F494795

General Info

Members Datasets Scaffolds Average Seq Length
1566 492 1566 216

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0227213|Ga0501040_0227213_310_1089
Length 259
Sequence MGSRTCRNVGRQRNGHATSRPRRGRRFRLGHPGRAAPDDAEYCTKKDKPVIDLYTWTTPNGRKISIALEEFGLPYTAHAVDISKDEQFKPEFLKISPNNRIPAIVDRDNGLSLMESGAILIYLGDKTGKFLPKDGEARYRTIEWLMWQMGGPGPMFGQVHHFVKYNKGKAPYAEERYLKEAHRLYGVLDKRLADHEFVADAYSIADMAIWPWVSRFEWQTVDLNQYPNVKRWYTTIAKRPAVQKGYKVPKDVGEVPMPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
118 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
124 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
140 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
175 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
176 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
259 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
260 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
262 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
263 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
264 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
265 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
266 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
269 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
270 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
271 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
272 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
273 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
276 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
277 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
278 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
279 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
280 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
281 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
282 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
283 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
284 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
285 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
286 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
287 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
292 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
293 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
294 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
295 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
296 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
297 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
298 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
303 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
304 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
305 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
306 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
307 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
309 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
310 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
311 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
312 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
313 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
315 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
318 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
321 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
322 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
323 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
324 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
325 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
326 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
327 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
328 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
329 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
330 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
336 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
337 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
338 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
339 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
346 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
347 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
348 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
352 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
353 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
354 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
357 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
358 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
359 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
360 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
363 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
384 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
399 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
400 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
401 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
404 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
405 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
406 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
412 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
413 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
414 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
415 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
416 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
417 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
418 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
419 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
420 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
438 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
439 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
440 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
441 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
442 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
445 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
446 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
447 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
448 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
449 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
450 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
465 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
466 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
467 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
468 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
469 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
470 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
471 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
472 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
473 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
474 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
475 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
480 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
481 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
487 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
488 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
489 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
490 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
491 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
492 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 5.56
Rhizosphere 89.46
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_271485 2162886007 Bacteria 2758
2 2214772993 2209111006 Bacteria 11650
3 ARcpr5oldR_c000025 3300000041 Bacteria 30356
4 ARSoilYngRDRAFT_c00011 3300000042 Bacteria 28426
5 ARcpr5yngRDRAFT_c000021 3300000043 Bacteria 25699
6 ARSoilOldRDRAFT_c000046 3300000044 Bacteria 25757
7 ARSoilOldRDRAFT_c003403 3300000044 Bacteria 1371
8 ARCol0oldRDRAFT_c00441 3300000045 Bacteria 3965
9 ARCol0yngRDRAFT_1000010 3300000652 Bacteria 42356
10 JGI24752J21851_1004261 3300001976 Bacteria 1877
11 JGI24752J21851_1011951 3300001976 Bacteria 1135
12 JGI24746J21847_1019342 3300001977 Bacteria 960
13 JGI24747J21853_1000049 3300001978 Bacteria 4570
14 JGI24747J21853_1013488 3300001978 Bacteria 843
15 JGI24739J22299_10015772 3300001989 Bacteria 2744
16 JGI24737J22298_10001098 3300001990 Bacteria 9510
17 JGI24737J22298_10011294 3300001990 Bacteria 2929
18 JGI24743J22301_10027953 3300001991 Bacteria 1102
19 JGI24743J22301_10051799 3300001991 Bacteria 837
20 JGI24750J21931_1000013 3300002070 Bacteria 21590
21 JGI24750J21931_1004807 3300002070 Bacteria 1645
22 JGI24745J21846_1000026 3300002073 Bacteria 9559
23 JGI24748J21848_1001841 3300002074 Bacteria 2359
24 JGI24738J21930_10000790 3300002075 Bacteria 9067
25 JGI24749J21850_1000522 3300002076 Bacteria 5664
26 JGI24035J26624_1000074 3300002126 Bacteria 8140
27 JGI24033J26618_1019203 3300002155 Bacteria 865
28 JGI24033J26618_1026409 3300002155 Bacteria 765
29 JGI24034J26672_10000354 3300002239 Bacteria 5982
30 JGI24034J26672_10035241 3300002239 Bacteria 827
31 JGI24742J22300_10000012 3300002244 Bacteria 29909
32 JGI24742J22300_10023938 3300002244 Bacteria 1052
33 JGI24742J22300_10034259 3300002244 Bacteria 894
34 JGI25153J46596_10008933 3300003215 Bacteria 4728
35 JGI25404J52841_10001636 3300003659 Bacteria 4009
36 JGI25405J52794_10003756 3300003911 Bacteria 2682
37 JGI25405J52794_10028692 3300003911 Bacteria 1150
38 Ga0065716_1001618 3300005277 Bacteria 5142
39 Ga0065714_10204173 3300005288 Bacteria 886
40 Ga0065704_10076840 3300005289 Bacteria 4955
41 Ga0065712_10037097 3300005290 Bacteria 841
42 Ga0065712_10074295 3300005290 Bacteria 4134
43 Ga0065712_10094580 3300005290 Bacteria 2250
44 Ga0065712_10368994 3300005290 Bacteria 765
45 Ga0065715_10005658 3300005293 Bacteria 3507
46 Ga0065715_10178972 3300005293 Bacteria 1490
47 Ga0065707_10101382 3300005295 Bacteria 2868
48 Ga0070658_10002492 3300005327 Bacteria 15376
49 Ga0070658_10012746 3300005327 Bacteria 6743
50 Ga0070676_10000008 3300005328 Bacteria 68426
51 Ga0070676_10010553 3300005328 Bacteria 5011
52 Ga0070676_10021231 3300005328 Bacteria 3634
53 Ga0070676_10259996 3300005328 Bacteria 1162
54 Ga0070683_100000442 3300005329 Bacteria 28808
55 Ga0070690_100004858 3300005330 Bacteria 7506
56 Ga0070690_100019824 3300005330 Bacteria 4090
57 Ga0070690_100023774 3300005330 Bacteria 3762
58 Ga0070690_100151000 3300005330 Bacteria 1585
59 Ga0070690_100184000 3300005330 Bacteria 1445
60 Ga0070670_100003481 3300005331 Bacteria 13073
61 Ga0070670_100012561 3300005331 Bacteria 7250
62 Ga0070670_100090772 3300005331 Bacteria 2625
63 Ga0070670_100522712 3300005331 Bacteria 1057
64 Ga0070677_10000100 3300005333 Bacteria 28234
65 Ga0070677_10106185 3300005333 Bacteria 1247
66 Ga0070677_10110789 3300005333 Bacteria 1225
67 Ga0070677_10152446 3300005333 Bacteria 1077
68 Ga0068869_100021707 3300005334 Bacteria 4419
69 Ga0068869_100043808 3300005334 Bacteria 3216
70 Ga0068869_100422854 3300005334 Bacteria 1100
71 Ga0068869_100760990 3300005334 Bacteria 830
72 Ga0070666_10005228 3300005335 Bacteria 7948
73 Ga0070666_10082839 3300005335 Bacteria 2194
74 Ga0070680_100041694 3300005336 Bacteria 3722
75 Ga0070680_100068482 3300005336 Bacteria 2913
76 Ga0070680_100095445 3300005336 Bacteria 2465
77 Ga0070680_100129407 3300005336 Bacteria 2111
78 Ga0070680_100438466 3300005336 Bacteria 1115
79 Ga0070682_100000217 3300005337 Bacteria 42442
80 Ga0070682_100019379 3300005337 Bacteria 3991
81 Ga0070682_100112974 3300005337 Bacteria 1813
82 Ga0068868_100000521 3300005338 Bacteria 25775
83 Ga0068868_100037947 3300005338 Bacteria 3737
84 Ga0070660_100000962 3300005339 Bacteria 19264
85 Ga0070660_100003958 3300005339 Bacteria 10234
86 Ga0070660_100079308 3300005339 Bacteria 2576
87 Ga0070660_100444869 3300005339 Bacteria 1075
88 Ga0070689_100000578 3300005340 Bacteria 22062
89 Ga0070689_100002246 3300005340 Bacteria 12546
90 Ga0070689_100018637 3300005340 Bacteria 5117
91 Ga0070689_100048263 3300005340 Bacteria 3284
92 Ga0070689_100096373 3300005340 Bacteria 2338
93 Ga0070689_100163656 3300005340 Bacteria 1800
94 Ga0070689_100174483 3300005340 Bacteria 1743
95 Ga0070689_100185278 3300005340 Bacteria 1692
96 Ga0070691_10000193 3300005341 Bacteria 20349
97 Ga0070691_10114088 3300005341 Bacteria 1354
98 Ga0070687_100000292 3300005343 Bacteria 16906
99 Ga0070687_100117451 3300005343 Bacteria 1516
100 Ga0070687_100174384 3300005343 Bacteria 1282
101 Ga0070661_100024093 3300005344 Bacteria 4366
102 Ga0070661_100212355 3300005344 Bacteria 1482
103 Ga0070661_100354504 3300005344 Bacteria 1152
104 Ga0070692_10006096 3300005345 Bacteria 5208
105 Ga0070692_10028100 3300005345 Bacteria 2794
106 Ga0070692_10086409 3300005345 Bacteria 1697
107 Ga0070692_10134738 3300005345 Bacteria 1392
108 Ga0070668_100000463 3300005347 Bacteria 26870
109 Ga0070668_100730528 3300005347 Bacteria 875
110 Ga0070669_100028711 3300005353 Bacteria 4006
111 Ga0070669_100071820 3300005353 Bacteria 2561
112 Ga0070669_100108637 3300005353 Bacteria 2102
113 Ga0070669_100130459 3300005353 Bacteria 1927
114 Ga0070669_100439489 3300005353 Bacteria 1073
115 Ga0070675_100000032 3300005354 Bacteria 97014
116 Ga0070675_100056420 3300005354 Bacteria 3237
117 Ga0070671_100016381 3300005355 Bacteria 5994
118 Ga0070671_100036667 3300005355 Bacteria 4066
119 Ga0070671_100154284 3300005355 Bacteria 1940
120 Ga0070671_100241644 3300005355 Bacteria 1533
121 Ga0070674_100000070 3300005356 Bacteria 47062
122 Ga0070674_100018781 3300005356 Bacteria 4379
123 Ga0070674_100057130 3300005356 Bacteria 2708
124 Ga0070674_100092437 3300005356 Bacteria 2187
125 Ga0070673_100000122 3300005364 Bacteria 36106
126 Ga0070673_100008361 3300005364 Bacteria 6878
127 Ga0070673_100017642 3300005364 Bacteria 5081
128 Ga0070673_100165525 3300005364 Bacteria 1883
129 Ga0070673_100461404 3300005364 Bacteria 1144
130 Ga0070673_100583754 3300005364 Bacteria 1018
131 Ga0070688_100000062 3300005365 Bacteria 52780
132 Ga0070688_100026834 3300005365 Bacteria 3425
133 Ga0070688_100055176 3300005365 Bacteria 2491
134 Ga0070688_100058883 3300005365 Bacteria 2420
135 Ga0070688_100381062 3300005365 Bacteria 1039
136 Ga0070659_100003490 3300005366 Bacteria 11191
137 Ga0070659_100120932 3300005366 Bacteria 2121
138 Ga0070667_100002274 3300005367 Bacteria 16906
139 Ga0070667_100076415 3300005367 Bacteria 2859
140 Ga0070667_100097246 3300005367 Bacteria 2539
141 Ga0070667_100317924 3300005367 Bacteria 1404
142 Ga0070667_100559328 3300005367 Bacteria 1052
143 Ga0070703_10041227 3300005406 Bacteria 1439
144 Ga0070709_10003313 3300005434 Bacteria 8667
145 Ga0070709_10004175 3300005434 Bacteria 7787
146 Ga0070709_10050479 3300005434 Bacteria 2606
147 Ga0070714_100037892 3300005435 Bacteria 4053
148 Ga0070714_100062100 3300005435 Bacteria 3211
149 Ga0070714_100081118 3300005435 Bacteria 2824
150 Ga0070714_100085878 3300005435 Bacteria 2749
151 Ga0070714_100094389 3300005435 Bacteria 2626
152 Ga0070714_100166188 3300005435 Bacteria 2000
153 Ga0070714_100368103 3300005435 Bacteria 1353
154 Ga0070714_100427263 3300005435 Bacteria 1256
155 Ga0070714_100880987 3300005435 Bacteria 869
156 Ga0070713_100168490 3300005436 Bacteria 1960
157 Ga0070713_100186378 3300005436 Bacteria 1867
158 Ga0070713_100373219 3300005436 Bacteria 1328
159 Ga0070713_100753466 3300005436 Bacteria 932
160 Ga0070710_10004441 3300005437 Bacteria 6635
161 Ga0070710_10007993 3300005437 Bacteria 5141
162 Ga0070710_10283687 3300005437 Bacteria 1075
163 Ga0070701_10000030 3300005438 Bacteria 35788
164 Ga0070701_10004344 3300005438 Bacteria 5725
165 Ga0070701_10366804 3300005438 Bacteria 904
166 Ga0070711_100006262 3300005439 Bacteria 7168
167 Ga0070711_100032548 3300005439 Bacteria 3467
168 Ga0070711_100126026 3300005439 Bacteria 1901
169 Ga0070711_100396320 3300005439 Bacteria 1119
170 Ga0070705_100011858 3300005440 Bacteria 4413
171 Ga0070705_100031956 3300005440 Bacteria 2920
172 Ga0070705_100235325 3300005440 Bacteria 1277
173 Ga0070700_100001800 3300005441 Bacteria 10813
174 Ga0070700_100007072 3300005441 Bacteria 6032
175 Ga0070700_100132900 3300005441 Bacteria 1681
176 Ga0070694_100001327 3300005444 Bacteria 14410
177 Ga0070694_100014744 3300005444 Bacteria 4897
178 Ga0070694_100209264 3300005444 Bacteria 1458
179 Ga0070708_100111542 3300005445 Bacteria 2514
180 Ga0070708_100265231 3300005445 Bacteria 1615
181 Ga0070663_100004939 3300005455 Bacteria 7874
182 Ga0070663_100017579 3300005455 Bacteria 4670
183 Ga0070663_100021480 3300005455 Bacteria 4294
184 Ga0070663_100040893 3300005455 Bacteria 3248
185 Ga0070663_100051638 3300005455 Bacteria 2930
186 Ga0070678_100000054 3300005456 Bacteria 40372
187 Ga0070678_100027056 3300005456 Bacteria 3888
188 Ga0070678_100033746 3300005456 Bacteria 3557
189 Ga0070678_100134640 3300005456 Bacteria 1969
190 Ga0070678_100141122 3300005456 Bacteria 1928
191 Ga0070678_100204024 3300005456 Bacteria 1634
192 Ga0070678_100729745 3300005456 Bacteria 895
193 Ga0070662_100065035 3300005457 Bacteria 2672
194 Ga0070662_100067777 3300005457 Bacteria 2621
195 Ga0070662_100152512 3300005457 Bacteria 1800
196 Ga0070662_100247599 3300005457 Bacteria 1432
197 Ga0070662_100336124 3300005457 Bacteria 1235
198 Ga0070662_100483036 3300005457 Bacteria 1032
199 Ga0070662_100567060 3300005457 Bacteria 952
200 Ga0070681_10000284 3300005458 Bacteria 40778
201 Ga0070681_10061420 3300005458 Bacteria 3732
202 Ga0070681_10074078 3300005458 Bacteria 3366
203 Ga0070681_10080211 3300005458 Bacteria 3219
204 Ga0070681_10148405 3300005458 Bacteria 2272
205 Ga0070681_10148585 3300005458 Bacteria 2271
206 Ga0070681_10161112 3300005458 Bacteria 2168
207 Ga0070681_10172101 3300005458 Bacteria 2087
208 Ga0070681_10184270 3300005458 Bacteria 2008
209 Ga0070681_10526267 3300005458 Bacteria 1096
210 Ga0068867_100000073 3300005459 Bacteria 61471
211 Ga0068867_100080243 3300005459 Bacteria 2456
212 Ga0070685_10004347 3300005466 Bacteria 7149
213 Ga0070685_10021204 3300005466 Bacteria 3529
214 Ga0070706_100374856 3300005467 Bacteria 1326
215 Ga0070707_100586445 3300005468 Bacteria 1077
216 Ga0070698_100829741 3300005471 Bacteria 869
217 Ga0070699_100000576 3300005518 Bacteria 34772
218 Ga0070699_100000915 3300005518 Bacteria 27492
219 Ga0070699_100582680 3300005518 Bacteria 1019
220 Ga0070679_100004433 3300005530 Bacteria 12970
221 Ga0070679_100006931 3300005530 Bacteria 10571
222 Ga0070679_100064239 3300005530 Bacteria 3658
223 Ga0070679_100133365 3300005530 Bacteria 2465
224 Ga0070679_100174085 3300005530 Bacteria 2125
225 Ga0070679_100215722 3300005530 Bacteria 1881
226 Ga0070679_100228471 3300005530 Bacteria 1821
227 Ga0070684_100000022 3300005535 Bacteria 128353
228 Ga0070684_100041704 3300005535 Bacteria 3958
229 Ga0070684_100086183 3300005535 Bacteria 2787
230 Ga0070697_100005196 3300005536 Bacteria 9998
231 Ga0070697_100167078 3300005536 Bacteria 1861
232 Ga0068853_100000820 3300005539 Bacteria 21708
233 Ga0068853_100078880 3300005539 Bacteria 2878
234 Ga0070672_100000012 3300005543 Bacteria 78125
235 Ga0070672_100358312 3300005543 Bacteria 1244
236 Ga0070686_100000087 3300005544 Bacteria 64591
237 Ga0070686_100044009 3300005544 Bacteria 2803
238 Ga0070686_100067052 3300005544 Bacteria 2336
239 Ga0070686_100419536 3300005544 Bacteria 1022
240 Ga0070695_100007385 3300005545 Bacteria 6518
241 Ga0070695_100018600 3300005545 Bacteria 4220
242 Ga0070695_100073500 3300005545 Bacteria 2244
243 Ga0070695_100087718 3300005545 Bacteria 2070
244 Ga0070695_100140539 3300005545 Bacteria 1674
245 Ga0070696_100000306 3300005546 Bacteria 29692
246 Ga0070696_100006084 3300005546 Bacteria 8058
247 Ga0070693_100035757 3300005547 Bacteria 2757
248 Ga0070693_100038512 3300005547 Bacteria 2672
249 Ga0070693_100141334 3300005547 Bacteria 1516
250 Ga0070693_100154062 3300005547 Bacteria 1458
251 Ga0070693_100355593 3300005547 Bacteria 1004
252 Ga0070665_100009158 3300005548 Bacteria 10027
253 Ga0070665_100055794 3300005548 Bacteria 3962
254 Ga0070665_100117054 3300005548 Bacteria 2667
255 Ga0070704_100002961 3300005549 Bacteria 9654
256 Ga0070704_100020451 3300005549 Bacteria 4268
257 Ga0070704_100034963 3300005549 Bacteria 3412
258 Ga0070704_100109460 3300005549 Bacteria 2099
259 Ga0070704_100112966 3300005549 Bacteria 2071
260 Ga0070704_100125147 3300005549 Bacteria 1982
261 Ga0068855_100034558 3300005563 Bacteria 6027
262 Ga0068855_100065574 3300005563 Bacteria 4233
263 Ga0068855_100131460 3300005563 Bacteria 2858
264 Ga0068855_100490966 3300005563 Bacteria 1335
265 Ga0070664_100000102 3300005564 Bacteria 54873
266 Ga0070664_100096372 3300005564 Bacteria 2567
267 Ga0070664_100103743 3300005564 Bacteria 2475
268 Ga0070664_100217816 3300005564 Bacteria 1707
269 Ga0070664_100268332 3300005564 Bacteria 1537
270 Ga0068857_100000069 3300005577 Bacteria 58801
271 Ga0068857_100030335 3300005577 Bacteria 4774
272 Ga0068857_100123798 3300005577 Bacteria 2329
273 Ga0068857_100191167 3300005577 Bacteria 1864
