_25617_c1_4621_5550 307
25 3300037418 Ga0395900_0600690 Ga0395900_0600690_27_959 308
26 3300038735 Ga0400485_20517 Ga0400485_20517_32867_33796 308
27 3300038741 Ga0400488_18032 Ga0400488_18032_833_1762 308
28 3300038742 Ga0400486_04466 Ga0400486_04466_11905_12834 308
29 3300039110 Ga0400487_65568 Ga0400487_65568_5304_6233 308
30 3300044712 Ga0453684_0137101 Ga0453684_0137101_1526_2455 308
31 3300036647 Ga0316582_0004972 Ga0316582_0004972_175_1125 315
32 3300011119 Ga0105246_10115615 Ga0105246_101156152 319
33 3300026075 Ga0207708_10267335 Ga0207708_102673352 319
34 3300048906 Ga0496103_0315796 Ga0496103_0315796_20_994 324
35 3300048915 Ga0496112_0034724 Ga0496112_0034724_1968_2954 324
36 3300050510 nmdc:mga06r32_48344_c1 nmdc:mga06r32_48344_c1_127_1209 324
37 3300042876 Ga0451577_0072334 Ga0451577_0072334_977_2053 325
38 3300044673 Ga0453683_0000076 Ga0453683_0000076_65702_66778 327
39 3300044673 Ga0453683_0000255 Ga0453683_0000255_55788_56771 327
40 3300044712 Ga0453684_0004620 Ga0453684_0004620_11901_12977 327
41 3300045051 Ga0451576_0000248 Ga0451576_0000248_98661_99737 327
42 3300053087 Ga0500643_014061 Ga0500643_014061_881_1906 327
43 3300005546 Ga0070696_100198650 Ga0070696_1001986502 328
44 3300009553 Ga0105249_10282786 Ga0105249_102827861 328
45 3300042876 Ga0451577_0000055 Ga0451577_0000055_193035_194111 328
46 3300044712 Ga0453684_0000183 Ga0453684_0000183_83056_84132 328
47 3300014968 Ga0157379_10000523 Ga0157379_1000052319 329
48 3300031824 Ga0307413_10063160 Ga0307413_100631602 329
49 3300045051 Ga0451576_0159287 Ga0451576_0159287_425_1501 329
50 3300049571 Ga0501034_0000138 Ga0501034_0000138_81943_83019 329
51 3300049574 Ga0501038_0077357 Ga0501038_0077357_1077_2153 329
52 3300050509 nmdc:mga0qj67_62775_c1 nmdc:mga0qj67_62775_c1_1767_2843 329
53 3300005327 Ga0070658_10063301 Ga0070658_100633013 330
54 3300005471 Ga0070698_100123030 Ga0070698_1001230302 330
55 3300005530 Ga0070679_100008403 Ga0070679_1000084035 330
56 3300042876 Ga0451577_0390124 Ga0451577_0390124_24_1106 330
57 3300046499 Ga0495594_0055468 Ga0495594_0055468_1163_2161 330
58 3300049575 Ga0501039_0094541 Ga0501039_0094541_1291_2289 330
59 3300049575 Ga0501039_0332370 Ga0501039_0332370_30_1031 330
60 3300050514 nmdc:mga08x19_235742_c1 nmdc:mga08x19_235742_c1_189_1211 330
61 3300050515 nmdc:mga0a205_434558_c1 nmdc:mga0a205_434558_c1_22_1020 330
62 3300005467 Ga0070706_100028077 Ga0070706_1000280774 331
63 3300025910 Ga0207684_10056350 Ga0207684_100563502 331
64 3300025922 Ga0207646_10306357 Ga0207646_103063572 331
65 3300038443 Ga0395901_0613905 Ga0395901_0613905_65_1066 331
66 3300049675 Ga0501243_008507 Ga0501243_008507_373_1449 331
67 3300026089 Ga0207648_10215327 Ga0207648_102153272 332
68 3300035691 Ga0373931_0010872 Ga0373931_0010872_3354_4355 333
69 3300036647 Ga0316582_0003926 Ga0316582_0003926_4331_5401 334
70 3300005719 Ga0068861_100022575 Ga0068861_1000225752 335
71 3300026118 Ga0207675_100195484 Ga0207675_1001954842 335
72 3300031901 Ga0307406_10013012 Ga0307406_100130122 335
73 3300036647 Ga0316582_0025174 Ga0316582_0025174_1741_2790 335
74 3300039062 Ga0400483_016424 Ga0400483_016424_4813_5919 335
75 3300039062 Ga0400483_162550 Ga0400483_162550_586_1692 335
76 3300047472 Ga0495686_0007377 Ga0495686_0007377_2983_4116 335
77 3300005337 Ga0070682_100005218 Ga0070682_1000052185 336
78 3300005337 Ga0070682_100002300 Ga0070682_1000023004 337
79 3300028577 Ga0265318_10000027 Ga0265318_1000002729 337
80 3300031235 Ga0265330_10000036 Ga0265330_1000003677 337
81 3300031238 Ga0265332_10001625 Ga0265332_100016254 337
82 3300031239 Ga0265328_10000909 Ga0265328_100009097 337
83 3300031240 Ga0265320_10000018 Ga0265320_10000018134 337
84 3300031242 Ga0265329_10003724 Ga0265329_100037243 337
85 3300031250 Ga0265331_10000046 Ga0265331_10000046133 337
86 3300031595 Ga0265313_10000075 Ga0265313_1000007529 337
87 3300031711 Ga0265314_10000137 Ga0265314_1000013729 337
88 3300031712 Ga0265342_10002987 Ga0265342_100029879 337
89 3300048913 Ga0496110_0308694 Ga0496110_0308694_14_1060 337
90 3300049583 Ga0501067_0010270 Ga0501067_0010270_719_1831 337
91 3300038742 Ga0400486_13683 Ga0400486_13683_13031_14110 338
92 3300038742 Ga0400486_22390 Ga0400486_22390_12175_13254 338
93 3300042876 Ga0451577_0002326 Ga0451577_0002326_3770_4846 338
94 3300044712 Ga0453684_0060854 Ga0453684_0060854_1995_3071 338
95 3300039062 Ga0400483_072467 Ga0400483_072467_649_1731 339
96 3300042876 Ga0451577_0043694 Ga0451577_0043694_2833_3909 339
97 3300042876 Ga0451577_0075812 Ga0451577_0075812_1851_2927 339
98 3300042876 Ga0451577_0422420 Ga0451577_0422420_44_1120 339
99 3300044673 Ga0453683_0000001 Ga0453683_0000001_55634_56710 339
100 3300044712 Ga0453684_0000242 Ga0453684_0000242_76950_78026 339
101 3300044712 Ga0453684_0006130 Ga0453684_0006130_5824_6900 339
102 3300044712 Ga0453684_0182007 Ga0453684_0182007_535_1611 339
103 3300045051 Ga0451576_0005282 Ga0451576_0005282_8449_9525 339
104 3300045051 Ga0451576_0006913 Ga0451576_0006913_1177_2253 339
105 3300031727 Ga0316576_10028127 Ga0316576_100281272 340
106 3300031728 Ga0316578_10026780 Ga0316578_100267802 340
107 3300036712 Ga0316584_0047592 Ga0316584_0047592_964_2043 340
108 3300044712 Ga0453684_0335244 Ga0453684_0335244_332_1408 340
109 3300044712 Ga0453684_0390020 Ga0453684_0390020_17_1048 340
110 3300046615 Ga0495656_0000003 Ga0495656_0000003_187258_188292 340
111 3300044673 Ga0453683_0004099 Ga0453683_0004099_5266_6342 341
112 3300049573 Ga0501037_0053873 Ga0501037_0053873_23_1048 341
113 3300005530 Ga0070679_100045681 Ga0070679_1000456813 342
114 3300031727 Ga0316576_10307305 Ga0316576_103073051 342
115 3300036647 Ga0316582_0094459 Ga0316582_0094459_765_1844 342
116 3300039062 Ga0400483_022887 Ga0400483_022887_1634_2713 342
117 3300044673 Ga0453683_0000132 Ga0453683_0000132_77485_78561 342
118 3300031665 Ga0316575_10025480 Ga0316575_100254802 343
119 3300031691 Ga0316579_10001478 Ga0316579_100014785 343
120 3300031691 Ga0316579_10003415 Ga0316579_100034154 343
121 3300031691 Ga0316579_10009552 Ga0316579_100095523 343
122 3300031727 Ga0316576_10001636 Ga0316576_100016362 343
123 3300031727 Ga0316576_10005318 Ga0316576_100053185 343
124 3300031728 Ga0316578_10001635 Ga0316578_100016354 343
125 3300031728 Ga0316578_10007028 Ga0316578_100070282 343
126 3300031728 Ga0316578_10017085 Ga0316578_100170851 343
127 3300031728 Ga0316578_10030928 Ga0316578_100309281 343
128 3300031733 Ga0316577_10088380 Ga0316577_100883801 343
129 3300032133 Ga0316583_10001322 Ga0316583_100013227 343
130 3300032137 Ga0316585_10000212 Ga0316585_1000021211 343
131 3300032137 Ga0316585_10000276 Ga0316585_100002768 343
132 3300032139 Ga0316580_10004268 Ga0316580_100042683 343
133 3300032139 Ga0316580_10006874 Ga0316580_100068743 343
134 3300035398 Ga0316574_0081320 Ga0316574_0081320_952_2031 343
135 3300036712 Ga0316584_0030945 Ga0316584_0030945_952_2031 343
136 3300038726 Ga0400490_41208 Ga0400490_41208_24287_25366 343
137 3300031727 Ga0316576_10009931 Ga0316576_100099312 344
138 3300005937 Ga0081455_10096654 Ga0081455_100966542 345
139 3300031995 Ga0307409_100105064 Ga0307409_1001050642 345
140 3300032004 Ga0307414_10348727 Ga0307414_103487272 345
141 3300035692 Ga0373935_0097496 Ga0373935_0097496_674_1765 345
142 3300005563 Ga0068855_100049389 Ga0068855_1000493892 346
143 3300009093 Ga0105240_10001929 Ga0105240_100019293 346
144 3300009545 Ga0105237_10000139 Ga0105237_1000013911 346
145 3300009545 Ga0105237_10140440 Ga0105237_101404402 346
146 3300010375 Ga0105239_10179584 Ga0105239_101795842 346
147 3300013306 Ga0163162_10200124 Ga0163162_102001242 346
148 3300025909 Ga0207705_10007157 Ga0207705_100071573 346
149 3300025912 Ga0207707_10081674 Ga0207707_100816743 346
150 3300025913 Ga0207695_10011470 Ga0207695_100114703 346
151 3300025914 Ga0207671_10000120 Ga0207671_1000012012 346
152 3300025914 Ga0207671_10147990 Ga0207671_101479902 346
153 3300025921 Ga0207652_10045109 Ga0207652_100451093 346
154 3300031727 Ga0316576_10128671 Ga0316576_101286713 346
155 3300035398 Ga0316574_0004793 Ga0316574_0004793_1035_2114 346
156 3300038741 Ga0400488_54927 Ga0400488_54927_37_1116 346
157 3300039093 Ga0400489_01372 Ga0400489_01372_23816_24967 346
158 3300039110 Ga0400487_12749 Ga0400487_12749_89_1168 346
159 3300039438 Ga0436360_0039635 Ga0436360_0039635_524_1579 346
160 3300039447 Ga0436361_0475510 Ga0436361_0475510_547_1602 346
161 3300044842 Ga0466957_0114590 Ga0466957_0114590_578_1690 346
162 3300006195 Ga0075366_10013770 Ga0075366_100137704 347
163 3300035695 Ga0373927_0018305 Ga0373927_0018305_537_1616 347
164 3300037068 Ga0373925_0053562 Ga0373925_0053562_1833_2912 347
165 3300050489 nmdc:mga03683_72395_c1 nmdc:mga03683_72395_c1_312_1403 347
166 3300005334 Ga0068869_100206311 Ga0068869_1002063111 348
167 3300005340 Ga0070689_100000013 Ga0070689_10000001364 348
168 3300006028 Ga0070717_10113455 Ga0070717_101134552 348
169 3300009176 Ga0105242_10040299 Ga0105242_100402992 348
170 3300009177 Ga0105248_10000908 Ga0105248_1000090831 348
171 3300013297 Ga0157378_10131593 Ga0157378_101315932 348
172 3300025934 Ga0207686_10066034 Ga0207686_100660342 348
173 3300025936 Ga0207670_10000004 Ga0207670_10000004588 348
174 3300025936 Ga0207670_10000032 Ga0207670_1000003258 348
175 3300025941 Ga0207711_10001788 Ga0207711_1000178817 348
176 3300026075 Ga0207708_10000413 Ga0207708_1000041327 348
177 3300026089 Ga0207648_10007881 Ga0207648_100078813 348
178 3300028381 Ga0268264_10232007 Ga0268264_102320071 348
179 3300034818 Ga0373950_0000089 Ga0373950_0000089_18012_19124 348
180 3300042007 Ga0439449_0032474 Ga0439449_0032474_373_1521 348
181 3300049583 Ga0501067_0000161 Ga0501067_0000161_36349_37461 348
182 3300049587 Ga0501071_0138205 Ga0501071_0138205_37_1116 348
183 3300049589 Ga0501073_0000682 Ga0501073_0000682_6505_7617 348
184 3300049591 Ga0501075_0005994 Ga0501075_0005994_6155_7234 348
185 3300049592 Ga0501076_0098120 Ga0501076_0098120_787_1866 348
186 3300049822 Ga0501035_0158569 Ga0501035_0158569_138_1262 348
187 3300005467 Ga0070706_100043376 Ga0070706_1000433763 349
188 3300005518 Ga0070699_100051324 Ga0070699_1000513242 349
189 3300026035 Ga0207703_10349667 Ga0207703_103496672 349
190 3300032139 Ga0316580_10033725 Ga0316580_100337252 349
191 3300036712 Ga0316584_0020379 Ga0316584_0020379_500_1564 349
192 3300049570 Ga0501033_0074009 Ga0501033_0074009_1374_2456 349
193 3300049576 Ga0501040_0049735 Ga0501040_0049735_913_1995 349
194 3300049591 Ga0501075_0008958 Ga0501075_0008958_1508_2590 349
195 3300049592 Ga0501076_0022969 Ga0501076_0022969_3308_4390 349
196 3300049593 Ga0501077_0002036 Ga0501077_0002036_4936_6018 349
197 3300049743 Ga0501081_0015292 Ga0501081_0015292_3482_4564 349
198 3300054114 Ga0501084_0020536 Ga0501084_0020536_2684_3766 349
199 3300039062 Ga0400483_075863 Ga0400483_075863_67188_68267 350
200 3300042876 Ga0451577_0067492 Ga0451577_0067492_1840_2916 350
201 3300042876 Ga0451577_0092909 Ga0451577_0092909_1083_2237 350
202 3300005347 Ga0070668_100095670 Ga0070668_1000956702 351
203 3300005458 Ga0070681_10001753 Ga0070681_100017536 351
204 3300005937 Ga0081455_10061928 Ga0081455_100619282 351
205 3300025912 Ga0207707_10004721 Ga0207707_100047214 351
206 3300025928 Ga0207700_10041605 Ga0207700_100416053 351
207 3300025933 Ga0207706_10212236 Ga0207706_102122362 351
208 3300025986 Ga0207658_10347316 Ga0207658_103473162 351
209 3300026089 Ga0207648_10356831 Ga0207648_103568312 351
210 3300061734 Ga0530510_0013719 Ga0530510_0013719_1929_3002 351
211 3300005356 Ga0070674_100041806 Ga0070674_1000418062 352
212 3300005617 Ga0068859_100276604 Ga0068859_1002766042 352
213 3300005618 Ga0068864_100091705 Ga0068864_1000917052 352
214 3300005719 Ga0068861_100172038 Ga0068861_1001720382 352
215 3300005937 Ga0081455_10108173 Ga0081455_101081732 352
216 3300006931 Ga0097620_100276624 Ga0097620_1002766242 352
217 3300025899 Ga0207642_10005219 Ga0207642_100052193 352
218 3300025936 Ga0207670_10000760 Ga0207670_100007602 352
219 3300025937 Ga0207669_10026928 Ga0207669_100269282 352
220 3300026095 Ga0207676_10010777 Ga0207676_100107774 352
221 3300031727 Ga0316576_10098325 Ga0316576_100983252 352
222 3300031728 Ga0316578_10000716 Ga0316578_100007167 352
223 3300031733 Ga0316577_10032349 Ga0316577_100323492 352
224 3300036712 Ga0316584_0000608 Ga0316584_0000608_10731_11846 352
