F494787

General Info

Members Datasets Scaffolds Average Seq Length
1564 573 1428 401

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0014163|Ga0453684_0014163_6214_7530
Length 438
Sequence LNQNNFDPQEDNHRSKFGTCFFLSLPPVGGEVWRGLQKNKIMKDKVVLAFSGGLDTSYCAKYLSVEKNLDVYTAIANTGGFTQSDLEAVEKKAYQLGAVKHVTLDVTDSYYEKSIKYMVFGNILRNNTYPISVSSERVFQAIAIIEYAKQIGAKYVAHGSTGAGNDQVRFDLTFQILAPEIGILTPTRDLELSRQEEIDYLKAHGVVADWKKMDYSINKGLWGTSIGGKETLKSNKTLPEEAYPSQLTQTEEKEITIDFIKGELKGVNGEVFENPVNAIRALEAVASPYAVGRDMHIGDTIIGIKGRVGFEAAAPIIAIKAHQMLEKHTLTKWQQYWKEQLGNWYGMFLHEALYFEPVMRDIEKFLEHSQENVTGKVIVKLKPYNFVLVGVESDHDLMRSEFGEYGEKNSAWTADDVKGFTKVLSTSLKIHNSVNHSF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
11 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
12 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
15 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
16 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
17 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
18 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
19 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
20 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
21 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
22 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
23 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
24 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
25 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
26 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
27 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
28 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
29 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
30 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
31 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
32 2738541278 Niastella sp. CF465 Isolate Unclassified
33 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
34 2738541283 Pedobacter sp. OK701 Isolate Unclassified
35 2738541284 Pedobacter sp. YR016 Isolate Unclassified
36 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
37 2738541302 Pedobacter sp. CF074 Isolate Unclassified
38 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
39 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
40 2738543023 Pedobacter sp. OK628 Isolate Unclassified
41 2739367651 Pedobacter sp. OK291 Isolate Unclassified
42 2739367656 Pedobacter sp. CF523 Isolate Unclassified
43 2739367663 Pedobacter sp. YR510 Isolate Unclassified
44 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
45 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
46 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
47 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
48 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
49 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
50 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
51 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
52 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
53 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
54 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
55 2818991437 Pedobacter terrae 518 Isolate Unclassified
56 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
57 2818991444 Filimonas endophytica 3197 Isolate Unclassified
58 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
59 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
60 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
61 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
62 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
63 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
64 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
65 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
66 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
67 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
68 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
69 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
70 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
71 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
72 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
73 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
74 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
75 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
76 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
77 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
78 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
79 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
80 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
81 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
82 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
83 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
84 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
85 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
86 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
87 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
88 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
89 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
90 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
91 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
92 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
93 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
94 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
95 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
96 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
97 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
98 2914759650 Rhizosphaericola mali Isolate Rhizosphere
99 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
100 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
101 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
102 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
103 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
104 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
105 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
106 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
107 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
108 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
109 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
110 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
111 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
112 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
113 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
114 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
115 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
116 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
117 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
118 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
119 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
120 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
121 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
122 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
123 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
124 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
125 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
126 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
127 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
128 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
129 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
130 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
131 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
132 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
133 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
134 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
135 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
136 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
137 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
138 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
139 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
140 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
141 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
142 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
143 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
144 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
145 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
146 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
147 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
148 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
149 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
150 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
151 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
152 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
153 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
154 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
155 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
156 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
157 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
158 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
159 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
160 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
161 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
164 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
165 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
166 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
167 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
168 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
169 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
170 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
171 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
172 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
173 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
178 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
179 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
180 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
181 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
182 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
185 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
186 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
187 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
188 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
189 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
190 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
191 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
195 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
196 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
197 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
198 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
199 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
200 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
201 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
202 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
203 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
206 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
207 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
208 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
209 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
210 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
211 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
212 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
213 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
214 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
215 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
216 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
217 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
218 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
219 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
220 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
221 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
222 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
223 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
224 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
226 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
227 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
228 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
229 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
230 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
231 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
232 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
233 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
234 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
235 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
236 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
237 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
238 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
239 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
240 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
241 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
242 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
243 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
244 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
245 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
246 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
247 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
248 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
249 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
250 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
251 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
252 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
253 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
254 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
255 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
256 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
257 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
258 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
259 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
260 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
261 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
262 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