274 Ga0068857_100794129 3300005577 Bacteria 904
275 Ga0068857_100988358 3300005577 Bacteria 810
276 Ga0068854_100000215 3300005578 Bacteria 38919
277 Ga0068854_100377128 3300005578 Bacteria 1168
278 Ga0068856_100000214 3300005614 Bacteria 62372
279 Ga0068856_100098248 3300005614 Bacteria 2918
280 Ga0068856_100930594 3300005614 Bacteria 888
281 Ga0070702_100000418 3300005615 Bacteria 15156
282 Ga0070702_100018080 3300005615 Bacteria 3649
283 Ga0070702_100026004 3300005615 Bacteria 3141
284 Ga0070702_100289669 3300005615 Bacteria 1128
285 Ga0068852_100003712 3300005616 Bacteria 10699
286 Ga0068852_100098818 3300005616 Bacteria 2629
287 Ga0068852_100279088 3300005616 Bacteria 1610
288 Ga0068859_100003063 3300005617 Bacteria 16943
289 Ga0068859_100011140 3300005617 Bacteria 9041
290 Ga0068859_100022056 3300005617 Bacteria 6384
291 Ga0068859_100380246 3300005617 Bacteria 1507
292 Ga0068864_100040738 3300005618 Bacteria 3972
293 Ga0068864_100053520 3300005618 Bacteria 3482
294 Ga0068864_100165491 3300005618 Bacteria 2013
295 Ga0068866_10000150 3300005718 Bacteria 31741
296 Ga0068866_10057479 3300005718 Bacteria 2005
297 Ga0068866_10083676 3300005718 Bacteria 1720
298 Ga0068861_100026033 3300005719 Bacteria 4248
299 Ga0068861_100171209 3300005719 Bacteria 1800
300 Ga0068861_100283341 3300005719 Bacteria 1428
301 Ga0068851_10157100 3300005834 Bacteria 1247
302 Ga0068870_10000001 3300005840 Bacteria 97513
303 Ga0068870_10070439 3300005840 Bacteria 1905
304 Ga0068863_100010203 3300005841 Bacteria 9133
305 Ga0068863_100539092 3300005841 Bacteria 1151
306 Ga0068863_100858728 3300005841 Bacteria 907
307 Ga0068858_100001238 3300005842 Bacteria 26382
308 Ga0068858_100028773 3300005842 Bacteria 5160
309 Ga0068858_100086831 3300005842 Bacteria 2909
310 Ga0068858_100291519 3300005842 Bacteria 1555
311 Ga0068858_100846687 3300005842 Bacteria 893
312 Ga0068860_100002790 3300005843 Bacteria 18164
313 Ga0068860_100019455 3300005843 Bacteria 6583
314 Ga0068860_100114516 3300005843 Bacteria 2578
315 Ga0068860_100424739 3300005843 Bacteria 1318
316 Ga0068862_100000304 3300005844 Bacteria 53990
317 Ga0068862_100012520 3300005844 Bacteria 7021
318 Ga0068862_100116726 3300005844 Bacteria 2348
319 Ga0068862_100272012 3300005844 Bacteria 1550
320 Ga0081455_10000031 3300005937 Bacteria 146486
321 Ga0081455_10004948 3300005937 Bacteria 14733
322 Ga0081455_10008273 3300005937 Bacteria 10841
323 Ga0081455_10009417 3300005937 Bacteria 10048
324 Ga0081455_10011785 3300005937 Bacteria 8756
325 Ga0081455_10024286 3300005937 Bacteria 5618
326 Ga0081455_10031626 3300005937 Bacteria 4782
327 Ga0081455_10150081 3300005937 Bacteria 1798
328 Ga0081538_10014997 3300005981 Bacteria 6028
329 Ga0081540_1000084 3300005983 Bacteria 100067
330 Ga0081540_1003528 3300005983 Bacteria 12329
331 Ga0081540_1006336 3300005983 Bacteria 8643
332 Ga0081540_1038709 3300005983 Bacteria 2510
333 Ga0081540_1043089 3300005983 Bacteria 2319
334 Ga0081539_10001242 3300005985 Bacteria 45360
335 Ga0081539_10078820 3300005985 Bacteria 1738
336 Ga0070717_10000869 3300006028 Bacteria 20007
337 Ga0070717_10011325 3300006028 Bacteria 6768
338 Ga0070717_10041506 3300006028 Bacteria 3750
339 Ga0070717_10041614 3300006028 Bacteria 3746
340 Ga0070717_10042713 3300006028 Bacteria 3698
341 Ga0070717_10124760 3300006028 Bacteria 2209
342 Ga0070717_10167251 3300006028 Bacteria 1911
343 Ga0070717_10315529 3300006028 Bacteria 1392
344 Ga0070717_10542758 3300006028 Bacteria 1052
345 Ga0075365_10007385 3300006038 Bacteria 6148
346 Ga0075365_10026169 3300006038 Bacteria 3701
347 Ga0075368_10008538 3300006042 Bacteria 3651
348 Ga0075363_100032531 3300006048 Bacteria 2710
349 Ga0075364_10025515 3300006051 Bacteria 3762
350 Ga0075364_10037238 3300006051 Bacteria 3149
351 Ga0075364_10119025 3300006051 Bacteria 1767
352 Ga0075432_10030706 3300006058 Bacteria 1858
353 Ga0070715_10000687 3300006163 Bacteria 9066
354 Ga0070715_10026969 3300006163 Bacteria 2290
355 Ga0070715_10112148 3300006163 Bacteria 1288
356 Ga0070716_100064781 3300006173 Bacteria 2126
357 Ga0070716_100192512 3300006173 Bacteria 1349
358 Ga0070716_100885076 3300006173 Bacteria 698
359 Ga0070712_100007908 3300006175 Bacteria 6666
360 Ga0070712_100016672 3300006175 Bacteria 4748
361 Ga0070712_100025242 3300006175 Bacteria 3948
362 Ga0070712_100053418 3300006175 Bacteria 2821
363 Ga0070712_100123106 3300006175 Bacteria 1955
364 Ga0075362_10046443 3300006177 Bacteria 1931
365 Ga0075362_10059959 3300006177 Bacteria 1719
366 Ga0075367_10001182 3300006178 Bacteria 10953
367 Ga0075367_10109282 3300006178 Bacteria 1696
368 Ga0075367_10145301 3300006178 Bacteria 1470
369 Ga0075369_10049579 3300006186 Bacteria 1814
370 Ga0075369_10061633 3300006186 Bacteria 1638
371 Ga0075369_10171697 3300006186 Bacteria 996
372 Ga0075427_10000195 3300006194 Bacteria 6119
373 Ga0075366_10034850 3300006195 Bacteria 2966
374 Ga0075366_10047689 3300006195 Bacteria 2539
375 Ga0075366_10154965 3300006195 Bacteria 1388
376 Ga0097621_100027665 3300006237 Bacteria 4461
377 Ga0097621_100044026 3300006237 Bacteria 3600
378 Ga0097621_100077437 3300006237 Bacteria 2760
379 Ga0097621_100128890 3300006237 Bacteria 2151
380 Ga0075370_10071053 3300006353 Bacteria 1991
381 Ga0075370_10127737 3300006353 Bacteria 1482
382 Ga0075370_10218044 3300006353 Bacteria 1127
383 Ga0075370_10514585 3300006353 Bacteria 723
384 Ga0068871_100000007 3300006358 Bacteria 115829
385 Ga0068871_100026169 3300006358 Bacteria 4550
386 Ga0068871_100273365 3300006358 Bacteria 1476
387 Ga0075428_100022413 3300006844 Bacteria 6994
388 Ga0075428_100042957 3300006844 Bacteria 4970
389 Ga0075428_100437757 3300006844 Bacteria 1400
390 Ga0075428_100462230 3300006844 Bacteria 1359
391 Ga0075428_101036749 3300006844 Bacteria 868
392 Ga0075430_100014321 3300006846 Bacteria 6759
393 Ga0075430_100020750 3300006846 Bacteria 5587
394 Ga0075430_100071953 3300006846 Bacteria 2900
395 Ga0075430_100124197 3300006846 Bacteria 2152
396 Ga0075430_100267441 3300006846 Bacteria 1415
397 Ga0075430_100282281 3300006846 Bacteria 1374
398 Ga0075431_100000490 3300006847 Bacteria 32831
399 Ga0075431_100000592 3300006847 Bacteria 30592
400 Ga0075431_100038722 3300006847 Bacteria 4911
401 Ga0075431_100229383 3300006847 Bacteria 1892
402 Ga0075431_100343266 3300006847 Bacteria 1502
403 Ga0075433_10054685 3300006852 Bacteria 3482
404 Ga0075433_10093678 3300006852 Bacteria 2658
405 Ga0075433_10355899 3300006852 Bacteria 1293
406 Ga0075433_10434967 3300006852 Bacteria 1157
407 Ga0075434_100000210 3300006871 Bacteria 39685
408 Ga0075434_100000421 3300006871 Bacteria 31416
409 Ga0075434_100160108 3300006871 Bacteria 2271
410 Ga0075434_100209287 3300006871 Bacteria 1971
411 Ga0075434_100213339 3300006871 Bacteria 1950
412 Ga0075434_100254921 3300006871 Bacteria 1773
413 Ga0075434_100979375 3300006871 Bacteria 860
414 Ga0075429_100010041 3300006880 Bacteria 8205
415 Ga0075429_100015676 3300006880 Bacteria 6567
416 Ga0075429_100096671 3300006880 Bacteria 2576
417 Ga0068865_100003045 3300006881 Bacteria 10022
418 Ga0068865_100073786 3300006881 Bacteria 2427
419 Ga0068865_100105866 3300006881 Bacteria 2067
420 Ga0075436_100122552 3300006914 Bacteria 1820
421 Ga0097620_100003063 3300006931 Bacteria 16943
422 Ga0097620_100011140 3300006931 Bacteria 9041
423 Ga0097620_100022056 3300006931 Bacteria 6384
424 Ga0097620_100380213 3300006931 Bacteria 1507
425 Ga0075435_100005402 3300007076 Bacteria 8910
426 Ga0075435_100050798 3300007076 Bacteria 3338
427 Ga0075435_100053012 3300007076 Bacteria 3269
428 Ga0075435_100151644 3300007076 Bacteria 1949
429 Ga0075435_100189901 3300007076 Bacteria 1739
430 Ga0075435_100496115 3300007076 Bacteria 1055
431 Ga0099794_10023487 3300007265 Bacteria 2821
432 Ga0099794_10061130 3300007265 Bacteria 1830
433 Ga0099795_10167737 3300007788 Bacteria 910
434 Ga0105244_10067676 3300009036 Bacteria 1786
435 Ga0105240_10033215 3300009093 Bacteria 6670
436 Ga0105240_10252025 3300009093 Bacteria 2041
437 Ga0105240_10309898 3300009093 Bacteria 1803
438 Ga0105240_10622425 3300009093 Bacteria 1186
439 Ga0111539_10000241 3300009094 Bacteria 65476
440 Ga0111539_10004570 3300009094 Bacteria 18089
441 Ga0111539_10015685 3300009094 Bacteria 9418
442 Ga0111539_10126113 3300009094 Bacteria 2999
443 Ga0111539_10533236 3300009094 Bacteria 1368
444 Ga0105245_10003072 3300009098 Bacteria 14945
445 Ga0105245_10203534 3300009098 Bacteria 1902
446 Ga0105245_10271041 3300009098 Bacteria 1656
447 Ga0105245_10956209 3300009098 Bacteria 900
448 Ga0105247_10006526 3300009101 Bacteria 7223
449 Ga0105247_10451063 3300009101 Bacteria 927
450 Ga0114129_10005303 3300009147 Bacteria 18192
451 Ga0114129_10055205 3300009147 Bacteria 5568
452 Ga0114129_10256259 3300009147 Bacteria 2347
453 Ga0114129_10363720 3300009147 Bacteria 1914
454 Ga0114129_10378979 3300009147 Bacteria 1869
455 Ga0114129_10668008 3300009147 Bacteria 1339
456 Ga0105243_10008450 3300009148 Bacteria 7905
457 Ga0105243_10044771 3300009148 Bacteria 3474
458 Ga0105243_10195748 3300009148 Bacteria 1769
459 Ga0105243_10301247 3300009148 Bacteria 1453
460 Ga0105243_10303743 3300009148 Bacteria 1447
461 Ga0105243_10391965 3300009148 Bacteria 1287
462 Ga0105243_10508625 3300009148 Bacteria 1143
463 Ga0105241_10008483 3300009174 Bacteria 7556
464 Ga0105241_10155076 3300009174 Bacteria 1877
465 Ga0105241_10155692 3300009174 Bacteria 1874
466 Ga0105241_10320929 3300009174 Bacteria 1335
467 Ga0105242_10002788 3300009176 Bacteria 13686
468 Ga0105248_10001294 3300009177 Bacteria 27861
469 Ga0105248_10020876 3300009177 Bacteria 7258
470 Ga0105248_10127733 3300009177 Bacteria 2868
471 Ga0105248_10326537 3300009177 Bacteria 1728
472 Ga0105248_10828770 3300009177 Bacteria 1044
473 Ga0105248_10992440 3300009177 Bacteria 948
474 Ga0105248_10996968 3300009177 Bacteria 946
475 Ga0105237_10021978 3300009545 Bacteria 6549
476 Ga0105237_10048019 3300009545 Bacteria 4292
477 Ga0105237_10068514 3300009545 Bacteria 3542
478 Ga0105238_10080671 3300009551 Bacteria 3243
479 Ga0105238_10399355 3300009551 Bacteria 1368
480 Ga0105238_10428622 3300009551 Bacteria 1318
481 Ga0105238_11054341 3300009551 Bacteria 835
482 Ga0105249_10000318 3300009553 Bacteria 48726
483 Ga0105249_10004500 3300009553 Bacteria 12048
484 Ga0105249_10040389 3300009553 Bacteria 4238
485 Ga0105249_10147042 3300009553 Bacteria 2265
486 Ga0105249_10769625 3300009553 Bacteria 1025
487 Ga0105249_10887066 3300009553 Bacteria 958
488 Ga0099796_10006962 3300010159 Bacteria 2927
489 Ga0099796_10011464 3300010159 Bacteria 2474
490 Ga0099796_10103924 3300010159 Bacteria 1072
491 Ga0105239_10007212 3300010375 Bacteria 12774
492 Ga0105239_10069751 3300010375 Bacteria 3861
493 Ga0105246_10022697 3300011119 Bacteria 4052
494 Ga0105246_10104775 3300011119 Bacteria 2066
495 Ga0105246_10134841 3300011119 Bacteria 1849
496 Ga0105246_10263332 3300011119 Bacteria 1374
497 Ga0105246_10301814 3300011119 Bacteria 1293
498 Ga0157373_10005714 3300013100 Bacteria 9321
499 Ga0157371_10006511 3300013102 Bacteria 9617
500 Ga0157371_10065596 3300013102 Bacteria 2571
501 Ga0157371_10210638 3300013102 Bacteria 1395
502 Ga0157370_10148143 3300013104 Bacteria 2185
503 Ga0157369_10180080 3300013105 Bacteria 2224
504 Ga0157369_10209454 3300013105 Bacteria 2044
505 Ga0157374_10004984 3300013296 Bacteria 11140
506 Ga0157374_10092211 3300013296 Bacteria 2890
507 Ga0157374_10100469 3300013296 Bacteria 2773
508 Ga0157374_10246039 3300013296 Bacteria 1759
509 Ga0157378_10002119 3300013297 Bacteria 17649
510 Ga0163162_10000416 3300013306 Bacteria 39159
511 Ga0163162_10606839 3300013306 Bacteria 1220
512 Ga0163162_10727180 3300013306 Bacteria 1113
513 Ga0157372_10074316 3300013307 Bacteria 3833
514 Ga0157372_10589219 3300013307 Bacteria 1296
515 Ga0157372_11082644 3300013307 Bacteria 927
516 Ga0157375_10000571 3300013308 Bacteria 32965
517 Ga0157375_10124089 3300013308 Bacteria 2696
518 Ga0163163_10000673 3300014325 Bacteria 29212
519 Ga0163163_10019035 3300014325 Bacteria 6442
520 Ga0163163_10161669 3300014325 Bacteria 2285
521 Ga0163163_10192114 3300014325 Bacteria 2090
522 Ga0163163_10192121 3300014325 Bacteria 2090
523 Ga0157380_10000115 3300014326 Bacteria 44247
524 Ga0157380_10043209 3300014326 Bacteria 3527
525 Ga0157380_10053585 3300014326 Bacteria 3198
526 Ga0157380_10091711 3300014326 Bacteria 2509
527 Ga0157380_10104172 3300014326 Bacteria 2369
528 Ga0157380_10929953 3300014326 Bacteria 898
529 Ga0182008_10137658 3300014497 Bacteria 1220
530 Ga0157377_10000086 3300014745 Bacteria 69604
531 Ga0157377_10122280 3300014745 Bacteria 1579
532 Ga0157379_10003187 3300014968 Bacteria 13897
533 Ga0157379_10017659 3300014968 Bacteria 6284
534 Ga0157376_10000253 3300014969 Bacteria 36981
535 Ga0163161_10000920 3300017792 Bacteria 22717
536 Ga0163161_10197998 3300017792 Bacteria 1547
537 Ga0163161_10325947 3300017792 Bacteria 1215
538 Ga0163161_10389780 3300017792 Bacteria 1115
539 Ga0163161_10403726 3300017792 Bacteria 1096
540 Ga0213872_10033976 3300021361 Bacteria 2336
541 Ga0213876_10005310 3300021384 Bacteria 7092
542 Ga0213875_10000009 3300021388 Bacteria 451129
543 Ga0207666_1000007 3300025271 Bacteria 49628
544 Ga0207673_1001891 3300025290 Bacteria 2337
545 Ga0209758_1000628 3300025297 Bacteria 54130
546 Ga0207697_10000083 3300025315 Bacteria 41914
547 Ga0207697_10002626 3300025315 Bacteria 9244
548 Ga0207656_10065701 3300025321 Bacteria 1602
549 Ga0207653_10004560 3300025885 Bacteria 4343
550 Ga0207653_10014043 3300025885 Bacteria 2511
551 Ga0207653_10018311 3300025885 Bacteria 2206
552 Ga0207682_10000002 3300025893 Bacteria 132580
553 Ga0207682_10001406 3300025893 Bacteria 11118
554 Ga0207682_10068456 3300025893 Bacteria 1500
555 Ga0207692_10003589 3300025898 Bacteria 6073
556 Ga0207692_10016939 3300025898 Bacteria 3239
557 Ga0207692_10247462 3300025898 Bacteria 1067
558 Ga0207642_10006692 3300025899 Bacteria 3849
559 Ga0207642_10054796 3300025899 Bacteria 1820
560 Ga0207642_10063769 3300025899 Bacteria 1725
561 Ga0207642_10174491 3300025899 Bacteria 1166
562 Ga0207710_10010672 3300025900 Bacteria 3867
563 Ga0207710_10048185 3300025900 Bacteria 1906
564 Ga0207710_10060848 3300025900 Bacteria 1713
565 Ga0207710_10086285 3300025900 Bacteria 1463
566 Ga0207688_10000102 3300025901 Bacteria 33857
567 Ga0207688_10000912 3300025901 Bacteria 14919
568 Ga0207688_10033970 3300025901 Bacteria 2822
569 Ga0207688_10200192 3300025901 Bacteria 1197
570 Ga0207680_10026688 3300025903 Bacteria 3205
571 Ga0207680_10036264 3300025903 Bacteria 2839
572 Ga0207680_10678857 3300025903 Bacteria 738
573 Ga0207647_10002077 3300025904 Bacteria 15320
574 Ga0207647_10044983 3300025904 Bacteria 2756
575 Ga0207647_10175338 3300025904 Bacteria 1247
576 Ga0207685_10009249 3300025905 Bacteria 2853
577 Ga0207685_10207590 3300025905 Bacteria 924
578 Ga0207699_10001084 3300025906 Bacteria 12844
579 Ga0207699_10034561 3300025906 Bacteria 2869
580 Ga0207699_10135505 3300025906 Bacteria 1612
581 Ga0207699_10151620 3300025906 Bacteria 1534
582 Ga0207699_10283666 3300025906 Bacteria 1151
583 Ga0207699_10335796 3300025906 Bacteria 1063
584 Ga0207645_10000026 3300025907 Bacteria 97025
585 Ga0207645_10013020 3300025907 Bacteria 5620
586 Ga0207645_10224703 3300025907 Bacteria 1238
587 Ga0207645_10231207 3300025907 Bacteria 1220
588 Ga0207645_10396353 3300025907 Bacteria 928
589 Ga0207643_10000003 3300025908 Bacteria 207506
590 Ga0207643_10003489 3300025908 Bacteria 8454
591 Ga0207705_10162514 3300025909 Bacteria 1678
592 Ga0207705_10211429 3300025909 Bacteria 1471
593 Ga0207684_10176984 3300025910 Bacteria 1839
594 Ga0207654_10114420 3300025911 Bacteria 1683
595 Ga0207654_10151032 3300025911 Bacteria 1491
596 Ga0207654_10158490 3300025911 Bacteria 1460
597 Ga0207707_10000915 3300025912 Bacteria 28718
598 Ga0207707_10011845 3300025912 Bacteria 7585
599 Ga0207707_10015675 3300025912 Bacteria 6603
600 Ga0207707_10066751 3300025912 Bacteria 3133
601 Ga0207707_10068811 3300025912 Bacteria 3085
602 Ga0207707_10191118 3300025912 Bacteria 1786
603 Ga0207707_10393110 3300025912 Bacteria 1191
604 Ga0207695_10210044 3300025913 Bacteria 1858
605 Ga0207671_10040624 3300025914 Bacteria 3443
606 Ga0207671_10190467 3300025914 Bacteria 1599
607 Ga0207693_10002909 3300025915 Bacteria 14824
608 Ga0207693_10012876 3300025915 Bacteria 6749
609 Ga0207693_10022262 3300025915 Bacteria 5037
610 Ga0207693_10026700 3300025915 Bacteria 4568
611 Ga0207693_10044663 3300025915 Bacteria 3482
612 Ga0207693_10081386 3300025915 Bacteria 2535
613 Ga0207693_10128186 3300025915 Bacteria 1995
614 Ga0207693_10312588 3300025915 Bacteria 1230
615 Ga0207663_10187949 3300025916 Bacteria 1481
616 Ga0207663_10218534 3300025916 Bacteria 1385
617 Ga0207663_10770609 3300025916 Bacteria 765
618 Ga0207660_10002152 3300025917 Bacteria 13070
619 Ga0207660_10006601 3300025917 Bacteria 7528
620 Ga0207660_10022077 3300025917 Bacteria 4285
621 Ga0207660_10037127 3300025917 Bacteria 3393
622 Ga0207660_10373490 3300025917 Bacteria 1145
623 Ga0207660_10375492 3300025917 Bacteria 1142
624 Ga0207662_10000297 3300025918 Bacteria 22884
625 Ga0207662_10004102 3300025918 Bacteria 7619
626 Ga0207662_10023791 3300025918 Bacteria 3522
627 Ga0207662_10094397 3300025918 Bacteria 1845
628 Ga0207662_10123450 3300025918 Bacteria 1626
629 Ga0207657_10000840 3300025919 Bacteria 32484
630 Ga0207657_10005450 3300025919 Bacteria 13282
631 Ga0207657_10028722 3300025919 Bacteria 5069
632 Ga0207657_10049298 3300025919 Bacteria 3670
633 Ga0207657_10051879 3300025919 Bacteria 3564
634 Ga0207657_10063231 3300025919 Bacteria 3165
635 Ga0207657_10429430 3300025919 Bacteria 1038
636 Ga0207649_10000054 3300025920 Bacteria 103258
637 Ga0207649_10106761 3300025920 Bacteria 1863
638 Ga0207649_10360887 3300025920 Bacteria 1078
639 Ga0207652_10000059 3300025921 Bacteria 113599
640 Ga0207652_10080562 3300025921 Bacteria 2846
641 Ga0207652_10114695 3300025921 Bacteria 2393
642 Ga0207652_10178809 3300025921 Bacteria 1906
643 Ga0207652_10460384 3300025921 Bacteria 1146
644 Ga0207652_10629832 3300025921 Bacteria 960
645 Ga0207681_10000118 3300025923 Bacteria 66554
646 Ga0207681_10237775 3300025923 Bacteria 1416
647 Ga0207681_10520000 3300025923 Bacteria 976
648 Ga0207694_10041845 3300025924 Bacteria 3532
649 Ga0207694_10136678 3300025924 Bacteria 1969
650 Ga0207694_10155969 3300025924 Bacteria 1841
651 Ga0207650_10002861 3300025925 Bacteria 11918
652 Ga0207650_10093342 3300025925 Bacteria 2303
653 Ga0207650_10135927 3300025925 Bacteria 1928
654 Ga0207659_10000015 3300025926 Bacteria 168475
655 Ga0207659_10233593 3300025926 Bacteria 1484
656 Ga0207659_10245404 3300025926 Bacteria 1451
657 Ga0207687_10000050 3300025927 Bacteria 93290
658 Ga0207687_10026697 3300025927 Bacteria 3869
659 Ga0207687_10159200 3300025927 Bacteria 1731
660 Ga0207700_10010739 3300025928 Bacteria 5799
661 Ga0207700_10022163 3300025928 Bacteria 4352
662 Ga0207700_10025534 3300025928 Bacteria 4104
663 Ga0207700_10110272 3300025928 Bacteria 2213
664 Ga0207700_10210004 3300025928 Bacteria 1645
665 Ga0207700_10288383 3300025928 Bacteria 1414
666 Ga0207700_10799752 3300025928 Bacteria 843
667 Ga0207664_10045920 3300025929 Bacteria 3427
668 Ga0207664_10094495 3300025929 Bacteria 2457
669 Ga0207664_10195278 3300025929 Bacteria 1744
670 Ga0207664_10490194 3300025929 Bacteria 1100
671 Ga0207644_10002278 3300025931 Bacteria 12445
672 Ga0207644_10010053 3300025931 Bacteria 6229
673 Ga0207644_10112785 3300025931 Bacteria 2058
674 Ga0207644_10116600 3300025931 Bacteria 2027
675 Ga0207644_10314000 3300025931 Bacteria 1266
676 Ga0207690_10000146 3300025932 Bacteria 56554
677 Ga0207690_10154625 3300025932 Bacteria 1704
678 Ga0207706_10001170 3300025933 Bacteria 26622
679 Ga0207706_10009125 3300025933 Bacteria 9119
680 Ga0207706_10012559 3300025933 Bacteria 7712
681 Ga0207706_10015658 3300025933 Bacteria 6852
682 Ga0207706_10086856 3300025933 Bacteria 2750
683 Ga0207706_10097445 3300025933 Bacteria 2586
684 Ga0207706_10467939 3300025933 Bacteria 1090
685 Ga0207686_10000256 3300025934 Bacteria 40403
686 Ga0207686_10011416 3300025934 Bacteria 4864
687 Ga0207686_10320692 3300025934 Bacteria 1157
688 Ga0207709_10000352 3300025935 Bacteria 47062
689 Ga0207709_10075967 3300025935 Bacteria 2149
690 Ga0207709_10125977 3300025935 Bacteria 1737
691 Ga0207709_10210545 3300025935 Bacteria 1395
692 Ga0207709_10594245 3300025935 Bacteria 876
693 Ga0207709_10664812 3300025935 Bacteria 831
694 Ga0207670_10000073 3300025936 Bacteria 70848
695 Ga0207670_10064591 3300025936 Bacteria 2509
696 Ga0207670_10077184 3300025936 Bacteria 2320
697 Ga0207670_10116792 3300025936 Bacteria 1932
698 Ga0207670_10119157 3300025936 Bacteria 1915
699 Ga0207670_10202078 3300025936 Bacteria 1510
700 Ga0207669_10000008 3300025937 Bacteria 168213
701 Ga0207669_10278542 3300025937 Bacteria 1260
702 Ga0207704_10000031 3300025938 Bacteria 111710
703 Ga0207704_10027994 3300025938 Bacteria 3120
704 Ga0207704_10061059 3300025938 Bacteria 2336
705 Ga0207704_10434409 3300025938 Bacteria 1044