225 3300045051 Ga0451576_0008791 Ga0451576_0008791_10334_11410 352
226 3300048905 Ga0496102_0272161 Ga0496102_0272161_408_1493 352
227 3300050508 nmdc:mga09592_286882_c1 nmdc:mga09592_286882_c1_202_1323 352
228 3300050511 nmdc:mga08y16_88440_c1 nmdc:mga08y16_88440_c1_2039_3181 352
229 3300005467 Ga0070706_100295734 Ga0070706_1002957342 353
230 3300005539 Ga0068853_100001998 Ga0068853_10000199811 353
231 3300005563 Ga0068855_100022343 Ga0068855_1000223437 353
232 3300005841 Ga0068863_100012644 Ga0068863_1000126443 353
233 3300006844 Ga0075428_100045235 Ga0075428_1000452352 353
234 3300006880 Ga0075429_100310239 Ga0075429_1003102392 353
235 3300007265 Ga0099794_10062329 Ga0099794_100623292 353
236 3300009147 Ga0114129_10480568 Ga0114129_104805682 353
237 3300009551 Ga0105238_10002511 Ga0105238_1000251114 353
238 3300010159 Ga0099796_10058664 Ga0099796_100586642 353
239 3300013296 Ga0157374_10066266 Ga0157374_100662662 353
240 3300013308 Ga0157375_10442038 Ga0157375_104420382 353
241 3300025913 Ga0207695_10003714 Ga0207695_100037147 353
242 3300025949 Ga0207667_10118850 Ga0207667_101188502 353
243 3300025981 Ga0207640_10134646 Ga0207640_101346462 353
244 3300026088 Ga0207641_10020018 Ga0207641_100200184 353
245 3300027671 Ga0209588_1058965 Ga0209588_10589651 353
246 3300028556 Ga0265337_1020130 Ga0265337_10201302 353
247 3300028573 Ga0265334_10009181 Ga0265334_100091813 353
248 3300028653 Ga0265323_10000685 Ga0265323_1000068512 353
249 3300028653 Ga0265323_10009474 Ga0265323_100094743 353
250 3300028653 Ga0265323_10010814 Ga0265323_100108143 353
251 3300028653 Ga0265323_10017135 Ga0265323_100171352 353
252 3300028653 Ga0265323_10038073 Ga0265323_100380732 353
253 3300028800 Ga0265338_10014435 Ga0265338_100144357 353
254 3300028800 Ga0265338_10121728 Ga0265338_101217282 353
255 3300028800 Ga0265338_10128194 Ga0265338_101281942 353
256 3300029957 Ga0265324_10000134 Ga0265324_1000013447 353
257 3300029957 Ga0265324_10036653 Ga0265324_100366532 353
258 3300031090 Ga0265760_10023910 Ga0265760_100239102 353
259 3300031235 Ga0265330_10000152 Ga0265330_1000015240 353
260 3300031235 Ga0265330_10000421 Ga0265330_1000042113 353
261 3300031235 Ga0265330_10000768 Ga0265330_100007684 353
262 3300031235 Ga0265330_10001825 Ga0265330_100018259 353
263 3300031235 Ga0265330_10007357 Ga0265330_100073573 353
264 3300031235 Ga0265330_10036525 Ga0265330_100365252 353
265 3300031241 Ga0265325_10013720 Ga0265325_100137203 353
266 3300031241 Ga0265325_10037066 Ga0265325_100370662 353
267 3300031242 Ga0265329_10000004 Ga0265329_1000000413 353
268 3300031242 Ga0265329_10000067 Ga0265329_1000006732 353
269 3300031247 Ga0265340_10000043 Ga0265340_100000436 353
270 3300031247 Ga0265340_10012930 Ga0265340_100129302 353
271 3300031249 Ga0265339_10000010 Ga0265339_100000108 353
272 3300031249 Ga0265339_10002404 Ga0265339_100024044 353
273 3300031249 Ga0265339_10016729 Ga0265339_100167292 353
274 3300031249 Ga0265339_10033047 Ga0265339_100330472 353
275 3300031250 Ga0265331_10000408 Ga0265331_100004086 353
276 3300031344 Ga0265316_10000046 Ga0265316_1000004640 353
277 3300031344 Ga0265316_10000645 Ga0265316_100006457 353
278 3300031344 Ga0265316_10000921 Ga0265316_1000092120 353
279 3300031344 Ga0265316_10001498 Ga0265316_1000149810 353
280 3300031344 Ga0265316_10005674 Ga0265316_100056742 353
281 3300031344 Ga0265316_10011444 Ga0265316_100114444 353
282 3300031344 Ga0265316_10060279 Ga0265316_100602792 353
283 3300031595 Ga0265313_10003304 Ga0265313_1000330410 353
284 3300031711 Ga0265314_10000008 Ga0265314_10000008126 353
285 3300031711 Ga0265314_10001571 Ga0265314_1000157116 353
286 3300031711 Ga0265314_10135957 Ga0265314_101359572 353
287 3300031712 Ga0265342_10000048 Ga0265342_10000048105 353
288 3300031712 Ga0265342_10001561 Ga0265342_100015614 353
289 3300031712 Ga0265342_10002055 Ga0265342_100020559 353
290 3300031712 Ga0265342_10002610 Ga0265342_100026103 353
291 3300031712 Ga0265342_10024762 Ga0265342_100247622 353
292 3300031712 Ga0265342_10067715 Ga0265342_100677152 353
293 3300031727 Ga0316576_10011887 Ga0316576_100118874 353
294 3300034818 Ga0373950_0000020 Ga0373950_0000020_150139_151251 353
295 3300035118 Ga0373954_0000932 Ga0373954_0000932_3490_4602 353
296 3300035724 Ga0373933_0001302 Ga0373933_0001302_2057_3169 353
297 3300036401 Ga0373937_0005888 Ga0373937_0005888_2665_3777 353
298 3300036401 Ga0373937_0007303 Ga0373937_0007303_7592_8704 353
299 3300036647 Ga0316582_0062574 Ga0316582_0062574_636_1757 353
300 3300039437 Ga0436365_1640466 Ga0436365_1640466_144_1223 353
301 3300041459 Ga0451800_0196302 Ga0451800_0196302_228_1340 353
302 3300044712 Ga0453684_0000034 Ga0453684_0000034_317501_318616 353
303 3300044712 Ga0453684_0008034 Ga0453684_0008034_5077_6192 353
304 3300044712 Ga0453684_0437649 Ga0453684_0437649_126_1241 353
305 3300044712 Ga0453684_0454528 Ga0453684_0454528_140_1273 353
306 3300045051 Ga0451576_0105945 Ga0451576_0105945_260_1375 353
307 3300047472 Ga0495686_0038273 Ga0495686_0038273_869_2002 353
308 3300048907 Ga0496104_0075028 Ga0496104_0075028_1970_3088 353
309 3300048917 Ga0496114_0028257 Ga0496114_0028257_3055_4173 353
310 3300048917 Ga0496114_0093442 Ga0496114_0093442_268_1380 353
311 3300049571 Ga0501034_0000026 Ga0501034_0000026_250789_251901 353
312 3300049572 Ga0501036_0148902 Ga0501036_0148902_89_1201 353
313 3300049579 Ga0501043_0024046 Ga0501043_0024046_2610_3722 353
314 3300049580 Ga0501046_0001137 Ga0501046_0001137_15761_16873 353
315 3300049581 Ga0501047_0000017 Ga0501047_0000017_266630_267742 353
316 3300049582 Ga0501048_0001028 Ga0501048_0001028_13536_14648 353
317 3300049583 Ga0501067_0088826 Ga0501067_0088826_187_1299 353
318 3300049584 Ga0501068_0011556 Ga0501068_0011556_2714_3826 353
319 3300049584 Ga0501068_0042474 Ga0501068_0042474_205_1317 353
320 3300049585 Ga0501069_0002016 Ga0501069_0002016_7308_8423 353
321 3300049585 Ga0501069_0036661 Ga0501069_0036661_30_1142 353
322 3300049586 Ga0501070_0003690 Ga0501070_0003690_10502_11614 353
323 3300049588 Ga0501072_0000033 Ga0501072_0000033_67559_68671 353
324 3300049589 Ga0501073_0002534 Ga0501073_0002534_5640_6752 353
325 3300049589 Ga0501073_0005271 Ga0501073_0005271_1483_2595 353
326 3300049590 Ga0501074_0000360 Ga0501074_0000360_25436_26548 353
327 3300049590 Ga0501074_0012245 Ga0501074_0012245_4019_5131 353
328 3300049590 Ga0501074_0131074 Ga0501074_0131074_485_1597 353
329 3300049741 Ga0501079_0000607 Ga0501079_0000607_20751_21863 353
330 3300049742 Ga0501080_0003185 Ga0501080_0003185_6821_7933 353
331 3300049742 Ga0501080_0052991 Ga0501080_0052991_657_1769 353
332 3300049744 Ga0501083_0000658 Ga0501083_0000658_968_2080 353
333 3300049744 Ga0501083_0011866 Ga0501083_0011866_459_1571 353
334 3300054114 Ga0501084_0000003 Ga0501084_0000003_8930_10042 353
335 3300060353 Ga0501082_0000042 Ga0501082_0000042_35886_36998 353
336 3300005354 Ga0070675_100189835 Ga0070675_1001898352 354
337 3300006871 Ga0075434_100081386 Ga0075434_1000813862 354
338 3300025926 Ga0207659_10096897 Ga0207659_100968972 354
339 3300031616 Ga0307508_10109264 Ga0307508_101092642 354
340 3300049571 Ga0501034_0060199 Ga0501034_0060199_1969_3108 354
341 3300050508 nmdc:mga09592_56668_c1 nmdc:mga09592_56668_c1_857_1930 354
342 3300050512 nmdc:mga0n895_215170_c1 nmdc:mga0n895_215170_c1_815_1891 354
343 iso_pu_bacteria 2740891818 2740990245 354
344 3300005937 Ga0081455_10002633 Ga0081455_100026334 355
345 3300009094 Ga0111539_10004422 Ga0111539_1000442215 355
346 3300027907 Ga0207428_10031416 Ga0207428_100314163 355
347 3300031733 Ga0316577_10025984 Ga0316577_100259842 355
348 3300036647 Ga0316582_0010738 Ga0316582_0010738_56_1126 355
349 3300036647 Ga0316582_0046689 Ga0316582_0046689_341_1411 355
350 3300050511 nmdc:mga08y16_1215_c1 nmdc:mga08y16_1215_c1_16238_17335 355
351 3300003371 JGI26145J50221_1002531 JGI26145J50221_10025312 356
352 3300003503 JGI26141J51220_1000265 JGI26141J51220_10002652 356
353 3300005293 Ga0065715_10163679 Ga0065715_101636792 356
354 3300005295 Ga0065707_10183925 Ga0065707_101839251 356
355 3300005328 Ga0070676_10001079 Ga0070676_100010797 356
356 3300005328 Ga0070676_10169732 Ga0070676_101697321 356
357 3300005330 Ga0070690_100108534 Ga0070690_1001085342 356
358 3300005330 Ga0070690_100203790 Ga0070690_1002037901 356
359 3300005331 Ga0070670_100002783 Ga0070670_1000027836 356
360 3300005334 Ga0068869_100000489 Ga0068869_1000004898 356
361 3300005334 Ga0068869_100109271 Ga0068869_1001092712 356
362 3300005335 Ga0070666_10094378 Ga0070666_100943781 356
363 3300005336 Ga0070680_100000714 Ga0070680_1000007146 356
364 3300005336 Ga0070680_100011285 Ga0070680_1000112852 356
365 3300005336 Ga0070680_100164016 Ga0070680_1001640162 356
366 3300005337 Ga0070682_100000427 Ga0070682_10000042717 356
367 3300005338 Ga0068868_100236644 Ga0068868_1002366441 356
368 3300005339 Ga0070660_100000553 Ga0070660_10000055315 356
369 3300005340 Ga0070689_100007543 Ga0070689_1000075432 356
370 3300005341 Ga0070691_10000946 Ga0070691_100009465 356
371 3300005343 Ga0070687_100024444 Ga0070687_1000244442 356
372 3300005344 Ga0070661_100001457 Ga0070661_1000014576 356
373 3300005345 Ga0070692_10002516 Ga0070692_100025166 356
374 3300005347 Ga0070668_100056056 Ga0070668_1000560562 356
375 3300005347 Ga0070668_100087485 Ga0070668_1000874851 356
376 3300005353 Ga0070669_100010791 Ga0070669_1000107913 356
377 3300005354 Ga0070675_100099581 Ga0070675_1000995812 356
378 3300005355 Ga0070671_100315840 Ga0070671_1003158402 356
379 3300005364 Ga0070673_100020950 Ga0070673_1000209503 356
380 3300005366 Ga0070659_100000361 Ga0070659_10000036121 356
381 3300005406 Ga0070703_10012003 Ga0070703_100120032 356
382 3300005436 Ga0070713_100283630 Ga0070713_1002836301 356
383 3300005438 Ga0070701_10001936 Ga0070701_100019366 356
384 3300005438 Ga0070701_10006093 Ga0070701_100060932 356
385 3300005438 Ga0070701_10027759 Ga0070701_100277592 356
386 3300005440 Ga0070705_100000749 Ga0070705_10000074912 356
387 3300005440 Ga0070705_100005299 Ga0070705_1000052993 356
388 3300005440 Ga0070705_100012634 Ga0070705_1000126344 356
389 3300005440 Ga0070705_100059340 Ga0070705_1000593402 356
390 3300005440 Ga0070705_100145639 Ga0070705_1001456392 356
391 3300005441 Ga0070700_100120674 Ga0070700_1001206741 356
392 3300005444 Ga0070694_100002050 Ga0070694_1000020507 356
393 3300005444 Ga0070694_100006124 Ga0070694_1000061247 356
394 3300005444 Ga0070694_100105901 Ga0070694_1001059012 356
395 3300005445 Ga0070708_100010375 Ga0070708_1000103753 356
396 3300005445 Ga0070708_100036969 Ga0070708_1000369692 356
397 3300005445 Ga0070708_100048473 Ga0070708_1000484732 356
398 3300005445 Ga0070708_100097966 Ga0070708_1000979662 356
399 3300005445 Ga0070708_100107869 Ga0070708_1001078692 356
400 3300005445 Ga0070708_100321845 Ga0070708_1003218451 356
401 3300005455 Ga0070663_100003646 Ga0070663_1000036467 356
402 3300005458 Ga0070681_10004948 Ga0070681_100049486 356
403 3300005459 Ga0068867_100005692 Ga0068867_1000056922 356
404 3300005459 Ga0068867_100080978 Ga0068867_1000809782 356
405 3300005466 Ga0070685_10212395 Ga0070685_102123951 356
406 3300005467 Ga0070706_100002460 Ga0070706_1000024602 356
407 3300005467 Ga0070706_100021148 Ga0070706_1000211484 356
408 3300005467 Ga0070706_100060205 Ga0070706_1000602052 356
409 3300005467 Ga0070706_100102444 Ga0070706_1001024442 356
410 3300005467 Ga0070706_100176533 Ga0070706_1001765332 356
411 3300005467 Ga0070706_100193929 Ga0070706_1001939292 356
412 3300005467 Ga0070706_100219267 Ga0070706_1002192672 356
413 3300005467 Ga0070706_100255424 Ga0070706_1002554242 356
414 3300005468 Ga0070707_100002048 Ga0070707_1000020482 356
415 3300005468 Ga0070707_100003191 Ga0070707_1000031912 356
416 3300005468 Ga0070707_100037471 Ga0070707_1000374712 356
417 3300005468 Ga0070707_100106350 Ga0070707_1001063502 356
418 3300005468 Ga0070707_100364707 Ga0070707_1003647072 356
419 3300005468 Ga0070707_100412757 Ga0070707_1004127571 356
420 3300005471 Ga0070698_100010709 Ga0070698_1000107097 356
421 3300005471 Ga0070698_100087809 Ga0070698_1000878092 356
422 3300005471 Ga0070698_100160335 Ga0070698_1001603352 356
423 3300005518 Ga0070699_100002466 Ga0070699_1000024668 356
424 3300005518 Ga0070699_100008240 Ga0070699_1000082407 356
425 3300005518 Ga0070699_100017283 Ga0070699_1000172832 356
426 3300005518 Ga0070699_100035846 Ga0070699_1000358463 356
427 3300005518 Ga0070699_100166162 Ga0070699_1001661622 356
428 3300005518 Ga0070699_100214738 Ga0070699_1002147382 356
429 3300005530 Ga0070679_100005619 Ga0070679_1000056195 356
430 3300005536 Ga0070697_100003324 Ga0070697_10000332410 356
431 3300005536 Ga0070697_100016789 Ga0070697_1000167894 356
432 3300005536 Ga0070697_100234349 Ga0070697_1002343492 356
433 3300005536 Ga0070697_100309327 Ga0070697_1003093272 356
434 3300005539 Ga0068853_100001019 Ga0068853_1000010194 356
435 3300005543 Ga0070672_100057865 Ga0070672_1000578652 356
436 3300005545 Ga0070695_100012945 Ga0070695_1000129452 356
437 3300005545 Ga0070695_100025121 Ga0070695_1000251212 356
438 3300005545 Ga0070695_100258475 Ga0070695_1002584751 356
439 3300005546 Ga0070696_100000431 Ga0070696_10000043110 356
440 3300005546 Ga0070696_100075054 Ga0070696_1000750542 356
441 3300005546 Ga0070696_100184451 Ga0070696_1001844512 356
442 3300005547 Ga0070693_100010740 Ga0070693_1000107404 356
443 3300005549 Ga0070704_100000606 Ga0070704_10000060611 356
444 3300005549 Ga0070704_100017966 Ga0070704_1000179664 356
445 3300005563 Ga0068855_100000004 Ga0068855_100000004123 356
446 3300005563 Ga0068855_100001782 Ga0068855_10000178214 356
447 3300005563 Ga0068855_100010883 Ga0068855_1000108835 356
448 3300005564 Ga0070664_100001912 Ga0070664_1000019127 356
449 3300005577 Ga0068857_100092310 Ga0068857_1000923102 356
450 3300005578 Ga0068854_100000767 Ga0068854_10000076712 356
451 3300005614 Ga0068856_100000390 Ga0068856_10000039045 356
452 3300005614 Ga0068856_100008599 Ga0068856_1000085993 356
453 3300005617 Ga0068859_100036578 Ga0068859_1000365782 356
454 3300005617 Ga0068859_100071419 Ga0068859_1000714192 356
455 3300005618 Ga0068864_100007911 Ga0068864_1000079112 356
456 3300005719 Ga0068861_100003765 Ga0068861_10000376510 356
457 3300005719 Ga0068861_100003920 Ga0068861_1000039207 356
458 3300005840 Ga0068870_10000449 Ga0068870_100004494 356
459 3300005840 Ga0068870_10078342 Ga0068870_100783421 356
460 3300005841 Ga0068863_100014689 Ga0068863_1000146894 356
461 3300005841 Ga0068863_100044137 Ga0068863_1000441373 356
462 3300005841 Ga0068863_100057508 Ga0068863_1000575082 356
463 3300005841 Ga0068863_100343400 Ga0068863_1003434001 356
464 3300005842 Ga0068858_100019944 Ga0068858_1000199442 356
465 3300005843 Ga0068860_100008259 Ga0068860_10000825910 356
466 3300005843 Ga0068860_100061811 Ga0068860_1000618112 356
467 3300005843 Ga0068860_100086261 Ga0068860_1000862612 356
468 3300005843 Ga0068860_100123499 Ga0068860_1001234992 356
469 3300005843 Ga0068860_100281031 Ga0068860_1002810312 356
470 3300005844 Ga0068862_100002840 Ga0068862_1000028408 356
471 3300005844 Ga0068862_100015163 Ga0068862_1000151632 356
472 3300005844 Ga0068862_100046960 Ga0068862_1000469603 356
473 3300005844 Ga0068862_100195869 Ga0068862_1001958692 356
474 3300005937 Ga0081455_10008966 Ga0081455_100089663 356
475 3300005981 Ga0081538_10020977 Ga0081538_100209772 356
476 3300005983 Ga0081540_1007784 Ga0081540_10077843 356
477 3300006173 Ga0070716_100047274 Ga0070716_1000472742 356
478 3300006175 Ga0070712_100002171 Ga0070712_10000217110 356
479 3300006237 Ga0097621_100134688 Ga0097621_1001346882 356
480 3300006237 Ga0097621_100169018 Ga0097621_1001690182 356
481 3300006844 Ga0075428_100000620 Ga0075428_10000062021 356
482 3300006844 Ga0075428_100000795 Ga0075428_1000007956 356
483 3300006844 Ga0075428_100015464 Ga0075428_1000154645 356
484 3300006844 Ga0075428_100052255 Ga0075428_1000522553 356
485 3300006846 Ga0075430_100000586 Ga0075430_1000005866 356
486 3300006846 Ga0075430_100001373 Ga0075430_1000013736 356
487 3300006846 Ga0075430_100071678 Ga0075430_1000716783 356
488 3300006846 Ga0075430_100091683 Ga0075430_1000916832 356
489 3300006847 Ga0075431_100000643 Ga0075431_1000006432 356
490 3300006847 Ga0075431_100002078 Ga0075431_10000207817 356
491 3300006847 Ga0075431_100002624 Ga0075431_10000262415 356
492 3300006847 Ga0075431_100016364 Ga0075431_1000163646 356
493 3300006847 Ga0075431_100064699 Ga0075431_1000646992 356
494 3300006847 Ga0075431_100086759 Ga0075431_1000867593 356
495 3300006847 Ga0075431_100203342 Ga0075431_1002033422 356
496 3300006852 Ga0075433_10000960 Ga0075433_1000096022 356
497 3300006852 Ga0075433_10001347 Ga0075433_1000134714 356
498 3300006852 Ga0075433_10003862 Ga0075433_100038629 356
499 3300006852 Ga0075433_10048944 Ga0075433_100489441 356
500 3300006852 Ga0075433_10207887 Ga0075433_102078872 356
501 3300006852 Ga0075433_10366422 Ga0075433_103664222 356
502 3300006871 Ga0075434_100001606 Ga0075434_10000160614 356
503 3300006871 Ga0075434_100001618 Ga0075434_1000016182 356
504 3300006871 Ga0075434_100002846 Ga0075434_10000284611 356
505 3300006871 Ga0075434_100005702 Ga0075434_1000057025 356
506 3300006871 Ga0075434_100017941 Ga0075434_1000179413 356
507 3300006871 Ga0075434_100029217 Ga0075434_1000292174 356
508 3300006871 Ga0075434_100032751 Ga0075434_1000327513 356
509 3300006871 Ga0075434_100098501 Ga0075434_1000985013 356
510 3300006880 Ga0075429_100000268 Ga0075429_10000026834 356
511 3300006880 Ga0075429_100055621 Ga0075429_1000556212 356
512 3300006880 Ga0075429_100114363 Ga0075429_1001143632 356
513 3300006880 Ga0075429_100267880 Ga0075429_1002678802 356
514 3300006881 Ga0068865_100185709 Ga0068865_1001857092 356
515 3300006914 Ga0075436_100041145 Ga0075436_1000411452 356
516 3300006931 Ga0097620_100036579 Ga0097620_1000365792 356
517 3300006931 Ga0097620_100071424 Ga0097620_1000714242 356
518 3300007076 Ga0075435_100005401 Ga0075435_1000054013 356
519 3300007076 Ga0075435_100038045 Ga0075435_1000380453 356
520 3300007076 Ga0075435_100052521 Ga0075435_1000525212 356
521 3300007076 Ga0075435_100057110 Ga0075435_1000571102 356
522 3300007076 Ga0075435_100084928 Ga0075435_1000849282 356
523 3300007076 Ga0075435_100110969 Ga0075435_1001109692 356
524 3300007076 Ga0075435_100363306 Ga0075435_1003633061 356
525 3300007265 Ga0099794_10014353 Ga0099794_100143533 356
526 3300007265 Ga0099794_10021496 Ga0099794_100214962 356
527 3300007265 Ga0099794_10108250 Ga0099794_101082501 356
528 3300009094 Ga0111539_10000318 Ga0111539_1000031852 356
529 3300009094 Ga0111539_10014897 Ga0111539_100148977 356
530 3300009094 Ga0111539_10058841 Ga0111539_100588411 356
531 3300009094 Ga0111539_10073184 Ga0111539_100731842 356
532 3300009094 Ga0111539_10090121 Ga0111539_100901213 356
533 3300009094 Ga0111539_10375173 Ga0111539_103751731 356
534 3300009098 Ga0105245_10005830 Ga0105245_100058305 356
535 3300009147 Ga0114129_10002104 Ga0114129_1000210420 356
536 3300009147 Ga0114129_10012915 Ga0114129_100129153 356
537 3300009147 Ga0114129_10039856 Ga0114129_100398561 356
538 3300009147 Ga0114129_10046632 Ga0114129_100466323 356
539 3300009147 Ga0114129_10069400 Ga0114129_100694003 356
540 3300009147 Ga0114129_10092487 Ga0114129_100924872 356
541 3300009147 Ga0114129_10103150 Ga0114129_101031502 356
542 3300009147 Ga0114129_10113816 Ga0114129_101138162 356
543 3300009147 Ga0114129_10232363 Ga0114129_102323632 356
544 3300009147 Ga0114129_10268783 Ga0114129_102687832 356
545 3300009148 Ga0105243_10017751 Ga0105243_100177512 356
546 3300009148 Ga0105243_10111474 Ga0105243_101114742 356
547 3300009148 Ga0105243_10326700 Ga0105243_103267002 356
548 3300009174 Ga0105241_10004001 Ga0105241_100040014 356
549 3300009176 Ga0105242_10061955 Ga0105242_100619552 356
550 3300009176 Ga0105242_10128646 Ga0105242_101286462 356
551 3300009553 Ga0105249_10042860 Ga0105249_100428602 356
552 3300009553 Ga0105249_10153338 Ga0105249_101533382 356
553 3300009553 Ga0105249_10281580 Ga0105249_102815802 356
554 3300013100 Ga0157373_10000619 Ga0157373_100006196 356
555 3300013102 Ga0157371_10177543 Ga0157371_101775431 356
556 3300013297 Ga0157378_10135362 Ga0157378_101353622 356
557 3300013306 Ga0163162_10004254 Ga0163162_100042546 356
558 3300013307 Ga0157372_10000405 Ga0157372_1000040510 356
559 3300013307 Ga0157372_10666854 Ga0157372_106668541 356
560 3300013308 Ga0157375_10008877 Ga0157375_100088772 356
561 3300014325 Ga0163163_10069879 Ga0163163_100698792 356
562 3300014326 Ga0157380_10071230 Ga0157380_100712303 356
563 3300017792 Ga0163161_10047209 Ga0163161_100472093 356
564 3300017792 Ga0163161_10229416 Ga0163161_102294161 356
565 3300020081 Ga0206354_11053466 Ga0206354_110534662 356
566 3300025885 Ga0207653_10002535 Ga0207653_100025352 356
567 3300025901 Ga0207688_10095397 Ga0207688_100953972 356
568 3300025903 Ga0207680_10037104 Ga0207680_100371043 356
569 3300025904 Ga0207647_10012299 Ga0207647_100122995 356
570 3300025906 Ga0207699_10192782 Ga0207699_101927822 356
571 3300025907 Ga0207645_10000192 Ga0207645_1000019243 356
572 3300025908 Ga0207643_10001002 Ga0207643_100010026 356
573 3300025908 Ga0207643_10066697 Ga0207643_100666973 356
574 3300025910 Ga0207684_10000508 Ga0207684_1000050833 356
575 3300025910 Ga0207684_10010730 Ga0207684_100107304 356
576 3300025910 Ga0207684_10015123 Ga0207684_100151233 356
577 3300025910 Ga0207684_10021146 Ga0207684_100211464 356
578 3300025910 Ga0207684_10108326 Ga0207684_101083262 356
579 3300025910 Ga0207684_10112922 Ga0207684_101129222 356
580 3300025910 Ga0207684_10172847 Ga0207684_101728472 356
581 3300025911 Ga0207654_10004026 Ga0207654_100040266 356
582 3300025912 Ga0207707_10000171 Ga0207707_1000017139 356
583 3300025916 Ga0207663_10016951 Ga0207663_100169513 356
584 3300025916 Ga0207663_10037378 Ga0207663_100373782 356
585 3300025917 Ga0207660_10000651 Ga0207660_1000065113 356
586 3300025918 Ga0207662_10078053 Ga0207662_100780532 356
587 3300025919 Ga0207657_10000085 Ga0207657_1000008541 356
588 3300025921 Ga0207652_10000264 Ga0207652_100002649 356
589 3300025921 Ga0207652_10398950 Ga0207652_103989501 356
590 3300025922 Ga0207646_10002033 Ga0207646_1000203317 356
591 3300025922 Ga0207646_10011683 Ga0207646_100116836 356
592 3300025923 Ga0207681_10022459 Ga0207681_100224594 356
593 3300025925 Ga0207650_10098021 Ga0207650_100980212 356
594 3300025926 Ga0207659_10134574 Ga0207659_101345742 356
595 3300025927 Ga0207687_10002407 Ga0207687_100024074 356
596 3300025932 Ga0207690_10001217 Ga0207690_100012179 356
597 3300025933 Ga0207706_10003246 Ga0207706_1000324613 356
598 3300025935 Ga0207709_10020922 Ga0207709_100209223 356
599 3300025935 Ga0207709_10074769 Ga0207709_100747692 356
600 3300025935 Ga0207709_10078287 Ga0207709_100782872 356
601 3300025936 Ga0207670_10004196 Ga0207670_100041962 356
602 3300025938 Ga0207704_10061710 Ga0207704_100617102 356
603 3300025938 Ga0207704_10160703 Ga0207704_101607031 356
604 3300025939 Ga0207665_10036912 Ga0207665_100369123 356
605 3300025940 Ga0207691_10016311 Ga0207691_100163115 356
606 3300025940 Ga0207691_10074614 Ga0207691_100746143 356
607 3300025940 Ga0207691_10078234 Ga0207691_100782342 356
608 3300025942 Ga0207689_10001095 Ga0207689_1000109518 356
609 3300025942 Ga0207689_10015506 Ga0207689_100155062 356
610 3300025942 Ga0207689_10167699 Ga0207689_101676992 356
611 3300025945 Ga0207679_10000724 Ga0207679_100007247 356
612 3300025949 Ga0207667_10000264 Ga0207667_100002644 356
613 3300025949 Ga0207667_10001063 Ga0207667_1000106327 356
614 3300025949 Ga0207667_10026473 Ga0207667_100264734 356
615 3300025949 Ga0207667_10405102 Ga0207667_104051022 356
616 3300025960 Ga0207651_10007047 Ga0207651_100070473 356
617 3300025961 Ga0207712_10015802 Ga0207712_100158022 356
618 3300025961 Ga0207712_10105931 Ga0207712_101059312 356
619 3300025961 Ga0207712_10118357 Ga0207712_101183572 356
620 3300025961 Ga0207712_10123115 Ga0207712_101231152 356
621 3300025972 Ga0207668_10058657 Ga0207668_100586572 356
622 3300025972 Ga0207668_10190607 Ga0207668_101906071 356
623 3300025981 Ga0207640_10001932 Ga0207640_100019324 356
624 3300025981 Ga0207640_10223424 Ga0207640_102234241 356
625 3300026023 Ga0207677_10113300 Ga0207677_101133002 356
626 3300026035 Ga0207703_10026664 Ga0207703_100266644 356
627 3300026035 Ga0207703_10144242 Ga0207703_101442422 356
628 3300026041 Ga0207639_10001968 Ga0207639_100019688 356
629 3300026067 Ga0207678_10000868 Ga0207678_1000086813 356
630 3300026075 Ga0207708_10065773 Ga0207708_100657732 356
631 3300026075 Ga0207708_10074313 Ga0207708_100743132 356
632 3300026078 Ga0207702_10002106 Ga0207702_100021067 356
633 3300026078 Ga0207702_10043452 Ga0207702_100434522 356
634 3300026088 Ga0207641_10024604 Ga0207641_100246044 356