706 Ga0207665_10057915 3300025939 Bacteria 2618
707 Ga0207665_10101203 3300025939 Bacteria 2012
708 Ga0207665_10484688 3300025939 Bacteria 953
709 Ga0207665_10909705 3300025939 Bacteria 698
710 Ga0207691_10001871 3300025940 Bacteria 20574
711 Ga0207691_10009791 3300025940 Bacteria 9202
712 Ga0207691_10010956 3300025940 Bacteria 8701
713 Ga0207691_10090031 3300025940 Bacteria 2751
714 Ga0207691_10247030 3300025940 Bacteria 1541
715 Ga0207691_10275318 3300025940 Bacteria 1449
716 Ga0207711_10000478 3300025941 Bacteria 41339
717 Ga0207711_10002137 3300025941 Bacteria 17813
718 Ga0207711_10040213 3300025941 Bacteria 3977
719 Ga0207711_10232511 3300025941 Bacteria 1689
720 Ga0207711_10308894 3300025941 Bacteria 1460
721 Ga0207711_10574762 3300025941 Bacteria 1051
722 Ga0207711_10671969 3300025941 Bacteria 966
723 Ga0207711_11196811 3300025941 Bacteria 701
724 Ga0207689_10000040 3300025942 Bacteria 93271
725 Ga0207689_10002512 3300025942 Bacteria 17049
726 Ga0207689_10057136 3300025942 Bacteria 3210
727 Ga0207689_10207899 3300025942 Bacteria 1617
728 Ga0207689_10614975 3300025942 Bacteria 914
729 Ga0207661_10000474 3300025944 Bacteria 25977
730 Ga0207661_10251603 3300025944 Bacteria 1571
731 Ga0207679_10000014 3300025945 Bacteria 275841
732 Ga0207679_10063328 3300025945 Bacteria 2760
733 Ga0207679_10087176 3300025945 Bacteria 2403
734 Ga0207679_10128326 3300025945 Bacteria 2030
735 Ga0207679_10141680 3300025945 Bacteria 1944
736 Ga0207679_10171910 3300025945 Bacteria 1785
737 Ga0207667_10021163 3300025949 Bacteria 7212
738 Ga0207651_10000317 3300025960 Bacteria 20700
739 Ga0207651_10006324 3300025960 Bacteria 6184
740 Ga0207651_10032208 3300025960 Bacteria 3364
741 Ga0207651_10118997 3300025960 Bacteria 1999
742 Ga0207651_10195942 3300025960 Bacteria 1615
743 Ga0207651_10684907 3300025960 Bacteria 902
744 Ga0207712_10000777 3300025961 Bacteria 23783
745 Ga0207712_10018723 3300025961 Bacteria 4513
746 Ga0207712_10061142 3300025961 Bacteria 2673
747 Ga0207712_10118368 3300025961 Bacteria 2000
748 Ga0207712_10143425 3300025961 Bacteria 1836
749 Ga0207668_10000037 3300025972 Bacteria 115995
750 Ga0207668_10267322 3300025972 Bacteria 1396
751 Ga0207640_10000444 3300025981 Bacteria 25172
752 Ga0207658_10001424 3300025986 Bacteria 18664
753 Ga0207658_10049504 3300025986 Bacteria 3088
754 Ga0207658_10263681 3300025986 Bacteria 1469
755 Ga0207677_10108557 3300026023 Bacteria 2061
756 Ga0207703_10006289 3300026035 Bacteria 9495
757 Ga0207703_10059452 3300026035 Bacteria 3122
758 Ga0207703_10077635 3300026035 Bacteria 2757
759 Ga0207703_10328793 3300026035 Bacteria 1402
760 Ga0207703_10412366 3300026035 Bacteria 1255
761 Ga0207639_10001125 3300026041 Bacteria 18174
762 Ga0207639_10080541 3300026041 Bacteria 2576
763 Ga0207639_10269303 3300026041 Bacteria 1493
764 Ga0207639_10441881 3300026041 Bacteria 1179
765 Ga0207678_10033669 3300026067 Bacteria 4463
766 Ga0207678_10050713 3300026067 Bacteria 3585
767 Ga0207678_10104818 3300026067 Bacteria 2413
768 Ga0207708_10000368 3300026075 Bacteria 35276
769 Ga0207708_10001462 3300026075 Bacteria 17660
770 Ga0207708_10005217 3300026075 Bacteria 9578
771 Ga0207708_10038284 3300026075 Bacteria 3654
772 Ga0207708_10160082 3300026075 Bacteria 1777
773 Ga0207708_10354640 3300026075 Bacteria 1204
774 Ga0207702_10006393 3300026078 Bacteria 10165
775 Ga0207702_10345856 3300026078 Bacteria 1421
776 Ga0207641_10000272 3300026088 Bacteria 65806
777 Ga0207641_10078115 3300026088 Bacteria 2866
778 Ga0207641_10306245 3300026088 Bacteria 1502
779 Ga0207641_10473742 3300026088 Bacteria 1213
780 Ga0207648_10000516 3300026089 Bacteria 43204
781 Ga0207648_10028541 3300026089 Bacteria 4946
782 Ga0207648_10068728 3300026089 Bacteria 3087
783 Ga0207648_10098242 3300026089 Bacteria 2563
784 Ga0207676_10042505 3300026095 Bacteria 3496
785 Ga0207676_10047276 3300026095 Bacteria 3334
786 Ga0207676_10050277 3300026095 Bacteria 3249
787 Ga0207676_10053392 3300026095 Bacteria 3163
788 Ga0207676_10103167 3300026095 Bacteria 2369
789 Ga0207676_10131926 3300026095 Bacteria 2125
790 Ga0207674_10000555 3300026116 Bacteria 48860
791 Ga0207674_10002061 3300026116 Bacteria 25517
792 Ga0207674_10042889 3300026116 Bacteria 4668
793 Ga0207674_10053024 3300026116 Bacteria 4134
794 Ga0207674_10069880 3300026116 Bacteria 3531
795 Ga0207674_10076926 3300026116 Bacteria 3344
796 Ga0207674_10103717 3300026116 Bacteria 2823
797 Ga0207674_10153293 3300026116 Bacteria 2260
798 Ga0207675_100000404 3300026118 Bacteria 41500
799 Ga0207675_100001087 3300026118 Bacteria 26918
800 Ga0207675_100166482 3300026118 Bacteria 2105
801 Ga0207675_101252391 3300026118 Bacteria 762
802 Ga0207683_10000002 3300026121 Bacteria 258441
803 Ga0207683_10000604 3300026121 Bacteria 33136
804 Ga0207683_10007177 3300026121 Bacteria 9551
805 Ga0207683_10021124 3300026121 Bacteria 5572
806 Ga0207683_10052271 3300026121 Bacteria 3580
807 Ga0207683_10153365 3300026121 Bacteria 2080
808 Ga0207698_10264042 3300026142 Bacteria 1583
809 Ga0209973_1018188 3300027252 Bacteria 909
810 Ga0210000_1004283 3300027462 Bacteria 2061
811 Ga0210002_1000129 3300027617 Bacteria 11732
812 Ga0210002_1009031 3300027617 Bacteria 1522
813 Ga0209588_1033721 3300027671 Bacteria 1642
814 Ga0209966_1000723 3300027695 Bacteria 7012
815 Ga0209998_10002298 3300027717 Bacteria 4424
816 Ga0209998_10005159 3300027717 Bacteria 2744
817 Ga0209813_10019315 3300027866 Bacteria 1892
818 Ga0209974_10002156 3300027876 Bacteria 7194
819 Ga0207428_10000011 3300027907 Bacteria 354388
820 Ga0207428_10000046 3300027907 Bacteria 191032
821 Ga0207428_10000243 3300027907 Bacteria 74403
822 Ga0207428_10006150 3300027907 Bacteria 11087
823 Ga0207428_10018951 3300027907 Bacteria 5869
824 Ga0268266_10016910 3300028379 Bacteria 6231
825 Ga0268266_10029581 3300028379 Bacteria 4656
826 Ga0268266_10314655 3300028379 Bacteria 1464
827 Ga0268265_10000476 3300028380 Bacteria 42108
828 Ga0268265_10025158 3300028380 Bacteria 4221
829 Ga0268265_10118764 3300028380 Bacteria 2174
830 Ga0268265_10360049 3300028380 Bacteria 1331
831 Ga0268264_10001990 3300028381 Bacteria 18364
832 Ga0268264_10017122 3300028381 Bacteria 5935
833 Ga0268264_10513194 3300028381 Bacteria 1171
834 Ga0265322_10046738 3300028654 Bacteria 1231
835 Ga0265338_10049984 3300028800 Bacteria 3783
836 Ga0265760_10044903 3300031090 Bacteria 1323
837 Ga0265760_10074766 3300031090 Bacteria 1043
838 Ga0265325_10000111 3300031241 Bacteria 56612
839 Ga0265325_10001355 3300031241 Bacteria 17353
840 Ga0265325_10008226 3300031241 Bacteria 6169
841 Ga0265325_10032785 3300031241 Bacteria 2771
842 Ga0265325_10039894 3300031241 Bacteria 2469
843 Ga0265325_10046754 3300031241 Bacteria 2243
844 Ga0265329_10017314 3300031242 Bacteria 2482
845 Ga0265340_10058945 3300031247 Bacteria 1842
846 Ga0265339_10001156 3300031249 Bacteria 19924
847 Ga0265331_10010104 3300031250 Bacteria 5243
848 Ga0265316_10154410 3300031344 Bacteria 1718
849 Ga0307513_10038601 3300031456 Bacteria 5301
850 Ga0265313_10000302 3300031595 Bacteria 53447
851 Ga0265313_10003665 3300031595 Bacteria 12285
852 Ga0265313_10034356 3300031595 Bacteria 2565
853 Ga0265313_10081344 3300031595 Bacteria 1470
854 Ga0265313_10115968 3300031595 Bacteria 1173
855 Ga0316575_10023981 3300031665 Bacteria 2360
856 Ga0316579_10080140 3300031691 Bacteria 1554
857 Ga0265314_10005172 3300031711 Bacteria 11847
858 Ga0265314_10042046 3300031711 Bacteria 3264
859 Ga0265314_10070177 3300031711 Bacteria 2349
860 Ga0265342_10000321 3300031712 Bacteria 54074
861 Ga0265342_10001182 3300031712 Bacteria 24782
862 Ga0265342_10016430 3300031712 Bacteria 4838
863 Ga0307410_10320976 3300031852 Bacteria 1229
864 Ga0307416_100422412 3300032002 Bacteria 1378
865 Ga0307416_101480749 3300032002 Bacteria 784
866 Ga0373930_0000166 3300034816 Bacteria 7621
867 Ga0373958_0001352 3300034819 Bacteria 3284
868 Ga0373958_0012052 3300034819 Bacteria 1473
869 Ga0373959_0002250 3300034820 Bacteria 3073
870 Ga0373959_0005842 3300034820 Bacteria 2027
871 Ga0373938_0000070 3300034957 Bacteria 13548
872 Ga0373938_0002545 3300034957 Bacteria 2944
873 Ga0373938_0007577 3300034957 Bacteria 1913
874 Ga0373926_0097750 3300035083 Bacteria 1095
875 Ga0373928_0000143 3300035084 Bacteria 13701
876 Ga0373929_0000468 3300035085 Bacteria 7715
877 Ga0373934_0013195 3300035086 Bacteria 3122
878 Ga0373934_0026247 3300035086 Bacteria 2259
879 Ga0373940_0001717 3300035088 Bacteria 4057
880 Ga0373940_0077743 3300035088 Bacteria 976
881 Ga0373944_0000730 3300035089 Bacteria 7974
882 Ga0373944_0010094 3300035089 Bacteria 2568
883 Ga0373944_0027427 3300035089 Bacteria 1688
884 Ga0373944_0085089 3300035089 Bacteria 1050
885 Ga0373949_0002572 3300035090 Bacteria 4607
886 Ga0373949_0015960 3300035090 Bacteria 1682
887 Ga0373951_0001200 3300035091 Bacteria 6847
888 Ga0373951_0028372 3300035091 Bacteria 1311
889 Ga0373952_0000075 3300035092 Bacteria 12686
890 Ga0373952_0003769 3300035092 Bacteria 2741
891 Ga0373923_0010715 3300035111 Bacteria 3344
892 Ga0373923_0028597 3300035111 Bacteria 2230
893 Ga0373923_0042490 3300035111 Bacteria 1878
894 Ga0373923_0375422 3300035111 Bacteria 681
895 Ga0373932_0000208 3300035112 Bacteria 17216
896 Ga0373936_0006899 3300035113 Bacteria 4274
897 Ga0373936_0012355 3300035113 Bacteria 3248
898 Ga0373936_0028480 3300035113 Bacteria 2196
899 Ga0373936_0096395 3300035113 Bacteria 1244
900 Ga0373939_0008023 3300035114 Bacteria 2579
901 Ga0373941_0042221 3300035115 Bacteria 1415
902 Ga0373945_0003488 3300035116 Bacteria 4950
903 Ga0373945_0023108 3300035116 Bacteria 2146
904 Ga0373953_0000909 3300035117 Bacteria 8287
905 Ga0373953_0121326 3300035117 Bacteria 1110
906 Ga0373954_0001233 3300035118 Bacteria 10298
907 Ga0373954_0010174 3300035118 Bacteria 4146
908 Ga0373954_0049015 3300035118 Bacteria 1980
909 Ga0373956_0006037 3300035119 Bacteria 4851
910 Ga0373956_0091007 3300035119 Bacteria 1407
911 Ga0373956_0276047 3300035119 Bacteria 800
912 Ga0373957_0001719 3300035120 Bacteria 6017
913 Ga0373957_0025663 3300035120 Bacteria 2126
914 Ga0373957_0026220 3300035120 Bacteria 2106
915 Ga0373960_0000295 3300035121 Bacteria 9499
916 Ga0373960_0007802 3300035121 Bacteria 2545
917 Ga0373943_0003126 3300035170 Bacteria 7525
918 Ga0373943_0004846 3300035170 Bacteria 6082
919 Ga0373943_0009241 3300035170 Bacteria 4417
920 Ga0373943_0017030 3300035170 Bacteria 3322
921 Ga0373943_0199290 3300035170 Bacteria 1108
922 Ga0373943_0208456 3300035170 Bacteria 1084
923 Ga0373946_0007088 3300035171 Bacteria 4091
924 Ga0373946_0023409 3300035171 Bacteria 2412
925 Ga0373946_0041659 3300035171 Bacteria 1885
926 Ga0373946_0177403 3300035171 Bacteria 1009
927 Ga0373955_0000054 3300035172 Bacteria 44460
928 Ga0373955_0001515 3300035172 Bacteria 9917
929 Ga0373955_0006403 3300035172 Bacteria 5366
930 Ga0373955_0009120 3300035172 Bacteria 4635
931 Ga0373955_0090830 3300035172 Bacteria 1740
932 Ga0373955_0135028 3300035172 Bacteria 1443
933 Ga0373955_0438589 3300035172 Bacteria 795
934 Ga0373961_0004818 3300035241 Bacteria 3244
935 Ga0373961_0023763 3300035241 Bacteria 1652
936 Ga0373962_0001251 3300035242 Bacteria 5962
937 Ga0316574_0157460 3300035398 Unclassified 1463
938 Ga0373924_0000398 3300035410 Bacteria 13331
939 Ga0373924_0148961 3300035410 Bacteria 1023
940 Ga0373931_0000081 3300035691 Bacteria 44696
941 Ga0373931_0013530 3300035691 Bacteria 3974
942 Ga0373931_0039252 3300035691 Bacteria 2480
943 Ga0373931_0279431 3300035691 Bacteria 1024
944 Ga0373935_0000223 3300035692 Bacteria 27646
945 Ga0373935_0004201 3300035692 Bacteria 8436
946 Ga0373935_0013636 3300035692 Bacteria 4906
947 Ga0373935_0033635 3300035692 Bacteria 3191
948 Ga0373935_0050009 3300035692 Bacteria 2652
949 Ga0373935_0288808 3300035692 Bacteria 1156
950 Ga0373927_0000892 3300035695 Bacteria 22721
951 Ga0373927_0045923 3300035695 Bacteria 2826
952 Ga0373927_0049683 3300035695 Bacteria 2712
953 Ga0373927_0103533 3300035695 Bacteria 1852
954 Ga0373927_0132831 3300035695 Bacteria 1626
955 Ga0373927_0405123 3300035695 Bacteria 900
956 Ga0373933_0005801 3300035724 Bacteria 6717
957 Ga0373933_0020210 3300035724 Bacteria 3773
958 Ga0373933_0085326 3300035724 Bacteria 1941
959 Ga0373933_0123379 3300035724 Bacteria 1624
960 Ga0373947_0000629 3300035725 Bacteria 20890
961 Ga0373947_0000858 3300035725 Bacteria 18335
962 Ga0373947_0012112 3300035725 Bacteria 4939
963 Ga0373947_0035202 3300035725 Bacteria 2964
964 Ga0373947_0129392 3300035725 Bacteria 1610
965 Ga0373947_0266628 3300035725 Bacteria 1136
966 Ga0373937_0000006 3300036401 Bacteria 194781
967 Ga0373937_0002442 3300036401 Bacteria 15442
968 Ga0373937_0002827 3300036401 Bacteria 14506
969 Ga0373937_0034735 3300036401 Bacteria 4585
970 Ga0373937_0064471 3300036401 Bacteria 3370
971 Ga0373937_0211380 3300036401 Bacteria 1825
972 Ga0373937_0688940 3300036401 Bacteria 968
973 Ga0316582_0179774 3300036647 Bacteria 1439
974 Ga0373925_0000002 3300037068 Bacteria 368879
975 Ga0373925_0005426 3300037068 Bacteria 9499
976 Ga0373925_0020779 3300037068 Bacteria 4783
977 Ga0373925_0024045 3300037068 Bacteria 4446
978 Ga0373925_0083515 3300037068 Bacteria 2433
979 Ga0373925_0133370 3300037068 Bacteria 1938
980 Ga0373925_0247632 3300037068 Bacteria 1429
981 Ga0395900_0009339 3300037418 Bacteria 10054
982 Ga0395900_0258771 3300037418 Bacteria 1739
983 Ga0436364_0017610 3300037853 Bacteria 3759
984 Ga0436364_1176343 3300037853 Bacteria 13801
985 Ga0436364_1447184 3300037853 Bacteria 1924
986 Ga0395901_0035553 3300038443 Bacteria 5148
987 Ga0395901_0054146 3300038443 Bacteria 4169
988 Ga0395901_0129376 3300038443 Bacteria 2653
989 Ga0436365_0304759 3300039437 Bacteria 17649
990 Ga0436365_1143764 3300039437 Bacteria 2539
991 Ga0436365_1182988 3300039437 Bacteria 1060
992 Ga0436360_0477775 3300039438 Bacteria 1103
993 Ga0436360_0800279 3300039438 Bacteria 1165
994 Ga0436360_1130441 3300039438 Bacteria 913
995 Ga0436361_0795962 3300039447 Bacteria 7571
996 Ga0436363_0184989 3300039450 Bacteria 1991
997 Ga0436363_0631326 3300039450 Bacteria 990
998 Ga0436363_0806245 3300039450 Bacteria 3399
999 Ga0436362_0665353 3300039453 Bacteria 754
1000 Ga0451839_1052360 3300041496 Bacteria 1110
1001 Ga0451845_0108344 3300041501 Bacteria 921
1002 Ga0439455_0003723 3300042012 Bacteria 2946
1003 Ga0439455_0060335 3300042012 Bacteria 1005
1004 Ga0439444_0039888 3300042437 Bacteria 918
1005 Ga0439460_0045052 3300042461 Bacteria 1307
1006 Ga0466966_0025755 3300044684 Bacteria 3842
1007 Ga0466966_0227391 3300044684 Bacteria 1126
1008 Ga0466963_0005907 3300044694 Bacteria 7209
1009 Ga0466963_0193158 3300044694 Bacteria 1422
1010 Ga0453684_0418992 3300044712 Bacteria 1496
1011 Ga0466971_0058939 3300044719 Bacteria 1734
1012 Ga0466957_0274806 3300044842 Bacteria 1126
1013 Ga0466957_0349276 3300044842 Bacteria 1003
1014 Ga0466959_0029744 3300045049 Bacteria 4047
1015 Ga0466959_0049370 3300045049 Bacteria 3091
1016 Ga0451576_0892660 3300045051 Bacteria 933
1017 Ga0466958_0047377 3300045836 Bacteria 2595
1018 Ga0466958_0062572 3300045836 Bacteria 2269
1019 Ga0466967_0035123 3300045976 Bacteria 4263
1020 Ga0466967_0411706 3300045976 Bacteria 1317
1021 Ga0466967_0651060 3300045976 Bacteria 1042
1022 Ga0466967_1021499 3300045976 Bacteria 823
1023 Ga0495592_0000086 3300046454 Bacteria 82248
1024 Ga0495592_0130313 3300046454 Bacteria 1760
1025 Ga0495603_0025478 3300046455 Bacteria 3577
1026 Ga0495603_0026392 3300046455 Bacteria 3509
1027 Ga0495603_0057320 3300046455 Bacteria 2305
1028 Ga0495590_0116804 3300046457 Bacteria 954
1029 Ga0495591_047965 3300046458 Bacteria 1180
1030 Ga0495629_0000102 3300046459 Bacteria 75235
1031 Ga0495629_0062443 3300046459 Bacteria 2602
1032 Ga0495629_0075062 3300046459 Bacteria 2361
1033 Ga0495629_0102631 3300046459 Bacteria 1995
1034 Ga0495629_0158224 3300046459 Bacteria 1573
1035 Ga0495638_0012731 3300046460 Bacteria 5751
1036 Ga0495638_0073312 3300046460 Bacteria 2090
1037 Ga0495638_0441731 3300046460 Bacteria 666
1038 Ga0495641_0063857 3300046461 Bacteria 1658
1039 Ga0495641_0091030 3300046461 Bacteria 1363
1040 Ga0495651_0002610 3300046462 Bacteria 13943
1041 Ga0495651_0012781 3300046462 Bacteria 6482
1042 Ga0495651_0074437 3300046462 Bacteria 2576
1043 Ga0495651_0097473 3300046462 Bacteria 2195
1044 Ga0495651_0205558 3300046462 Bacteria 1374
1045 Ga0495651_0245213 3300046462 Bacteria 1226
1046 Ga0495651_0404184 3300046462 Bacteria 891
1047 Ga0495653_0000006 3300046463 Bacteria 363285
1048 Ga0495653_0001478 3300046463 Bacteria 18332
1049 Ga0495653_0009722 3300046463 Bacteria 7865
1050 Ga0495653_0124946 3300046463 Bacteria 1828
1051 Ga0495653_0146044 3300046463 Bacteria 1657
1052 Ga0495580_0037467 3300046472 Bacteria 3480
1053 Ga0495580_0090494 3300046472 Bacteria 2130
1054 Ga0495582_0007603 3300046473 Bacteria 5996
1055 Ga0495582_0035860 3300046473 Bacteria 2728
1056 Ga0495582_0066289 3300046473 Bacteria 1995
1057 Ga0495582_0107170 3300046473 Bacteria 1568
1058 Ga0495605_0015905 3300046474 Bacteria 4083
1059 Ga0495605_0023637 3300046474 Bacteria 3228
1060 Ga0495639_0007577 3300046475 Bacteria 4664
1061 Ga0495639_0067431 3300046475 Bacteria 1648
1062 Ga0495639_0162492 3300046475 Bacteria 1081
1063 Ga0495662_0001529 3300046476 Bacteria 11497
1064 Ga0495662_0003742 3300046476 Bacteria 7668
1065 Ga0495662_0058271 3300046476 Bacteria 1865
1066 Ga0495662_0161045 3300046476 Bacteria 1105
1067 Ga0495664_0000002 3300046477 Bacteria 625183
1068 Ga0495664_0083198 3300046477 Bacteria 1920
1069 Ga0495584_0017751 3300046491 Bacteria 3620
1070 Ga0495585_0031865 3300046492 Bacteria 2990
1071 Ga0495594_0001621 3300046499 Bacteria 11698
1072 Ga0495594_0007428 3300046499 Bacteria 5638
1073 Ga0495594_0065373 3300046499 Bacteria 2017
1074 Ga0495607_0062488 3300046501 Bacteria 2110
1075 Ga0495608_0000009 3300046511 Bacteria 266614
1076 Ga0495608_0004302 3300046511 Bacteria 10197
1077 Ga0495608_0104491 3300046511 Bacteria 1824
1078 Ga0495608_0111335 3300046511 Bacteria 1760
1079 Ga0495608_0181772 3300046511 Bacteria 1330
1080 Ga0495608_0280570 3300046511 Bacteria 1034
1081 Ga0495618_0000005 3300046514 Bacteria 230421
1082 Ga0495618_0034349 3300046514 Bacteria 3179
1083 Ga0495618_0072190 3300046514 Bacteria 2196
1084 Ga0495618_0225342 3300046514 Bacteria 1181
1085 Ga0495628_0000002 3300046516 Bacteria 589399
1086 Ga0495628_0016439 3300046516 Bacteria 6173
1087 Ga0495628_0053450 3300046516 Bacteria 3187
1088 Ga0495628_0061485 3300046516 Bacteria 2945
1089 Ga0495630_0006258 3300046517 Bacteria 8450
1090 Ga0495630_0065815 3300046517 Bacteria 2723
1091 Ga0495630_0103001 3300046517 Bacteria 2160
1092 Ga0495630_0512670 3300046517 Bacteria 919
1093 Ga0495632_0074914 3300046519 Bacteria 1621
1094 Ga0495637_0160355 3300046520 Bacteria 844
1095 Ga0495643_0088497 3300046522 Bacteria 1601
1096 Ga0495643_0310480 3300046522 Bacteria 716
1097 Ga0495644_0005556 3300046523 Bacteria 4921
1098 Ga0495663_0012025 3300046525 Bacteria 2412
1099 Ga0495663_0088123 3300046525 Bacteria 1008
1100 Ga0495666_0072016 3300046526 Bacteria 1642
1101 Ga0495666_0085085 3300046526 Bacteria 1493
1102 Ga0495666_0197495 3300046526 Bacteria 925
1103 Ga0495652_0000004 3300046529 Bacteria 588877
1104 Ga0495652_0044785 3300046529 Bacteria 3808
1105 Ga0495652_0108769 3300046529 Bacteria 2233
1106 Ga0495652_0108783 3300046529 Bacteria 2233
1107 Ga0495652_0130358 3300046529 Bacteria 1991
1108 Ga0495652_0280889 3300046529 Bacteria 1219
1109 Ga0495665_0008565 3300046531 Bacteria 5550
1110 Ga0495665_0044141 3300046531 Bacteria 2369
1111 Ga0495665_0107160 3300046531 Bacteria 1466
1112 Ga0495665_0115141 3300046531 Bacteria 1409
1113 Ga0495665_0238693 3300046531 Bacteria 937
1114 Ga0495640_0000005 3300046533 Bacteria 318271
1115 Ga0495640_0007182 3300046533 Bacteria 8774
1116 Ga0495640_0031082 3300046533 Bacteria 3815
1117 Ga0495640_0039228 3300046533 Bacteria 3325
1118 Ga0495640_0068913 3300046533 Bacteria 2379
1119 Ga0495640_0087567 3300046533 Bacteria 2059
1120 Ga0495587_0000007 3300046536 Bacteria 290788
1121 Ga0495587_0002711 3300046536 Bacteria 11824
1122 Ga0495587_0019764 3300046536 Bacteria 4164
1123 Ga0495587_0047442 3300046536 Bacteria 2547
1124 Ga0495587_0061115 3300046536 Bacteria 2208
1125 Ga0495598_0001796 3300046537 Bacteria 4312
1126 Ga0495609_0049156 3300046538 Bacteria 1883
1127 Ga0495645_0000003 3300046543 Bacteria 570133
1128 Ga0495645_0006697 3300046543 Bacteria 8004
1129 Ga0495645_0048417 3300046543 Bacteria 3096
1130 Ga0495645_0194635 3300046543 Bacteria 1379
1131 Ga0495622_0003142 3300046557 Bacteria 7822
1132 Ga0495622_0268894 3300046557 Bacteria 747
1133 Ga0495633_0153158 3300046558 Bacteria 1064
1134 Ga0495667_0000002 3300046559 Bacteria 437535
1135 Ga0495667_0005667 3300046559 Bacteria 8450
1136 Ga0495667_0008306 3300046559 Bacteria 7037
1137 Ga0495667_0022412 3300046559 Bacteria 4254
1138 Ga0495667_0165211 3300046559 Bacteria 1423
1139 Ga0495656_0006305 3300046615 Bacteria 4155
1140 Ga0495656_0213277 3300046615 Bacteria 963
1141 Ga0495634_0000370 3300046642 Bacteria 43881