635 3300026088 Ga0207641_10057236 Ga0207641_100572362 356
636 3300026089 Ga0207648_10001871 Ga0207648_1000187110 356
637 3300026089 Ga0207648_10064047 Ga0207648_100640472 356
638 3300026089 Ga0207648_10065146 Ga0207648_100651462 356
639 3300026089 Ga0207648_10142915 Ga0207648_101429152 356
640 3300026116 Ga0207674_10000702 Ga0207674_1000070237 356
641 3300026116 Ga0207674_10181165 Ga0207674_101811652 356
642 3300026118 Ga0207675_100003318 Ga0207675_10000331813 356
643 3300026118 Ga0207675_100007470 Ga0207675_1000074702 356
644 3300026118 Ga0207675_100070313 Ga0207675_1000703132 356
645 3300027360 Ga0209969_1007506 Ga0209969_10075062 356
646 3300027364 Ga0209967_1002715 Ga0209967_10027152 356
647 3300027378 Ga0209981_1006337 Ga0209981_10063372 356
648 3300027395 Ga0209996_1004057 Ga0209996_10040572 356
649 3300027462 Ga0210000_1002243 Ga0210000_10022432 356
650 3300027526 Ga0209968_1000974 Ga0209968_10009742 356
651 3300027543 Ga0209999_1004012 Ga0209999_10040123 356
652 3300027552 Ga0209982_1009046 Ga0209982_10090462 356
653 3300027614 Ga0209970_1000394 Ga0209970_10003942 356
654 3300027665 Ga0209983_1000603 Ga0209983_10006033 356
655 3300027671 Ga0209588_1004363 Ga0209588_10043634 356
656 3300027682 Ga0209971_1000104 Ga0209971_100010422 356
657 3300027695 Ga0209966_1000032 Ga0209966_100003260 356
658 3300027717 Ga0209998_10000162 Ga0209998_1000016214 356
659 3300027876 Ga0209974_10002485 Ga0209974_100024856 356
660 3300027907 Ga0207428_10000399 Ga0207428_1000039936 356
661 3300027907 Ga0207428_10000489 Ga0207428_1000048934 356
662 3300027907 Ga0207428_10022918 Ga0207428_100229184 356
663 3300027907 Ga0207428_10054905 Ga0207428_100549053 356
664 3300027907 Ga0207428_10183323 Ga0207428_101833231 356
665 3300028379 Ga0268266_10057784 Ga0268266_100577843 356
666 3300028380 Ga0268265_10002229 Ga0268265_1000222913 356
667 3300028380 Ga0268265_10005189 Ga0268265_100051897 356
668 3300028380 Ga0268265_10361250 Ga0268265_103612501 356
669 3300028380 Ga0268265_10416630 Ga0268265_104166302 356
670 3300028381 Ga0268264_10238289 Ga0268264_102382892 356
671 3300028556 Ga0265337_1004025 Ga0265337_10040254 356
672 3300028573 Ga0265334_10004065 Ga0265334_100040652 356
673 3300030521 Ga0307511_10026258 Ga0307511_100262583 356
674 3300031238 Ga0265332_10034428 Ga0265332_100344282 356
675 3300031240 Ga0265320_10002159 Ga0265320_1000215910 356
676 3300031249 Ga0265339_10002786 Ga0265339_100027868 356
677 3300031344 Ga0265316_10016519 Ga0265316_100165192 356
678 3300031456 Ga0307513_10192879 Ga0307513_101928792 356
679 3300031548 Ga0307408_100014384 Ga0307408_1000143842 356
680 3300031616 Ga0307508_10006597 Ga0307508_100065978 356
681 3300031711 Ga0265314_10000002 Ga0265314_10000002718 356
682 3300031711 Ga0265314_10119898 Ga0265314_101198982 356
683 3300031727 Ga0316576_10014555 Ga0316576_100145553 356
684 3300031727 Ga0316576_10114400 Ga0316576_101144002 356
685 3300031730 Ga0307516_10009436 Ga0307516_100094368 356
686 3300031852 Ga0307410_10018924 Ga0307410_100189242 356
687 3300031852 Ga0307410_10045685 Ga0307410_100456852 356
688 3300031903 Ga0307407_10004264 Ga0307407_100042642 356
689 3300031903 Ga0307407_10157891 Ga0307407_101578912 356
690 3300031903 Ga0307407_10187004 Ga0307407_101870041 356
691 3300031995 Ga0307409_100031249 Ga0307409_1000312494 356
692 3300032002 Ga0307416_100055450 Ga0307416_1000554502 356
693 3300032002 Ga0307416_100122701 Ga0307416_1001227012 356
694 3300032005 Ga0307411_10091848 Ga0307411_100918482 356
695 3300035088 Ga0373940_0014138 Ga0373940_0014138_655_1734 356
696 3300035090 Ga0373949_0006693 Ga0373949_0006693_1276_2358 356
697 3300035112 Ga0373932_0017719 Ga0373932_0017719_651_1730 356
698 3300035121 Ga0373960_0004851 Ga0373960_0004851_1990_3072 356
699 3300035171 Ga0373946_0071022 Ga0373946_0071022_338_1423 356
700 3300035241 Ga0373961_0002268 Ga0373961_0002268_3379_4461 356
701 3300035242 Ga0373962_0020166 Ga0373962_0020166_401_1480 356
702 3300035398 Ga0316574_0020998 Ga0316574_0020998_1178_2305 356
703 3300035691 Ga0373931_0025238 Ga0373931_0025238_251_1330 356
704 3300035691 Ga0373931_0026409 Ga0373931_0026409_884_1966 356
705 3300035691 Ga0373931_0040486 Ga0373931_0040486_1158_2231 356
706 3300036401 Ga0373937_0012910 Ga0373937_0012910_1838_2965 356
707 3300036647 Ga0316582_0185242 Ga0316582_0185242_259_1389 356
708 3300037466 Ga0395898_0002760 Ga0395898_0002760_6778_7857 356
709 3300038443 Ga0395901_0004796 Ga0395901_0004796_12396_13475 356
710 3300038996 Ga0242420_008801 Ga0242420_008801_332_1411 356
711 3300041413 Ga0439465_0034926 Ga0439465_0034926_305_1435 356
712 3300041453 Ga0451797_1478612 Ga0451797_1478612_131_1258 356
713 3300041486 Ga0451807_0085809 Ga0451807_0085809_2913_4040 356
714 3300041509 Ga0451843_0821208 Ga0451843_0821208_37_1167 356
715 3300042004 Ga0439445_0010053 Ga0439445_0010053_615_1745 356
716 3300042005 Ga0439448_0001005 Ga0439448_0001005_5851_6933 356
717 3300042005 Ga0439448_0018144 Ga0439448_0018144_868_1950 356
718 3300042435 Ga0439434_0052353 Ga0439434_0052353_99_1178 356
719 3300042439 Ga0439464_0016251 Ga0439464_0016251_703_1785 356
720 3300042461 Ga0439460_0003121 Ga0439460_0003121_2743_3825 356
721 3300042876 Ga0451577_0005061 Ga0451577_0005061_8957_10039 356
722 3300042876 Ga0451577_0015048 Ga0451577_0015048_2178_3257 356
723 3300042876 Ga0451577_0174959 Ga0451577_0174959_288_1370 356
724 3300044673 Ga0453683_0002410 Ga0453683_0002410_2371_3501 356
725 3300044673 Ga0453683_0010171 Ga0453683_0010171_4203_5282 356
726 3300044673 Ga0453683_0016098 Ga0453683_0016098_1726_2808 356
727 3300044673 Ga0453683_0113330 Ga0453683_0113330_487_1569 356
728 3300044673 Ga0453683_0114636 Ga0453683_0114636_473_1555 356
729 3300044673 Ga0453683_0136322 Ga0453683_0136322_388_1467 356
730 3300044712 Ga0453684_0303929 Ga0453684_0303929_66_1148 356
731 3300044712 Ga0453684_0552328 Ga0453684_0552328_166_1248 356
732 3300045051 Ga0451576_0005102 Ga0451576_0005102_6036_7118 356
733 3300045051 Ga0451576_0014820 Ga0451576_0014820_4640_5722 356
734 3300045051 Ga0451576_0076296 Ga0451576_0076296_2180_3262 356
735 3300045051 Ga0451576_0118013 Ga0451576_0118013_1411_2490 356
736 3300045051 Ga0451576_0210331 Ga0451576_0210331_221_1303 356
737 3300045051 Ga0451576_0214272 Ga0451576_0214272_154_1233 356
738 3300045051 Ga0451576_0404829 Ga0451576_0404829_157_1236 356
739 3300045976 Ga0466967_0128859 Ga0466967_0128859_663_1793 356
740 3300046472 Ga0495580_0000604 Ga0495580_0000604_8237_9316 356
741 3300046664 Ga0495659_0027554 Ga0495659_0027554_773_1852 356
742 3300046684 Ga0495669_0004248 Ga0495669_0004248_1662_2741 356
743 3300046691 Ga0495670_0106724 Ga0495670_0106724_306_1385 356
744 3300046794 Ga0495589_0050545 Ga0495589_0050545_622_1749 356
745 3300047318 Ga0495636_0023197 Ga0495636_0023197_587_1666 356
746 3300047319 Ga0495674_0242004 Ga0495674_0242004_262_1347 356
747 3300048905 Ga0496102_0007528 Ga0496102_0007528_6659_7738 356
748 3300048905 Ga0496102_0076649 Ga0496102_0076649_595_1677 356
749 3300048909 Ga0496106_0152770 Ga0496106_0152770_164_1243 356
750 3300048910 Ga0496107_0123622 Ga0496107_0123622_654_1733 356
751 3300048910 Ga0496107_0208329 Ga0496107_0208329_148_1230 356
752 3300048912 Ga0496109_0275887 Ga0496109_0275887_462_1544 356
753 3300048913 Ga0496110_0276558 Ga0496110_0276558_149_1228 356
754 3300048914 Ga0496111_0098344 Ga0496111_0098344_1007_2089 356
755 3300049569 Ga0501032_0064688 Ga0501032_0064688_26_1153 356
756 3300049571 Ga0501034_0301855 Ga0501034_0301855_62_1186 356
757 3300049572 Ga0501036_0042303 Ga0501036_0042303_955_2037 356
758 3300049572 Ga0501036_0129792 Ga0501036_0129792_132_1214 356
759 3300049574 Ga0501038_0001888 Ga0501038_0001888_8974_10101 356
760 3300049574 Ga0501038_0212179 Ga0501038_0212179_198_1280 356
761 3300049575 Ga0501039_0025895 Ga0501039_0025895_3294_4376 356
762 3300049576 Ga0501040_0063345 Ga0501040_0063345_468_1550 356
763 3300049576 Ga0501040_0167261 Ga0501040_0167261_462_1541 356
764 3300049577 Ga0501041_0024326 Ga0501041_0024326_1511_2593 356
765 3300049577 Ga0501041_0085025 Ga0501041_0085025_306_1388 356
766 3300049578 Ga0501042_0069215 Ga0501042_0069215_310_1392 356
767 3300049578 Ga0501042_0160021 Ga0501042_0160021_27_1109 356
768 3300049579 Ga0501043_0151800 Ga0501043_0151800_412_1494 356
769 3300049580 Ga0501046_0001435 Ga0501046_0001435_11986_13068 356
770 3300049580 Ga0501046_0091611 Ga0501046_0091611_1076_2158 356
771 3300049580 Ga0501046_0144674 Ga0501046_0144674_475_1554 356
772 3300049580 Ga0501046_0283353 Ga0501046_0283353_52_1131 356
773 3300049581 Ga0501047_0005978 Ga0501047_0005978_7584_8711 356
774 3300049581 Ga0501047_0017834 Ga0501047_0017834_606_1733 356
775 3300049581 Ga0501047_0025965 Ga0501047_0025965_988_2115 356
776 3300049582 Ga0501048_0007983 Ga0501048_0007983_5335_6417 356
777 3300049583 Ga0501067_0083172 Ga0501067_0083172_403_1530 356
778 3300049584 Ga0501068_0053580 Ga0501068_0053580_1206_2288 356
779 3300049585 Ga0501069_0119025 Ga0501069_0119025_187_1269 356
780 3300049587 Ga0501071_0059912 Ga0501071_0059912_113_1195 356
781 3300049587 Ga0501071_0062547 Ga0501071_0062547_107_1288 356
782 3300049588 Ga0501072_0000151 Ga0501072_0000151_48790_49917 356
783 3300049588 Ga0501072_0093308 Ga0501072_0093308_1115_2197 356
784 3300049588 Ga0501072_0098073 Ga0501072_0098073_637_1719 356
785 3300049589 Ga0501073_0124014 Ga0501073_0124014_218_1348 356
786 3300049590 Ga0501074_0000711 Ga0501074_0000711_18946_20028 356
787 3300049590 Ga0501074_0010416 Ga0501074_0010416_2326_3453 356
788 3300049591 Ga0501075_0057859 Ga0501075_0057859_1207_2286 356
789 3300049591 Ga0501075_0145727 Ga0501075_0145727_626_1705 356
790 3300049592 Ga0501076_0026863 Ga0501076_0026863_322_1449 356
791 3300049592 Ga0501076_0049430 Ga0501076_0049430_2151_3281 356
792 3300049592 Ga0501076_0167626 Ga0501076_0167626_308_1390 356
793 3300049593 Ga0501077_0022122 Ga0501077_0022122_2517_3599 356
794 3300049593 Ga0501077_0096659 Ga0501077_0096659_449_1528 356
795 3300049741 Ga0501079_0002462 Ga0501079_0002462_6765_7847 356
796 3300049741 Ga0501079_0030639 Ga0501079_0030639_833_1960 356
797 3300049741 Ga0501079_0072674 Ga0501079_0072674_605_1684 356
798 3300049742 Ga0501080_0021065 Ga0501080_0021065_3853_4983 356
799 3300049742 Ga0501080_0029621 Ga0501080_0029621_2469_3596 356
800 3300049742 Ga0501080_0039338 Ga0501080_0039338_320_1402 356
801 3300049743 Ga0501081_0009676 Ga0501081_0009676_4764_5846 356
802 3300049743 Ga0501081_0011656 Ga0501081_0011656_2157_3239 356
803 3300049743 Ga0501081_0045969 Ga0501081_0045969_1715_2794 356
804 3300049744 Ga0501083_0002181 Ga0501083_0002181_9212_10339 356
805 3300049744 Ga0501083_0003816 Ga0501083_0003816_6619_7749 356
806 3300049823 Ga0501044_0136559 Ga0501044_0136559_1154_2281 356
807 3300049824 Ga0501045_0000228 Ga0501045_0000228_15991_17073 356
808 3300049824 Ga0501045_0036968 Ga0501045_0036968_1089_2171 356
809 3300050493 nmdc:mga0k408_12630_c1 nmdc:mga0k408_12630_c1_477_1607 356
810 3300050507 nmdc:mga05p37_10465_c1 nmdc:mga05p37_10465_c1_3252_4331 356
811 3300050507 nmdc:mga05p37_115006_c1 nmdc:mga05p37_115006_c1_1580_2662 356
812 3300050507 nmdc:mga05p37_156768_c1 nmdc:mga05p37_156768_c1_950_2029 356
813 3300050507 nmdc:mga05p37_207882_c1 nmdc:mga05p37_207882_c1_27_1106 356
814 3300050507 nmdc:mga05p37_248738_c1 nmdc:mga05p37_248738_c1_25_1098 356
815 3300050507 nmdc:mga05p37_3059_c2 nmdc:mga05p37_3059_c2_149_1228 356
816 3300050507 nmdc:mga05p37_38019_c1 nmdc:mga05p37_38019_c1_2142_3221 356
817 3300050507 nmdc:mga05p37_393266_c1 nmdc:mga05p37_393266_c1_110_1192 356
818 3300050507 nmdc:mga05p37_418646_c1 nmdc:mga05p37_418646_c1_345_1424 356
819 3300050507 nmdc:mga05p37_6210_c1 nmdc:mga05p37_6210_c1_2813_3892 356
820 3300050507 nmdc:mga05p37_7013_c1 nmdc:mga05p37_7013_c1_10745_11824 356
821 3300050508 nmdc:mga09592_30515_c1 nmdc:mga09592_30515_c1_1761_2840 356
822 3300050508 nmdc:mga09592_6449_c1 nmdc:mga09592_6449_c1_456_1535 356
823 3300050508 nmdc:mga09592_6819_c1 nmdc:mga09592_6819_c1_2865_3944 356
824 3300050508 nmdc:mga09592_77104_c1 nmdc:mga09592_77104_c1_1507_2586 356
825 3300050508 nmdc:mga09592_78395_c2 nmdc:mga09592_78395_c2_341_1414 356
826 3300050508 nmdc:mga09592_9752_c1 nmdc:mga09592_9752_c1_1229_2308 356
827 3300050509 nmdc:mga0qj67_12218_c1 nmdc:mga0qj67_12218_c1_5123_6202 356
828 3300050509 nmdc:mga0qj67_127_c1 nmdc:mga0qj67_127_c1_28983_30062 356
829 3300050509 nmdc:mga0qj67_1289_c1 nmdc:mga0qj67_1289_c1_5037_6116 356
830 3300050509 nmdc:mga0qj67_84748_c1 nmdc:mga0qj67_84748_c1_68_1147 356
831 3300050510 nmdc:mga06r32_192601_c1 nmdc:mga06r32_192601_c1_299_1378 356
832 3300050510 nmdc:mga06r32_202032_c1 nmdc:mga06r32_202032_c1_376_1449 356
833 3300050510 nmdc:mga06r32_21770_c1 nmdc:mga06r32_21770_c1_578_1657 356
834 3300050510 nmdc:mga06r32_2863_c1 nmdc:mga06r32_2863_c1_6424_7503 356
835 3300050510 nmdc:mga06r32_321317_c1 nmdc:mga06r32_321317_c1_373_1452 356
836 3300050510 nmdc:mga06r32_334_c1 nmdc:mga06r32_334_c1_32536_33615 356
837 3300050510 nmdc:mga06r32_39383_c1 nmdc:mga06r32_39383_c1_1361_2440 356
838 3300050511 nmdc:mga08y16_13554_c1 nmdc:mga08y16_13554_c1_771_1898 356
839 3300050511 nmdc:mga08y16_24503_c1 nmdc:mga08y16_24503_c1_3664_4743 356
840 3300050511 nmdc:mga08y16_31776_c1 nmdc:mga08y16_31776_c1_593_1672 356
841 3300050511 nmdc:mga08y16_3543_c1 nmdc:mga08y16_3543_c1_7151_8230 356
842 3300050512 nmdc:mga0n895_101801_c1 nmdc:mga0n895_101801_c1_598_1677 356
843 3300050512 nmdc:mga0n895_18895_c1 nmdc:mga0n895_18895_c1_2852_3931 356
844 3300050512 nmdc:mga0n895_27307_c1 nmdc:mga0n895_27307_c1_90_1169 356
845 3300050512 nmdc:mga0n895_4597_c1 nmdc:mga0n895_4597_c1_9180_10262 356
846 3300050513 nmdc:mga0rr50_124729_c1 nmdc:mga0rr50_124729_c1_540_1622 356
847 3300050513 nmdc:mga0rr50_1639_c1 nmdc:mga0rr50_1639_c1_3121_4203 356
848 3300050513 nmdc:mga0rr50_30495_c1 nmdc:mga0rr50_30495_c1_219_1298 356
849 3300050513 nmdc:mga0rr50_43348_c1 nmdc:mga0rr50_43348_c1_89_1168 356
850 3300050513 nmdc:mga0rr50_44319_c1 nmdc:mga0rr50_44319_c1_1830_2909 356
851 3300050513 nmdc:mga0rr50_9725_c1 nmdc:mga0rr50_9725_c1_683_1765 356
852 3300050514 nmdc:mga08x19_107854_c1 nmdc:mga08x19_107854_c1_47_1129 356
853 3300050514 nmdc:mga08x19_36554_c1 nmdc:mga08x19_36554_c1_1520_2599 356
854 3300050514 nmdc:mga08x19_52576_c1 nmdc:mga08x19_52576_c1_1501_2580 356
855 3300050515 nmdc:mga0a205_1638_c1 nmdc:mga0a205_1638_c1_11315_12397 356
856 3300050515 nmdc:mga0a205_218413_c1 nmdc:mga0a205_218413_c1_123_1205 356
857 3300050515 nmdc:mga0a205_230184_c1 nmdc:mga0a205_230184_c1_240_1319 356
858 3300050515 nmdc:mga0a205_26998_c1 nmdc:mga0a205_26998_c1_2298_3377 356
859 3300050515 nmdc:mga0a205_30820_c1 nmdc:mga0a205_30820_c1_1066_2145 356
860 3300050515 nmdc:mga0a205_392185_c1 nmdc:mga0a205_392185_c1_104_1183 356
861 3300050515 nmdc:mga0a205_66246_c1 nmdc:mga0a205_66246_c1_1409_2488 356
862 3300050515 nmdc:mga0a205_71444_c1 nmdc:mga0a205_71444_c1_629_1708 356
863 3300050515 nmdc:mga0a205_72737_c1 nmdc:mga0a205_72737_c1_184_1263 356
864 3300050515 nmdc:mga0a205_9316_c1 nmdc:mga0a205_9316_c1_6632_7711 356
865 3300053080 Ga0500635_0065829 Ga0500635_0065829_113_1243 356
866 3300053088 Ga0500644_0003290 Ga0500644_0003290_931_2061 356
867 3300053103 Ga0500555_017352 Ga0500555_017352_919_2049 356
868 3300054114 Ga0501084_0000172 Ga0501084_0000172_8906_10033 356
869 3300054114 Ga0501084_0000281 Ga0501084_0000281_7593_8723 356
870 3300054114 Ga0501084_0004324 Ga0501084_0004324_3186_4268 356
871 3300054114 Ga0501084_0029219 Ga0501084_0029219_190_1317 356
872 3300054114 Ga0501084_0087705 Ga0501084_0087705_459_1538 356
873 3300060353 Ga0501082_0000359 Ga0501082_0000359_25831_26913 356
874 3300060353 Ga0501082_0039533 Ga0501082_0039533_77_1204 356
875 3300061734 Ga0530510_0004754 Ga0530510_0004754_5397_6479 356
876 3300061734 Ga0530510_0019295 Ga0530510_0019295_453_1535 356
877 3300061734 Ga0530510_0019501 Ga0530510_0019501_2544_3671 356
878 3300061734 Ga0530510_0028964 Ga0530510_0028964_1549_2631 356
879 3300061734 Ga0530510_0029526 Ga0530510_0029526_1168_2247 356
880 3300061734 Ga0530510_0181325 Ga0530510_0181325_239_1318 356
881 3300005293 Ga0065715_10132415 Ga0065715_101324151 357
882 3300005295 Ga0065707_10000785 Ga0065707_1000078515 357
883 3300005327 Ga0070658_10028548 Ga0070658_100285484 357
884 3300005328 Ga0070676_10011919 Ga0070676_100119193 357
885 3300005330 Ga0070690_100009599 Ga0070690_1000095994 357
886 3300005330 Ga0070690_100033354 Ga0070690_1000333543 357
887 3300005331 Ga0070670_100021259 Ga0070670_1000212594 357
888 3300005333 Ga0070677_10002570 Ga0070677_100025703 357
889 3300005336 Ga0070680_100120857 Ga0070680_1001208572 357
890 3300005337 Ga0070682_100104513 Ga0070682_1001045132 357
891 3300005338 Ga0068868_100250795 Ga0068868_1002507952 357
892 3300005339 Ga0070660_100041563 Ga0070660_1000415632 357
893 3300005339 Ga0070660_100045875 Ga0070660_1000458753 357
894 3300005340 Ga0070689_100005158 Ga0070689_1000051586 357
895 3300005340 Ga0070689_100168068 Ga0070689_1001680682 357
896 3300005343 Ga0070687_100008427 Ga0070687_1000084273 357
897 3300005343 Ga0070687_100010457 Ga0070687_1000104573 357
898 3300005344 Ga0070661_100001616 Ga0070661_10000161615 357
899 3300005344 Ga0070661_100012698 Ga0070661_1000126984 357
900 3300005344 Ga0070661_100092135 Ga0070661_1000921352 357
901 3300005347 Ga0070668_100346633 Ga0070668_1003466331 357
902 3300005353 Ga0070669_100074789 Ga0070669_1000747891 357
903 3300005354 Ga0070675_100024682 Ga0070675_1000246824 357
904 3300005354 Ga0070675_100196399 Ga0070675_1001963991 357
905 3300005355 Ga0070671_100020159 Ga0070671_1000201592 357
906 3300005356 Ga0070674_100000416 Ga0070674_10000041620 357
907 3300005356 Ga0070674_100096079 Ga0070674_1000960791 357
908 3300005356 Ga0070674_100097643 Ga0070674_1000976432 357
909 3300005364 Ga0070673_100004710 Ga0070673_1000047104 357
910 3300005367 Ga0070667_100007693 Ga0070667_1000076937 357
911 3300005367 Ga0070667_100017771 Ga0070667_1000177714 357
912 3300005438 Ga0070701_10023634 Ga0070701_100236342 357
913 3300005438 Ga0070701_10130626 Ga0070701_101306262 357
914 3300005440 Ga0070705_100020374 Ga0070705_1000203741 357
915 3300005441 Ga0070700_100208461 Ga0070700_1002084611 357
916 3300005444 Ga0070694_100017612 Ga0070694_1000176123 357
917 3300005445 Ga0070708_100001538 Ga0070708_10000153818 357
918 3300005445 Ga0070708_100004626 Ga0070708_1000046266 357
919 3300005445 Ga0070708_100053137 Ga0070708_1000531371 357
920 3300005445 Ga0070708_100092020 Ga0070708_1000920202 357
921 3300005445 Ga0070708_100114046 Ga0070708_1001140462 357
922 3300005445 Ga0070708_100259164 Ga0070708_1002591642 357
923 3300005455 Ga0070663_100055639 Ga0070663_1000556392 357
924 3300005456 Ga0070678_100006207 Ga0070678_1000062071 357
925 3300005457 Ga0070662_100074496 Ga0070662_1000744962 357
926 3300005458 Ga0070681_10021082 Ga0070681_100210823 357
927 3300005459 Ga0068867_100001801 Ga0068867_10000180111 357
928 3300005459 Ga0068867_100104103 Ga0068867_1001041032 357
929 3300005467 Ga0070706_100014801 Ga0070706_1000148012 357
930 3300005467 Ga0070706_100043420 Ga0070706_1000434202 357
931 3300005467 Ga0070706_100181262 Ga0070706_1001812622 357
932 3300005467 Ga0070706_100221547 Ga0070706_1002215472 357
933 3300005468 Ga0070707_100000018 Ga0070707_100000018105 357
934 3300005468 Ga0070707_100001411 Ga0070707_10000141114 357
935 3300005468 Ga0070707_100004567 Ga0070707_1000045675 357
936 3300005468 Ga0070707_100047514 Ga0070707_1000475143 357
937 3300005471 Ga0070698_100000895 Ga0070698_10000089520 357
938 3300005471 Ga0070698_100003431 Ga0070698_10000343119 357
939 3300005471 Ga0070698_100011560 Ga0070698_1000115608 357
940 3300005471 Ga0070698_100018461 Ga0070698_1000184612 357
941 3300005518 Ga0070699_100002663 Ga0070699_10000266315 357
942 3300005518 Ga0070699_100003215 Ga0070699_1000032159 357
943 3300005518 Ga0070699_100008261 Ga0070699_1000082613 357
944 3300005518 Ga0070699_100014268 Ga0070699_1000142684 357
945 3300005518 Ga0070699_100021910 Ga0070699_1000219103 357
946 3300005518 Ga0070699_100029367 Ga0070699_1000293672 357
947 3300005530 Ga0070679_100109519 Ga0070679_1001095192 357
948 3300005535 Ga0070684_100367834 Ga0070684_1003678341 357
949 3300005536 Ga0070697_100002969 Ga0070697_1000029696 357
950 3300005536 Ga0070697_100006928 Ga0070697_1000069284 357
951 3300005536 Ga0070697_100014714 Ga0070697_1000147143 357
952 3300005536 Ga0070697_100023092 Ga0070697_1000230924 357
953 3300005536 Ga0070697_100048114 Ga0070697_1000481143 357
954 3300005536 Ga0070697_100060358 Ga0070697_1000603582 357
955 3300005536 Ga0070697_100206960 Ga0070697_1002069602 357
956 3300005543 Ga0070672_100001791 Ga0070672_1000017914 357
957 3300005544 Ga0070686_100003770 Ga0070686_1000037706 357
958 3300005545 Ga0070695_100004520 Ga0070695_1000045203 357
959 3300005548 Ga0070665_100137853 Ga0070665_1001378532 357
960 3300005549 Ga0070704_100004113 Ga0070704_1000041133 357
961 3300005549 Ga0070704_100031063 Ga0070704_1000310632 357
962 3300005549 Ga0070704_100036470 Ga0070704_1000364702 357
963 3300005549 Ga0070704_100059854 Ga0070704_1000598542 357
964 3300005564 Ga0070664_100061123 Ga0070664_1000611233 357
965 3300005615 Ga0070702_100031545 Ga0070702_1000315453 357
966 3300005617 Ga0068859_100043179 Ga0068859_1000431793 357
967 3300005618 Ga0068864_100245376 Ga0068864_1002453762 357
968 3300005718 Ga0068866_10133955 Ga0068866_101339552 357
969 3300005719 Ga0068861_100147603 Ga0068861_1001476032 357
970 3300005840 Ga0068870_10137066 Ga0068870_101370661 357
971 3300005843 Ga0068860_100059103 Ga0068860_1000591032 357
972 3300005937 Ga0081455_10000594 Ga0081455_1000059430 357
973 3300005985 Ga0081539_10001199 Ga0081539_1000119943 357
974 3300005985 Ga0081539_10001564 Ga0081539_1000156416 357
975 3300005985 Ga0081539_10021436 Ga0081539_100214363 357
976 3300006058 Ga0075432_10043455 Ga0075432_100434552 357
977 3300006163 Ga0070715_10050825 Ga0070715_100508252 357
978 3300006237 Ga0097621_100009993 Ga0097621_1000099934 357
979 3300006237 Ga0097621_100016968 Ga0097621_1000169683 357
980 3300006358 Ga0068871_100002252 Ga0068871_1000022527 357
981 3300006358 Ga0068871_100016996 Ga0068871_1000169962 357
982 3300006844 Ga0075428_100003882 Ga0075428_10000388213 357
983 3300006844 Ga0075428_100008653 Ga0075428_1000086539 357
984 3300006844 Ga0075428_100022633 Ga0075428_1000226332 357
985 3300006844 Ga0075428_100073386 Ga0075428_1000733862 357
986 3300006844 Ga0075428_100121683 Ga0075428_1001216832 357
987 3300006844 Ga0075428_100185782 Ga0075428_1001857822 357
988 3300006846 Ga0075430_100001325 Ga0075430_10000132511 357
989 3300006846 Ga0075430_100029980 Ga0075430_1000299803 357
990 3300006846 Ga0075430_100060279 Ga0075430_1000602793 357
991 3300006846 Ga0075430_100067241 Ga0075430_1000672413 357
992 3300006847 Ga0075431_100002074 Ga0075431_1000020743 357
993 3300006847 Ga0075431_100010928 Ga0075431_1000109287 357
994 3300006847 Ga0075431_100013279 Ga0075431_1000132792 357
995 3300006847 Ga0075431_100015426 Ga0075431_1000154263 357
996 3300006852 Ga0075433_10000107 Ga0075433_1000010740 357
997 3300006852 Ga0075433_10001847 Ga0075433_100018479 357
998 3300006852 Ga0075433_10013281 Ga0075433_100132812 357
999 3300006852 Ga0075433_10099863 Ga0075433_100998632 357
1000 3300006871 Ga0075434_100046998 Ga0075434_1000469982 357
1001 3300006871 Ga0075434_100144486 Ga0075434_1001444862 357
1002 3300006871 Ga0075434_100172754 Ga0075434_1001727542 357
1003 3300006871 Ga0075434_100239892 Ga0075434_1002398922 357
1004 3300006880 Ga0075429_100003751 Ga0075429_1000037519 357
1005 3300006880 Ga0075429_100014968 Ga0075429_1000149684 357
1006 3300006880 Ga0075429_100024998 Ga0075429_1000249983 357
1007 3300006880 Ga0075429_100041443 Ga0075429_1000414433 357
1008 3300006880 Ga0075429_100056339 Ga0075429_1000563392 357
1009 3300006880 Ga0075429_100072724 Ga0075429_1000727243 357
1010 3300006880 Ga0075429_100144286 Ga0075429_1001442862 357
1011 3300006881 Ga0068865_100050747 Ga0068865_1000507472 357
1012 3300006914 Ga0075436_100001281 Ga0075436_1000012815 357
1013 3300006914 Ga0075436_100014868 Ga0075436_1000148682 357
1014 3300006914 Ga0075436_100038258 Ga0075436_1000382582 357
1015 3300006914 Ga0075436_100067387 Ga0075436_1000673872 357
1016 3300006931 Ga0097620_100043178 Ga0097620_1000431782 357
1017 3300007076 Ga0075435_100032115 Ga0075435_1000321152 357
1018 3300007076 Ga0075435_100164654 Ga0075435_1001646542 357
1019 3300007265 Ga0099794_10015243 Ga0099794_100152432 357
1020 3300007265 Ga0099794_10062265 Ga0099794_100622652 357
1021 3300007265 Ga0099794_10079703 Ga0099794_100797032 357
1022 3300009094 Ga0111539_10000334 Ga0111539_100003347 357