1142 Ga0495634_0038394 3300046642 Bacteria 3266
1143 Ga0495634_0043794 3300046642 Bacteria 3032
1144 Ga0495635_0000020 3300046663 Bacteria 189698
1145 Ga0495635_0002189 3300046663 Bacteria 13290
1146 Ga0495635_0012205 3300046663 Bacteria 6022
1147 Ga0495635_0093869 3300046663 Bacteria 2051
1148 Ga0495659_0004205 3300046664 Bacteria 4544
1149 Ga0495659_0008734 3300046664 Bacteria 3227
1150 Ga0495588_0030592 3300046674 Bacteria 2707
1151 Ga0495588_0279006 3300046674 Bacteria 880
1152 Ga0495657_0000240 3300046675 Bacteria 49927
1153 Ga0495657_0065357 3300046675 Bacteria 2393
1154 Ga0495657_0084068 3300046675 Bacteria 2054
1155 Ga0495657_0315317 3300046675 Bacteria 930
1156 Ga0495599_0000001 3300046678 Bacteria 537563
1157 Ga0495599_0016560 3300046678 Bacteria 4577
1158 Ga0495623_0000001 3300046679 Bacteria 313861
1159 Ga0495623_0001957 3300046679 Bacteria 13828
1160 Ga0495623_0097274 3300046679 Bacteria 1798
1161 Ga0495646_0000013 3300046680 Bacteria 159700
1162 Ga0495646_0007674 3300046680 Bacteria 6856
1163 Ga0495646_0266155 3300046680 Bacteria 914
1164 Ga0495647_0039495 3300046681 Bacteria 1789
1165 Ga0495647_0042270 3300046681 Bacteria 1739
1166 Ga0495647_0060866 3300046681 Bacteria 1489
1167 Ga0495658_0000053 3300046683 Bacteria 58161
1168 Ga0495658_0004065 3300046683 Bacteria 7205
1169 Ga0495658_0083377 3300046683 Bacteria 1880
1170 Ga0495658_0118798 3300046683 Bacteria 1597
1171 Ga0495658_0309162 3300046683 Bacteria 1000
1172 Ga0495669_0004939 3300046684 Bacteria 5538
1173 Ga0495669_0137838 3300046684 Bacteria 1151
1174 Ga0495613_0002216 3300046689 Bacteria 14718
1175 Ga0495613_0016392 3300046689 Bacteria 5520
1176 Ga0495613_0049090 3300046689 Bacteria 3115
1177 Ga0495613_0460145 3300046689 Bacteria 861
1178 Ga0495624_0009657 3300046690 Bacteria 6680
1179 Ga0495624_0061491 3300046690 Bacteria 2353
1180 Ga0495624_0085343 3300046690 Bacteria 1950
1181 Ga0495670_0001982 3300046691 Bacteria 10052
1182 Ga0495670_0070550 3300046691 Bacteria 1768
1183 Ga0495600_0000041 3300046809 Bacteria 75747
1184 Ga0495600_0012714 3300046809 Bacteria 5270
1185 Ga0495600_0016627 3300046809 Bacteria 4673
1186 Ga0495600_0096880 3300046809 Bacteria 1923
1187 Ga0495581_0026170 3300047315 Bacteria 3384
1188 Ga0495581_0041169 3300047315 Bacteria 2673
1189 Ga0495581_0043882 3300047315 Bacteria 2586
1190 Ga0495581_0071826 3300047315 Bacteria 2002
1191 Ga0495581_0120149 3300047315 Bacteria 1529
1192 Ga0495604_0000005 3300047317 Bacteria 424516
1193 Ga0495604_0012681 3300047317 Bacteria 6706
1194 Ga0495604_0035518 3300047317 Bacteria 3936
1195 Ga0495604_0083771 3300047317 Bacteria 2382
1196 Ga0495604_0127317 3300047317 Bacteria 1834
1197 Ga0495604_0162681 3300047317 Bacteria 1576
1198 Ga0495604_0179844 3300047317 Bacteria 1480
1199 Ga0495604_0214775 3300047317 Bacteria 1327
1200 Ga0495674_0000003 3300047319 Bacteria 562126
1201 Ga0495674_0009717 3300047319 Bacteria 9133
1202 Ga0495674_0095193 3300047319 Bacteria 2539
1203 Ga0495674_0171662 3300047319 Bacteria 1809
1204 Ga0495674_0188831 3300047319 Bacteria 1713
1205 Ga0495674_0252650 3300047319 Bacteria 1450
1206 Ga0495674_0745751 3300047319 Bacteria 765
1207 Ga0495676_0030302 3300047321 Bacteria 4595
1208 Ga0495676_0368520 3300047321 Bacteria 957
1209 Ga0495680_0000002 3300047322 Bacteria 197533
1210 Ga0495680_0005450 3300047322 Bacteria 11973
1211 Ga0495680_0014597 3300047322 Bacteria 6799
1212 Ga0495680_0014851 3300047322 Bacteria 6732
1213 Ga0495680_0019006 3300047322 Bacteria 5816
1214 Ga0495680_0020938 3300047322 Bacteria 5485
1215 Ga0495680_0070730 3300047322 Bacteria 2659
1216 Ga0495683_0261896 3300047323 Bacteria 755
1217 Ga0495683_0272055 3300047323 Bacteria 736
1218 Ga0495675_0000010 3300047444 Bacteria 153375
1219 Ga0495675_0002614 3300047444 Bacteria 10792
1220 Ga0495675_0044659 3300047444 Bacteria 2823
1221 Ga0495675_0147576 3300047444 Bacteria 1455
1222 Ga0495677_0074424 3300047445 Bacteria 1268
1223 Ga0495679_009496 3300047446 Bacteria 3891
1224 Ga0495685_038085 3300047447 Bacteria 1648
1225 Ga0495681_0154853 3300047470 Bacteria 959
1226 Ga0495684_0000020 3300047471 Bacteria 148507
1227 Ga0495684_0105287 3300047471 Bacteria 2131
1228 Ga0495684_0113668 3300047471 Bacteria 2041
1229 Ga0495684_0289915 3300047471 Bacteria 1178
1230 Ga0495684_0519522 3300047471 Bacteria 816
1231 Ga0495593_0001835 3300047673 Bacteria 12647
1232 Ga0495593_0010195 3300047673 Bacteria 5432
1233 Ga0495593_0012341 3300047673 Bacteria 4882
1234 Ga0495602_0000027 3300048088 Bacteria 145010
1235 Ga0495602_0004530 3300048088 Bacteria 14499
1236 Ga0495602_0100018 3300048088 Bacteria 2382
1237 Ga0495602_0299977 3300048088 Bacteria 1176
1238 Ga0495602_0347093 3300048088 Bacteria 1072
1239 Ga0495602_0348098 3300048088 Bacteria 1070
1240 Ga0495602_0526817 3300048088 Bacteria 822
1241 Ga0495614_0021062 3300048089 Bacteria 2818
1242 Ga0495614_0061249 3300048089 Bacteria 1617
1243 Ga0495614_0153792 3300048089 Bacteria 1027
1244 Ga0495615_0008947 3300048090 Bacteria 1952
1245 Ga0495626_0227867 3300048091 Bacteria 755
1246 Ga0496100_0000297 3300048903 Bacteria 24690
1247 Ga0496100_0007653 3300048903 Bacteria 5976
1248 Ga0496100_0040734 3300048903 Bacteria 2958
1249 Ga0496100_0048258 3300048903 Bacteria 2747
1250 Ga0496101_0000061 3300048904 Bacteria 127480
1251 Ga0496101_0039136 3300048904 Bacteria 3370
1252 Ga0496102_0000755 3300048905 Bacteria 31610
1253 Ga0496102_0005986 3300048905 Bacteria 10358
1254 Ga0496102_0057781 3300048905 Bacteria 3543
1255 Ga0496102_0122050 3300048905 Bacteria 2434
1256 Ga0496102_0533190 3300048905 Bacteria 1096
1257 Ga0496102_0691363 3300048905 Bacteria 943
1258 Ga0496103_0001510 3300048906 Bacteria 15563
1259 Ga0496103_0002840 3300048906 Bacteria 10773
1260 Ga0496103_0014136 3300048906 Bacteria 4738
1261 Ga0496103_0096799 3300048906 Bacteria 1865
1262 Ga0496103_0117825 3300048906 Bacteria 1690
1263 Ga0496104_0001796 3300048907 Bacteria 18590
1264 Ga0496104_0005538 3300048907 Bacteria 11062
1265 Ga0496104_0012186 3300048907 Bacteria 7724
1266 Ga0496104_0060060 3300048907 Bacteria 3601
1267 Ga0496104_0726268 3300048907 Bacteria 901
1268 Ga0496105_0000541 3300048908 Bacteria 24931
1269 Ga0496105_0004608 3300048908 Bacteria 10386
1270 Ga0496105_0009830 3300048908 Bacteria 7497
1271 Ga0496105_0037915 3300048908 Bacteria 3970
1272 Ga0496106_0000690 3300048909 Bacteria 24224
1273 Ga0496106_0002107 3300048909 Bacteria 14884
1274 Ga0496106_0023158 3300048909 Bacteria 4613
1275 Ga0496106_0028812 3300048909 Bacteria 4138
1276 Ga0496106_0070287 3300048909 Bacteria 2673
1277 Ga0496106_0078282 3300048909 Bacteria 2536
1278 Ga0496106_0680539 3300048909 Bacteria 821
1279 Ga0496107_0000308 3300048910 Bacteria 26232
1280 Ga0496107_0012301 3300048910 Bacteria 5974
1281 Ga0496107_0020511 3300048910 Bacteria 4668
1282 Ga0496107_0089197 3300048910 Bacteria 2252
1283 Ga0496107_0168554 3300048910 Bacteria 1624
1284 Ga0496107_0556306 3300048910 Bacteria 849
1285 Ga0496107_0736391 3300048910 Bacteria 724
1286 Ga0496108_0001212 3300048911 Bacteria 20220
1287 Ga0496108_0003829 3300048911 Bacteria 12060
1288 Ga0496108_0005567 3300048911 Bacteria 10190
1289 Ga0496108_0017593 3300048911 Bacteria 5848
1290 Ga0496108_0045104 3300048911 Bacteria 3681
1291 Ga0496108_0170681 3300048911 Bacteria 1882
1292 Ga0496108_0218387 3300048911 Bacteria 1656
1293 Ga0496108_0272594 3300048911 Bacteria 1473
1294 Ga0496108_0307452 3300048911 Bacteria 1381
1295 Ga0496109_0000530 3300048912 Bacteria 32282
1296 Ga0496109_0002514 3300048912 Bacteria 15376
1297 Ga0496109_0081939 3300048912 Bacteria 2973
1298 Ga0496109_0105150 3300048912 Bacteria 2621
1299 Ga0496109_0630874 3300048912 Bacteria 1008
1300 Ga0496109_0720410 3300048912 Bacteria 935
1301 Ga0496109_1083222 3300048912 Bacteria 738
1302 Ga0496110_0001525 3300048913 Bacteria 16816
1303 Ga0496110_0049062 3300048913 Bacteria 3702
1304 Ga0496110_0077983 3300048913 Bacteria 2949
1305 Ga0496110_0136067 3300048913 Bacteria 2220
1306 Ga0496110_0216036 3300048913 Bacteria 1743
1307 Ga0496110_0622554 3300048913 Bacteria 978
1308 Ga0496111_0002616 3300048914 Bacteria 10910
1309 Ga0496111_0018936 3300048914 Bacteria 4773
1310 Ga0496111_0053204 3300048914 Bacteria 2924
1311 Ga0496111_0094817 3300048914 Bacteria 2189
1312 Ga0496111_0534812 3300048914 Bacteria 861
1313 Ga0496112_0001311 3300048915 Bacteria 18910
1314 Ga0496112_0026813 3300048915 Bacteria 5551
1315 Ga0496112_0028051 3300048915 Bacteria 5431
1316 Ga0496112_0505112 3300048915 Bacteria 1144
1317 Ga0496113_0000122 3300048916 Bacteria 33708
1318 Ga0496113_0046775 3300048916 Bacteria 3213
1319 Ga0496113_0065168 3300048916 Bacteria 2756
1320 Ga0496113_0085203 3300048916 Bacteria 2427
1321 Ga0496113_0670550 3300048916 Bacteria 829
1322 Ga0496114_0006714 3300048917 Bacteria 9067
1323 Ga0496114_0132473 3300048917 Bacteria 2153
1324 Ga0496114_0216272 3300048917 Bacteria 1682
1325 Ga0496114_0435153 3300048917 Bacteria 1162
1326 Ga0496114_1028782 3300048917 Bacteria 707
1327 Ga0496115_0003537 3300048918 Bacteria 11240
1328 Ga0496115_0052144 3300048918 Bacteria 3281
1329 Ga0496115_0133215 3300048918 Bacteria 2048
1330 Ga0496115_0160652 3300048918 Bacteria 1857
1331 Ga0496115_0171423 3300048918 Bacteria 1795
1332 Ga0496115_0356941 3300048918 Bacteria 1191
1333 Ga0501031_0014328 3300049568 Bacteria 5154
1334 Ga0501032_0090537 3300049569 Bacteria 2030
1335 Ga0501032_0189451 3300049569 Bacteria 1344
1336 Ga0501034_0000230 3300049571 Bacteria 105001
1337 Ga0501034_0000979 3300049571 Bacteria 41076
1338 Ga0501034_0058928 3300049571 Bacteria 3858
1339 Ga0501034_0278823 3300049571 Bacteria 1611
1340 Ga0501034_0327423 3300049571 Bacteria 1464
1341 Ga0501034_0371728 3300049571 Bacteria 1355
1342 Ga0501034_0996745 3300049571 Bacteria 722
1343 Ga0501036_0001363 3300049572 Bacteria 18749
1344 Ga0501036_0040704 3300049572 Bacteria 3930
1345 Ga0501036_0112049 3300049572 Bacteria 2305
1346 Ga0501036_0201179 3300049572 Bacteria 1675
1347 Ga0501036_0401195 3300049572 Bacteria 1144
1348 Ga0501037_0004189 3300049573 Bacteria 10459
1349 Ga0501037_0005414 3300049573 Bacteria 9296
1350 Ga0501037_0069205 3300049573 Bacteria 2569
1351 Ga0501037_0075572 3300049573 Bacteria 2446
1352 Ga0501038_0204839 3300049574 Bacteria 1581
1353 Ga0501039_0056147 3300049575 Bacteria 3050
1354 Ga0501039_0192615 3300049575 Bacteria 1603
1355 Ga0501039_0479678 3300049575 Bacteria 976
1356 Ga0501040_0227213 3300049576 Bacteria 1329
1357 Ga0501042_0186301 3300049578 Bacteria 1497
1358 Ga0501042_0411598 3300049578 Bacteria 980
1359 Ga0501043_0025842 3300049579 Bacteria 4606
1360 Ga0501043_0107538 3300049579 Bacteria 2190
1361 Ga0501043_0177763 3300049579 Bacteria 1659
1362 Ga0501043_0291756 3300049579 Bacteria 1248
1363 Ga0501043_0340694 3300049579 Bacteria 1140
1364 Ga0501046_0030547 3300049580 Bacteria 4372
1365 Ga0501046_0087403 3300049580 Bacteria 2402
1366 Ga0501046_0116592 3300049580 Bacteria 2035
1367 Ga0501046_0333857 3300049580 Bacteria 1103
1368 Ga0501047_0000104 3300049581 Bacteria 102971
1369 Ga0501047_0013879 3300049581 Bacteria 7651
1370 Ga0501047_0130322 3300049581 Bacteria 2395
1371 Ga0501047_0261271 3300049581 Bacteria 1579
1372 Ga0501047_0488547 3300049581 Bacteria 1058
1373 Ga0501047_0582553 3300049581 Bacteria 941
1374 Ga0501047_0766276 3300049581 Bacteria 780
1375 Ga0501048_0065844 3300049582 Bacteria 2561
1376 Ga0501048_0111604 3300049582 Bacteria 1930
1377 Ga0501048_0255460 3300049582 Bacteria 1245
1378 Ga0501067_0188984 3300049583 Bacteria 1147
1379 Ga0501068_0187892 3300049584 Bacteria 1308
1380 Ga0501069_0005267 3300049585 Bacteria 6718
1381 Ga0501069_0032938 3300049585 Bacteria 2852
1382 Ga0501069_0047073 3300049585 Bacteria 2393
1383 Ga0501070_0004425 3300049586 Bacteria 12066
1384 Ga0501070_0008389 3300049586 Bacteria 8728
1385 Ga0501070_0085497 3300049586 Bacteria 2611
1386 Ga0501070_0269885 3300049586 Bacteria 1389
1387 Ga0501070_0581299 3300049586 Bacteria 894
1388 Ga0501071_0037150 3300049587 Bacteria 3476
1389 Ga0501071_0222279 3300049587 Bacteria 1421
1390 Ga0501072_0046653 3300049588 Bacteria 3411
1391 Ga0501073_0025376 3300049589 Bacteria 4251
1392 Ga0501073_0132290 3300049589 Bacteria 1729
1393 Ga0501073_0238023 3300049589 Bacteria 1257
1394 Ga0501073_0317729 3300049589 Bacteria 1074
1395 Ga0501074_0008421 3300049590 Bacteria 7478
1396 Ga0501074_0014334 3300049590 Bacteria 5766
1397 Ga0501074_0055363 3300049590 Bacteria 2859
1398 Ga0501075_0089053 3300049591 Bacteria 2340
1399 Ga0501075_0253892 3300049591 Bacteria 1340
1400 Ga0501075_0316321 3300049591 Bacteria 1190
1401 Ga0501075_0633591 3300049591 Bacteria 815
1402 Ga0501076_0069172 3300049592 Bacteria 2821
1403 Ga0501076_0207668 3300049592 Bacteria 1600
1404 Ga0501076_0254157 3300049592 Bacteria 1438
1405 Ga0501076_0367708 3300049592 Bacteria 1182
1406 Ga0501076_1033087 3300049592 Bacteria 677
1407 Ga0501077_0122081 3300049593 Bacteria 1652
1408 Ga0501077_0456183 3300049593 Bacteria 819
1409 Ga0501079_0099398 3300049741 Bacteria 2255
1410 Ga0501079_0173214 3300049741 Bacteria 1683
1411 Ga0501079_0227168 3300049741 Bacteria 1458
1412 Ga0501079_0487161 3300049741 Bacteria 969
1413 Ga0501080_0000750 3300049742 Bacteria 26251
1414 Ga0501080_0033845 3300049742 Bacteria 4770
1415 Ga0501080_0095364 3300049742 Bacteria 2762
1416 Ga0501080_0109574 3300049742 Bacteria 2559
1417 Ga0501080_0186791 3300049742 Bacteria 1905
1418 Ga0501080_0381257 3300049742 Bacteria 1270
1419 Ga0501081_0044633 3300049743 Bacteria 3043
1420 Ga0501081_0098465 3300049743 Bacteria 2065
1421 Ga0501083_0001387 3300049744 Bacteria 16462
1422 Ga0501083_0003903 3300049744 Bacteria 10472
1423 Ga0501083_0177308 3300049744 Bacteria 1392
1424 Ga0501083_0184070 3300049744 Bacteria 1363
1425 Ga0501035_0015132 3300049822 Bacteria 7120
1426 Ga0501035_0121202 3300049822 Bacteria 2286
1427 Ga0501035_0121262 3300049822 Bacteria 2285
1428 Ga0501035_0264382 3300049822 Bacteria 1457
1429 Ga0501035_0402620 3300049822 Bacteria 1138
1430 Ga0501035_0414737 3300049822 Bacteria 1118
1431 Ga0501044_0021098 3300049823 Bacteria 6955
1432 Ga0501044_0045705 3300049823 Bacteria 4536
1433 Ga0501044_0049599 3300049823 Bacteria 4333
1434 Ga0501044_0383328 3300049823 Bacteria 1320
1435 Ga0501044_0983386 3300049823 Bacteria 716
1436 Ga0501045_0286694 3300049824 Bacteria 1226
1437 nmdc:mga03683_148949_c1 3300050489 Bacteria 1055
1438 nmdc:mga03683_190664_c1 3300050489 Bacteria 938
1439 nmdc:mga03683_20876_c1 3300050489 Bacteria 2518
1440 nmdc:mga03683_67652_c1 3300050489 Bacteria 1521
1441 nmdc:mga03683_77367_c1 3300050489 Bacteria 1431
1442 nmdc:mga03n38_188976_c1 3300050490 Bacteria 1060
1443 nmdc:mga03n38_55772_c1 3300050490 Bacteria 1781
1444 nmdc:mga03n38_9263_c1 3300050490 Bacteria 3572
1445 nmdc:mga00v17_59863_c1 3300050491 Bacteria 2338
1446 nmdc:mga0yw44_297193_c1 3300050492 Bacteria 1081
1447 nmdc:mga0yw44_40773_c1 3300050492 Bacteria 2761
1448 nmdc:mga0yw44_51052_c1 3300050492 Bacteria 2503
1449 nmdc:mga0yw44_80385_c1 3300050492 Bacteria 2042
1450 nmdc:mga0k408_211839_c1 3300050493 Bacteria 1157
1451 nmdc:mga0k408_33851_c1 3300050493 Bacteria 2924
1452 nmdc:mga06z11_19298_c1 3300050494 Bacteria 3131
1453 nmdc:mga06z11_487003_c1 3300050494 Bacteria 747
1454 nmdc:mga06z11_55267_c1 3300050494 Bacteria 2049
1455 nmdc:mga04h51_23009_c1 3300050495 Bacteria 1892
1456 nmdc:mga04h51_6154_c1 3300050495 Bacteria 3096
1457 nmdc:mga07m45_242634_c1 3300050496 Bacteria 1048
1458 nmdc:mga07m45_365128_c1 3300050496 Bacteria 839
1459 nmdc:mga07m45_412497_c1 3300050496 Bacteria 784
1460 nmdc:mga07m45_50023_c1 3300050496 Bacteria 2354
1461 nmdc:mga07m45_65791_c1 3300050496 Bacteria 2059
1462 nmdc:mga05p37_1686_c1 3300050507 Bacteria 25707
1463 nmdc:mga05p37_253127_c1 3300050507 Bacteria 2111
1464 nmdc:mga05p37_269281_c1 3300050507 Bacteria 2036
1465 nmdc:mga05p37_3518_c1 3300050507 Bacteria 18302
1466 nmdc:mga05p37_62967_c1 3300050507 Bacteria 4565
1467 nmdc:mga05p37_90903_c1 3300050507 Bacteria 3762
1468 nmdc:mga09592_2329_c1 3300050508 Bacteria 15331
1469 nmdc:mga09592_66746_c1 3300050508 Bacteria 3050
1470 nmdc:mga09592_9760_c1 3300050508 Bacteria 7800
1471 nmdc:mga0qj67_115598_c1 3300050509 Bacteria 2168
1472 nmdc:mga0qj67_50077_c1 3300050509 Bacteria 3302
1473 nmdc:mga0qj67_655_c1 3300050509 Bacteria 23866
1474 nmdc:mga0qj67_98813_c1 3300050509 Bacteria 2351
1475 nmdc:mga06r32_13402_c1 3300050510 Bacteria 7424
1476 nmdc:mga06r32_151696_c1 3300050510 Bacteria 2296
1477 nmdc:mga06r32_36766_c1 3300050510 Bacteria 4630
1478 nmdc:mga06r32_37775_c1 3300050510 Bacteria 4569
1479 nmdc:mga06r32_40424_c1 3300050510 Bacteria 2509
1480 nmdc:mga06r32_45175_c1 3300050510 Bacteria 4198
1481 nmdc:mga06r32_482229_c1 3300050510 Bacteria 1218
1482 nmdc:mga06r32_639132_c1 3300050510 Bacteria 1033
1483 nmdc:mga06r32_755609_c1 3300050510 Bacteria 935
1484 nmdc:mga06r32_865078_c1 3300050510 Bacteria 862
1485 nmdc:mga08y16_11167_c1 3300050511 Bacteria 9433
1486 nmdc:mga08y16_111884_c1 3300050511 Bacteria 2842
1487 nmdc:mga08y16_1119643_c1 3300050511 Bacteria 761
1488 nmdc:mga08y16_1572_c1 3300050511 Bacteria 23057
1489 nmdc:mga08y16_157653_c1 3300050511 Bacteria 2359
1490 nmdc:mga08y16_208254_c1 3300050511 Bacteria 2025
1491 nmdc:mga08y16_26488_c1 3300050511 Bacteria 6113
1492 nmdc:mga08y16_391496_c1 3300050511 Bacteria 1424
1493 nmdc:mga0n895_1314457_c1 3300050512 Bacteria 694
1494 nmdc:mga0n895_1438_c1 3300050512 Bacteria 17803
1495 nmdc:mga0n895_24805_c1 3300050512 Bacteria 5657
1496 nmdc:mga0n895_3408_c1 3300050512 Bacteria 12806
1497 nmdc:mga0n895_365885_c1 3300050512 Bacteria 1460
1498 nmdc:mga0n895_462304_c1 3300050512 Bacteria 1281
1499 nmdc:mga0n895_7582_c2 3300050512 Bacteria 7771
1500 nmdc:mga0rr50_264508_c1 3300050513 Bacteria 1432
1501 nmdc:mga0rr50_47749_c1 3300050513 Bacteria 3161
1502 nmdc:mga0rr50_821487_c1 3300050513 Bacteria 793
1503 nmdc:mga08x19_152921_c1 3300050514 Bacteria 1563
1504 nmdc:mga08x19_401004_c1 3300050514 Bacteria 962
1505 nmdc:mga0a205_155097_c1 3300050515 Bacteria 2188
1506 nmdc:mga0a205_328996_c1 3300050515 Bacteria 1398
1507 nmdc:mga0a205_549411_c1 3300050515 Bacteria 1010
1508 nmdc:mga0a205_5554_c3 3300050515 Bacteria 8325
1509 nmdc:mga0a205_67929_c1 3300050515 Bacteria 3443
1510 nmdc:mga0a205_989001_c1 3300050515 Bacteria 688
1511 nmdc:mga0sz30_136334_c1 3300050516 Bacteria 1083
1512 nmdc:mga0sz30_200956_c1 3300050516 Bacteria 885
1513 Ga0495601_0000008 3300053077 Bacteria 362152
1514 Ga0495601_0000532 3300053077 Bacteria 20138
1515 Ga0495601_0001456 3300053077 Bacteria 13045
1516 Ga0495601_0001725 3300053077 Bacteria 12088
1517 Ga0495601_0016949 3300053077 Bacteria 4419
1518 Ga0495601_0017524 3300053077 Bacteria 4349
1519 Ga0495601_0019036 3300053077 Bacteria 4183
1520 Ga0495601_0108227 3300053077 Bacteria 1798
1521 Ga0495601_0110329 3300053077 Bacteria 1781
1522 Ga0495612_0000002 3300053078 Bacteria 310466
1523 Ga0495612_0002354 3300053078 Bacteria 7783
1524 Ga0495612_0002553 3300053078 Bacteria 7508
1525 Ga0495612_0072115 3300053078 Bacteria 1441
1526 Ga0495655_0041036 3300053083 Bacteria 1181
1527 Ga0495595_0000008 3300053084 Bacteria 196206
1528 Ga0495595_0000211 3300053084 Bacteria 23480
1529 Ga0495595_0003527 3300053084 Bacteria 6210
1530 Ga0495595_0012207 3300053084 Bacteria 3606
1531 Ga0495595_0025092 3300053084 Bacteria 2637
1532 Ga0495595_0059736 3300053084 Bacteria 1783
1533 Ga0495595_0065099 3300053084 Bacteria 1714
1534 Ga0495595_0209446 3300053084 Bacteria 971
1535 Ga0495619_0000002 3300053085 Bacteria 530226
1536 Ga0495619_0000122 3300053085 Bacteria 57583
1537 Ga0495619_0000134 3300053085 Bacteria 54869
1538 Ga0495619_0008776 3300053085 Bacteria 6392
1539 Ga0495619_0015735 3300053085 Bacteria 4789
1540 Ga0495619_0023727 3300053085 Bacteria 3932
1541 Ga0495619_0064201 3300053085 Bacteria 2447
1542 Ga0495619_0100821 3300053085 Bacteria 1965
1543 Ga0500644_0000657 3300053088 Bacteria 12711
1544 Ga0500651_0009740 3300053093 Bacteria 5728
1545 Ga0500566_0198516 3300053094 Bacteria 1015
1546 Ga0500556_0060741 3300053104 Bacteria 1392
1547 Ga0500593_026538 3300053117 Bacteria 2580
1548 Ga0500595_000006 3300053119 Bacteria 300857
1549 Ga0500597_130598 3300053120 Bacteria 1086
1550 Ga0500642_0176875 3300053130 Bacteria 998
1551 Ga0500652_020511 3300053131 Bacteria 2473
1552 Ga0500616_0000001 3300053153 Bacteria 1986011
1553 Ga0500627_0031796 3300053158 Bacteria 2220
1554 Ga0500645_001371 3300053730 Bacteria 12503
1555 Ga0501084_0120067 3300054114 Bacteria 2210
1556 Ga0501084_0190094 3300054114 Bacteria 1732
1557 Ga0501084_0297949 3300054114 Bacteria 1362
1558 Ga0501084_0354633 3300054114 Bacteria 1239
1559 Ga0501082_0000079 3300060353 Bacteria 71956
1560 Ga0501082_0011869 3300060353 Bacteria 7486
1561 Ga0501082_0571260 3300060353 Bacteria 989
1562 Ga0501082_0784142 3300060353 Bacteria 834
1563 Ga0530510_0033543 3300061734 Bacteria 3696
1564 Ga0530510_0043888 3300061734 Bacteria 3230
1565 Ga0530510_0085310 3300061734 Bacteria 2300
1566 Ga0530510_0407300 3300061734 Bacteria 1026