1023 3300009094 Ga0111539_10023005 Ga0111539_100230056 357
1024 3300009098 Ga0105245_10003582 Ga0105245_100035822 357
1025 3300009147 Ga0114129_10001627 Ga0114129_1000162722 357
1026 3300009147 Ga0114129_10005728 Ga0114129_1000572814 357
1027 3300009147 Ga0114129_10013635 Ga0114129_100136355 357
1028 3300009147 Ga0114129_10014404 Ga0114129_100144042 357
1029 3300009147 Ga0114129_10019349 Ga0114129_100193496 357
1030 3300009147 Ga0114129_10019679 Ga0114129_100196796 357
1031 3300009147 Ga0114129_10050242 Ga0114129_100502423 357
1032 3300009147 Ga0114129_10061150 Ga0114129_100611503 357
1033 3300009147 Ga0114129_10062274 Ga0114129_100622743 357
1034 3300009147 Ga0114129_10066004 Ga0114129_100660041 357
1035 3300009147 Ga0114129_10108015 Ga0114129_101080152 357
1036 3300009147 Ga0114129_10139168 Ga0114129_101391683 357
1037 3300009147 Ga0114129_10618182 Ga0114129_106181822 357
1038 3300009148 Ga0105243_10003345 Ga0105243_100033459 357
1039 3300009176 Ga0105242_10002043 Ga0105242_100020433 357
1040 3300009177 Ga0105248_10233469 Ga0105248_102334692 357
1041 3300009553 Ga0105249_10070771 Ga0105249_100707713 357
1042 3300009553 Ga0105249_10179463 Ga0105249_101794632 357
1043 3300013102 Ga0157371_10014280 Ga0157371_100142802 357
1044 3300013296 Ga0157374_10008705 Ga0157374_100087057 357
1045 3300013296 Ga0157374_10051313 Ga0157374_100513132 357
1046 3300013297 Ga0157378_10000040 Ga0157378_1000004077 357
1047 3300013297 Ga0157378_10002668 Ga0157378_100026683 357
1048 3300013297 Ga0157378_10463111 Ga0157378_104631111 357
1049 3300013306 Ga0163162_10082703 Ga0163162_100827032 357
1050 3300014326 Ga0157380_10013334 Ga0157380_100133344 357
1051 3300014326 Ga0157380_10056310 Ga0157380_100563102 357
1052 3300014745 Ga0157377_10001674 Ga0157377_100016746 357
1053 3300014969 Ga0157376_10051065 Ga0157376_100510653 357
1054 3300014969 Ga0157376_10055270 Ga0157376_100552702 357
1055 3300025315 Ga0207697_10027579 Ga0207697_100275792 357
1056 3300025901 Ga0207688_10003494 Ga0207688_100034944 357
1057 3300025903 Ga0207680_10003106 Ga0207680_100031066 357
1058 3300025907 Ga0207645_10000808 Ga0207645_1000080822 357
1059 3300025907 Ga0207645_10010592 Ga0207645_100105923 357
1060 3300025910 Ga0207684_10000198 Ga0207684_1000019885 357
1061 3300025910 Ga0207684_10000866 Ga0207684_1000086627 357
1062 3300025910 Ga0207684_10001042 Ga0207684_1000104227 357
1063 3300025910 Ga0207684_10362989 Ga0207684_103629892 357
1064 3300025912 Ga0207707_10096984 Ga0207707_100969842 357
1065 3300025917 Ga0207660_10004820 Ga0207660_100048205 357
1066 3300025918 Ga0207662_10016959 Ga0207662_100169593 357
1067 3300025919 Ga0207657_10002541 Ga0207657_1000254116 357
1068 3300025919 Ga0207657_10020299 Ga0207657_100202994 357
1069 3300025920 Ga0207649_10144123 Ga0207649_101441232 357
1070 3300025922 Ga0207646_10000072 Ga0207646_10000072107 357
1071 3300025922 Ga0207646_10000181 Ga0207646_1000018134 357
1072 3300025922 Ga0207646_10001790 Ga0207646_1000179023 357
1073 3300025922 Ga0207646_10112712 Ga0207646_101127122 357
1074 3300025925 Ga0207650_10036866 Ga0207650_100368663 357
1075 3300025925 Ga0207650_10358642 Ga0207650_103586421 357
1076 3300025926 Ga0207659_10188866 Ga0207659_101888662 357
1077 3300025931 Ga0207644_10060037 Ga0207644_100600372 357
1078 3300025933 Ga0207706_10001096 Ga0207706_100010965 357
1079 3300025933 Ga0207706_10113197 Ga0207706_101131972 357
1080 3300025935 Ga0207709_10064847 Ga0207709_100648471 357
1081 3300025937 Ga0207669_10005720 Ga0207669_100057203 357
1082 3300025939 Ga0207665_10048662 Ga0207665_100486622 357
1083 3300025940 Ga0207691_10000007 Ga0207691_1000000748 357
1084 3300025940 Ga0207691_10001064 Ga0207691_1000106425 357
1085 3300025942 Ga0207689_10001346 Ga0207689_100013465 357
1086 3300025945 Ga0207679_10029295 Ga0207679_100292952 357
1087 3300025945 Ga0207679_10029785 Ga0207679_100297852 357
1088 3300025960 Ga0207651_10000138 Ga0207651_1000013832 357
1089 3300025972 Ga0207668_10064022 Ga0207668_100640222 357
1090 3300026067 Ga0207678_10044575 Ga0207678_100445752 357
1091 3300026067 Ga0207678_10215905 Ga0207678_102159051 357
1092 3300026075 Ga0207708_10000051 Ga0207708_1000005199 357
1093 3300026089 Ga0207648_10000101 Ga0207648_1000010165 357
1094 3300026089 Ga0207648_10041813 Ga0207648_100418133 357
1095 3300026116 Ga0207674_10020561 Ga0207674_100205615 357
1096 3300026116 Ga0207674_10286055 Ga0207674_102860552 357
1097 3300026118 Ga0207675_100184859 Ga0207675_1001848592 357
1098 3300026121 Ga0207683_10000229 Ga0207683_1000022929 357
1099 3300026121 Ga0207683_10007424 Ga0207683_100074242 357
1100 3300027360 Ga0209969_1000130 Ga0209969_10001301 357
1101 3300027364 Ga0209967_1000043 Ga0209967_10000433 357
1102 3300027364 Ga0209967_1006257 Ga0209967_10062572 357
1103 3300027378 Ga0209981_1000074 Ga0209981_10000748 357
1104 3300027395 Ga0209996_1000042 Ga0209996_100004211 357
1105 3300027424 Ga0209984_1000006 Ga0209984_100000622 357
1106 3300027424 Ga0209984_1005788 Ga0209984_10057882 357
1107 3300027462 Ga0210000_1000039 Ga0210000_10000395 357
1108 3300027471 Ga0209995_1000776 Ga0209995_10007762 357
1109 3300027526 Ga0209968_1000027 Ga0209968_100002725 357
1110 3300027543 Ga0209999_1000034 Ga0209999_10000346 357
1111 3300027552 Ga0209982_1000426 Ga0209982_10004264 357
1112 3300027614 Ga0209970_1000118 Ga0209970_10001186 357
1113 3300027671 Ga0209588_1035841 Ga0209588_10358412 357
1114 3300027682 Ga0209971_1000642 Ga0209971_10006427 357
1115 3300027682 Ga0209971_1002702 Ga0209971_10027023 357
1116 3300027695 Ga0209966_1000016 Ga0209966_100001656 357
1117 3300027695 Ga0209966_1002173 Ga0209966_10021732 357
1118 3300027717 Ga0209998_10000021 Ga0209998_1000002128 357
1119 3300027876 Ga0209974_10000003 Ga0209974_100000039 357
1120 3300027876 Ga0209974_10001085 Ga0209974_100010856 357
1121 3300027907 Ga0207428_10000598 Ga0207428_1000059840 357
1122 3300028379 Ga0268266_10100250 Ga0268266_101002502 357
1123 3300028379 Ga0268266_10225019 Ga0268266_102250192 357
1124 3300028380 Ga0268265_10032719 Ga0268265_100327192 357
1125 3300028577 Ga0265318_10023573 Ga0265318_100235732 357
1126 3300031235 Ga0265330_10014266 Ga0265330_100142663 357
1127 3300031238 Ga0265332_10000267 Ga0265332_1000026711 357
1128 3300031239 Ga0265328_10000918 Ga0265328_100009183 357
1129 3300031241 Ga0265325_10010359 Ga0265325_100103594 357
1130 3300031242 Ga0265329_10009439 Ga0265329_100094392 357
1131 3300031242 Ga0265329_10029597 Ga0265329_100295972 357
1132 3300031250 Ga0265331_10000321 Ga0265331_1000032125 357
1133 3300031251 Ga0265327_10016003 Ga0265327_100160034 357
1134 3300031251 Ga0265327_10056670 Ga0265327_100566702 357
1135 3300031344 Ga0265316_10001017 Ga0265316_100010179 357
1136 3300031548 Ga0307408_100035887 Ga0307408_1000358873 357
1137 3300031548 Ga0307408_100266143 Ga0307408_1002661432 357
1138 3300031665 Ga0316575_10011631 Ga0316575_100116312 357
1139 3300031665 Ga0316575_10024235 Ga0316575_100242353 357
1140 3300031711 Ga0265314_10000866 Ga0265314_100008667 357
1141 3300031711 Ga0265314_10065047 Ga0265314_100650472 357
1142 3300031712 Ga0265342_10004273 Ga0265342_100042734 357
1143 3300031727 Ga0316576_10000590 Ga0316576_100005903 357
1144 3300031727 Ga0316576_10007679 Ga0316576_100076794 357
1145 3300031727 Ga0316576_10010305 Ga0316576_100103054 357
1146 3300031727 Ga0316576_10066793 Ga0316576_100667932 357
1147 3300031728 Ga0316578_10004926 Ga0316578_100049266 357
1148 3300031728 Ga0316578_10027605 Ga0316578_100276052 357
1149 3300031728 Ga0316578_10028198 Ga0316578_100281982 357
1150 3300031731 Ga0307405_10002064 Ga0307405_100020645 357
1151 3300031731 Ga0307405_10106827 Ga0307405_101068272 357
1152 3300031733 Ga0316577_10007022 Ga0316577_100070223 357
1153 3300031733 Ga0316577_10010473 Ga0316577_100104733 357
1154 3300031733 Ga0316577_10020032 Ga0316577_100200323 357
1155 3300031733 Ga0316577_10063098 Ga0316577_100630982 357
1156 3300031901 Ga0307406_10022251 Ga0307406_100222512 357
1157 3300031901 Ga0307406_10059558 Ga0307406_100595582 357
1158 3300031911 Ga0307412_10000625 Ga0307412_1000062510 357
1159 3300031995 Ga0307409_100008071 Ga0307409_1000080715 357
1160 3300031995 Ga0307409_100158240 Ga0307409_1001582402 357
1161 3300032002 Ga0307416_100004333 Ga0307416_1000043331 357
1162 3300032002 Ga0307416_100043362 Ga0307416_1000433622 357
1163 3300032004 Ga0307414_10098993 Ga0307414_100989932 357
1164 3300032005 Ga0307411_10003939 Ga0307411_100039392 357
1165 3300032139 Ga0316580_10030778 Ga0316580_100307781 357
1166 3300035083 Ga0373926_0003654 Ga0373926_0003654_3819_4895 357
1167 3300035088 Ga0373940_0021750 Ga0373940_0021750_198_1274 357
1168 3300035115 Ga0373941_0013027 Ga0373941_0013027_767_1843 357
1169 3300035118 Ga0373954_0017115 Ga0373954_0017115_2154_3230 357
1170 3300035118 Ga0373954_0020324 Ga0373954_0020324_1323_2399 357
1171 3300035119 Ga0373956_0005379 Ga0373956_0005379_3434_4510 357
1172 3300035170 Ga0373943_0013945 Ga0373943_0013945_2130_3206 357
1173 3300035171 Ga0373946_0029802 Ga0373946_0029802_886_1962 357
1174 3300035172 Ga0373955_0014622 Ga0373955_0014622_768_1844 357
1175 3300035398 Ga0316574_0031736 Ga0316574_0031736_1704_2780 357
1176 3300035398 Ga0316574_0060957 Ga0316574_0060957_75_1151 357
1177 3300035692 Ga0373935_0035961 Ga0373935_0035961_2001_3077 357
1178 3300035695 Ga0373927_0000866 Ga0373927_0000866_6942_8018 357
1179 3300035695 Ga0373927_0054183 Ga0373927_0054183_799_1875 357
1180 3300035724 Ga0373933_0162781 Ga0373933_0162781_327_1403 357
1181 3300035725 Ga0373947_0001959 Ga0373947_0001959_1728_2804 357
1182 3300035725 Ga0373947_0039476 Ga0373947_0039476_123_1199 357
1183 3300036401 Ga0373937_0057448 Ga0373937_0057448_454_1530 357
1184 3300036401 Ga0373937_0086937 Ga0373937_0086937_1276_2352 357
1185 3300036647 Ga0316582_0023731 Ga0316582_0023731_2303_3382 357
1186 3300036647 Ga0316582_0194361 Ga0316582_0194361_233_1312 357
1187 3300036712 Ga0316584_0011784 Ga0316584_0011784_130_1209 357
1188 3300036712 Ga0316584_0063843 Ga0316584_0063843_1438_2517 357
1189 3300036712 Ga0316584_0078408 Ga0316584_0078408_767_1897 357
1190 3300036712 Ga0316584_0086442 Ga0316584_0086442_427_1506 357
1191 3300036712 Ga0316584_0100447 Ga0316584_0100447_708_1787 357
1192 3300037068 Ga0373925_0002133 Ga0373925_0002133_13568_14644 357
1193 3300037068 Ga0373925_0015514 Ga0373925_0015514_408_1484 357
1194 3300037471 Ga0395905_0027876 Ga0395905_0027876_4071_5153 357
1195 3300037471 Ga0395905_0094759 Ga0395905_0094759_142_1224 357
1196 3300038725 Ga0400484_34638 Ga0400484_34638_7053_8132 357
1197 3300038725 Ga0400484_40454 Ga0400484_40454_262_1341 357
1198 3300038727 Ga0400491_22990 Ga0400491_22990_355_1434 357
1199 3300038741 Ga0400488_44983 Ga0400488_44983_1805_2884 357
1200 3300039062 Ga0400483_262255 Ga0400483_262255_905_1984 357
1201 3300039062 Ga0400483_266651 Ga0400483_266651_842_1918 357
1202 3300039093 Ga0400489_27790 Ga0400489_27790_75884_76963 357
1203 3300039093 Ga0400489_35047 Ga0400489_35047_65948_67027 357
1204 3300041407 Ga0439447_007486 Ga0439447_007486_2202_3278 357
1205 3300041410 Ga0439461_0002413 Ga0439461_0002413_1762_2838 357
1206 3300042008 Ga0439450_007804 Ga0439450_007804_846_1922 357
1207 3300042010 Ga0439452_001836 Ga0439452_001836_5752_6828 357
1208 3300042011 Ga0439454_004315 Ga0439454_004315_239_1315 357
1209 3300042137 Ga0450902_018235 Ga0450902_018235_46_1122 357
1210 3300042156 Ga0439446_0003240 Ga0439446_0003240_2866_3942 357
1211 3300042435 Ga0439434_0004098 Ga0439434_0004098_2275_3351 357
1212 3300042876 Ga0451577_0001410 Ga0451577_0001410_4359_5435 357
1213 3300042876 Ga0451577_0007075 Ga0451577_0007075_2251_3327 357
1214 3300042876 Ga0451577_0089244 Ga0451577_0089244_579_1655 357
1215 3300044673 Ga0453683_0000110 Ga0453683_0000110_45850_46926 357
1216 3300044673 Ga0453683_0000154 Ga0453683_0000154_81413_82489 357
1217 3300044673 Ga0453683_0000355 Ga0453683_0000355_40250_41326 357
1218 3300044673 Ga0453683_0008407 Ga0453683_0008407_3846_4922 357
1219 3300044673 Ga0453683_0187768 Ga0453683_0187768_146_1222 357
1220 3300044712 Ga0453684_0000254 Ga0453684_0000254_103419_104495 357
1221 3300044712 Ga0453684_0000403 Ga0453684_0000403_166302_167378 357
1222 3300044712 Ga0453684_0002601 Ga0453684_0002601_18453_19529 357
1223 3300044712 Ga0453684_0008974 Ga0453684_0008974_12676_13752 357
1224 3300044712 Ga0453684_0009290 Ga0453684_0009290_5461_6537 357
1225 3300044712 Ga0453684_0013077 Ga0453684_0013077_10061_11137 357
1226 3300044712 Ga0453684_0020619 Ga0453684_0020619_8292_9368 357
1227 3300044712 Ga0453684_0021895 Ga0453684_0021895_5151_6227 357
1228 3300044712 Ga0453684_0026442 Ga0453684_0026442_5426_6502 357
1229 3300044712 Ga0453684_0076505 Ga0453684_0076505_2578_3654 357
1230 3300044712 Ga0453684_0101896 Ga0453684_0101896_1426_2502 357
1231 3300044712 Ga0453684_0108818 Ga0453684_0108818_1982_3061 357
1232 3300044712 Ga0453684_0181299 Ga0453684_0181299_872_1948 357
1233 3300044712 Ga0453684_0349870 Ga0453684_0349870_465_1541 357
1234 3300044712 Ga0453684_0381320 Ga0453684_0381320_137_1213 357
1235 3300045051 Ga0451576_0000462 Ga0451576_0000462_65555_66631 357
1236 3300045051 Ga0451576_0003322 Ga0451576_0003322_3745_4821 357
1237 3300045051 Ga0451576_0056512 Ga0451576_0056512_2030_3106 357
1238 3300045051 Ga0451576_0088009 Ga0451576_0088009_1135_2211 357
1239 3300045051 Ga0451576_0135262 Ga0451576_0135262_253_1329 357
1240 3300045051 Ga0451576_0413525 Ga0451576_0413525_79_1155 357
1241 3300046459 Ga0495629_0013071 Ga0495629_0013071_3957_5033 357
1242 3300046472 Ga0495580_0062032 Ga0495580_0062032_863_1945 357
1243 3300046472 Ga0495580_0134066 Ga0495580_0134066_514_1590 357
1244 3300046499 Ga0495594_0030566 Ga0495594_0030566_731_1807 357
1245 3300046664 Ga0495659_0022728 Ga0495659_0022728_945_2021 357
1246 3300046683 Ga0495658_0170126 Ga0495658_0170126_114_1190 357
1247 3300046690 Ga0495624_0045406 Ga0495624_0045406_78_1154 357
1248 3300046691 Ga0495670_0029735 Ga0495670_0029735_962_2038 357
1249 3300048905 Ga0496102_0152284 Ga0496102_0152284_293_1369 357
1250 3300048907 Ga0496104_0149545 Ga0496104_0149545_718_1794 357
1251 3300048908 Ga0496105_0122474 Ga0496105_0122474_253_1329 357
1252 3300048909 Ga0496106_0041831 Ga0496106_0041831_636_1712 357
1253 3300048910 Ga0496107_0044779 Ga0496107_0044779_707_1783 357
1254 3300048911 Ga0496108_0022854 Ga0496108_0022854_2907_3983 357
1255 3300048912 Ga0496109_0031239 Ga0496109_0031239_2560_3636 357
1256 3300048915 Ga0496112_0031377 Ga0496112_0031377_1654_2730 357
1257 3300048917 Ga0496114_0002536 Ga0496114_0002536_3189_4265 357
1258 3300048918 Ga0496115_0152335 Ga0496115_0152335_730_1806 357
1259 3300049513 Ga0501290_000073 Ga0501290_000073_4127_5203 357
1260 3300049514 Ga0501291_000019 Ga0501291_000019_16580_17656 357
1261 3300049515 Ga0501292_000081 Ga0501292_000081_15013_16089 357
1262 3300049516 Ga0501293_000364 Ga0501293_000364_2258_3334 357
1263 3300049518 Ga0501295_000011 Ga0501295_000011_10059_11135 357
1264 3300049519 Ga0501296_000020 Ga0501296_000020_157_1233 357
1265 3300049520 Ga0501297_000006 Ga0501297_000006_13302_14378 357
1266 3300049521 Ga0501298_000012 Ga0501298_000012_7460_8536 357
1267 3300049522 Ga0501299_000055 Ga0501299_000055_7325_8401 357
1268 3300049523 Ga0501300_000036 Ga0501300_000036_12636_13712 357
1269 3300049524 Ga0501301_000035 Ga0501301_000035_3457_4533 357
1270 3300049525 Ga0501302_000536 Ga0501302_000536_10_1086 357
1271 3300049568 Ga0501031_0002612 Ga0501031_0002612_10019_11095 357
1272 3300049568 Ga0501031_0013249 Ga0501031_0013249_593_1669 357
1273 3300049569 Ga0501032_0011926 Ga0501032_0011926_2100_3176 357
1274 3300049569 Ga0501032_0031422 Ga0501032_0031422_1452_2528 357
1275 3300049572 Ga0501036_0011110 Ga0501036_0011110_4582_5658 357
1276 3300049573 Ga0501037_0022497 Ga0501037_0022497_2194_3270 357
1277 3300049574 Ga0501038_0020858 Ga0501038_0020858_1448_2524 357
1278 3300049574 Ga0501038_0088825 Ga0501038_0088825_1212_2288 357
1279 3300049574 Ga0501038_0097451 Ga0501038_0097451_13_1089 357
1280 3300049575 Ga0501039_0002225 Ga0501039_0002225_324_1400 357
1281 3300049575 Ga0501039_0003779 Ga0501039_0003779_5644_6720 357
1282 3300049575 Ga0501039_0023765 Ga0501039_0023765_2240_3316 357
1283 3300049575 Ga0501039_0026926 Ga0501039_0026926_2680_3756 357
1284 3300049575 Ga0501039_0072083 Ga0501039_0072083_563_1639 357
1285 3300049576 Ga0501040_0031572 Ga0501040_0031572_1600_2682 357
1286 3300049577 Ga0501041_0005293 Ga0501041_0005293_15_1091 357
1287 3300049577 Ga0501041_0006580 Ga0501041_0006580_3148_4224 357
1288 3300049577 Ga0501041_0024294 Ga0501041_0024294_2445_3527 357
1289 3300049577 Ga0501041_0043241 Ga0501041_0043241_484_1560 357
1290 3300049578 Ga0501042_0001451 Ga0501042_0001451_2962_4038 357
1291 3300049578 Ga0501042_0005188 Ga0501042_0005188_5038_6114 357
1292 3300049578 Ga0501042_0035882 Ga0501042_0035882_86_1168 357
1293 3300049578 Ga0501042_0036671 Ga0501042_0036671_1196_2278 357
1294 3300049578 Ga0501042_0047937 Ga0501042_0047937_713_1789 357
1295 3300049578 Ga0501042_0102265 Ga0501042_0102265_542_1624 357
1296 3300049578 Ga0501042_0187498 Ga0501042_0187498_257_1339 357
1297 3300049578 Ga0501042_0196298 Ga0501042_0196298_213_1289 357
1298 3300049579 Ga0501043_0048294 Ga0501043_0048294_224_1300 357
1299 3300049580 Ga0501046_0003759 Ga0501046_0003759_6567_7643 357
1300 3300049580 Ga0501046_0010965 Ga0501046_0010965_5747_6823 357
1301 3300049580 Ga0501046_0021782 Ga0501046_0021782_2159_3235 357
1302 3300049582 Ga0501048_0002502 Ga0501048_0002502_9439_10515 357
1303 3300049582 Ga0501048_0017207 Ga0501048_0017207_1547_2629 357
1304 3300049582 Ga0501048_0055705 Ga0501048_0055705_73_1149 357
1305 3300049584 Ga0501068_0036821 Ga0501068_0036821_1693_2775 357
1306 3300049584 Ga0501068_0115567 Ga0501068_0115567_478_1560 357
1307 3300049585 Ga0501069_0085388 Ga0501069_0085388_327_1409 357
1308 3300049587 Ga0501071_0049057 Ga0501071_0049057_465_1547 357
1309 3300049588 Ga0501072_0005161 Ga0501072_0005161_6876_7958 357
1310 3300049588 Ga0501072_0042698 Ga0501072_0042698_2371_3453 357
1311 3300049590 Ga0501074_0061228 Ga0501074_0061228_1231_2313 357
1312 3300049590 Ga0501074_0183423 Ga0501074_0183423_259_1335 357
1313 3300049591 Ga0501075_0045051 Ga0501075_0045051_874_1950 357
1314 3300049591 Ga0501075_0069843 Ga0501075_0069843_1214_2296 357
1315 3300049592 Ga0501076_0025819 Ga0501076_0025819_104_1186 357
1316 3300049592 Ga0501076_0155286 Ga0501076_0155286_19_1095 357
1317 3300049593 Ga0501077_0109888 Ga0501077_0109888_386_1468 357
1318 3300049650 Ga0501199_000074 Ga0501199_000074_4322_5398 357
1319 3300049651 Ga0501201_000136 Ga0501201_000136_4794_5870 357
1320 3300049652 Ga0501202_000450 Ga0501202_000450_3823_4899 357
1321 3300049653 Ga0501206_000101 Ga0501206_000101_4072_5148 357
1322 3300049654 Ga0501207_004072 Ga0501207_004072_861_1937 357
1323 3300049658 Ga0501211_002470 Ga0501211_002470_587_1663 357
1324 3300049660 Ga0501216_000012 Ga0501216_000012_4904_5980 357
1325 3300049661 Ga0501217_000078 Ga0501217_000078_5629_6705 357
1326 3300049666 Ga0501228_001757 Ga0501228_001757_536_1612 357
1327 3300049668 Ga0501233_000046 Ga0501233_000046_15067_16143 357
1328 3300049669 Ga0501235_001026 Ga0501235_001026_17_1093 357
1329 3300049670 Ga0501236_000099 Ga0501236_000099_5633_6709 357
1330 3300049672 Ga0501239_000961 Ga0501239_000961_899_1975 357
1331 3300049675 Ga0501243_000230 Ga0501243_000230_1633_2709 357
1332 3300049676 Ga0501246_000223 Ga0501246_000223_1466_2542 357
1333 3300049678 Ga0501248_000415 Ga0501248_000415_304_1380 357
1334 3300049679 Ga0501249_000187 Ga0501249_000187_7889_8965 357
1335 3300049681 Ga0501251_000333 Ga0501251_000333_2616_3692 357
1336 3300049682 Ga0501252_002390 Ga0501252_002390_205_1281 357
1337 3300049683 Ga0501253_001835 Ga0501253_001835_943_2019 357
1338 3300049686 Ga0501257_000193 Ga0501257_000193_9976_11052 357
1339 3300049688 Ga0501259_010090 Ga0501259_010090_451_1527 357
1340 3300049689 Ga0501260_000182 Ga0501260_000182_3260_4336 357
1341 3300049690 Ga0501261_000123 Ga0501261_000123_2181_3257 357
1342 3300049703 Ga0501219_001002 Ga0501219_001002_594_1670 357
1343 3300049704 Ga0501221_000143 Ga0501221_000143_920_1996 357
1344 3300049705 Ga0501225_0000158 Ga0501225_0000158_4000_5076 357
1345 3300049706 Ga0501229_000031 Ga0501229_000031_12456_13532 357
1346 3300049708 Ga0501245_002934 Ga0501245_002934_720_1796 357
1347 3300049741 Ga0501079_0003858 Ga0501079_0003858_6874_7956 357
1348 3300049741 Ga0501079_0009206 Ga0501079_0009206_2806_3888 357
1349 3300049741 Ga0501079_0024433 Ga0501079_0024433_1098_2174 357
1350 3300049741 Ga0501079_0058496 Ga0501079_0058496_611_1693 357
1351 3300049741 Ga0501079_0060318 Ga0501079_0060318_36_1118 357
1352 3300049742 Ga0501080_0428642 Ga0501080_0428642_24_1106 357
1353 3300049743 Ga0501081_0018690 Ga0501081_0018690_1067_2149 357
1354 3300049743 Ga0501081_0056422 Ga0501081_0056422_1118_2194 357
1355 3300049743 Ga0501081_0184335 Ga0501081_0184335_410_1492 357
1356 3300049761 Ga0501264_000443 Ga0501264_000443_5174_6250 357
1357 3300049763 Ga0501266_000291 Ga0501266_000291_2043_3119 357
1358 3300049766 Ga0501269_004838 Ga0501269_004838_519_1595 357
1359 3300049767 Ga0501270_000074 Ga0501270_000074_820_1896 357
1360 3300049768 Ga0501271_000663 Ga0501271_000663_426_1502 357
1361 3300049769 Ga0501272_000018 Ga0501272_000018_3260_4336 357
1362 3300049770 Ga0501273_000020 Ga0501273_000020_6062_7138 357
1363 3300049771 Ga0501274_000033 Ga0501274_000033_1482_2558 357
1364 3300049774 Ga0501278_000080 Ga0501278_000080_1428_2504 357
1365 3300049775 Ga0501279_000078 Ga0501279_000078_13438_14514 357
1366 3300049776 Ga0501280_001276 Ga0501280_001276_819_1895 357
1367 3300049777 Ga0501281_00326 Ga0501281_00326_2974_4050 357
1368 3300049778 Ga0501282_000411 Ga0501282_000411_3774_4850 357
1369 3300049779 Ga0501283_000015 Ga0501283_000015_13480_14556 357
1370 3300049822 Ga0501035_0002674 Ga0501035_0002674_2189_3265 357
1371 3300049822 Ga0501035_0036272 Ga0501035_0036272_1453_2529 357
1372 3300049822 Ga0501035_0094255 Ga0501035_0094255_969_2045 357
1373 3300049822 Ga0501035_0121164 Ga0501035_0121164_1056_2132 357
1374 3300049822 Ga0501035_0153133 Ga0501035_0153133_380_1462 357
1375 3300049824 Ga0501045_0027365 Ga0501045_0027365_1217_2299 357
1376 3300049824 Ga0501045_0149239 Ga0501045_0149239_247_1329 357
1377 3300049851 Ga0501212_000346 Ga0501212_000346_2279_3355 357
1378 3300050507 nmdc:mga05p37_13868_c1 nmdc:mga05p37_13868_c1_4365_5441 357
1379 3300050507 nmdc:mga05p37_1693_c1 nmdc:mga05p37_1693_c1_16177_17259 357
1380 3300050507 nmdc:mga05p37_1952_c1 nmdc:mga05p37_1952_c1_4592_5674 357
1381 3300050507 nmdc:mga05p37_2315_c1 nmdc:mga05p37_2315_c1_4919_6001 357
1382 3300050507 nmdc:mga05p37_374141_c1 nmdc:mga05p37_374141_c1_175_1251 357
1383 3300050507 nmdc:mga05p37_42321_c1 nmdc:mga05p37_42321_c1_2016_3092 357
1384 3300050507 nmdc:mga05p37_58690_c1 nmdc:mga05p37_58690_c1_1006_2088 357
1385 3300050507 nmdc:mga05p37_67747_c1 nmdc:mga05p37_67747_c1_1155_2231 357
1386 3300050507 nmdc:mga05p37_86550_c1 nmdc:mga05p37_86550_c1_1520_2602 357
1387 3300050507 nmdc:mga05p37_9045_c1 nmdc:mga05p37_9045_c1_2724_3806 357
1388 3300050508 nmdc:mga09592_13935_c1 nmdc:mga09592_13935_c1_573_1655 357
1389 3300050508 nmdc:mga09592_14121_c1 nmdc:mga09592_14121_c1_3808_4884 357
1390 3300050508 nmdc:mga09592_1654_c1 nmdc:mga09592_1654_c1_9138_10220 357
1391 3300050508 nmdc:mga09592_26125_c1 nmdc:mga09592_26125_c1_3308_4390 357
1392 3300050508 nmdc:mga09592_69096_c1 nmdc:mga09592_69096_c1_1630_2706 357
1393 3300050509 nmdc:mga0qj67_168384_c1 nmdc:mga0qj67_168384_c1_161_1237 357
1394 3300050509 nmdc:mga0qj67_252557_c1 nmdc:mga0qj67_252557_c1_241_1323 357
1395 3300050509 nmdc:mga0qj67_4400_c1 nmdc:mga0qj67_4400_c1_6669_7745 357
1396 3300050509 nmdc:mga0qj67_8153_c1 nmdc:mga0qj67_8153_c1_4097_5179 357
1397 3300050510 nmdc:mga06r32_20824_c1 nmdc:mga06r32_20824_c1_1151_2233 357
1398 3300050510 nmdc:mga06r32_38218_c1 nmdc:mga06r32_38218_c1_239_1321 357
1399 3300050510 nmdc:mga06r32_67571_c1 nmdc:mga06r32_67571_c1_1558_2640 357
1400 3300050511 nmdc:mga08y16_128_c1 nmdc:mga08y16_128_c1_42973_44049 357
1401 3300050511 nmdc:mga08y16_28104_c1 nmdc:mga08y16_28104_c1_4829_5905 357
1402 3300050511 nmdc:mga08y16_48420_c1 nmdc:mga08y16_48420_c1_750_1826 357
1403 3300050512 nmdc:mga0n895_2185_c1 nmdc:mga0n895_2185_c1_9996_11150 357
1404 3300050512 nmdc:mga0n895_324037_c1 nmdc:mga0n895_324037_c1_22_1098 357
1405 3300050512 nmdc:mga0n895_37542_c1 nmdc:mga0n895_37542_c1_885_1961 357
1406 3300050512 nmdc:mga0n895_513_c1 nmdc:mga0n895_513_c1_2050_3132 357
1407 3300050512 nmdc:mga0n895_67663_c1 nmdc:mga0n895_67663_c1_505_1581 357
1408 3300050513 nmdc:mga0rr50_19019_c1 nmdc:mga0rr50_19019_c1_1057_2133 357