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0100821 Ga0495619_0100821_165_1016 205
2 3300047322 Ga0495680_0070730 Ga0495680_0070730_187_816 207
3 3300006028 Ga0070717_10041614 Ga0070717_100416144 208
4 3300047317 Ga0495604_0179844 Ga0495604_0179844_722_1348 208
5 3300047445 Ga0495677_0074424 Ga0495677_0074424_627_1253 208
6 3300000044 ARSoilOldRDRAFT_c003403 ARSoilOldRDRAFT_0034031 209
7 3300001976 JGI24752J21851_1011951 JGI24752J21851_10119511 209
8 3300001977 JGI24746J21847_1019342 JGI24746J21847_10193422 209
9 3300001978 JGI24747J21853_1013488 JGI24747J21853_10134881 209
10 3300001991 JGI24743J22301_10027953 JGI24743J22301_100279532 209
11 3300002070 JGI24750J21931_1004807 JGI24750J21931_10048071 209
12 3300002155 JGI24033J26618_1026409 JGI24033J26618_10264091 209
13 3300002239 JGI24034J26672_10035241 JGI24034J26672_100352411 209
14 3300002244 JGI24742J22300_10034259 JGI24742J22300_100342591 209
15 3300003911 JGI25405J52794_10003756 JGI25405J52794_100037562 209
16 3300005290 Ga0065712_10037097 Ga0065712_100370971 209
17 3300005290 Ga0065712_10368994 Ga0065712_103689941 209
18 3300005293 Ga0065715_10178972 Ga0065715_101789722 209
19 3300005327 Ga0070658_10002492 Ga0070658_100024924 209
20 3300005328 Ga0070676_10010553 Ga0070676_100105534 209
21 3300005328 Ga0070676_10021231 Ga0070676_100212312 209
22 3300005328 Ga0070676_10259996 Ga0070676_102599962 209
23 3300005330 Ga0070690_100151000 Ga0070690_1001510002 209
24 3300005330 Ga0070690_100184000 Ga0070690_1001840001 209
25 3300005331 Ga0070670_100003481 Ga0070670_10000348113 209
26 3300005331 Ga0070670_100090772 Ga0070670_1000907723 209
27 3300005331 Ga0070670_100522712 Ga0070670_1005227121 209
28 3300005333 Ga0070677_10106185 Ga0070677_101061852 209
29 3300005333 Ga0070677_10110789 Ga0070677_101107891 209
30 3300005334 Ga0068869_100043808 Ga0068869_1000438082 209
31 3300005334 Ga0068869_100760990 Ga0068869_1007609901 209
32 3300005335 Ga0070666_10005228 Ga0070666_100052285 209
33 3300005336 Ga0070680_100041694 Ga0070680_1000416941 209
34 3300005336 Ga0070680_100095445 Ga0070680_1000954452 209
35 3300005337 Ga0070682_100019379 Ga0070682_1000193794 209
36 3300005337 Ga0070682_100112974 Ga0070682_1001129742 209
37 3300005338 Ga0068868_100037947 Ga0068868_1000379472 209
38 3300005339 Ga0070660_100003958 Ga0070660_1000039589 209
39 3300005339 Ga0070660_100079308 Ga0070660_1000793082 209
40 3300005339 Ga0070660_100444869 Ga0070660_1004448691 209
41 3300005340 Ga0070689_100096373 Ga0070689_1000963731 209
42 3300005340 Ga0070689_100163656 Ga0070689_1001636561 209
43 3300005340 Ga0070689_100185278 Ga0070689_1001852782 209
44 3300005341 Ga0070691_10114088 Ga0070691_101140882 209
45 3300005343 Ga0070687_100174384 Ga0070687_1001743842 209
46 3300005344 Ga0070661_100212355 Ga0070661_1002123552 209
47 3300005344 Ga0070661_100354504 Ga0070661_1003545042 209
48 3300005345 Ga0070692_10086409 Ga0070692_100864092 209
49 3300005347 Ga0070668_100730528 Ga0070668_1007305281 209
50 3300005353 Ga0070669_100108637 Ga0070669_1001086372 209
51 3300005353 Ga0070669_100130459 Ga0070669_1001304592 209
52 3300005353 Ga0070669_100439489 Ga0070669_1004394891 209
53 3300005355 Ga0070671_100016381 Ga0070671_1000163812 209
54 3300005355 Ga0070671_100036667 Ga0070671_1000366673 209
55 3300005355 Ga0070671_100154284 Ga0070671_1001542842 209
56 3300005355 Ga0070671_100241644 Ga0070671_1002416442 209
57 3300005356 Ga0070674_100018781 Ga0070674_1000187814 209
58 3300005356 Ga0070674_100057130 Ga0070674_1000571303 209
59 3300005356 Ga0070674_100092437 Ga0070674_1000924371 209
60 3300005364 Ga0070673_100008361 Ga0070673_1000083615 209
61 3300005364 Ga0070673_100017642 Ga0070673_1000176421 209
62 3300005364 Ga0070673_100165525 Ga0070673_1001655253 209
63 3300005365 Ga0070688_100058883 Ga0070688_1000588832 209
64 3300005365 Ga0070688_100381062 Ga0070688_1003810622 209
65 3300005366 Ga0070659_100120932 Ga0070659_1001209322 209
66 3300005367 Ga0070667_100076415 Ga0070667_1000764151 209
67 3300005367 Ga0070667_100097246 Ga0070667_1000972462 209
68 3300005367 Ga0070667_100317924 Ga0070667_1003179242 209
69 3300005434 Ga0070709_10003313 Ga0070709_100033135 209
70 3300005434 Ga0070709_10050479 Ga0070709_100504792 209
71 3300005435 Ga0070714_100037892 Ga0070714_1000378922 209
72 3300005435 Ga0070714_100081118 Ga0070714_1000811184 209
73 3300005435 Ga0070714_100085878 Ga0070714_1000858782 209
74 3300005435 Ga0070714_100094389 Ga0070714_1000943893 209
75 3300005435 Ga0070714_100427263 Ga0070714_1004272631 209
76 3300005435 Ga0070714_100880987 Ga0070714_1008809872 209
77 3300005436 Ga0070713_100168490 Ga0070713_1001684902 209
78 3300005436 Ga0070713_100186378 Ga0070713_1001863782 209
79 3300005436 Ga0070713_100373219 Ga0070713_1003732192 209
80 3300005436 Ga0070713_100753466 Ga0070713_1007534662 209
81 3300005437 Ga0070710_10007993 Ga0070710_100079934 209
82 3300005437 Ga0070710_10283687 Ga0070710_102836871 209
83 3300005438 Ga0070701_10366804 Ga0070701_103668041 209
84 3300005439 Ga0070711_100006262 Ga0070711_1000062622 209
85 3300005439 Ga0070711_100126026 Ga0070711_1001260262 209
86 3300005439 Ga0070711_100396320 Ga0070711_1003963201 209
87 3300005440 Ga0070705_100235325 Ga0070705_1002353252 209
88 3300005444 Ga0070694_100209264 Ga0070694_1002092642 209
89 3300005455 Ga0070663_100040893 Ga0070663_1000408933 209
90 3300005455 Ga0070663_100051638 Ga0070663_1000516382 209
91 3300005456 Ga0070678_100027056 Ga0070678_1000270563 209
92 3300005456 Ga0070678_100033746 Ga0070678_1000337464 209
93 3300005456 Ga0070678_100141122 Ga0070678_1001411222 209
94 3300005456 Ga0070678_100204024 Ga0070678_1002040241 209
95 3300005456 Ga0070678_100729745 Ga0070678_1007297452 209
96 3300005457 Ga0070662_100067777 Ga0070662_1000677772 209
97 3300005457 Ga0070662_100152512 Ga0070662_1001525122 209
98 3300005457 Ga0070662_100247599 Ga0070662_1002475991 209
99 3300005457 Ga0070662_100336124 Ga0070662_1003361241 209
100 3300005457 Ga0070662_100483036 Ga0070662_1004830362 209
101 3300005457 Ga0070662_100567060 Ga0070662_1005670601 209
102 3300005458 Ga0070681_10074078 Ga0070681_100740783 209
103 3300005458 Ga0070681_10161112 Ga0070681_101611122 209
104 3300005458 Ga0070681_10172101 Ga0070681_101721012 209
105 3300005458 Ga0070681_10526267 Ga0070681_105262671 209
106 3300005466 Ga0070685_10004347 Ga0070685_100043472 209
107 3300005466 Ga0070685_10021204 Ga0070685_100212043 209
108 3300005471 Ga0070698_100829741 Ga0070698_1008297411 209
109 3300005530 Ga0070679_100174085 Ga0070679_1001740853 209
110 3300005530 Ga0070679_100228471 Ga0070679_1002284712 209
111 3300005535 Ga0070684_100041704 Ga0070684_1000417044 209
112 3300005536 Ga0070697_100005196 Ga0070697_1000051965 209
113 3300005539 Ga0068853_100078880 Ga0068853_1000788802 209
114 3300005543 Ga0070672_100358312 Ga0070672_1003583122 209
115 3300005544 Ga0070686_100044009 Ga0070686_1000440092 209
116 3300005544 Ga0070686_100067052 Ga0070686_1000670523 209
117 3300005545 Ga0070695_100073500 Ga0070695_1000735002 209
118 3300005545 Ga0070695_100140539 Ga0070695_1001405392 209
119 3300005546 Ga0070696_100006084 Ga0070696_1000060848 209
120 3300005547 Ga0070693_100035757 Ga0070693_1000357571 209
121 3300005547 Ga0070693_100355593 Ga0070693_1003555931 209
122 3300005548 Ga0070665_100055794 Ga0070665_1000557943 209
123 3300005548 Ga0070665_100117054 Ga0070665_1001170541 209
124 3300005549 Ga0070704_100034963 Ga0070704_1000349633 209
125 3300005549 Ga0070704_100125147 Ga0070704_1001251472 209
126 3300005563 Ga0068855_100131460 Ga0068855_1001314603 209
127 3300005563 Ga0068855_100490966 Ga0068855_1004909662 209
128 3300005564 Ga0070664_100096372 Ga0070664_1000963724 209
129 3300005564 Ga0070664_100217816 Ga0070664_1002178162 209
130 3300005564 Ga0070664_100268332 Ga0070664_1002683322 209
131 3300005577 Ga0068857_100123798 Ga0068857_1001237982 209
132 3300005577 Ga0068857_100794129 Ga0068857_1007941292 209
133 3300005577 Ga0068857_100988358 Ga0068857_1009883581 209
134 3300005578 Ga0068854_100377128 Ga0068854_1003771281 209
135 3300005614 Ga0068856_100098248 Ga0068856_1000982483 209
136 3300005614 Ga0068856_100930594 Ga0068856_1009305942 209
137 3300005615 Ga0070702_100018080 Ga0070702_1000180804 209
138 3300005615 Ga0070702_100026004 Ga0070702_1000260042 209
139 3300005615 Ga0070702_100289669 Ga0070702_1002896692 209
140 3300005616 Ga0068852_100098818 Ga0068852_1000988183 209
141 3300005617 Ga0068859_100380246 Ga0068859_1003802462 209
142 3300005618 Ga0068864_100053520 Ga0068864_1000535203 209
143 3300005718 Ga0068866_10057479 Ga0068866_100574793 209
144 3300005834 Ga0068851_10157100 Ga0068851_101571001 209
145 3300005840 Ga0068870_10070439 Ga0068870_100704392 209
146 3300005841 Ga0068863_100539092 Ga0068863_1005390922 209
147 3300005842 Ga0068858_100028773 Ga0068858_1000287735 209
148 3300005842 Ga0068858_100291519 Ga0068858_1002915192 209
149 3300005843 Ga0068860_100114516 Ga0068860_1001145162 209
150 3300005843 Ga0068860_100424739 Ga0068860_1004247392 209
151 3300005844 Ga0068862_100272012 Ga0068862_1002720121 209
152 3300005937 Ga0081455_10004948 Ga0081455_100049486 209
153 3300005937 Ga0081455_10024286 Ga0081455_100242863 209
154 3300005983 Ga0081540_1003528 Ga0081540_10035285 209
155 3300005983 Ga0081540_1038709 Ga0081540_10387094 209
156 3300005983 Ga0081540_1043089 Ga0081540_10430892 209
157 3300005985 Ga0081539_10078820 Ga0081539_100788202 209
158 3300006028 Ga0070717_10000869 Ga0070717_1000086919 209
159 3300006028 Ga0070717_10041506 Ga0070717_100415062 209
160 3300006028 Ga0070717_10042713 Ga0070717_100427133 209
161 3300006028 Ga0070717_10124760 Ga0070717_101247603 209
162 3300006028 Ga0070717_10167251 Ga0070717_101672512 209
163 3300006028 Ga0070717_10315529 Ga0070717_103155292 209
164 3300006038 Ga0075365_10026169 Ga0075365_100261693 209
165 3300006042 Ga0075368_10008538 Ga0075368_100085384 209
166 3300006048 Ga0075363_100032531 Ga0075363_1000325312 209
167 3300006051 Ga0075364_10025515 Ga0075364_100255152 209
168 3300006058 Ga0075432_10030706 Ga0075432_100307062 209
169 3300006163 Ga0070715_10000687 Ga0070715_100006873 209
170 3300006163 Ga0070715_10112148 Ga0070715_101121482 209
171 3300006173 Ga0070716_100885076 Ga0070716_1008850761 209
172 3300006175 Ga0070712_100016672 Ga0070712_1000166723 209
173 3300006175 Ga0070712_100025242 Ga0070712_1000252424 209
174 3300006175 Ga0070712_100123106 Ga0070712_1001231062 209
175 3300006177 Ga0075362_10046443 Ga0075362_100464432 209
176 3300006177 Ga0075362_10059959 Ga0075362_100599592 209
177 3300006178 Ga0075367_10109282 Ga0075367_101092822 209
178 3300006178 Ga0075367_10145301 Ga0075367_101453012 209
179 3300006186 Ga0075369_10049579 Ga0075369_100495792 209
180 3300006186 Ga0075369_10061633 Ga0075369_100616332 209
181 3300006186 Ga0075369_10171697 Ga0075369_101716972 209
182 3300006194 Ga0075427_10000195 Ga0075427_100001951 209
183 3300006195 Ga0075366_10034850 Ga0075366_100348502 209
184 3300006195 Ga0075366_10154965 Ga0075366_101549652 209
185 3300006237 Ga0097621_100044026 Ga0097621_1000440263 209
186 3300006237 Ga0097621_100077437 Ga0097621_1000774373 209
187 3300006237 Ga0097621_100128890 Ga0097621_1001288903 209
188 3300006353 Ga0075370_10071053 Ga0075370_100710532 209
189 3300006353 Ga0075370_10127737 Ga0075370_101277372 209
190 3300006358 Ga0068871_100026169 Ga0068871_1000261693 209
191 3300006358 Ga0068871_100273365 Ga0068871_1002733652 209
192 3300006844 Ga0075428_100022413 Ga0075428_1000224138 209
193 3300006844 Ga0075428_101036749 Ga0075428_1010367491 209
194 3300006846 Ga0075430_100014321 Ga0075430_1000143215 209
195 3300006847 Ga0075431_100000592 Ga0075431_10000059210 209
196 3300006847 Ga0075431_100229383 Ga0075431_1002293832 209
197 3300006847 Ga0075431_100343266 Ga0075431_1003432661 209
198 3300006852 Ga0075433_10054685 Ga0075433_100546853 209
199 3300006852 Ga0075433_10093678 Ga0075433_100936782 209
200 3300006871 Ga0075434_100000421 Ga0075434_1000004217 209
201 3300006871 Ga0075434_100160108 Ga0075434_1001601083 209
202 3300006871 Ga0075434_100209287 Ga0075434_1002092873 209
203 3300006871 Ga0075434_100254921 Ga0075434_1002549212 209
204 3300006880 Ga0075429_100010041 Ga0075429_1000100415 209
205 3300006880 Ga0075429_100015676 Ga0075429_1000156762 209
206 3300006881 Ga0068865_100073786 Ga0068865_1000737862 209
207 3300006914 Ga0075436_100122552 Ga0075436_1001225522 209
208 3300006931 Ga0097620_100380213 Ga0097620_1003802132 209
209 3300007076 Ga0075435_100005402 Ga0075435_1000054025 209
210 3300007076 Ga0075435_100053012 Ga0075435_1000530123 209
211 3300007076 Ga0075435_100151644 Ga0075435_1001516442 209
212 3300007076 Ga0075435_100189901 Ga0075435_1001899012 209
213 3300007265 Ga0099794_10061130 Ga0099794_100611301 209
214 3300007788 Ga0099795_10167737 Ga0099795_101677371 209
215 3300009093 Ga0105240_10252025 Ga0105240_102520251 209
216 3300009093 Ga0105240_10309898 Ga0105240_103098982 209
217 3300009094 Ga0111539_10015685 Ga0111539_1001568513 209
218 3300009094 Ga0111539_10126113 Ga0111539_101261134 209
219 3300009094 Ga0111539_10533236 Ga0111539_105332361 209
220 3300009098 Ga0105245_10956209 Ga0105245_109562091 209
221 3300009101 Ga0105247_10451063 Ga0105247_104510632 209
222 3300009147 Ga0114129_10005303 Ga0114129_100053035 209
223 3300009147 Ga0114129_10378979 Ga0114129_103789792 209
224 3300009148 Ga0105243_10195748 Ga0105243_101957481 209
225 3300009148 Ga0105243_10301247 Ga0105243_103012473 209
226 3300009148 Ga0105243_10303743 Ga0105243_103037432 209
227 3300009148 Ga0105243_10508625 Ga0105243_105086251 209
228 3300009174 Ga0105241_10155076 Ga0105241_101550762 209
229 3300009174 Ga0105241_10155692 Ga0105241_101556922 209
230 3300009177 Ga0105248_10127733 Ga0105248_101277333 209
231 3300009545 Ga0105237_10048019 Ga0105237_100480194 209
232 3300009551 Ga0105238_10399355 Ga0105238_103993552 209
233 3300009551 Ga0105238_10428622 Ga0105238_104286222 209
234 3300009551 Ga0105238_11054341 Ga0105238_110543411 209
235 3300009553 Ga0105249_10004500 Ga0105249_100045005 209
236 3300009553 Ga0105249_10769625 Ga0105249_107696252 209
237 3300009553 Ga0105249_10887066 Ga0105249_108870662 209
238 3300010159 Ga0099796_10006962 Ga0099796_100069622 209
239 3300010159 Ga0099796_10011464 Ga0099796_100114642 209
240 3300010375 Ga0105239_10069751 Ga0105239_100697514 209
241 3300011119 Ga0105246_10022697 Ga0105246_100226974 209
242 3300011119 Ga0105246_10134841 Ga0105246_101348412 209
243 3300011119 Ga0105246_10263332 Ga0105246_102633321 209
244 3300013105 Ga0157369_10209454 Ga0157369_102094543 209
245 3300013296 Ga0157374_10092211 Ga0157374_100922113 209
246 3300013296 Ga0157374_10100469 Ga0157374_101004692 209
247 3300013296 Ga0157374_10246039 Ga0157374_102460393 209
248 3300013306 Ga0163162_10727180 Ga0163162_107271802 209
249 3300013307 Ga0157372_10589219 Ga0157372_105892191 209
250 3300013307 Ga0157372_11082644 Ga0157372_110826442 209
251 3300014325 Ga0163163_10161669 Ga0163163_101616693 209
252 3300014325 Ga0163163_10192114 Ga0163163_101921142 209
253 3300014326 Ga0157380_10043209 Ga0157380_100432092 209
254 3300014326 Ga0157380_10053585 Ga0157380_100535852 209
255 3300014326 Ga0157380_10091711 Ga0157380_100917111 209
256 3300014326 Ga0157380_10929953 Ga0157380_109299531 209
257 3300014745 Ga0157377_10122280 Ga0157377_101222802 209
258 3300014968 Ga0157379_10017659 Ga0157379_100176594 209
259 3300017792 Ga0163161_10197998 Ga0163161_101979982 209
260 3300017792 Ga0163161_10325947 Ga0163161_103259471 209
261 3300017792 Ga0163161_10389780 Ga0163161_103897801 209
262 3300021384 Ga0213876_10005310 Ga0213876_100053103 209
263 3300021388 Ga0213875_10000009 Ga0213875_10000009191 209
264 3300025321 Ga0207656_10065701 Ga0207656_100657012 209
265 3300025893 Ga0207682_10001406 Ga0207682_100014066 209
266 3300025893 Ga0207682_10068456 Ga0207682_100684562 209
267 3300025898 Ga0207692_10003589 Ga0207692_100035894 209
268 3300025898 Ga0207692_10247462 Ga0207692_102474621 209
269 3300025899 Ga0207642_10054796 Ga0207642_100547963 209
270 3300025899 Ga0207642_10174491 Ga0207642_101744911 209
271 3300025900 Ga0207710_10010672 Ga0207710_100106724 209
272 3300025900 Ga0207710_10060848 Ga0207710_100608481 209
273 3300025900 Ga0207710_10086285 Ga0207710_100862852 209
274 3300025901 Ga0207688_10000912 Ga0207688_100009122 209
275 3300025901 Ga0207688_10200192 Ga0207688_102001922 209
276 3300025903 Ga0207680_10036264 Ga0207680_100362644 209
277 3300025903 Ga0207680_10678857 Ga0207680_106788571 209
278 3300025904 Ga0207647_10175338 Ga0207647_101753381 209
279 3300025905 Ga0207685_10009249 Ga0207685_100092494 209
280 3300025906 Ga0207699_10001084 Ga0207699_100010847 209
281 3300025906 Ga0207699_10034561 Ga0207699_100345615 209
282 3300025906 Ga0207699_10335796 Ga0207699_103357961 209
283 3300025907 Ga0207645_10013020 Ga0207645_100130205 209
284 3300025907 Ga0207645_10224703 Ga0207645_102247033 209
285 3300025907 Ga0207645_10231207 Ga0207645_102312073 209
286 3300025907 Ga0207645_10396353 Ga0207645_103963531 209
287 3300025908 Ga0207643_10003489 Ga0207643_100034894 209
288 3300025909 Ga0207705_10211429 Ga0207705_102114292 209
289 3300025911 Ga0207654_10114420 Ga0207654_101144201 209
290 3300025911 Ga0207654_10158490 Ga0207654_101584902 209
291 3300025912 Ga0207707_10393110 Ga0207707_103931102 209
292 3300025914 Ga0207671_10190467 Ga0207671_101904672 209
293 3300025915 Ga0207693_10002909 Ga0207693_100029095 209
294 3300025915 Ga0207693_10022262 Ga0207693_100222622 209
295 3300025915 Ga0207693_10026700 Ga0207693_100267004 209
296 3300025915 Ga0207693_10081386 Ga0207693_100813863 209
297 3300025915 Ga0207693_10312588 Ga0207693_103125881 209
298 3300025916 Ga0207663_10187949 Ga0207663_101879491 209
299 3300025916 Ga0207663_10218534 Ga0207663_102185341 209
300 3300025916 Ga0207663_10770609 Ga0207663_107706091 209
301 3300025917 Ga0207660_10022077 Ga0207660_100220774 209
302 3300025918 Ga0207662_10023791 Ga0207662_100237913 209
303 3300025919 Ga0207657_10005450 Ga0207657_1000545015 209
304 3300025919 Ga0207657_10028722 Ga0207657_100287223 209
305 3300025919 Ga0207657_10049298 Ga0207657_100492983 209
306 3300025920 Ga0207649_10106761 Ga0207649_101067611 209
307 3300025920 Ga0207649_10360887 Ga0207649_103608871 209
308 3300025921 Ga0207652_10460384 Ga0207652_104603842 209
309 3300025921 Ga0207652_10629832 Ga0207652_106298321 209
310 3300025924 Ga0207694_10041845 Ga0207694_100418452 209
311 3300025924 Ga0207694_10136678 Ga0207694_101366782 209
312 3300025925 Ga0207650_10093342 Ga0207650_100933422 209
313 3300025925 Ga0207650_10135927 Ga0207650_101359273 209
314 3300025926 Ga0207659_10233593 Ga0207659_102335932 209
315 3300025927 Ga0207687_10026697 Ga0207687_100266972 209
316 3300025927 Ga0207687_10159200 Ga0207687_101592001 209
317 3300025928 Ga0207700_10022163 Ga0207700_100221632 209
318 3300025928 Ga0207700_10025534 Ga0207700_100255344 209
319 3300025928 Ga0207700_10110272 Ga0207700_101102722 209
320 3300025928 Ga0207700_10210004 Ga0207700_102100042 209
321 3300025928 Ga0207700_10288383 Ga0207700_102883832 209
322 3300025928 Ga0207700_10799752 Ga0207700_107997521 209
323 3300025929 Ga0207664_10045920 Ga0207664_100459202 209
324 3300025929 Ga0207664_10094495 Ga0207664_100944953 209
325 3300025929 Ga0207664_10195278 Ga0207664_101952782 209
326 3300025929 Ga0207664_10490194 Ga0207664_104901941 209
327 3300025931 Ga0207644_10010053 Ga0207644_100100535 209
328 3300025931 Ga0207644_10112785 Ga0207644_101127853 209
329 3300025931 Ga0207644_10116600 Ga0207644_101166002 209
330 3300025931 Ga0207644_10314000 Ga0207644_103140001 209
331 3300025932 Ga0207690_10154625 Ga0207690_101546253 209
332 3300025933 Ga0207706_10009125 Ga0207706_100091253 209
333 3300025933 Ga0207706_10012559 Ga0207706_100125592 209
334 3300025933 Ga0207706_10015658 Ga0207706_100156582 209
335 3300025933 Ga0207706_10097445 Ga0207706_100974452 209
336 3300025934 Ga0207686_10011416 Ga0207686_100114165 209
337 3300025934 Ga0207686_10320692 Ga0207686_103206921 209
338 3300025935 Ga0207709_10210545 Ga0207709_102105452 209
339 3300025935 Ga0207709_10594245 Ga0207709_105942451 209
340 3300025935 Ga0207709_10664812 Ga0207709_106648121 209
341 3300025936 Ga0207670_10116792 Ga0207670_101167922 209
342 3300025936 Ga0207670_10119157 Ga0207670_101191571 209
343 3300025936 Ga0207670_10202078 Ga0207670_102020783 209
344 3300025938 Ga0207704_10434409 Ga0207704_104344091 209
345 3300025939 Ga0207665_10057915 Ga0207665_100579152 209
346 3300025939 Ga0207665_10909705 Ga0207665_109097051 209
347 3300025940 Ga0207691_10009791 Ga0207691_100097916 209
348 3300025940 Ga0207691_10010956 Ga0207691_100109564 209
349 3300025940 Ga0207691_10090031 Ga0207691_100900313 209
350 3300025940 Ga0207691_10247030 Ga0207691_102470301 209
351 3300025941 Ga0207711_10002137 Ga0207711_100021371 209
352 3300025941 Ga0207711_10040213 Ga0207711_100402135 209
353 3300025941 Ga0207711_10671969 Ga0207711_106719691 209
354 3300025942 Ga0207689_10002512 Ga0207689_1000251216 209
355 3300025942 Ga0207689_10057136 Ga0207689_100571364 209
356 3300025944 Ga0207661_10251603 Ga0207661_102516032 209
357 3300025945 Ga0207679_10063328 Ga0207679_100633282 209
358 3300025945 Ga0207679_10128326 Ga0207679_101283261 209
359 3300025945 Ga0207679_10141680 Ga0207679_101416803 209
360 3300025945 Ga0207679_10171910 Ga0207679_101719102 209
361 3300025960 Ga0207651_10006324 Ga0207651_100063241 209
362 3300025960 Ga0207651_10032208 Ga0207651_100322083 209
363 3300025960 Ga0207651_10118997 Ga0207651_101189972 209
364 3300025960 Ga0207651_10684907 Ga0207651_106849071 209
365 3300025961 Ga0207712_10018723 Ga0207712_100187235 209
366 3300025961 Ga0207712_10061142 Ga0207712_100611422 209
367 3300025961 Ga0207712_10143425 Ga0207712_101434253 209
368 3300025972 Ga0207668_10267322 Ga0207668_102673221 209
369 3300025986 Ga0207658_10049504 Ga0207658_100495042 209
370 3300026023 Ga0207677_10108557 Ga0207677_101085572 209
371 3300026035 Ga0207703_10059452 Ga0207703_100594524 209
372 3300026035 Ga0207703_10328793 Ga0207703_103287932 209
373 3300026035 Ga0207703_10412366 Ga0207703_104123661 209
374 3300026041 Ga0207639_10080541 Ga0207639_100805411 209
375 3300026041 Ga0207639_10441881 Ga0207639_104418811 209
376 3300026067 Ga0207678_10050713 Ga0207678_100507132 209
377 3300026075 Ga0207708_10001462 Ga0207708_100014622 209
378 3300026075 Ga0207708_10160082 Ga0207708_101600822 209
379 3300026078 Ga0207702_10345856 Ga0207702_103458562 209
380 3300026088 Ga0207641_10078115 Ga0207641_100781153 209
381 3300026088 Ga0207641_10473742 Ga0207641_104737422 209
382 3300026089 Ga0207648_10028541 Ga0207648_100285414 209
383 3300026095 Ga0207676_10042505 Ga0207676_100425051 209
384 3300026095 Ga0207676_10053392 Ga0207676_100533923 209
385 3300026095 Ga0207676_10131926 Ga0207676_101319263 209
386 3300026116 Ga0207674_10042889 Ga0207674_100428892 209
387 3300026116 Ga0207674_10069880 Ga0207674_100698802 209
388 3300026116 Ga0207674_10076926 Ga0207674_100769263 209
389 3300026116 Ga0207674_10103717 Ga0207674_101037173 209
390 3300026116 Ga0207674_10153293 Ga0207674_101532933 209
391 3300026118 Ga0207675_100001087 Ga0207675_1000010877 209
392 3300026121 Ga0207683_10000604 Ga0207683_100006042 209
393 3300026121 Ga0207683_10007177 Ga0207683_100071777 209
394 3300026121 Ga0207683_10021124 Ga0207683_100211244 209
395 3300026121 Ga0207683_10052271 Ga0207683_100522714 209
396 3300027907 Ga0207428_10000243 Ga0207428_1000024371 209
397 3300027907 Ga0207428_10018951 Ga0207428_100189519 209
398 3300028379 Ga0268266_10016910 Ga0268266_100169102 209
399 3300028379 Ga0268266_10314655 Ga0268266_103146552 209
400 3300028380 Ga0268265_10118764 Ga0268265_101187642 209
401 3300028380 Ga0268265_10360049 Ga0268265_103600492 209
402 3300028381 Ga0268264_10513194 Ga0268264_105131942 209
403 3300028654 Ga0265322_10046738 Ga0265322_100467381 209
404 3300031090 Ga0265760_10074766 Ga0265760_100747661 209
405 3300031241 Ga0265325_10000111 Ga0265325_100001117 209
406 3300031241 Ga0265325_10032785 Ga0265325_100327854 209
407 3300031241 Ga0265325_10046754 Ga0265325_100467543 209
408 3300031242 Ga0265329_10017314 Ga0265329_100173144 209
409 3300031247 Ga0265340_10058945 Ga0265340_100589452 209
410 3300031456 Ga0307513_10038601 Ga0307513_100386012 209
411 3300031595 Ga0265313_10003665 Ga0265313_100036656 209
412 3300031595 Ga0265313_10034356 Ga0265313_100343564 209
413 3300031595 Ga0265313_10081344 Ga0265313_100813441 209
414 3300031665 Ga0316575_10023981 Ga0316575_100239812 209
415 3300031691 Ga0316579_10080140 Ga0316579_100801402 209
416 3300031711 Ga0265314_10005172 Ga0265314_100051729 209
417 3300031711 Ga0265314_10042046 Ga0265314_100420464 209
418 3300031711 Ga0265314_10070177 Ga0265314_100701773 209
419 3300031712 Ga0265342_10000321 Ga0265342_1000032144 209
420 3300031712 Ga0265342_10001182 Ga0265342_1000118214 209
421 3300031712 Ga0265342_10016430 Ga0265342_100164303 209
422 3300031852 Ga0307410_10320976 Ga0307410_103209763 209
423 3300032002 Ga0307416_100422412 Ga0307416_1004224122 209
424 3300032002 Ga0307416_101480749 Ga0307416_1014807491 209
425 3300034957 Ga0373938_0007577 Ga0373938_0007577_777_1406 209
426 3300035083 Ga0373926_0097750 Ga0373926_0097750_115_744 209
427 3300035086 Ga0373934_0013195 Ga0373934_0013195_55_684 209
428 3300035086 Ga0373934_0026247 Ga0373934_0026247_398_1027 209
429 3300035088 Ga0373940_0077743 Ga0373940_0077743_239_868 209
430 3300035089 Ga0373944_0000730 Ga0373944_0000730_3136_3765 209
431 3300035089 Ga0373944_0010094 Ga0373944_0010094_1860_2489 209
432 3300035089 Ga0373944_0027427 Ga0373944_0027427_736_1365 209
433 3300035089 Ga0373944_0085089 Ga0373944_0085089_130_759 209
434 3300035091 Ga0373951_0028372 Ga0373951_0028372_428_1057 209
435 3300035092 Ga0373952_0003769 Ga0373952_0003769_725_1354 209
436 3300035111 Ga0373923_0010715 Ga0373923_0010715_1565_2341 209
437 3300035111 Ga0373923_0028597 Ga0373923_0028597_114_743 209
438 3300035111 Ga0373923_0375422 Ga0373923_0375422_17_646 209
439 3300035113 Ga0373936_0012355 Ga0373936_0012355_899_1528 209
440 3300035113 Ga0373936_0028480 Ga0373936_0028480_671_1300 209
441 3300035113 Ga0373936_0096395 Ga0373936_0096395_249_878 209
442 3300035116 Ga0373945_0003488 Ga0373945_0003488_3063_3692 209
443 3300035116 Ga0373945_0023108 Ga0373945_0023108_640_1269 209
444 3300035117 Ga0373953_0000909 Ga0373953_0000909_491_1267 209
445 3300035117 Ga0373953_0121326 Ga0373953_0121326_136_765 209
446 3300035118 Ga0373954_0001233 Ga0373954_0001233_4174_4950 209
447 3300035118 Ga0373954_0010174 Ga0373954_0010174_3487_4116 209
448 3300035119 Ga0373956_0006037 Ga0373956_0006037_4043_4672 209
449 3300035119 Ga0373956_0276047 Ga0373956_0276047_81_710 209
450 3300035120 Ga0373957_0001719 Ga0373957_0001719_836_1465 209
451 3300035120 Ga0373957_0025663 Ga0373957_0025663_257_886 209
452 3300035170 Ga0373943_0003126 Ga0373943_0003126_2326_2955 209
453 3300035170 Ga0373943_0009241 Ga0373943_0009241_1525_2154 209
454 3300035170 Ga0373943_0017030 Ga0373943_0017030_383_1012 209
455 3300035170 Ga0373943_0199290 Ga0373943_0199290_160_936 209
456 3300035170 Ga0373943_0208456 Ga0373943_0208456_374_1021 209
457 3300035171 Ga0373946_0023409 Ga0373946_0023409_512_1141 209
458 3300035171 Ga0373946_0041659 Ga0373946_0041659_734_1363 209
459 3300035171 Ga0373946_0177403 Ga0373946_0177403_22_651 209
460 3300035172 Ga0373955_0000054 Ga0373955_0000054_16785_17561 209
461 3300035172 Ga0373955_0001515 Ga0373955_0001515_7469_8098 209
462 3300035172 Ga0373955_0009120 Ga0373955_0009120_2514_3143 209
463 3300035172 Ga0373955_0438589 Ga0373955_0438589_132_761 209
464 3300035241 Ga0373961_0004818 Ga0373961_0004818_1687_2316 209
465 3300035398 Ga0316574_0157460 Ga0316574_0157460_328_990 209
466 3300035410 Ga0373924_0000398 Ga0373924_0000398_2049_2825 209
467 3300035410 Ga0373924_0148961 Ga0373924_0148961_346_975 209
468 3300035691 Ga0373931_0013530 Ga0373931_0013530_228_857 209
469 3300035692 Ga0373935_0000223 Ga0373935_0000223_25389_26165 209
470 3300035692 Ga0373935_0004201 Ga0373935_0004201_1333_1962 209
471 3300035692 Ga0373935_0033635 Ga0373935_0033635_94_723 209
472 3300035695 Ga0373927_0045923 Ga0373927_0045923_1620_2249 209
473 3300035695 Ga0373927_0049683 Ga0373927_0049683_735_1511 209
474 3300035695 Ga0373927_0103533 Ga0373927_0103533_1094_1741 209
475 3300035695 Ga0373927_0132831 Ga0373927_0132831_801_1430 209
476 3300035695 Ga0373927_0405123 Ga0373927_0405123_144_773 209
477 3300035724 Ga0373933_0005801 Ga0373933_0005801_4878_5507 209
478 3300035724 Ga0373933_0020210 Ga0373933_0020210_1660_2436 209
479 3300035724 Ga0373933_0085326 Ga0373933_0085326_237_866 209
480 3300035725 Ga0373947_0000858 Ga0373947_0000858_17518_18147 209
481 3300035725 Ga0373947_0012112 Ga0373947_0012112_2447_3076 209
482 3300035725 Ga0373947_0035202 Ga0373947_0035202_1203_1979 209
483 3300036401 Ga0373937_0000006 Ga0373937_0000006_175103_175879 209
484 3300036401 Ga0373937_0002442 Ga0373937_0002442_2701_3330 209
485 3300036401 Ga0373937_0034735 Ga0373937_0034735_3151_3780 209
486 3300036401 Ga0373937_0064471 Ga0373937_0064471_1545_2174 209
487 3300036401 Ga0373937_0211380 Ga0373937_0211380_546_1175 209
488 3300036647 Ga0316582_0179774 Ga0316582_0179774_117_746 209
489 3300037068 Ga0373925_0000002 Ga0373925_0000002_306679_307455 209
490 3300037068 Ga0373925_0005426 Ga0373925_0005426_5865_6494 209
491 3300037068 Ga0373925_0024045 Ga0373925_0024045_3749_4378 209
492 3300037068 Ga0373925_0133370 Ga0373925_0133370_996_1763 209
493 3300037418 Ga0395900_0009339 Ga0395900_0009339_5607_6266 209
494 3300037418 Ga0395900_0258771 Ga0395900_0258771_849_1478 209
495 3300037853 Ga0436364_0017610 Ga0436364_0017610_1540_2178 209
496 3300037853 Ga0436364_1176343 Ga0436364_1176343_6497_7126 209
497 3300037853 Ga0436364_1447184 Ga0436364_1447184_880_1509 209
498 3300038443 Ga0395901_0035553 Ga0395901_0035553_1247_1876 209
499 3300038443 Ga0395901_0054146 Ga0395901_0054146_2763_3422 209
500 3300039437 Ga0436365_0304759 Ga0436365_0304759_1023_1652 209
501 3300039437 Ga0436365_1143764 Ga0436365_1143764_1223_1852 209
502 3300039438 Ga0436360_1130441 Ga0436360_1130441_228_857 209
503 3300039450 Ga0436363_0184989 Ga0436363_0184989_1179_1808 209
504 3300039450 Ga0436363_0631326 Ga0436363_0631326_121_750 209
505 3300039450 Ga0436363_0806245 Ga0436363_0806245_615_1244 209
506 3300039453 Ga0436362_0665353 Ga0436362_0665353_71_700 209
507 3300041496 Ga0451839_1052360 Ga0451839_1052360_61_690 209
508 3300042437 Ga0439444_0039888 Ga0439444_0039888_198_902 209
509 3300042461 Ga0439460_0045052 Ga0439460_0045052_406_1110 209
510 3300044684 Ga0466966_0025755 Ga0466966_0025755_3166_3795 209
511 3300044694 Ga0466963_0005907 Ga0466963_0005907_4933_5562 209
512 3300044842 Ga0466957_0274806 Ga0466957_0274806_177_806 209
513 3300045049 Ga0466959_0029744 Ga0466959_0029744_3086_3715 209
514 3300045051 Ga0451576_0892660 Ga0451576_0892660_113_742 209
515 3300045836 Ga0466958_0062572 Ga0466958_0062572_491_1120 209
516 3300045976 Ga0466967_0035123 Ga0466967_0035123_2348_2977 209
517 3300045976 Ga0466967_0411706 Ga0466967_0411706_407_1036 209
518 3300045976 Ga0466967_0651060 Ga0466967_0651060_205_885 209
519 3300045976 Ga0466967_1021499 Ga0466967_1021499_27_656 209
520 3300046454 Ga0495592_0000086 Ga0495592_0000086_26101_26877 209
521 3300046455 Ga0495603_0025478 Ga0495603_0025478_2106_2735 209
522 3300046455 Ga0495603_0026392 Ga0495603_0026392_557_1186 209
523 3300046455 Ga0495603_0057320 Ga0495603_0057320_331_960 209
524 3300046457 Ga0495590_0116804 Ga0495590_0116804_176_805 209
525 3300046458 Ga0495591_047965 Ga0495591_047965_209_838 209
526 3300046459 Ga0495629_0000102 Ga0495629_0000102_28034_28663 209
527 3300046459 Ga0495629_0062443 Ga0495629_0062443_1440_2069 209
528 3300046459 Ga0495629_0075062 Ga0495629_0075062_749_1378 209
529 3300046459 Ga0495629_0102631 Ga0495629_0102631_1146_1922 209
530 3300046459 Ga0495629_0158224 Ga0495629_0158224_598_1227 209
531 3300046460 Ga0495638_0012731 Ga0495638_0012731_333_962 209
532 3300046460 Ga0495638_0441731 Ga0495638_0441731_24_653 209
533 3300046461 Ga0495641_0063857 Ga0495641_0063857_936_1565 209
534 3300046461 Ga0495641_0091030 Ga0495641_0091030_123_752 209
535 3300046462 Ga0495651_0002610 Ga0495651_0002610_11026_11802 209
536 3300046462 Ga0495651_0012781 Ga0495651_0012781_4345_4974 209
537 3300046462 Ga0495651_0074437 Ga0495651_0074437_546_1175 209
538 3300046462 Ga0495651_0097473 Ga0495651_0097473_1088_1717 209
539 3300046462 Ga0495651_0205558 Ga0495651_0205558_432_1061 209
540 3300046462 Ga0495651_0245213 Ga0495651_0245213_183_812 209
541 3300046463 Ga0495653_0000006 Ga0495653_0000006_306827_307603 209
542 3300046463 Ga0495653_0001478 Ga0495653_0001478_3765_4394 209
543 3300046463 Ga0495653_0009722 Ga0495653_0009722_3460_4089 209
544 3300046463 Ga0495653_0146044 Ga0495653_0146044_160_789 209
545 3300046472 Ga0495580_0037467 Ga0495580_0037467_257_886 209
546 3300046472 Ga0495580_0090494 Ga0495580_0090494_1346_1975 209
547 3300046473 Ga0495582_0007603 Ga0495582_0007603_219_848 209
548 3300046473 Ga0495582_0035860 Ga0495582_0035860_2041_2670 209
549 3300046473 Ga0495582_0066289 Ga0495582_0066289_460_1176 209
550 3300046473 Ga0495582_0107170 Ga0495582_0107170_183_812 209
551 3300046474 Ga0495605_0015905 Ga0495605_0015905_291_920 209
552 3300046474 Ga0495605_0023637 Ga0495605_0023637_1874_2503 209
553 3300046475 Ga0495639_0007577 Ga0495639_0007577_201_830 209
554 3300046475 Ga0495639_0067431 Ga0495639_0067431_25_654 209
555 3300046475 Ga0495639_0162492 Ga0495639_0162492_415_1044 209
556 3300046476 Ga0495662_0001529 Ga0495662_0001529_118_747 209
557 3300046476 Ga0495662_0003742 Ga0495662_0003742_1798_2427 209
558 3300046477 Ga0495664_0000002 Ga0495664_0000002_342461_343237 209
559 3300046477 Ga0495664_0083198 Ga0495664_0083198_640_1269 209
560 3300046491 Ga0495584_0017751 Ga0495584_0017751_185_814 209
561 3300046492 Ga0495585_0031865 Ga0495585_0031865_447_1076 209
562 3300046499 Ga0495594_0001621 Ga0495594_0001621_8877_9506 209
563 3300046499 Ga0495594_0007428 Ga0495594_0007428_3750_4379 209
564 3300046499 Ga0495594_0065373 Ga0495594_0065373_330_959 209
565 3300046501 Ga0495607_0062488 Ga0495607_0062488_385_1014 209
566 3300046511 Ga0495608_0000009 Ga0495608_0000009_137198_137974 209
567 3300046511 Ga0495608_0004302 Ga0495608_0004302_6868_7497 209
568 3300046511 Ga0495608_0111335 Ga0495608_0111335_990_1619 209
569 3300046511 Ga0495608_0181772 Ga0495608_0181772_674_1303 209
570 3300046511 Ga0495608_0280570 Ga0495608_0280570_328_957 209
571 3300046514 Ga0495618_0000005 Ga0495618_0000005_119820_120596 209
572 3300046514 Ga0495618_0034349 Ga0495618_0034349_2271_2900 209
573 3300046516 Ga0495628_0000002 Ga0495628_0000002_306846_307622 209
574 3300046516 Ga0495628_0016439 Ga0495628_0016439_3904_4533 209
575 3300046516 Ga0495628_0053450 Ga0495628_0053450_1343_1972 209
576 3300046516 Ga0495628_0061485 Ga0495628_0061485_1644_2273 209
577 3300046517 Ga0495630_0006258 Ga0495630_0006258_788_1564 209
578 3300046517 Ga0495630_0103001 Ga0495630_0103001_186_815 209
579 3300046517 Ga0495630_0512670 Ga0495630_0512670_91_720 209
580 3300046519 Ga0495632_0074914 Ga0495632_0074914_362_991 209
581 3300046520 Ga0495637_0160355 Ga0495637_0160355_50_679 209
582 3300046522 Ga0495643_0088497 Ga0495643_0088497_826_1455 209
583 3300046523 Ga0495644_0005556 Ga0495644_0005556_1656_2285 209
584 3300046525 Ga0495663_0012025 Ga0495663_0012025_197_826 209
585 3300046525 Ga0495663_0088123 Ga0495663_0088123_345_974 209
586 3300046526 Ga0495666_0072016 Ga0495666_0072016_251_880 209
587 3300046526 Ga0495666_0085085 Ga0495666_0085085_32_661 209
588 3300046529 Ga0495652_0000004 Ga0495652_0000004_281261_282037 209
589 3300046529 Ga0495652_0044785 Ga0495652_0044785_2701_3330 209
590 3300046529 Ga0495652_0108769 Ga0495652_0108769_246_875 209
591 3300046529 Ga0495652_0108783 Ga0495652_0108783_411_1040 209
592 3300046529 Ga0495652_0280889 Ga0495652_0280889_399_1028 209
593 3300046531 Ga0495665_0008565 Ga0495665_0008565_652_1281 209
594 3300046531 Ga0495665_0107160 Ga0495665_0107160_800_1429 209
595 3300046531 Ga0495665_0115141 Ga0495665_0115141_75_704 209
596 3300046531 Ga0495665_0238693 Ga0495665_0238693_41_670 209
597 3300046533 Ga0495640_0000005 Ga0495640_0000005_137213_137989 209
598 3300046533 Ga0495640_0007182 Ga0495640_0007182_2900_3529 209
599 3300046533 Ga0495640_0039228 Ga0495640_0039228_2197_2826 209
600 3300046533 Ga0495640_0068913 Ga0495640_0068913_1044_1673 209
601 3300046536 Ga0495587_0000007 Ga0495587_0000007_180253_181029 209
602 3300046536 Ga0495587_0002711 Ga0495587_0002711_7175_7804 209
603 3300046536 Ga0495587_0019764 Ga0495587_0019764_40_669 209
604 3300046536 Ga0495587_0061115 Ga0495587_0061115_965_1594 209
605 3300046537 Ga0495598_0001796 Ga0495598_0001796_357_986 209
606 3300046538 Ga0495609_0049156 Ga0495609_0049156_619_1248 209
607 3300046543 Ga0495645_0000003 Ga0495645_0000003_288097_288873 209
608 3300046543 Ga0495645_0006697 Ga0495645_0006697_459_1088 209
609 3300046543 Ga0495645_0194635 Ga0495645_0194635_316_945 209
610 3300046557 Ga0495622_0003142 Ga0495622_0003142_4922_5551 209
611 3300046557 Ga0495622_0268894 Ga0495622_0268894_73_702 209
612 3300046558 Ga0495633_0153158 Ga0495633_0153158_142_771 209
613 3300046559 Ga0495667_0000002 Ga0495667_0000002_130101_130877 209
614 3300046559 Ga0495667_0005667 Ga0495667_0005667_3846_4475 209
615 3300046559 Ga0495667_0008306 Ga0495667_0008306_5930_6559 209
616 3300046615 Ga0495656_0006305 Ga0495656_0006305_109_738 209
617 3300046642 Ga0495634_0000370 Ga0495634_0000370_16995_17771 209
618 3300046642 Ga0495634_0043794 Ga0495634_0043794_1359_1988 209
619 3300046663 Ga0495635_0000020 Ga0495635_0000020_116219_116995 209
620 3300046663 Ga0495635_0002189 Ga0495635_0002189_3891_4520 209
621 3300046663 Ga0495635_0012205 Ga0495635_0012205_3166_3795 209
622 3300046664 Ga0495659_0004205 Ga0495659_0004205_2262_2891 209
623 3300046664 Ga0495659_0008734 Ga0495659_0008734_2132_2761 209
624 3300046674 Ga0495588_0030592 Ga0495588_0030592_540_1169 209
625 3300046674 Ga0495588_0279006 Ga0495588_0279006_34_663 209
626 3300046675 Ga0495657_0000240 Ga0495657_0000240_37959_38735 209
627 3300046675 Ga0495657_0084068 Ga0495657_0084068_294_923 209
628 3300046675 Ga0495657_0315317 Ga0495657_0315317_217_846 209
629 3300046678 Ga0495599_0000001 Ga0495599_0000001_445524_446300 209
630 3300046678 Ga0495599_0016560 Ga0495599_0016560_3470_4099 209
631 3300046679 Ga0495623_0000001 Ga0495623_0000001_214469_215245 209
632 3300046679 Ga0495623_0001957 Ga0495623_0001957_4424_5053 209
633 3300046679 Ga0495623_0097274 Ga0495623_0097274_593_1222 209
634 3300046680 Ga0495646_0000013 Ga0495646_0000013_65102_65878 209
635 3300046680 Ga0495646_0007674 Ga0495646_0007674_479_1108 209
636 3300046680 Ga0495646_0266155 Ga0495646_0266155_237_866 209
637 3300046681 Ga0495647_0039495 Ga0495647_0039495_971_1600 209
638 3300046681 Ga0495647_0060866 Ga0495647_0060866_268_897 209
639 3300046683 Ga0495658_0000053 Ga0495658_0000053_17874_18503 209
640 3300046683 Ga0495658_0004065 Ga0495658_0004065_6446_7075 209
641 3300046683 Ga0495658_0083377 Ga0495658_0083377_496_1212 209
642 3300046683 Ga0495658_0309162 Ga0495658_0309162_250_879 209
643 3300046684 Ga0495669_0004939 Ga0495669_0004939_3153_3782 209
644 3300046689 Ga0495613_0002216 Ga0495613_0002216_5576_6205 209
645 3300046689 Ga0495613_0016392 Ga0495613_0016392_4777_5406 209
646 3300046689 Ga0495613_0460145 Ga0495613_0460145_14_730 209
647 3300046690 Ga0495624_0085343 Ga0495624_0085343_478_1107 209
648 3300046691 Ga0495670_0001982 Ga0495670_0001982_866_1495 209
649 3300046691 Ga0495670_0070550 Ga0495670_0070550_598_1227 209
650 3300046809 Ga0495600_0000041 Ga0495600_0000041_24091_24867 209
651 3300046809 Ga0495600_0012714 Ga0495600_0012714_1279_1908 209
652 3300046809 Ga0495600_0016627 Ga0495600_0016627_1393_2022 209
653 3300046809 Ga0495600_0096880 Ga0495600_0096880_1272_1901 209
654 3300047315 Ga0495581_0041169 Ga0495581_0041169_1194_1970 209
655 3300047315 Ga0495581_0043882 Ga0495581_0043882_1282_1911 209
656 3300047315 Ga0495581_0071826 Ga0495581_0071826_1283_1912 209
657 3300047315 Ga0495581_0120149 Ga0495581_0120149_308_937 209
658 3300047317 Ga0495604_0000005 Ga0495604_0000005_332490_333266 209
659 3300047317 Ga0495604_0012681 Ga0495604_0012681_2077_2706 209
660 3300047317 Ga0495604_0035518 Ga0495604_0035518_607_1236 209
661 3300047317 Ga0495604_0127317 Ga0495604_0127317_73_702 209
662 3300047317 Ga0495604_0214775 Ga0495604_0214775_271_900 209
663 3300047319 Ga0495674_0000003 Ga0495674_0000003_254504_255280 209
664 3300047319 Ga0495674_0009717 Ga0495674_0009717_4800_5429 209
665 3300047319 Ga0495674_0095193 Ga0495674_0095193_790_1419 209
666 3300047319 Ga0495674_0171662 Ga0495674_0171662_1097_1726 209
667 3300047319 Ga0495674_0252650 Ga0495674_0252650_201_830 209
668 3300047319 Ga0495674_0745751 Ga0495674_0745751_126_755 209
669 3300047321 Ga0495676_0368520 Ga0495676_0368520_219_848 209
670 3300047322 Ga0495680_0000002 Ga0495680_0000002_109913_110689 209
671 3300047322 Ga0495680_0005450 Ga0495680_0005450_9652_10281 209
672 3300047322 Ga0495680_0014597 Ga0495680_0014597_4541_5170 209
673 3300047322 Ga0495680_0014851 Ga0495680_0014851_4802_5431 209
674 3300047322 Ga0495680_0020938 Ga0495680_0020938_2482_3111 209
675 3300047323 Ga0495683_0261896 Ga0495683_0261896_65_694 209
676 3300047323 Ga0495683_0272055 Ga0495683_0272055_61_690 209
677 3300047444 Ga0495675_0000010 Ga0495675_0000010_9365_10141 209
678 3300047444 Ga0495675_0002614 Ga0495675_0002614_2701_3330 209
679 3300047446 Ga0495679_009496 Ga0495679_009496_87_716 209
680 3300047447 Ga0495685_038085 Ga0495685_038085_230_859 209
681 3300047470 Ga0495681_0154853 Ga0495681_0154853_318_947 209
682 3300047471 Ga0495684_0000020 Ga0495684_0000020_56506_57282 209
683 3300047471 Ga0495684_0105287 Ga0495684_0105287_237_866 209
684 3300047471 Ga0495684_0289915 Ga0495684_0289915_19_648 209
685 3300047673 Ga0495593_0001835 Ga0495593_0001835_10341_11117 209
686 3300047673 Ga0495593_0010195 Ga0495593_0010195_3428_4057 209
687 3300047673 Ga0495593_0012341 Ga0495593_0012341_3742_4371 209
688 3300048088 Ga0495602_0000027 Ga0495602_0000027_34406_35182 209
689 3300048088 Ga0495602_0004530 Ga0495602_0004530_9336_9965 209
690 3300048088 Ga0495602_0100018 Ga0495602_0100018_226_855 209
691 3300048088 Ga0495602_0347093 Ga0495602_0347093_135_764 209
692 3300048089 Ga0495614_0021062 Ga0495614_0021062_1478_2107 209
693 3300048089 Ga0495614_0153792 Ga0495614_0153792_255_884 209
694 3300048090 Ga0495615_0008947 Ga0495615_0008947_796_1425 209
695 3300048091 Ga0495626_0227867 Ga0495626_0227867_18_647 209
696 3300048903 Ga0496100_0007653 Ga0496100_0007653_4402_5031 209
697 3300048903 Ga0496100_0040734 Ga0496100_0040734_128_757 209
698 3300048903 Ga0496100_0048258 Ga0496100_0048258_1963_2592 209
699 3300048904 Ga0496101_0039136 Ga0496101_0039136_1544_2173 209
700 3300048905 Ga0496102_0000755 Ga0496102_0000755_24806_25435 209
701 3300048905 Ga0496102_0057781 Ga0496102_0057781_285_914 209
702 3300048906 Ga0496103_0002840 Ga0496103_0002840_9081_9710 209
703 3300048906 Ga0496103_0014136 Ga0496103_0014136_3756_4385 209
704 3300048906 Ga0496103_0096799 Ga0496103_0096799_130_759 209
705 3300048906 Ga0496103_0117825 Ga0496103_0117825_992_1621 209
706 3300048907 Ga0496104_0001796 Ga0496104_0001796_37_666 209
707 3300048907 Ga0496104_0005538 Ga0496104_0005538_8972_9601 209
708 3300048907 Ga0496104_0012186 Ga0496104_0012186_6844_7473 209
709 3300048907 Ga0496104_0726268 Ga0496104_0726268_64_693 209
710 3300048908 Ga0496105_0000541 Ga0496105_0000541_3110_3739 209
711 3300048908 Ga0496105_0004608 Ga0496105_0004608_7796_8425 209
712 3300048908 Ga0496105_0009830 Ga0496105_0009830_3338_3967 209
713 3300048909 Ga0496106_0028812 Ga0496106_0028812_116_745 209
714 3300048909 Ga0496106_0070287 Ga0496106_0070287_1144_1773 209
715 3300048909 Ga0496106_0078282 Ga0496106_0078282_467_1096 209
716 3300048909 Ga0496106_0680539 Ga0496106_0680539_110_739 209
717 3300048910 Ga0496107_0020511 Ga0496107_0020511_617_1246 209
718 3300048911 Ga0496108_0003829 Ga0496108_0003829_8956_9657 209
719 3300048911 Ga0496108_0017593 Ga0496108_0017593_1028_1657 209
720 3300048911 Ga0496108_0045104 Ga0496108_0045104_711_1340 209
721 3300048911 Ga0496108_0272594 Ga0496108_0272594_688_1317 209
722 3300048911 Ga0496108_0307452 Ga0496108_0307452_608_1237 209
723 3300048912 Ga0496109_0105150 Ga0496109_0105150_1288_1917 209
724 3300048912 Ga0496109_0630874 Ga0496109_0630874_92_721 209
725 3300048912 Ga0496109_0720410 Ga0496109_0720410_220_849 209
726 3300048913 Ga0496110_0001525 Ga0496110_0001525_3753_4382 209
727 3300048913 Ga0496110_0077983 Ga0496110_0077983_1001_1630 209
728 3300048913 Ga0496110_0216036 Ga0496110_0216036_440_1069 209
729 3300048914 Ga0496111_0002616 Ga0496111_0002616_3936_4637 209
730 3300048914 Ga0496111_0018936 Ga0496111_0018936_1179_1808 209
731 3300048914 Ga0496111_0053204 Ga0496111_0053204_1342_1971 209
732 3300048915 Ga0496112_0026813 Ga0496112_0026813_3732_4433 209
733 3300048915 Ga0496112_0028051 Ga0496112_0028051_2609_3238 209
734 3300048915 Ga0496112_0505112 Ga0496112_0505112_116_745 209
735 3300048916 Ga0496113_0046775 Ga0496113_0046775_448_1077 209
736 3300048916 Ga0496113_0065168 Ga0496113_0065168_585_1214 209
737 3300048916 Ga0496113_0670550 Ga0496113_0670550_151_780 209
738 3300048917 Ga0496114_0006714 Ga0496114_0006714_6956_7585 209
739 3300048917 Ga0496114_0132473 Ga0496114_0132473_1218_1847 209
740 3300048917 Ga0496114_0216272 Ga0496114_0216272_733_1362 209
741 3300048917 Ga0496114_1028782 Ga0496114_1028782_35_664 209
742 3300048918 Ga0496115_0133215 Ga0496115_0133215_255_884 209
743 3300048918 Ga0496115_0171423 Ga0496115_0171423_102_731 209
744 3300048918 Ga0496115_0356941 Ga0496115_0356941_379_1008 209
745 3300049568 Ga0501031_0014328 Ga0501031_0014328_4168_4797 209
746 3300049569 Ga0501032_0090537 Ga0501032_0090537_500_1129 209
747 3300049569 Ga0501032_0189451 Ga0501032_0189451_399_1028 209
748 3300049571 Ga0501034_0000230 Ga0501034_0000230_49986_50615 209
749 3300049571 Ga0501034_0000979 Ga0501034_0000979_4443_5072 209
750 3300049571 Ga0501034_0278823 Ga0501034_0278823_235_864 209
751 3300049571 Ga0501034_0371728 Ga0501034_0371728_270_899 209
752 3300049572 Ga0501036_0001363 Ga0501036_0001363_16149_16778 209
753 3300049572 Ga0501036_0040704 Ga0501036_0040704_2894_3523 209
754 3300049572 Ga0501036_0112049 Ga0501036_0112049_1514_2143 209
755 3300049572 Ga0501036_0201179 Ga0501036_0201179_506_1135 209
756 3300049572 Ga0501036_0401195 Ga0501036_0401195_204_833 209
757 3300049573 Ga0501037_0004189 Ga0501037_0004189_7888_8517 209
758 3300049573 Ga0501037_0005414 Ga0501037_0005414_3885_4514 209
759 3300049573 Ga0501037_0069205 Ga0501037_0069205_375_1004 209
760 3300049573 Ga0501037_0075572 Ga0501037_0075572_1402_2031 209
761 3300049574 Ga0501038_0204839 Ga0501038_0204839_397_1026 209
762 3300049575 Ga0501039_0056147 Ga0501039_0056147_2237_2866 209
763 3300049575 Ga0501039_0192615 Ga0501039_0192615_387_1016 209
764 3300049575 Ga0501039_0479678 Ga0501039_0479678_321_950 209
765 3300049578 Ga0501042_0186301 Ga0501042_0186301_853_1482 209
766 3300049579 Ga0501043_0025842 Ga0501043_0025842_1374_2003 209
767 3300049579 Ga0501043_0107538 Ga0501043_0107538_422_1051 209
768 3300049579 Ga0501043_0291756 Ga0501043_0291756_383_1012 209
769 3300049579 Ga0501043_0340694 Ga0501043_0340694_27_656 209
770 3300049580 Ga0501046_0030547 Ga0501046_0030547_3522_4151 209
771 3300049580 Ga0501046_0116592 Ga0501046_0116592_374_1003 209
772 3300049581 Ga0501047_0000104 Ga0501047_0000104_29920_30549 209
773 3300049581 Ga0501047_0013879 Ga0501047_0013879_4291_4920 209
774 3300049581 Ga0501047_0130322 Ga0501047_0130322_1000_1629 209
775 3300049581 Ga0501047_0261271 Ga0501047_0261271_940_1569 209
776 3300049581 Ga0501047_0488547 Ga0501047_0488547_75_704 209
777 3300049581 Ga0501047_0582553 Ga0501047_0582553_286_915 209
778 3300049581 Ga0501047_0766276 Ga0501047_0766276_125_754 209
779 3300049582 Ga0501048_0065844 Ga0501048_0065844_1547_2176 209
780 3300049582 Ga0501048_0111604 Ga0501048_0111604_496_1125 209
781 3300049582 Ga0501048_0255460 Ga0501048_0255460_197_826 209
782 3300049583 Ga0501067_0188984 Ga0501067_0188984_305_934 209
783 3300049584 Ga0501068_0187892 Ga0501068_0187892_339_968 209
784 3300049585 Ga0501069_0005267 Ga0501069_0005267_5690_6319 209
785 3300049585 Ga0501069_0047073 Ga0501069_0047073_1701_2330 209
786 3300049586 Ga0501070_0004425 Ga0501070_0004425_8293_8922 209
787 3300049586 Ga0501070_0008389 Ga0501070_0008389_3657_4286 209
788 3300049586 Ga0501070_0085497 Ga0501070_0085497_185_814 209
789 3300049586 Ga0501070_0269885 Ga0501070_0269885_399_1028 209
790 3300049586 Ga0501070_0581299 Ga0501070_0581299_74_703 209
791 3300049587 Ga0501071_0037150 Ga0501071_0037150_82_711 209
792 3300049589 Ga0501073_0025376 Ga0501073_0025376_798_1427 209
793 3300049589 Ga0501073_0132290 Ga0501073_0132290_506_1135 209
794 3300049589 Ga0501073_0238023 Ga0501073_0238023_481_1110 209
795 3300049589 Ga0501073_0317729 Ga0501073_0317729_212_841 209
796 3300049590 Ga0501074_0008421 Ga0501074_0008421_6045_6674 209
797 3300049590 Ga0501074_0014334 Ga0501074_0014334_1221_1850 209
798 3300049590 Ga0501074_0055363 Ga0501074_0055363_1004_1633 209
799 3300049591 Ga0501075_0316321 Ga0501075_0316321_439_1068 209
800 3300049593 Ga0501077_0122081 Ga0501077_0122081_451_1080 209
801 3300049742 Ga0501080_0000750 Ga0501080_0000750_4192_4821 209
802 3300049742 Ga0501080_0033845 Ga0501080_0033845_416_1045 209
803 3300049742 Ga0501080_0095364 Ga0501080_0095364_48_677 209
804 3300049742 Ga0501080_0109574 Ga0501080_0109574_504_1133 209
805 3300049742 Ga0501080_0186791 Ga0501080_0186791_17_646 209
806 3300049742 Ga0501080_0381257 Ga0501080_0381257_241_870 209
807 3300049744 Ga0501083_0001387 Ga0501083_0001387_14296_14925 209