1409 3300050513 nmdc:mga0rr50_22117_c1 nmdc:mga0rr50_22117_c1_485_1639 357
1410 3300050513 nmdc:mga0rr50_247211_c1 nmdc:mga0rr50_247211_c1_145_1221 357
1411 3300050513 nmdc:mga0rr50_37577_c1 nmdc:mga0rr50_37577_c1_1986_3062 357
1412 3300050513 nmdc:mga0rr50_516_c1 nmdc:mga0rr50_516_c1_4843_5925 357
1413 3300050514 nmdc:mga08x19_1656_c1 nmdc:mga08x19_1656_c1_5357_6439 357
1414 3300050514 nmdc:mga08x19_7634_c1 nmdc:mga08x19_7634_c1_231_1313 357
1415 3300050514 nmdc:mga08x19_90404_c1 nmdc:mga08x19_90404_c1_398_1474 357
1416 3300050515 nmdc:mga0a205_101447_c1 nmdc:mga0a205_101447_c1_925_2001 357
1417 3300050515 nmdc:mga0a205_10766_c1 nmdc:mga0a205_10766_c1_7032_8108 357
1418 3300050515 nmdc:mga0a205_116585_c1 nmdc:mga0a205_116585_c1_910_1986 357
1419 3300050515 nmdc:mga0a205_2344_c1 nmdc:mga0a205_2344_c1_14550_15632 357
1420 3300050515 nmdc:mga0a205_2627_c1 nmdc:mga0a205_2627_c1_419_1501 357
1421 3300050515 nmdc:mga0a205_434318_c1 nmdc:mga0a205_434318_c1_47_1129 357
1422 3300053077 Ga0495601_0028361 Ga0495601_0028361_2246_3322 357
1423 3300054114 Ga0501084_0002669 Ga0501084_0002669_170_1252 357
1424 3300054114 Ga0501084_0024166 Ga0501084_0024166_417_1499 357
1425 3300054114 Ga0501084_0049598 Ga0501084_0049598_1095_2171 357
1426 3300054114 Ga0501084_0053140 Ga0501084_0053140_1122_2198 357
1427 3300059421 Ga0590071_009929 Ga0590071_009929_298_1374 357
1428 3300059424 Ga0590075_005828 Ga0590075_005828_396_1472 357
1429 3300060353 Ga0501082_0018850 Ga0501082_0018850_3096_4178 357
1430 3300060353 Ga0501082_0111483 Ga0501082_0111483_938_2020 357
1431 3300061734 Ga0530510_0028583 Ga0530510_0028583_650_1726 357
1432 3300005340 Ga0070689_100085722 Ga0070689_1000857222 358
1433 3300025936 Ga0207670_10013259 Ga0207670_100132592 358
1434 3300025937 Ga0207669_10083144 Ga0207669_100831441 358
1435 3300037471 Ga0395905_0022419 Ga0395905_0022419_2539_3693 358
1436 3300042876 Ga0451577_0078930 Ga0451577_0078930_68_1147 358
1437 3300045051 Ga0451576_0000933 Ga0451576_0000933_26655_27734 358
1438 3300045051 Ga0451576_0216737 Ga0451576_0216737_243_1322 358
1439 3300049591 Ga0501075_0026987 Ga0501075_0026987_3068_4147 358
1440 3300049592 Ga0501076_0058755 Ga0501076_0058755_521_1600 358
1441 3300005981 Ga0081538_10039031 Ga0081538_100390313 359
1442 3300049577 Ga0501041_0126356 Ga0501041_0126356_467_1552 359
1443 3300049592 Ga0501076_0012127 Ga0501076_0012127_3553_4638 359
1444 3300061734 Ga0530510_0105047 Ga0530510_0105047_235_1320 359
1445 3300005445 Ga0070708_100014216 Ga0070708_1000142163 360
1446 3300005518 Ga0070699_100068155 Ga0070699_1000681552 360
1447 3300005985 Ga0081539_10002068 Ga0081539_1000206812 360
1448 3300006038 Ga0075365_10016282 Ga0075365_100162823 360
1449 3300006038 Ga0075365_10040808 Ga0075365_100408083 360
1450 3300006177 Ga0075362_10013780 Ga0075362_100137803 360
1451 3300006353 Ga0075370_10016890 Ga0075370_100168903 360
1452 3300006353 Ga0075370_10135691 Ga0075370_101356912 360
1453 3300031344 Ga0265316_10110608 Ga0265316_101106082 360
1454 3300031595 Ga0265313_10033228 Ga0265313_100332282 360
1455 3300031711 Ga0265314_10028462 Ga0265314_100284622 360
1456 3300038443 Ga0395901_0000384 Ga0395901_0000384_28094_29179 360
1457 3300050489 nmdc:mga03683_1943_c1 nmdc:mga03683_1943_c1_3396_4484 360
1458 3300050489 nmdc:mga03683_8533_c2 nmdc:mga03683_8533_c2_192_1280 360
1459 3300050490 nmdc:mga03n38_18580_c1 nmdc:mga03n38_18580_c1_1365_2447 360
1460 3300050495 nmdc:mga04h51_42048_c1 nmdc:mga04h51_42048_c1_270_1358 360
1461 3300050496 nmdc:mga07m45_2368_c1 nmdc:mga07m45_2368_c1_1311_2393 360
1462 3300050516 nmdc:mga0sz30_30003_c2 nmdc:mga0sz30_30003_c2_78_1160 360
1463 3300053096 Ga0500641_0002170 Ga0500641_0002170_4729_5817 360
1464 3300003215 JGI25153J46596_10025421 JGI25153J46596_100254212 361
1465 3300005336 Ga0070680_100000350 Ga0070680_10000035019 361
1466 3300005336 Ga0070680_100067592 Ga0070680_1000675922 361
1467 3300005354 Ga0070675_100083137 Ga0070675_1000831372 361
1468 3300005354 Ga0070675_100086193 Ga0070675_1000861932 361
1469 3300005355 Ga0070671_100090566 Ga0070671_1000905662 361
1470 3300005356 Ga0070674_100009929 Ga0070674_1000099294 361
1471 3300005434 Ga0070709_10070917 Ga0070709_100709172 361
1472 3300005438 Ga0070701_10090568 Ga0070701_100905682 361
1473 3300005458 Ga0070681_10000414 Ga0070681_1000041421 361
1474 3300005458 Ga0070681_10109610 Ga0070681_101096102 361
1475 3300005458 Ga0070681_10352196 Ga0070681_103521961 361
1476 3300005471 Ga0070698_100003375 Ga0070698_1000033759 361
1477 3300005530 Ga0070679_100002812 Ga0070679_10000281214 361
1478 3300005530 Ga0070679_100098611 Ga0070679_1000986112 361
1479 3300005530 Ga0070679_100105605 Ga0070679_1001056052 361
1480 3300005535 Ga0070684_100012770 Ga0070684_1000127705 361
1481 3300005548 Ga0070665_100003738 Ga0070665_1000037389 361
1482 3300005548 Ga0070665_100027443 Ga0070665_1000274435 361
1483 3300005548 Ga0070665_100033575 Ga0070665_1000335754 361
1484 3300005563 Ga0068855_100021008 Ga0068855_1000210082 361
1485 3300005563 Ga0068855_100241848 Ga0068855_1002418482 361
1486 3300005564 Ga0070664_100041338 Ga0070664_1000413383 361
1487 3300005614 Ga0068856_100075782 Ga0068856_1000757822 361
1488 3300005937 Ga0081455_10001275 Ga0081455_1000127523 361
1489 3300005937 Ga0081455_10006844 Ga0081455_100068447 361
1490 3300005985 Ga0081539_10026676 Ga0081539_100266762 361
1491 3300006177 Ga0075362_10003508 Ga0075362_100035084 361
1492 3300006177 Ga0075362_10050642 Ga0075362_100506422 361
1493 3300009093 Ga0105240_10066545 Ga0105240_100665454 361
1494 3300009174 Ga0105241_10287459 Ga0105241_102874592 361
1495 3300009176 Ga0105242_10225061 Ga0105242_102250612 361
1496 3300010375 Ga0105239_10427815 Ga0105239_104278152 361
1497 3300013105 Ga0157369_10063065 Ga0157369_100630652 361
1498 3300013105 Ga0157369_10220931 Ga0157369_102209312 361
1499 3300013307 Ga0157372_10411679 Ga0157372_104116791 361
1500 3300025297 Ga0209758_1000186 Ga0209758_100018658 361
1501 3300025297 Ga0209758_1029347 Ga0209758_10293472 361
1502 3300025302 Ga0207426_1004647 Ga0207426_10046474 361
1503 3300025909 Ga0207705_10059370 Ga0207705_100593702 361
1504 3300025912 Ga0207707_10023722 Ga0207707_100237223 361
1505 3300025913 Ga0207695_10237495 Ga0207695_102374952 361
1506 3300025914 Ga0207671_10279731 Ga0207671_102797312 361
1507 3300025917 Ga0207660_10021834 Ga0207660_100218342 361
1508 3300025917 Ga0207660_10087992 Ga0207660_100879922 361
1509 3300025919 Ga0207657_10027458 Ga0207657_100274584 361
1510 3300025921 Ga0207652_10018935 Ga0207652_100189352 361
1511 3300025922 Ga0207646_10072731 Ga0207646_100727312 361
1512 3300025926 Ga0207659_10104182 Ga0207659_101041822 361
1513 3300025928 Ga0207700_10184869 Ga0207700_101848692 361
1514 3300025937 Ga0207669_10004616 Ga0207669_100046162 361
1515 3300025939 Ga0207665_10094258 Ga0207665_100942582 361
1516 3300025940 Ga0207691_10026780 Ga0207691_100267804 361
1517 3300025941 Ga0207711_10071385 Ga0207711_100713852 361
1518 3300025949 Ga0207667_10040434 Ga0207667_100404343 361
1519 3300026121 Ga0207683_10213247 Ga0207683_102132472 361
1520 3300028379 Ga0268266_10007683 Ga0268266_100076834 361
1521 3300028379 Ga0268266_10037604 Ga0268266_100376043 361
1522 3300031241 Ga0265325_10000855 Ga0265325_100008552 361
1523 3300031241 Ga0265325_10007980 Ga0265325_100079801 361
1524 3300035091 Ga0373951_0027989 Ga0373951_0027989_171_1256 361
1525 3300035692 Ga0373935_0030350 Ga0373935_0030350_1011_2096 361
1526 3300035695 Ga0373927_0212369 Ga0373927_0212369_139_1227 361
1527 3300035725 Ga0373947_0035137 Ga0373947_0035137_1125_2210 361
1528 3300037312 Ga0395899_0002397 Ga0395899_0002397_1953_3044 361
1529 3300037312 Ga0395899_0008397 Ga0395899_0008397_5421_6512 361
1530 3300037418 Ga0395900_0017281 Ga0395900_0017281_3138_4229 361
1531 3300037418 Ga0395900_0044429 Ga0395900_0044429_1650_2741 361
1532 3300037418 Ga0395900_0107404 Ga0395900_0107404_1413_2504 361
1533 3300037466 Ga0395898_0006268 Ga0395898_0006268_4601_5692 361
1534 3300037466 Ga0395898_0125062 Ga0395898_0125062_236_1327 361
1535 3300038443 Ga0395901_0002282 Ga0395901_0002282_2351_3442 361
1536 3300038443 Ga0395901_0004667 Ga0395901_0004667_7855_8946 361
1537 3300038443 Ga0395901_0012183 Ga0395901_0012183_5059_6150 361
1538 3300039438 Ga0436360_0949586 Ga0436360_0949586_8514_9605 361
1539 3300044694 Ga0466963_0106525 Ga0466963_0106525_306_1397 361
1540 3300045976 Ga0466967_0082562 Ga0466967_0082562_759_1850 361
1541 3300048904 Ga0496101_0149518 Ga0496101_0149518_274_1359 361
1542 3300048905 Ga0496102_0172833 Ga0496102_0172833_474_1559 361
1543 3300048909 Ga0496106_0193295 Ga0496106_0193295_216_1301 361
1544 3300048910 Ga0496107_0070006 Ga0496107_0070006_332_1417 361
1545 3300048911 Ga0496108_0125296 Ga0496108_0125296_229_1314 361
1546 3300048912 Ga0496109_0065381 Ga0496109_0065381_951_2036 361
1547 3300048913 Ga0496110_0026159 Ga0496110_0026159_2410_3495 361
1548 3300048929 Ga0496126_0013736 Ga0496126_0013736_1744_2832 361
1549 3300049571 Ga0501034_0003688 Ga0501034_0003688_14681_15772 361
1550 3300049571 Ga0501034_0020469 Ga0501034_0020469_130_1215 361
1551 3300049571 Ga0501034_0023687 Ga0501034_0023687_17_1153 361
1552 3300049579 Ga0501043_0073527 Ga0501043_0073527_1377_2468 361
1553 3300049580 Ga0501046_0109765 Ga0501046_0109765_160_1245 361
1554 3300049581 Ga0501047_0149532 Ga0501047_0149532_111_1196 361
1555 3300049583 Ga0501067_0013654 Ga0501067_0013654_45_1130 361
1556 3300049584 Ga0501068_0001274 Ga0501068_0001274_8550_9641 361
1557 3300049586 Ga0501070_0080753 Ga0501070_0080753_1153_2238 361
1558 3300049741 Ga0501079_0068365 Ga0501079_0068365_655_1740 361
1559 3300049742 Ga0501080_0059658 Ga0501080_0059658_576_1661 361
1560 3300049742 Ga0501080_0326591 Ga0501080_0326591_97_1188 361
1561 3300049823 Ga0501044_0000286 Ga0501044_0000286_22133_23218 361
1562 3300049823 Ga0501044_0028651 Ga0501044_0028651_3350_4441 361
1563 3300049823 Ga0501044_0104251 Ga0501044_0104251_1024_2115 361
1564 3300050489 nmdc:mga03683_3057_c1 nmdc:mga03683_3057_c1_3973_5064 361
1565 3300050489 nmdc:mga03683_47320_c1 nmdc:mga03683_47320_c1_422_1507 361
1566 3300050494 nmdc:mga06z11_82391_c1 nmdc:mga06z11_82391_c1_119_1204 361
1567 3300053098 Ga0500650_0060750 Ga0500650_0060750_635_1726 361
1568 3300053130 Ga0500642_0034057 Ga0500642_0034057_277_1368 361
1569 3300053153 Ga0500616_0003158 Ga0500616_0003158_4691_5782 361
1570 3300053733 Ga0500552_000071 Ga0500552_000071_4691_5782 361
1571 3300060353 Ga0501082_0238216 Ga0501082_0238216_321_1406 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

117

129

0.98

PF00953

Glycos_transf_4

Glycosyl transferase family 4

147

332

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyz-assembly2.cif.gz_C crystal structure of mray bound to capuramycin 0.9746 24 359
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.9744 24 359
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9721 24 359
8cxr-assembly1.cif.gz_A crystal structure of mray bound to a sphaerimicin analogue 0.9695 24 359
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9686 20 359
ID Description Score Start End Superfamily
af_P36554_255_462_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2771 178 359 1.20.1250.20
af_Q22089_196_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2731 181 356 1.20.1250.20
af_Q20734_279_525_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2701 139 357 1.20.1250.20
af_Q59X41_293_496_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2688 84 352 1.20.1250.20
af_Q5TF39_224_480_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2688 98 356 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537PIT9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9952 1 296 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A3S1VV32-F1-model_v4 deleted 0.9943 192 344
AF-A0A2V6UUB9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9936 206 361 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0071555
AF-A0A534PXT1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9933 159 361 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555
AF-A0A351T5E0-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9929 1 284 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0071555

Feature Viewer

pLDDT pTM Quality
88.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map