808 3300049744 Ga0501083_0003903 Ga0501083_0003903_5369_6082 209
809 3300049744 Ga0501083_0177308 Ga0501083_0177308_617_1255 209
810 3300049744 Ga0501083_0184070 Ga0501083_0184070_655_1284 209
811 3300049822 Ga0501035_0015132 Ga0501035_0015132_416_1045 209
812 3300049822 Ga0501035_0121202 Ga0501035_0121202_1583_2212 209
813 3300049822 Ga0501035_0121262 Ga0501035_0121262_310_939 209
814 3300049822 Ga0501035_0264382 Ga0501035_0264382_185_814 209
815 3300049822 Ga0501035_0402620 Ga0501035_0402620_413_1042 209
816 3300049822 Ga0501035_0414737 Ga0501035_0414737_478_1107 209
817 3300049823 Ga0501044_0021098 Ga0501044_0021098_416_1045 209
818 3300049823 Ga0501044_0045705 Ga0501044_0045705_2531_3160 209
819 3300049823 Ga0501044_0049599 Ga0501044_0049599_1689_2318 209
820 3300049823 Ga0501044_0383328 Ga0501044_0383328_393_1022 209
821 3300050489 nmdc:mga03683_20876_c1 nmdc:mga03683_20876_c1_365_994 209
822 3300050489 nmdc:mga03683_67652_c1 nmdc:mga03683_67652_c1_460_1089 209
823 3300050490 nmdc:mga03n38_188976_c1 nmdc:mga03n38_188976_c1_67_696 209
824 3300050490 nmdc:mga03n38_55772_c1 nmdc:mga03n38_55772_c1_649_1278 209
825 3300050490 nmdc:mga03n38_9263_c1 nmdc:mga03n38_9263_c1_1598_2227 209
826 3300050491 nmdc:mga00v17_59863_c1 nmdc:mga00v17_59863_c1_550_1179 209
827 3300050492 nmdc:mga0yw44_40773_c1 nmdc:mga0yw44_40773_c1_1661_2290 209
828 3300050493 nmdc:mga0k408_211839_c1 nmdc:mga0k408_211839_c1_176_805 209
829 3300050493 nmdc:mga0k408_33851_c1 nmdc:mga0k408_33851_c1_1293_1922 209
830 3300050494 nmdc:mga06z11_55267_c1 nmdc:mga06z11_55267_c1_645_1274 209
831 3300050495 nmdc:mga04h51_6154_c1 nmdc:mga04h51_6154_c1_813_1442 209
832 3300050496 nmdc:mga07m45_242634_c1 nmdc:mga07m45_242634_c1_222_851 209
833 3300050496 nmdc:mga07m45_412497_c1 nmdc:mga07m45_412497_c1_59_688 209
834 3300050496 nmdc:mga07m45_65791_c1 nmdc:mga07m45_65791_c1_1393_2022 209
835 3300050507 nmdc:mga05p37_1686_c1 nmdc:mga05p37_1686_c1_13788_14417 209
836 3300050507 nmdc:mga05p37_253127_c1 nmdc:mga05p37_253127_c1_930_1559 209
837 3300050507 nmdc:mga05p37_3518_c1 nmdc:mga05p37_3518_c1_11445_12074 209
838 3300050507 nmdc:mga05p37_62967_c1 nmdc:mga05p37_62967_c1_3497_4171 209
839 3300050508 nmdc:mga09592_2329_c1 nmdc:mga09592_2329_c1_4918_5547 209
840 3300050508 nmdc:mga09592_9760_c1 nmdc:mga09592_9760_c1_3885_4514 209
841 3300050509 nmdc:mga0qj67_655_c1 nmdc:mga0qj67_655_c1_8569_9198 209
842 3300050510 nmdc:mga06r32_13402_c1 nmdc:mga06r32_13402_c1_321_950 209
843 3300050510 nmdc:mga06r32_37775_c1 nmdc:mga06r32_37775_c1_3313_3942 209
844 3300050510 nmdc:mga06r32_639132_c1 nmdc:mga06r32_639132_c1_53_682 209
845 3300050511 nmdc:mga08y16_11167_c1 nmdc:mga08y16_11167_c1_7181_7810 209
846 3300050511 nmdc:mga08y16_111884_c1 nmdc:mga08y16_111884_c1_1474_2103 209
847 3300050511 nmdc:mga08y16_157653_c1 nmdc:mga08y16_157653_c1_207_836 209
848 3300050511 nmdc:mga08y16_208254_c1 nmdc:mga08y16_208254_c1_1045_1674 209
849 3300050511 nmdc:mga08y16_391496_c1 nmdc:mga08y16_391496_c1_248_877 209
850 3300050512 nmdc:mga0n895_24805_c1 nmdc:mga0n895_24805_c1_3356_3985 209
851 3300050512 nmdc:mga0n895_3408_c1 nmdc:mga0n895_3408_c1_10958_11587 209
852 3300050512 nmdc:mga0n895_365885_c1 nmdc:mga0n895_365885_c1_239_868 209
853 3300050512 nmdc:mga0n895_7582_c2 nmdc:mga0n895_7582_c2_3660_4298 209
854 3300050513 nmdc:mga0rr50_264508_c1 nmdc:mga0rr50_264508_c1_46_675 209
855 3300050513 nmdc:mga0rr50_821487_c1 nmdc:mga0rr50_821487_c1_122_751 209
856 3300050514 nmdc:mga08x19_401004_c1 nmdc:mga08x19_401004_c1_211_840 209
857 3300050515 nmdc:mga0a205_328996_c1 nmdc:mga0a205_328996_c1_199_828 209
858 3300050515 nmdc:mga0a205_67929_c1 nmdc:mga0a205_67929_c1_2747_3376 209
859 3300050516 nmdc:mga0sz30_136334_c1 nmdc:mga0sz30_136334_c1_214_843 209
860 3300050516 nmdc:mga0sz30_200956_c1 nmdc:mga0sz30_200956_c1_151_780 209
861 3300053077 Ga0495601_0000008 Ga0495601_0000008_15120_15896 209
862 3300053077 Ga0495601_0000532 Ga0495601_0000532_11989_12618 209
863 3300053077 Ga0495601_0001725 Ga0495601_0001725_7326_7955 209
864 3300053077 Ga0495601_0016949 Ga0495601_0016949_385_1014 209
865 3300053077 Ga0495601_0110329 Ga0495601_0110329_194_823 209
866 3300053078 Ga0495612_0000002 Ga0495612_0000002_218442_219218 209
867 3300053078 Ga0495612_0002354 Ga0495612_0002354_5982_6611 209
868 3300053078 Ga0495612_0002553 Ga0495612_0002553_5036_5665 209
869 3300053078 Ga0495612_0072115 Ga0495612_0072115_419_1048 209
870 3300053083 Ga0495655_0041036 Ga0495655_0041036_195_824 209
871 3300053084 Ga0495595_0000008 Ga0495595_0000008_15248_16024 209
872 3300053084 Ga0495595_0000211 Ga0495595_0000211_2381_3010 209
873 3300053084 Ga0495595_0012207 Ga0495595_0012207_541_1170 209
874 3300053084 Ga0495595_0025092 Ga0495595_0025092_547_1176 209
875 3300053084 Ga0495595_0059736 Ga0495595_0059736_92_721 209
876 3300053084 Ga0495595_0209446 Ga0495595_0209446_183_812 209
877 3300053085 Ga0495619_0000002 Ga0495619_0000002_306849_307625 209
878 3300053085 Ga0495619_0000122 Ga0495619_0000122_49950_50579 209
879 3300053085 Ga0495619_0000134 Ga0495619_0000134_10981_11610 209
880 3300053085 Ga0495619_0015735 Ga0495619_0015735_3563_4192 209
881 3300053085 Ga0495619_0023727 Ga0495619_0023727_651_1280 209
882 3300053085 Ga0495619_0064201 Ga0495619_0064201_731_1360 209
883 3300053117 Ga0500593_026538 Ga0500593_026538_1800_2429 209
884 3300053158 Ga0500627_0031796 Ga0500627_0031796_560_1189 209
885 3300054114 Ga0501084_0190094 Ga0501084_0190094_263_892 209
886 3300054114 Ga0501084_0354633 Ga0501084_0354633_54_830 209
887 3300060353 Ga0501082_0000079 Ga0501082_0000079_19422_20051 209
888 3300060353 Ga0501082_0011869 Ga0501082_0011869_2790_3419 209
889 3300061734 Ga0530510_0407300 Ga0530510_0407300_337_966 209
890 2162886007 SwRhRL2b_contig_271485 SwRhRL2b_0437.00001720 210
891 2209111006 2214772993 2213793023 210
892 3300000041 ARcpr5oldR_c000025 ARcpr5oldR_0000256 210
893 3300000042 ARSoilYngRDRAFT_c00011 ARSoilYngRDRAFT_000118 210
894 3300000043 ARcpr5yngRDRAFT_c000021 ARcpr5yngRDRAFT_0000218 210
895 3300000044 ARSoilOldRDRAFT_c000046 ARSoilOldRDRAFT_0000468 210
896 3300000045 ARCol0oldRDRAFT_c00441 ARCol0oldRDRAFT_004412 210
897 3300000652 ARCol0yngRDRAFT_1000010 ARCol0yngRDRAFT_10000108 210
898 3300001976 JGI24752J21851_1004261 JGI24752J21851_10042612 210
899 3300001978 JGI24747J21853_1000049 JGI24747J21853_10000493 210
900 3300001989 JGI24739J22299_10015772 JGI24739J22299_100157723 210
901 3300001990 JGI24737J22298_10001098 JGI24737J22298_100010982 210
902 3300001990 JGI24737J22298_10011294 JGI24737J22298_100112942 210
903 3300001991 JGI24743J22301_10051799 JGI24743J22301_100517991 210
904 3300002070 JGI24750J21931_1000013 JGI24750J21931_10000138 210
905 3300002073 JGI24745J21846_1000026 JGI24745J21846_10000262 210
906 3300002074 JGI24748J21848_1001841 JGI24748J21848_10018412 210
907 3300002075 JGI24738J21930_10000790 JGI24738J21930_100007907 210
908 3300002076 JGI24749J21850_1000522 JGI24749J21850_10005222 210
909 3300002126 JGI24035J26624_1000074 JGI24035J26624_10000745 210
910 3300002155 JGI24033J26618_1019203 JGI24033J26618_10192031 210
911 3300002239 JGI24034J26672_10000354 JGI24034J26672_100003542 210
912 3300002244 JGI24742J22300_10000012 JGI24742J22300_100000126 210
913 3300002244 JGI24742J22300_10023938 JGI24742J22300_100239381 210
914 3300003215 JGI25153J46596_10008933 JGI25153J46596_100089334 210
915 3300003659 JGI25404J52841_10001636 JGI25404J52841_100016363 210
916 3300003911 JGI25405J52794_10028692 JGI25405J52794_100286922 210
917 3300005277 Ga0065716_1001618 Ga0065716_10016185 210
918 3300005288 Ga0065714_10204173 Ga0065714_102041731 210
919 3300005289 Ga0065704_10076840 Ga0065704_100768404 210
920 3300005290 Ga0065712_10074295 Ga0065712_100742952 210
921 3300005290 Ga0065712_10094580 Ga0065712_100945801 210
922 3300005293 Ga0065715_10005658 Ga0065715_100056581 210
923 3300005295 Ga0065707_10101382 Ga0065707_101013824 210
924 3300005327 Ga0070658_10012746 Ga0070658_100127465 210
925 3300005328 Ga0070676_10000008 Ga0070676_100000082 210
926 3300005329 Ga0070683_100000442 Ga0070683_10000044210 210
927 3300005330 Ga0070690_100004858 Ga0070690_1000048584 210
928 3300005330 Ga0070690_100019824 Ga0070690_1000198243 210
929 3300005330 Ga0070690_100023774 Ga0070690_1000237742 210
930 3300005331 Ga0070670_100012561 Ga0070670_1000125615 210
931 3300005333 Ga0070677_10000100 Ga0070677_1000010020 210
932 3300005333 Ga0070677_10152446 Ga0070677_101524462 210
933 3300005334 Ga0068869_100021707 Ga0068869_1000217071 210
934 3300005334 Ga0068869_100422854 Ga0068869_1004228542 210
935 3300005335 Ga0070666_10082839 Ga0070666_100828392 210
936 3300005336 Ga0070680_100068482 Ga0070680_1000684822 210
937 3300005336 Ga0070680_100129407 Ga0070680_1001294072 210
938 3300005336 Ga0070680_100438466 Ga0070680_1004384661 210
939 3300005337 Ga0070682_100000217 Ga0070682_10000021736 210
940 3300005338 Ga0068868_100000521 Ga0068868_10000052116 210
941 3300005339 Ga0070660_100000962 Ga0070660_10000096211 210
942 3300005340 Ga0070689_100000578 Ga0070689_10000057812 210
943 3300005340 Ga0070689_100002246 Ga0070689_1000022463 210
944 3300005340 Ga0070689_100018637 Ga0070689_1000186373 210
945 3300005340 Ga0070689_100048263 Ga0070689_1000482633 210
946 3300005340 Ga0070689_100174483 Ga0070689_1001744833 210
947 3300005341 Ga0070691_10000193 Ga0070691_1000019314 210
948 3300005343 Ga0070687_100000292 Ga0070687_1000002925 210
949 3300005343 Ga0070687_100117451 Ga0070687_1001174512 210
950 3300005344 Ga0070661_100024093 Ga0070661_1000240932 210
951 3300005345 Ga0070692_10006096 Ga0070692_100060963 210
952 3300005345 Ga0070692_10028100 Ga0070692_100281002 210
953 3300005345 Ga0070692_10134738 Ga0070692_101347381 210
954 3300005347 Ga0070668_100000463 Ga0070668_10000046320 210
955 3300005353 Ga0070669_100028711 Ga0070669_1000287112 210
956 3300005353 Ga0070669_100071820 Ga0070669_1000718202 210
957 3300005354 Ga0070675_100000032 Ga0070675_10000003284 210
958 3300005354 Ga0070675_100056420 Ga0070675_1000564203 210
959 3300005356 Ga0070674_100000070 Ga0070674_1000000709 210
960 3300005364 Ga0070673_100000122 Ga0070673_10000012228 210
961 3300005364 Ga0070673_100461404 Ga0070673_1004614042 210
962 3300005364 Ga0070673_100583754 Ga0070673_1005837542 210
963 3300005365 Ga0070688_100000062 Ga0070688_1000000625 210
964 3300005365 Ga0070688_100026834 Ga0070688_1000268344 210
965 3300005365 Ga0070688_100055176 Ga0070688_1000551764 210
966 3300005366 Ga0070659_100003490 Ga0070659_1000034906 210
967 3300005367 Ga0070667_100002274 Ga0070667_1000022745 210
968 3300005367 Ga0070667_100559328 Ga0070667_1005593282 210
969 3300005406 Ga0070703_10041227 Ga0070703_100412272 210
970 3300005434 Ga0070709_10004175 Ga0070709_100041756 210
971 3300005435 Ga0070714_100062100 Ga0070714_1000621003 210
972 3300005435 Ga0070714_100166188 Ga0070714_1001661882 210
973 3300005435 Ga0070714_100368103 Ga0070714_1003681031 210
974 3300005437 Ga0070710_10004441 Ga0070710_100044413 210
975 3300005438 Ga0070701_10000030 Ga0070701_1000003030 210
976 3300005438 Ga0070701_10004344 Ga0070701_100043444 210
977 3300005439 Ga0070711_100032548 Ga0070711_1000325482 210
978 3300005440 Ga0070705_100011858 Ga0070705_1000118582 210
979 3300005440 Ga0070705_100031956 Ga0070705_1000319563 210
980 3300005441 Ga0070700_100001800 Ga0070700_1000018003 210
981 3300005441 Ga0070700_100007072 Ga0070700_1000070726 210
982 3300005441 Ga0070700_100132900 Ga0070700_1001329001 210
983 3300005444 Ga0070694_100001327 Ga0070694_1000013277 210
984 3300005444 Ga0070694_100014744 Ga0070694_1000147442 210
985 3300005445 Ga0070708_100111542 Ga0070708_1001115423 210
986 3300005445 Ga0070708_100265231 Ga0070708_1002652312 210
987 3300005455 Ga0070663_100004939 Ga0070663_1000049392 210
988 3300005455 Ga0070663_100017579 Ga0070663_1000175792 210
989 3300005455 Ga0070663_100021480 Ga0070663_1000214804 210
990 3300005456 Ga0070678_100000054 Ga0070678_1000000542 210
991 3300005456 Ga0070678_100134640 Ga0070678_1001346402 210
992 3300005457 Ga0070662_100065035 Ga0070662_1000650352 210
993 3300005458 Ga0070681_10000284 Ga0070681_100002845 210
994 3300005458 Ga0070681_10061420 Ga0070681_100614201 210
995 3300005458 Ga0070681_10080211 Ga0070681_100802111 210
996 3300005458 Ga0070681_10148405 Ga0070681_101484052 210
997 3300005458 Ga0070681_10148585 Ga0070681_101485853 210
998 3300005458 Ga0070681_10184270 Ga0070681_101842702 210
999 3300005459 Ga0068867_100000073 Ga0068867_10000007336 210
1000 3300005459 Ga0068867_100080243 Ga0068867_1000802432 210
1001 3300005467 Ga0070706_100374856 Ga0070706_1003748561 210
1002 3300005468 Ga0070707_100586445 Ga0070707_1005864451 210
1003 3300005518 Ga0070699_100000576 Ga0070699_10000057636 210
1004 3300005518 Ga0070699_100000915 Ga0070699_1000009159 210
1005 3300005518 Ga0070699_100582680 Ga0070699_1005826802 210
1006 3300005530 Ga0070679_100004433 Ga0070679_1000044331 210
1007 3300005530 Ga0070679_100006931 Ga0070679_1000069312 210
1008 3300005530 Ga0070679_100064239 Ga0070679_1000642393 210
1009 3300005530 Ga0070679_100133365 Ga0070679_1001333651 210
1010 3300005530 Ga0070679_100215722 Ga0070679_1002157223 210
1011 3300005535 Ga0070684_100000022 Ga0070684_100000022115 210
1012 3300005535 Ga0070684_100086183 Ga0070684_1000861833 210
1013 3300005536 Ga0070697_100167078 Ga0070697_1001670782 210
1014 3300005539 Ga0068853_100000820 Ga0068853_10000082014 210
1015 3300005543 Ga0070672_100000012 Ga0070672_1000000129 210
1016 3300005544 Ga0070686_100000087 Ga0070686_10000008711 210
1017 3300005544 Ga0070686_100419536 Ga0070686_1004195361 210
1018 3300005545 Ga0070695_100007385 Ga0070695_1000073854 210
1019 3300005545 Ga0070695_100018600 Ga0070695_1000186004 210
1020 3300005545 Ga0070695_100087718 Ga0070695_1000877182 210
1021 3300005546 Ga0070696_100000306 Ga0070696_1000003062 210
1022 3300005547 Ga0070693_100038512 Ga0070693_1000385122 210
1023 3300005547 Ga0070693_100141334 Ga0070693_1001413341 210
1024 3300005547 Ga0070693_100154062 Ga0070693_1001540622 210
1025 3300005548 Ga0070665_100009158 Ga0070665_1000091585 210
1026 3300005549 Ga0070704_100002961 Ga0070704_1000029614 210
1027 3300005549 Ga0070704_100020451 Ga0070704_1000204514 210
1028 3300005549 Ga0070704_100109460 Ga0070704_1001094602 210
1029 3300005549 Ga0070704_100112966 Ga0070704_1001129662 210
1030 3300005563 Ga0068855_100034558 Ga0068855_1000345582 210
1031 3300005563 Ga0068855_100065574 Ga0068855_1000655742 210
1032 3300005564 Ga0070664_100000102 Ga0070664_10000010253 210
1033 3300005564 Ga0070664_100103743 Ga0070664_1001037432 210
1034 3300005577 Ga0068857_100000069 Ga0068857_10000006950 210
1035 3300005577 Ga0068857_100030335 Ga0068857_1000303352 210
1036 3300005577 Ga0068857_100191167 Ga0068857_1001911673 210
1037 3300005578 Ga0068854_100000215 Ga0068854_10000021540 210
1038 3300005614 Ga0068856_100000214 Ga0068856_10000021456 210
1039 3300005615 Ga0070702_100000418 Ga0070702_1000004188 210
1040 3300005616 Ga0068852_100003712 Ga0068852_1000037124 210
1041 3300005616 Ga0068852_100279088 Ga0068852_1002790883 210
1042 3300005617 Ga0068859_100003063 Ga0068859_10000306311 210
1043 3300005617 Ga0068859_100011140 Ga0068859_1000111407 210
1044 3300005617 Ga0068859_100022056 Ga0068859_1000220562 210
1045 3300005618 Ga0068864_100040738 Ga0068864_1000407383 210
1046 3300005618 Ga0068864_100165491 Ga0068864_1001654912 210
1047 3300005718 Ga0068866_10000150 Ga0068866_100001502 210
1048 3300005718 Ga0068866_10083676 Ga0068866_100836762 210
1049 3300005719 Ga0068861_100026033 Ga0068861_1000260334 210
1050 3300005719 Ga0068861_100171209 Ga0068861_1001712092 210
1051 3300005719 Ga0068861_100283341 Ga0068861_1002833412 210
1052 3300005840 Ga0068870_10000001 Ga0068870_1000000174 210
1053 3300005841 Ga0068863_100010203 Ga0068863_1000102035 210
1054 3300005841 Ga0068863_100858728 Ga0068863_1008587281 210
1055 3300005842 Ga0068858_100001238 Ga0068858_1000012385 210
1056 3300005842 Ga0068858_100086831 Ga0068858_1000868312 210
1057 3300005842 Ga0068858_100846687 Ga0068858_1008466872 210
1058 3300005843 Ga0068860_100002790 Ga0068860_1000027908 210
1059 3300005843 Ga0068860_100019455 Ga0068860_1000194555 210
1060 3300005844 Ga0068862_100000304 Ga0068862_10000030415 210
1061 3300005844 Ga0068862_100012520 Ga0068862_1000125202 210
1062 3300005844 Ga0068862_100116726 Ga0068862_1001167263 210
1063 3300005937 Ga0081455_10000031 Ga0081455_1000003176 210
1064 3300005937 Ga0081455_10008273 Ga0081455_100082732 210
1065 3300005937 Ga0081455_10009417 Ga0081455_100094172 210
1066 3300005937 Ga0081455_10011785 Ga0081455_100117851 210
1067 3300005937 Ga0081455_10031626 Ga0081455_100316263 210
1068 3300005937 Ga0081455_10150081 Ga0081455_101500811 210
1069 3300005981 Ga0081538_10014997 Ga0081538_100149972 210
1070 3300005983 Ga0081540_1000084 Ga0081540_100008494 210
1071 3300005983 Ga0081540_1006336 Ga0081540_10063364 210
1072 3300005985 Ga0081539_10001242 Ga0081539_1000124241 210
1073 3300006028 Ga0070717_10011325 Ga0070717_100113252 210
1074 3300006028 Ga0070717_10542758 Ga0070717_105427582 210
1075 3300006038 Ga0075365_10007385 Ga0075365_100073854 210
1076 3300006051 Ga0075364_10037238 Ga0075364_100372384 210
1077 3300006051 Ga0075364_10119025 Ga0075364_101190251 210
1078 3300006163 Ga0070715_10026969 Ga0070715_100269692 210
1079 3300006173 Ga0070716_100064781 Ga0070716_1000647812 210
1080 3300006173 Ga0070716_100192512 Ga0070716_1001925122 210
1081 3300006175 Ga0070712_100007908 Ga0070712_1000079086 210
1082 3300006175 Ga0070712_100053418 Ga0070712_1000534183 210
1083 3300006178 Ga0075367_10001182 Ga0075367_1000118210 210
1084 3300006195 Ga0075366_10047689 Ga0075366_100476892 210
1085 3300006237 Ga0097621_100027665 Ga0097621_1000276653 210
1086 3300006353 Ga0075370_10218044 Ga0075370_102180441 210
1087 3300006353 Ga0075370_10514585 Ga0075370_105145851 210
1088 3300006358 Ga0068871_100000007 Ga0068871_10000000791 210
1089 3300006844 Ga0075428_100042957 Ga0075428_1000429572 210
1090 3300006844 Ga0075428_100437757 Ga0075428_1004377572 210
1091 3300006844 Ga0075428_100462230 Ga0075428_1004622301 210
1092 3300006846 Ga0075430_100020750 Ga0075430_1000207504 210
1093 3300006846 Ga0075430_100071953 Ga0075430_1000719533 210
1094 3300006846 Ga0075430_100124197 Ga0075430_1001241973 210
1095 3300006846 Ga0075430_100267441 Ga0075430_1002674412 210
1096 3300006846 Ga0075430_100282281 Ga0075430_1002822812 210
1097 3300006847 Ga0075431_100000490 Ga0075431_10000049016 210
1098 3300006847 Ga0075431_100038722 Ga0075431_1000387221 210
1099 3300006852 Ga0075433_10355899 Ga0075433_103558992 210
1100 3300006852 Ga0075433_10434967 Ga0075433_104349671 210
1101 3300006871 Ga0075434_100000210 Ga0075434_10000021032 210
1102 3300006871 Ga0075434_100213339 Ga0075434_1002133391 210
1103 3300006871 Ga0075434_100979375 Ga0075434_1009793752 210
1104 3300006880 Ga0075429_100096671 Ga0075429_1000966712 210
1105 3300006881 Ga0068865_100003045 Ga0068865_1000030452 210
1106 3300006881 Ga0068865_100105866 Ga0068865_1001058662 210
1107 3300006931 Ga0097620_100003063 Ga0097620_10000306311 210
1108 3300006931 Ga0097620_100011140 Ga0097620_1000111403 210
1109 3300006931 Ga0097620_100022056 Ga0097620_1000220562 210
1110 3300007076 Ga0075435_100050798 Ga0075435_1000507983 210
1111 3300007076 Ga0075435_100496115 Ga0075435_1004961152 210
1112 3300007265 Ga0099794_10023487 Ga0099794_100234872 210
1113 3300009036 Ga0105244_10067676 Ga0105244_100676762 210
1114 3300009093 Ga0105240_10033215 Ga0105240_100332153 210
1115 3300009093 Ga0105240_10622425 Ga0105240_106224252 210
1116 3300009094 Ga0111539_10000241 Ga0111539_1000024156 210
1117 3300009094 Ga0111539_10004570 Ga0111539_1000457011 210
1118 3300009098 Ga0105245_10003072 Ga0105245_100030727 210
1119 3300009098 Ga0105245_10203534 Ga0105245_102035343 210
1120 3300009098 Ga0105245_10271041 Ga0105245_102710411 210
1121 3300009101 Ga0105247_10006526 Ga0105247_100065266 210
1122 3300009147 Ga0114129_10055205 Ga0114129_100552053 210
1123 3300009147 Ga0114129_10256259 Ga0114129_102562593 210
1124 3300009147 Ga0114129_10363720 Ga0114129_103637201 210
1125 3300009147 Ga0114129_10668008 Ga0114129_106680082 210
1126 3300009148 Ga0105243_10008450 Ga0105243_100084508 210
1127 3300009148 Ga0105243_10044771 Ga0105243_100447714 210
1128 3300009148 Ga0105243_10391965 Ga0105243_103919652 210
1129 3300009174 Ga0105241_10008483 Ga0105241_100084836 210
1130 3300009174 Ga0105241_10320929 Ga0105241_103209292 210
1131 3300009176 Ga0105242_10002788 Ga0105242_100027883 210
1132 3300009177 Ga0105248_10001294 Ga0105248_1000129420 210
1133 3300009177 Ga0105248_10020876 Ga0105248_100208763 210
1134 3300009177 Ga0105248_10326537 Ga0105248_103265373 210
1135 3300009177 Ga0105248_10828770 Ga0105248_108287701 210
1136 3300009177 Ga0105248_10992440 Ga0105248_109924402 210
1137 3300009177 Ga0105248_10996968 Ga0105248_109969681 210
1138 3300009545 Ga0105237_10021978 Ga0105237_100219784 210
1139 3300009545 Ga0105237_10068514 Ga0105237_100685144 210
1140 3300009551 Ga0105238_10080671 Ga0105238_100806712 210
1141 3300009553 Ga0105249_10000318 Ga0105249_1000031841 210
1142 3300009553 Ga0105249_10040389 Ga0105249_100403894 210
1143 3300009553 Ga0105249_10147042 Ga0105249_101470424 210
1144 3300010159 Ga0099796_10103924 Ga0099796_101039242 210
1145 3300010375 Ga0105239_10007212 Ga0105239_100072123 210
1146 3300011119 Ga0105246_10104775 Ga0105246_101047752 210
1147 3300011119 Ga0105246_10301814 Ga0105246_103018142 210
1148 3300013100 Ga0157373_10005714 Ga0157373_100057149 210
1149 3300013102 Ga0157371_10006511 Ga0157371_100065116 210
1150 3300013102 Ga0157371_10065596 Ga0157371_100655963 210
1151 3300013102 Ga0157371_10210638 Ga0157371_102106382 210
1152 3300013104 Ga0157370_10148143 Ga0157370_101481432 210
1153 3300013105 Ga0157369_10180080 Ga0157369_101800802 210
1154 3300013296 Ga0157374_10004984 Ga0157374_100049842 210
1155 3300013297 Ga0157378_10002119 Ga0157378_100021195 210
1156 3300013306 Ga0163162_10000416 Ga0163162_100004162 210
1157 3300013306 Ga0163162_10606839 Ga0163162_106068392 210
1158 3300013307 Ga0157372_10074316 Ga0157372_100743162 210
1159 3300013308 Ga0157375_10000571 Ga0157375_1000057111 210
1160 3300013308 Ga0157375_10124089 Ga0157375_101240893 210
1161 3300014325 Ga0163163_10000673 Ga0163163_1000067310 210
1162 3300014325 Ga0163163_10019035 Ga0163163_100190353 210
1163 3300014325 Ga0163163_10192121 Ga0163163_101921212 210
1164 3300014326 Ga0157380_10000115 Ga0157380_1000011537 210
1165 3300014326 Ga0157380_10104172 Ga0157380_101041722 210
1166 3300014497 Ga0182008_10137658 Ga0182008_101376581 210
1167 3300014745 Ga0157377_10000086 Ga0157377_1000008667 210
1168 3300014968 Ga0157379_10003187 Ga0157379_100031876 210
1169 3300014969 Ga0157376_10000253 Ga0157376_1000025340 210
1170 3300017792 Ga0163161_10000920 Ga0163161_100009209 210
1171 3300017792 Ga0163161_10403726 Ga0163161_104037262 210
1172 3300021361 Ga0213872_10033976 Ga0213872_100339761 210
1173 3300025271 Ga0207666_1000007 Ga0207666_100000719 210
1174 3300025290 Ga0207673_1001891 Ga0207673_10018912 210
1175 3300025297 Ga0209758_1000628 Ga0209758_100062820 210
1176 3300025315 Ga0207697_10000083 Ga0207697_1000008336 210
1177 3300025315 Ga0207697_10002626 Ga0207697_100026268 210
1178 3300025885 Ga0207653_10004560 Ga0207653_100045605 210
1179 3300025885 Ga0207653_10014043 Ga0207653_100140432 210
1180 3300025885 Ga0207653_10018311 Ga0207653_100183112 210
1181 3300025893 Ga0207682_10000002 Ga0207682_1000000288 210
1182 3300025898 Ga0207692_10016939 Ga0207692_100169392 210
1183 3300025899 Ga0207642_10006692 Ga0207642_100066924 210
1184 3300025899 Ga0207642_10063769 Ga0207642_100637692 210
1185 3300025900 Ga0207710_10048185 Ga0207710_100481852 210
1186 3300025901 Ga0207688_10000102 Ga0207688_1000010227 210
1187 3300025901 Ga0207688_10033970 Ga0207688_100339702 210
1188 3300025903 Ga0207680_10026688 Ga0207680_100266882 210
1189 3300025904 Ga0207647_10002077 Ga0207647_100020777 210
1190 3300025904 Ga0207647_10044983 Ga0207647_100449832 210
1191 3300025905 Ga0207685_10207590 Ga0207685_102075901 210
1192 3300025906 Ga0207699_10135505 Ga0207699_101355051 210
1193 3300025906 Ga0207699_10151620 Ga0207699_101516202 210
1194 3300025906 Ga0207699_10283666 Ga0207699_102836662 210
1195 3300025907 Ga0207645_10000026 Ga0207645_1000002684 210
1196 3300025908 Ga0207643_10000003 Ga0207643_1000000330 210
1197 3300025909 Ga0207705_10162514 Ga0207705_101625142 210
1198 3300025910 Ga0207684_10176984 Ga0207684_101769842 210
1199 3300025911 Ga0207654_10151032 Ga0207654_101510322 210
1200 3300025912 Ga0207707_10000915 Ga0207707_1000091528 210
1201 3300025912 Ga0207707_10011845 Ga0207707_100118458 210
1202 3300025912 Ga0207707_10015675 Ga0207707_100156753 210
1203 3300025912 Ga0207707_10066751 Ga0207707_100667511 210
1204 3300025912 Ga0207707_10068811 Ga0207707_100688112 210
1205 3300025912 Ga0207707_10191118 Ga0207707_101911182 210
1206 3300025913 Ga0207695_10210044 Ga0207695_102100442 210
1207 3300025914 Ga0207671_10040624 Ga0207671_100406242 210
1208 3300025915 Ga0207693_10012876 Ga0207693_100128762 210
1209 3300025915 Ga0207693_10044663 Ga0207693_100446633 210
1210 3300025915 Ga0207693_10128186 Ga0207693_101281862 210
1211 3300025917 Ga0207660_10002152 Ga0207660_1000215213 210
1212 3300025917 Ga0207660_10006601 Ga0207660_100066011 210
1213 3300025917 Ga0207660_10037127 Ga0207660_100371272 210
1214 3300025917 Ga0207660_10373490 Ga0207660_103734902 210
1215 3300025917 Ga0207660_10375492 Ga0207660_103754922 210
1216 3300025918 Ga0207662_10000297 Ga0207662_1000029713 210
1217 3300025918 Ga0207662_10004102 Ga0207662_100041026 210
1218 3300025918 Ga0207662_10094397 Ga0207662_100943973 210
1219 3300025918 Ga0207662_10123450 Ga0207662_101234502 210
1220 3300025919 Ga0207657_10000840 Ga0207657_1000084035 210
1221 3300025919 Ga0207657_10051879 Ga0207657_100518791 210
1222 3300025919 Ga0207657_10063231 Ga0207657_100632313 210
1223 3300025919 Ga0207657_10429430 Ga0207657_104294301 210
1224 3300025920 Ga0207649_10000054 Ga0207649_1000005453 210
1225 3300025921 Ga0207652_10000059 Ga0207652_1000005993 210
1226 3300025921 Ga0207652_10080562 Ga0207652_100805622 210
1227 3300025921 Ga0207652_10114695 Ga0207652_101146951 210
1228 3300025921 Ga0207652_10178809 Ga0207652_101788092 210
1229 3300025923 Ga0207681_10000118 Ga0207681_100001186 210
1230 3300025923 Ga0207681_10237775 Ga0207681_102377752 210
1231 3300025923 Ga0207681_10520000 Ga0207681_105200001 210
1232 3300025924 Ga0207694_10155969 Ga0207694_101559691 210
1233 3300025925 Ga0207650_10002861 Ga0207650_100028614 210
1234 3300025926 Ga0207659_10000015 Ga0207659_1000001511 210
1235 3300025926 Ga0207659_10245404 Ga0207659_102454043 210
1236 3300025927 Ga0207687_10000050 Ga0207687_1000005028 210
1237 3300025928 Ga0207700_10010739 Ga0207700_100107394 210
1238 3300025931 Ga0207644_10002278 Ga0207644_1000227813 210
1239 3300025932 Ga0207690_10000146 Ga0207690_1000014653 210
1240 3300025933 Ga0207706_10001170 Ga0207706_100011708 210
1241 3300025933 Ga0207706_10086856 Ga0207706_100868562 210
1242 3300025933 Ga0207706_10467939 Ga0207706_104679391 210
1243 3300025934 Ga0207686_10000256 Ga0207686_1000025624 210
1244 3300025935 Ga0207709_10000352 Ga0207709_1000035241 210
1245 3300025935 Ga0207709_10075967 Ga0207709_100759672 210
1246 3300025935 Ga0207709_10125977 Ga0207709_101259772 210
1247 3300025936 Ga0207670_10000073 Ga0207670_1000007354 210
1248 3300025936 Ga0207670_10064591 Ga0207670_100645913 210
1249 3300025936 Ga0207670_10077184 Ga0207670_100771843 210
1250 3300025937 Ga0207669_10000008 Ga0207669_10000008151 210
1251 3300025937 Ga0207669_10278542 Ga0207669_102785422 210
1252 3300025938 Ga0207704_10000031 Ga0207704_1000003125 210
1253 3300025938 Ga0207704_10027994 Ga0207704_100279942 210
1254 3300025938 Ga0207704_10061059 Ga0207704_100610593 210
1255 3300025939 Ga0207665_10101203 Ga0207665_101012032 210
1256 3300025939 Ga0207665_10484688 Ga0207665_104846881 210
1257 3300025940 Ga0207691_10001871 Ga0207691_100018712 210
1258 3300025940 Ga0207691_10275318 Ga0207691_102753182 210
1259 3300025941 Ga0207711_10000478 Ga0207711_1000047825 210
1260 3300025941 Ga0207711_10232511 Ga0207711_102325111 210
1261 3300025941 Ga0207711_10308894 Ga0207711_103088943 210
1262 3300025941 Ga0207711_10574762 Ga0207711_105747621 210
1263 3300025941 Ga0207711_11196811 Ga0207711_111968111 210
1264 3300025942 Ga0207689_10000040 Ga0207689_1000004041 210
1265 3300025942 Ga0207689_10207899 Ga0207689_102078992 210
1266 3300025942 Ga0207689_10614975 Ga0207689_106149751 210
1267 3300025944 Ga0207661_10000474 Ga0207661_1000047416 210
1268 3300025945 Ga0207679_10000014 Ga0207679_1000001492 210
1269 3300025945 Ga0207679_10087176 Ga0207679_100871762 210
1270 3300025949 Ga0207667_10021163 Ga0207667_100211636 210
1271 3300025960 Ga0207651_10000317 Ga0207651_100003177 210
1272 3300025960 Ga0207651_10195942 Ga0207651_101959422 210
1273 3300025961 Ga0207712_10000777 Ga0207712_1000077718 210
1274 3300025961 Ga0207712_10118368 Ga0207712_101183681 210
1275 3300025972 Ga0207668_10000037 Ga0207668_1000003714 210
1276 3300025981 Ga0207640_10000444 Ga0207640_1000044426 210
1277 3300025986 Ga0207658_10001424 Ga0207658_1000142413 210
1278 3300025986 Ga0207658_10263681 Ga0207658_102636811 210
1279 3300026035 Ga0207703_10006289 Ga0207703_100062895 210
1280 3300026035 Ga0207703_10077635 Ga0207703_100776353 210
1281 3300026041 Ga0207639_10001125 Ga0207639_100011258 210
1282 3300026041 Ga0207639_10269303 Ga0207639_102693031 210
1283 3300026067 Ga0207678_10033669 Ga0207678_100336695 210
1284 3300026067 Ga0207678_10104818 Ga0207678_101048182 210
1285 3300026075 Ga0207708_10000368 Ga0207708_1000036811 210
1286 3300026075 Ga0207708_10005217 Ga0207708_100052171 210
1287 3300026075 Ga0207708_10038284 Ga0207708_100382842 210
1288 3300026075 Ga0207708_10354640 Ga0207708_103546402 210
1289 3300026078 Ga0207702_10006393 Ga0207702_100063933 210
1290 3300026088 Ga0207641_10000272 Ga0207641_1000027225 210
1291 3300026088 Ga0207641_10306245 Ga0207641_103062451 210
1292 3300026089 Ga0207648_10000516 Ga0207648_100005162 210
1293 3300026089 Ga0207648_10068728 Ga0207648_100687282 210
1294 3300026089 Ga0207648_10098242 Ga0207648_100982423 210
1295 3300026095 Ga0207676_10047276 Ga0207676_100472761 210
1296 3300026095 Ga0207676_10050277 Ga0207676_100502773 210
1297 3300026095 Ga0207676_10103167 Ga0207676_101031672 210
1298 3300026116 Ga0207674_10000555 Ga0207674_100005557 210
1299 3300026116 Ga0207674_10002061 Ga0207674_100020611 210
1300 3300026116 Ga0207674_10053024 Ga0207674_100530244 210
1301 3300026118 Ga0207675_100000404 Ga0207675_10000040411 210
1302 3300026118 Ga0207675_100166482 Ga0207675_1001664822 210
1303 3300026118 Ga0207675_101252391 Ga0207675_1012523912 210
1304 3300026121 Ga0207683_10000002 Ga0207683_10000002133 210
1305 3300026121 Ga0207683_10153365 Ga0207683_101533652 210
1306 3300026142 Ga0207698_10264042 Ga0207698_102640421 210
1307 3300027252 Ga0209973_1018188 Ga0209973_10181881 210
1308 3300027462 Ga0210000_1004283 Ga0210000_10042832 210
1309 3300027617 Ga0210002_1000129 Ga0210002_10001294 210
1310 3300027617 Ga0210002_1009031 Ga0210002_10090313 210
1311 3300027671 Ga0209588_1033721 Ga0209588_10337212 210
1312 3300027695 Ga0209966_1000723 Ga0209966_10007235 210
1313 3300027717 Ga0209998_10002298 Ga0209998_100022984 210
1314 3300027717 Ga0209998_10005159 Ga0209998_100051592 210
1315 3300027866 Ga0209813_10019315 Ga0209813_100193151 210
1316 3300027876 Ga0209974_10002156 Ga0209974_100021562 210
1317 3300027907 Ga0207428_10000011 Ga0207428_10000011169 210
1318 3300027907 Ga0207428_10000046 Ga0207428_1000004611 210
1319 3300027907 Ga0207428_10006150 Ga0207428_100061502 210
1320 3300028379 Ga0268266_10029581 Ga0268266_100295811 210
1321 3300028380 Ga0268265_10000476 Ga0268265_1000047620 210
1322 3300028380 Ga0268265_10025158 Ga0268265_100251581 210
1323 3300028381 Ga0268264_10001990 Ga0268264_100019908 210
1324 3300028381 Ga0268264_10017122 Ga0268264_100171227 210
1325 3300028800 Ga0265338_10049984 Ga0265338_100499843 210
1326 3300031090 Ga0265760_10044903 Ga0265760_100449032 210
1327 3300031241 Ga0265325_10001355 Ga0265325_1000135514 210
1328 3300031241 Ga0265325_10008226 Ga0265325_100082264 210
1329 3300031241 Ga0265325_10039894 Ga0265325_100398943 210
1330 3300031249 Ga0265339_10001156 Ga0265339_100011564 210
1331 3300031250 Ga0265331_10010104 Ga0265331_100101044 210
1332 3300031344 Ga0265316_10154410 Ga0265316_101544101 210
1333 3300031595 Ga0265313_10000302 Ga0265313_1000030250 210
1334 3300031595 Ga0265313_10115968 Ga0265313_101159682 210
1335 3300034816 Ga0373930_0000166 Ga0373930_0000166_6817_7449 210
1336 3300034819 Ga0373958_0001352 Ga0373958_0001352_997_1629 210
1337 3300034819 Ga0373958_0012052 Ga0373958_0012052_756_1445 210
1338 3300034820 Ga0373959_0002250 Ga0373959_0002250_1749_2381 210
1339 3300034820 Ga0373959_0005842 Ga0373959_0005842_1257_1994 210
1340 3300034957 Ga0373938_0000070 Ga0373938_0000070_7761_8393 210
1341 3300034957 Ga0373938_0002545 Ga0373938_0002545_1295_2032 210
1342 3300035084 Ga0373928_0000143 Ga0373928_0000143_1089_1721 210
1343 3300035085 Ga0373929_0000468 Ga0373929_0000468_3225_3857 210
1344 3300035088 Ga0373940_0001717 Ga0373940_0001717_3224_3856 210
1345 3300035090 Ga0373949_0002572 Ga0373949_0002572_3804_4436 210
1346 3300035090 Ga0373949_0015960 Ga0373949_0015960_965_1654 210
1347 3300035091 Ga0373951_0001200 Ga0373951_0001200_4067_4699 210
1348 3300035092 Ga0373952_0000075 Ga0373952_0000075_10034_10666 210
1349 3300035111 Ga0373923_0042490 Ga0373923_0042490_481_1113 210
1350 3300035112 Ga0373932_0000208 Ga0373932_0000208_13360_13992 210
1351 3300035113 Ga0373936_0006899 Ga0373936_0006899_321_953 210
1352 3300035114 Ga0373939_0008023 Ga0373939_0008023_496_1128 210
1353 3300035115 Ga0373941_0042221 Ga0373941_0042221_281_1018 210
1354 3300035118 Ga0373954_0049015 Ga0373954_0049015_442_1074 210
1355 3300035119 Ga0373956_0091007 Ga0373956_0091007_556_1188 210
1356 3300035120 Ga0373957_0026220 Ga0373957_0026220_70_702 210
1357 3300035121 Ga0373960_0000295 Ga0373960_0000295_8055_8687 210
1358 3300035121 Ga0373960_0007802 Ga0373960_0007802_1182_1919 210
1359 3300035170 Ga0373943_0004846 Ga0373943_0004846_3556_4188 210
1360 3300035171 Ga0373946_0007088 Ga0373946_0007088_2560_3192 210
1361 3300035172 Ga0373955_0006403 Ga0373955_0006403_133_765 210
1362 3300035172 Ga0373955_0090830 Ga0373955_0090830_369_1001 210
1363 3300035172 Ga0373955_0135028 Ga0373955_0135028_79_711 210
1364 3300035241 Ga0373961_0023763 Ga0373961_0023763_194_931 210
1365 3300035242 Ga0373962_0001251 Ga0373962_0001251_4291_4923 210
1366 3300035691 Ga0373931_0000081 Ga0373931_0000081_42798_43535 210
1367 3300035691 Ga0373931_0039252 Ga0373931_0039252_848_1480 210
1368 3300035691 Ga0373931_0279431 Ga0373931_0279431_241_873 210
1369 3300035692 Ga0373935_0013636 Ga0373935_0013636_966_1598 210
1370 3300035692 Ga0373935_0050009 Ga0373935_0050009_1066_1698 210
1371 3300035692 Ga0373935_0288808 Ga0373935_0288808_127_759 210
1372 3300035695 Ga0373927_0000892 Ga0373927_0000892_9414_10046 210
1373 3300035724 Ga0373933_0123379 Ga0373933_0123379_214_846 210
1374 3300035725 Ga0373947_0000629 Ga0373947_0000629_12160_12792 210
1375 3300035725 Ga0373947_0129392 Ga0373947_0129392_844_1476 210
1376 3300035725 Ga0373947_0266628 Ga0373947_0266628_290_922 210
1377 3300036401 Ga0373937_0002827 Ga0373937_0002827_8243_8875 210
1378 3300036401 Ga0373937_0688940 Ga0373937_0688940_171_803 210
1379 3300037068 Ga0373925_0020779 Ga0373925_0020779_728_1360 210
1380 3300037068 Ga0373925_0083515 Ga0373925_0083515_68_700 210
1381 3300037068 Ga0373925_0247632 Ga0373925_0247632_198_830 210
1382 3300038443 Ga0395901_0129376 Ga0395901_0129376_326_958 210
1383 3300039437 Ga0436365_1182988 Ga0436365_1182988_139_771 210
1384 3300039438 Ga0436360_0477775 Ga0436360_0477775_203_835 210
1385 3300039438 Ga0436360_0800279 Ga0436360_0800279_117_749 210
1386 3300039447 Ga0436361_0795962 Ga0436361_0795962_1324_1956 210
1387 3300041501 Ga0451845_0108344 Ga0451845_0108344_134_766 210
1388 3300042012 Ga0439455_0003723 Ga0439455_0003723_1251_1883 210
1389 3300042012 Ga0439455_0060335 Ga0439455_0060335_75_707 210
1390 3300044684 Ga0466966_0227391 Ga0466966_0227391_270_902 210
1391 3300044694 Ga0466963_0193158 Ga0466963_0193158_596_1228 210
1392 3300044712 Ga0453684_0418992 Ga0453684_0418992_173_805 210
1393 3300044719 Ga0466971_0058939 Ga0466971_0058939_25_657 210
1394 3300044842 Ga0466957_0349276 Ga0466957_0349276_16_648 210
1395 3300045049 Ga0466959_0049370 Ga0466959_0049370_1052_1684 210
1396 3300045836 Ga0466958_0047377 Ga0466958_0047377_1413_2045 210
1397 3300046454 Ga0495592_0130313 Ga0495592_0130313_451_1089 210
1398 3300046460 Ga0495638_0073312 Ga0495638_0073312_873_1505 210
1399 3300046462 Ga0495651_0404184 Ga0495651_0404184_112_744 210
1400 3300046463 Ga0495653_0124946 Ga0495653_0124946_554_1186 210
1401 3300046476 Ga0495662_0058271 Ga0495662_0058271_719_1351 210
1402 3300046476 Ga0495662_0161045 Ga0495662_0161045_20_652 210
1403 3300046511 Ga0495608_0104491 Ga0495608_0104491_1129_1761 210
1404 3300046514 Ga0495618_0072190 Ga0495618_0072190_867_1499 210
1405 3300046514 Ga0495618_0225342 Ga0495618_0225342_63_695 210
1406 3300046517 Ga0495630_0065815 Ga0495630_0065815_1370_2002 210
1407 3300046522 Ga0495643_0310480 Ga0495643_0310480_63_695 210
1408 3300046526 Ga0495666_0197495 Ga0495666_0197495_61_693 210
1409 3300046529 Ga0495652_0130358 Ga0495652_0130358_1018_1650 210
1410 3300046531 Ga0495665_0044141 Ga0495665_0044141_286_918 210
1411 3300046533 Ga0495640_0031082 Ga0495640_0031082_552_1184 210
1412 3300046533 Ga0495640_0087567 Ga0495640_0087567_684_1316 210
1413 3300046536 Ga0495587_0047442 Ga0495587_0047442_1501_2133 210
1414 3300046543 Ga0495645_0048417 Ga0495645_0048417_251_883 210
1415 3300046559 Ga0495667_0022412 Ga0495667_0022412_3588_4220 210
1416 3300046559 Ga0495667_0165211 Ga0495667_0165211_753_1385 210
1417 3300046615 Ga0495656_0213277 Ga0495656_0213277_112_744 210
1418 3300046642 Ga0495634_0038394 Ga0495634_0038394_414_1046 210
1419 3300046663 Ga0495635_0093869 Ga0495635_0093869_626_1258 210
1420 3300046675 Ga0495657_0065357 Ga0495657_0065357_1563_2195 210
1421 3300046681 Ga0495647_0042270 Ga0495647_0042270_642_1274 210
1422 3300046683 Ga0495658_0118798 Ga0495658_0118798_918_1550 210
1423 3300046684 Ga0495669_0137838 Ga0495669_0137838_390_1127 210
1424 3300046689 Ga0495613_0049090 Ga0495613_0049090_1042_1674 210
1425 3300046690 Ga0495624_0009657 Ga0495624_0009657_5887_6519 210
1426 3300046690 Ga0495624_0061491 Ga0495624_0061491_1609_2241 210
1427 3300047315 Ga0495581_0026170 Ga0495581_0026170_1678_2310 210
1428 3300047317 Ga0495604_0083771 Ga0495604_0083771_64_696 210
1429 3300047317 Ga0495604_0162681 Ga0495604_0162681_791_1423 210
1430 3300047319 Ga0495674_0188831 Ga0495674_0188831_1053_1685 210
1431 3300047321 Ga0495676_0030302 Ga0495676_0030302_3088_3720 210
1432 3300047322 Ga0495680_0019006 Ga0495680_0019006_36_668 210
1433 3300047444 Ga0495675_0044659 Ga0495675_0044659_1598_2230 210
1434 3300047444 Ga0495675_0147576 Ga0495675_0147576_443_1075 210
1435 3300047471 Ga0495684_0113668 Ga0495684_0113668_691_1323 210
1436 3300047471 Ga0495684_0519522 Ga0495684_0519522_128_760 210
1437 3300048088 Ga0495602_0299977 Ga0495602_0299977_407_1039 210
1438 3300048088 Ga0495602_0348098 Ga0495602_0348098_112_744 210
1439 3300048088 Ga0495602_0526817 Ga0495602_0526817_144_776 210
1440 3300048089 Ga0495614_0061249 Ga0495614_0061249_879_1511 210
1441 3300048903 Ga0496100_0000297 Ga0496100_0000297_16535_17272 210
1442 3300048904 Ga0496101_0000061 Ga0496101_0000061_60913_61650 210
1443 3300048905 Ga0496102_0005986 Ga0496102_0005986_9105_9737 210
1444 3300048905 Ga0496102_0122050 Ga0496102_0122050_338_970 210
1445 3300048905 Ga0496102_0533190 Ga0496102_0533190_52_789 210
1446 3300048905 Ga0496102_0691363 Ga0496102_0691363_80_712 210
1447 3300048906 Ga0496103_0001510 Ga0496103_0001510_14519_15256 210
1448 3300048907 Ga0496104_0060060 Ga0496104_0060060_2284_2916 210
1449 3300048908 Ga0496105_0037915 Ga0496105_0037915_2828_3460 210
1450 3300048909 Ga0496106_0000690 Ga0496106_0000690_180_917 210
1451 3300048909 Ga0496106_0002107 Ga0496106_0002107_625_1257 210
1452 3300048909 Ga0496106_0023158 Ga0496106_0023158_2308_2940 210
1453 3300048910 Ga0496107_0000308 Ga0496107_0000308_6122_6859 210
1454 3300048910 Ga0496107_0012301 Ga0496107_0012301_3916_4548 210
1455 3300048910 Ga0496107_0089197 Ga0496107_0089197_1595_2227 210
1456 3300048910 Ga0496107_0168554 Ga0496107_0168554_384_1016 210
1457 3300048910 Ga0496107_0556306 Ga0496107_0556306_59_691 210
1458 3300048910 Ga0496107_0736391 Ga0496107_0736391_29_661 210
1459 3300048911 Ga0496108_0001212 Ga0496108_0001212_8501_9133 210
1460 3300048911 Ga0496108_0005567 Ga0496108_0005567_6074_6811 210
1461 3300048911 Ga0496108_0170681 Ga0496108_0170681_487_1119 210
1462 3300048911 Ga0496108_0218387 Ga0496108_0218387_20_652 210
1463 3300048912 Ga0496109_0000530 Ga0496109_0000530_27184_27921 210
1464 3300048912 Ga0496109_0002514 Ga0496109_0002514_14221_14853 210
1465 3300048912 Ga0496109_0081939 Ga0496109_0081939_1743_2375 210
1466 3300048912 Ga0496109_1083222 Ga0496109_1083222_69_701 210
1467 3300048913 Ga0496110_0049062 Ga0496110_0049062_217_849 210
1468 3300048913 Ga0496110_0136067 Ga0496110_0136067_88_720 210
1469 3300048913 Ga0496110_0622554 Ga0496110_0622554_272_907 210
1470 3300048914 Ga0496111_0094817 Ga0496111_0094817_302_934 210
1471 3300048914 Ga0496111_0534812 Ga0496111_0534812_155_787 210
1472 3300048915 Ga0496112_0001311 Ga0496112_0001311_922_1554 210
1473 3300048916 Ga0496113_0000122 Ga0496113_0000122_8974_9606 210
1474 3300048916 Ga0496113_0085203 Ga0496113_0085203_628_1365 210
1475 3300048917 Ga0496114_0435153 Ga0496114_0435153_495_1127 210
1476 3300048918 Ga0496115_0003537 Ga0496115_0003537_584_1321 210
1477 3300048918 Ga0496115_0052144 Ga0496115_0052144_29_661 210
1478 3300048918 Ga0496115_0160652 Ga0496115_0160652_630_1262 210
1479 3300049571 Ga0501034_0058928 Ga0501034_0058928_2047_2679 210
1480 3300049571 Ga0501034_0327423 Ga0501034_0327423_668_1300 210
1481 3300049571 Ga0501034_0996745 Ga0501034_0996745_22_654 210
1482 3300049576 Ga0501040_0227213 Ga0501040_0227213_310_1089 210
1483 3300049578 Ga0501042_0411598 Ga0501042_0411598_207_839 210
1484 3300049579 Ga0501043_0177763 Ga0501043_0177763_570_1202 210
1485 3300049580 Ga0501046_0087403 Ga0501046_0087403_1177_1857 210
1486 3300049580 Ga0501046_0333857 Ga0501046_0333857_240_875 210
1487 3300049585 Ga0501069_0032938 Ga0501069_0032938_888_1520 210
1488 3300049587 Ga0501071_0222279 Ga0501071_0222279_137_769 210
1489 3300049588 Ga0501072_0046653 Ga0501072_0046653_162_794 210
1490 3300049591 Ga0501075_0089053 Ga0501075_0089053_654_1289 210
1491 3300049591 Ga0501075_0253892 Ga0501075_0253892_144_776 210
1492 3300049591 Ga0501075_0633591 Ga0501075_0633591_101_733 210
1493 3300049592 Ga0501076_0069172 Ga0501076_0069172_846_1478 210
1494 3300049592 Ga0501076_0207668 Ga0501076_0207668_600_1235 210
1495 3300049592 Ga0501076_0254157 Ga0501076_0254157_176_808 210
1496 3300049592 Ga0501076_0367708 Ga0501076_0367708_142_783 210
1497 3300049592 Ga0501076_1033087 Ga0501076_1033087_11_643 210
1498 3300049593 Ga0501077_0456183 Ga0501077_0456183_35_667 210
1499 3300049741 Ga0501079_0099398 Ga0501079_0099398_1010_1789 210
1500 3300049741 Ga0501079_0173214 Ga0501079_0173214_904_1536 210
1501 3300049741 Ga0501079_0227168 Ga0501079_0227168_505_1185 210
1502 3300049741 Ga0501079_0487161 Ga0501079_0487161_262_894 210
1503 3300049743 Ga0501081_0044633 Ga0501081_0044633_193_825 210
1504 3300049743 Ga0501081_0098465 Ga0501081_0098465_575_1255 210
1505 3300049823 Ga0501044_0983386 Ga0501044_0983386_51_683 210
1506 3300049824 Ga0501045_0286694 Ga0501045_0286694_544_1176 210
1507 3300050489 nmdc:mga03683_148949_c1 nmdc:mga03683_148949_c1_124_756 210
1508 3300050489 nmdc:mga03683_190664_c1 nmdc:mga03683_190664_c1_82_714 210
1509 3300050489 nmdc:mga03683_77367_c1 nmdc:mga03683_77367_c1_519_1151 210
1510 3300050492 nmdc:mga0yw44_297193_c1 nmdc:mga0yw44_297193_c1_305_937 210
1511 3300050492 nmdc:mga0yw44_51052_c1 nmdc:mga0yw44_51052_c1_1234_1866 210
1512 3300050492 nmdc:mga0yw44_80385_c1 nmdc:mga0yw44_80385_c1_1106_1738 210
1513 3300050494 nmdc:mga06z11_19298_c1 nmdc:mga06z11_19298_c1_815_1552 210
1514 3300050494 nmdc:mga06z11_487003_c1 nmdc:mga06z11_487003_c1_52_684 210
1515 3300050495 nmdc:mga04h51_23009_c1 nmdc:mga04h51_23009_c1_50_787 210
1516 3300050496 nmdc:mga07m45_365128_c1 nmdc:mga07m45_365128_c1_51_683 210
1517 3300050496 nmdc:mga07m45_50023_c1 nmdc:mga07m45_50023_c1_1543_2175 210
1518 3300050507 nmdc:mga05p37_269281_c1 nmdc:mga05p37_269281_c1_1174_1806 210
1519 3300050507 nmdc:mga05p37_90903_c1 nmdc:mga05p37_90903_c1_283_915 210
1520 3300050508 nmdc:mga09592_66746_c1 nmdc:mga09592_66746_c1_1160_1792 210
1521 3300050509 nmdc:mga0qj67_115598_c1 nmdc:mga0qj67_115598_c1_886_1518 210
1522 3300050509 nmdc:mga0qj67_50077_c1 nmdc:mga0qj67_50077_c1_859_1491 210
1523 3300050509 nmdc:mga0qj67_98813_c1 nmdc:mga0qj67_98813_c1_138_770 210
1524 3300050510 nmdc:mga06r32_151696_c1 nmdc:mga06r32_151696_c1_51_683 210
1525 3300050510 nmdc:mga06r32_36766_c1 nmdc:mga06r32_36766_c1_2120_2752 210
1526 3300050510 nmdc:mga06r32_40424_c1 nmdc:mga06r32_40424_c1_198_830 210
1527 3300050510 nmdc:mga06r32_45175_c1 nmdc:mga06r32_45175_c1_60_695 210
1528 3300050510 nmdc:mga06r32_482229_c1 nmdc:mga06r32_482229_c1_337_969 210
1529 3300050510 nmdc:mga06r32_755609_c1 nmdc:mga06r32_755609_c1_130_762 210
1530 3300050510 nmdc:mga06r32_865078_c1 nmdc:mga06r32_865078_c1_32_664 210
1531 3300050511 nmdc:mga08y16_1119643_c1 nmdc:mga08y16_1119643_c1_74_706 210
1532 3300050511 nmdc:mga08y16_1572_c1 nmdc:mga08y16_1572_c1_15860_16597 210
1533 3300050511 nmdc:mga08y16_26488_c1 nmdc:mga08y16_26488_c1_4600_5232 210
1534 3300050512 nmdc:mga0n895_1314457_c1 nmdc:mga0n895_1314457_c1_40_672 210
1535 3300050512 nmdc:mga0n895_1438_c1 nmdc:mga0n895_1438_c1_5036_5773 210
1536 3300050512 nmdc:mga0n895_462304_c1 nmdc:mga0n895_462304_c1_194_826 210
1537 3300050513 nmdc:mga0rr50_47749_c1 nmdc:mga0rr50_47749_c1_114_851 210
1538 3300050514 nmdc:mga08x19_152921_c1 nmdc:mga08x19_152921_c1_243_875 210
1539 3300050515 nmdc:mga0a205_155097_c1 nmdc:mga0a205_155097_c1_1523_2155 210
1540 3300050515 nmdc:mga0a205_549411_c1 nmdc:mga0a205_549411_c1_265_897 210
1541 3300050515 nmdc:mga0a205_5554_c3 nmdc:mga0a205_5554_c3_5070_5807 210
1542 3300050515 nmdc:mga0a205_989001_c1 nmdc:mga0a205_989001_c1_30_662 210
1543 3300053077 Ga0495601_0001456 Ga0495601_0001456_6976_7608 210
1544 3300053077 Ga0495601_0017524 Ga0495601_0017524_450_1082 210
1545 3300053077 Ga0495601_0019036 Ga0495601_0019036_1870_2502 210
1546 3300053077 Ga0495601_0108227 Ga0495601_0108227_782_1414 210
1547 3300053084 Ga0495595_0003527 Ga0495595_0003527_1484_2116 210
1548 3300053084 Ga0495595_0065099 Ga0495595_0065099_172_804 210
1549 3300053085 Ga0495619_0008776 Ga0495619_0008776_3589_4221 210
1550 3300053088 Ga0500644_0000657 Ga0500644_0000657_7054_7692 210
1551 3300053093 Ga0500651_0009740 Ga0500651_0009740_14_646 210
1552 3300053094 Ga0500566_0198516 Ga0500566_0198516_326_958 210
1553 3300053104 Ga0500556_0060741 Ga0500556_0060741_743_1375 210
1554 3300053119 Ga0500595_000006 Ga0500595_000006_283317_283949 210
1555 3300053120 Ga0500597_130598 Ga0500597_130598_303_935 210
1556 3300053130 Ga0500642_0176875 Ga0500642_0176875_189_821 210
1557 3300053131 Ga0500652_020511 Ga0500652_020511_24_656 210
1558 3300053153 Ga0500616_0000001 Ga0500616_0000001_221777_222409 210
1559 3300053730 Ga0500645_001371 Ga0500645_001371_11714_12352 210
1560 3300054114 Ga0501084_0120067 Ga0501084_0120067_934_1614 210
1561 3300054114 Ga0501084_0297949 Ga0501084_0297949_684_1325 210
1562 3300060353 Ga0501082_0571260 Ga0501082_0571260_22_654 210
1563 3300060353 Ga0501082_0784142 Ga0501082_0784142_19_651 210
1564 3300061734 Ga0530510_0033543 Ga0530510_0033543_187_819 210
1565 3300061734 Ga0530510_0043888 Ga0530510_0043888_596_1228 210
1566 3300061734 Ga0530510_0085310 Ga0530510_0085310_816_1451 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

49

125

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

57

126

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

171

235

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

53

130

0.85

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

153

240

0.84

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

156

246

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9698 2 201
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9672 2 201
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.964 3 197
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9639 1 197
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9624 1 196
ID Description Score Start End Superfamily
4eciA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9769 2 81 3.40.30.10
af_Q8SSU2_3_102_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9683 2 84 3.40.30.10
4puaA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9678 2 79 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.961 1 79 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9609 89 195 1.20.1050.130
ID Description Score Start End GO Terms
AF-A0A3D5DFL8-F1-model_v4 Glutathione S-transferase 0.9925 1 100 GO:0016740
AF-A0A7W0XLR5-F1-model_v4 Glutathione S-transferase N-terminal domain-containing protein 0.9917 1 209 GO:0016740
AF-A0A1X4NRF9-F1-model_v4 Glutathione S-transferase 0.9899 1 209 GO:0016740
AF-A0A6P0QDN6-F1-model_v4 deleted 0.9898 1 90
AF-A0A316L3X0-F1-model_v4 Glutathione S-transferase 0.9887 1 209 GO:0016740

Feature Viewer

pLDDT pTM Quality
95.63 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map