263 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
264 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
265 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
266 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
267 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
268 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
269 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
270 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
271 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
273 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
275 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
276 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
277 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
279 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
280 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
281 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
283 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
284 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
294 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
353 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
354 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
355 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
360 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
361 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
362 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
363 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
364 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
365 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
366 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
367 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
368 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
369 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
370 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
371 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
372 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
373 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
374 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
375 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
376 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
377 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
378 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
379 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
380 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
381 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
382 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
383 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
384 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
385 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
386 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
387 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
388 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
389 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
390 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
391 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
392 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
393 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
394 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
395 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
396 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
397 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
398 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
399 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
400 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
401 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
402 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
403 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
404 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
405 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
406 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
407 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
408 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
409 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
410 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
411 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
412 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
413 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
414 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
415 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
416 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
417 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
418 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
419 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
420 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
421 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
422 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
423 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
424 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
425 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
426 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
427 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
428 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
429 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
430 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
431 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
432 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
433 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
434 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
435 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
436 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
437 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
438 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
439 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
440 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
441 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
442 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
443 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
444 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
445 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
446 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
447 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
448 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
449 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
450 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
451 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
452 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
453 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
454 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
455 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
456 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
457 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
458 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
459 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
460 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
461 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
462 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
463 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
464 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
465 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
466 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
467 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
468 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
469 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
470 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
471 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
472 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
473 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
474 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
475 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
476 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
477 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
478 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
479 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
480 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
485 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
486 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
487 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
495 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
496 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
498 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
499 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
507 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
508 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
509 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
510 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
511 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
512 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
513 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
514 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
515 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
516 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
517 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
518 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
519 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
520 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
521 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
522 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
523 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
524 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
525 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
526 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
527 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
528 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
529 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
530 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
531 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
532 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
533 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
534 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
535 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
536 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
537 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
538 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
539 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
540 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
541 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
542 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
543 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
544 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
545 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
546 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
547 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
548 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
549 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
550 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
551 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
552 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
553 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
554 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
555 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
556 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
557 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
558 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
559 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
560 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
561 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
562 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
563 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
564 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
565 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
566 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
567 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
568 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
569 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
570 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
571 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
572 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
573 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.79
Metatranscriptomes 0.45
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 7.1
Nodule 0.45
Rhizoplane 0.96
Rhizosphere 82.1
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663676 2162886007 Bacteria 241831
2 SwRhRL2b_contig_3047449 2162886007 Bacteria 1886
3 JGI24740J21852_10004979 3300001979 Bacteria 5644
4 JGI24740J21852_10006938 3300001979 Bacteria 4650
5 JGI24739J22299_10004155 3300001989 Bacteria 5539
6 JGI24739J22299_10005815 3300001989 Bacteria 4671
7 JGI24737J22298_10002176 3300001990 Bacteria 6977
8 JGI24735J21928_10000002 3300002067 Bacteria 624895
9 JGI24751J29686_10001013 3300002459 Bacteria 6158
10 JGI25162J39368_1000024 3300002737 Bacteria 229507
11 JGI25162J39368_1001318 3300002737 Bacteria 13921
12 JGI25154J39366_1000047 3300002738 Bacteria 126449
13 JGI25158J39367_1004804 3300002739 Bacteria 2011
14 JGI25157J39369_1002465 3300002741 Bacteria 4569
15 JGI25164J39214_1000855 3300002772 Bacteria 10454
16 JGI25152J39213_1000007 3300002773 Bacteria 156012
17 JGI25150J39212_1000013 3300002774 Bacteria 182307
18 JGI25151J46595_10000004 3300003187 Bacteria 494006
19 JGI25406J46586_10007660 3300003203 Bacteria 4912
20 JGI25153J46596_10000004 3300003215 Bacteria 494006
21 JGI25153J46596_10007229 3300003215 Bacteria 5497
22 rootH1_10001629 3300003316 Bacteria 29048
23 rootH1_10073809 3300003316 Bacteria 8113
24 rootH1_10160863 3300003316 Bacteria 2958
25 rootH2_10003246 3300003320 Bacteria 168239
26 rootH2_10005719 3300003320 Bacteria 108734
27 rootH2_10006783 3300003320 Bacteria 50422
28 rootH2_10061691 3300003320 Bacteria 2691
29 rootL2_10006109 3300003322 Bacteria 15155
30 rootL2_10018664 3300003322 Bacteria 7331
31 rootL2_10048389 3300003322 Bacteria 6120
32 rootL2_10058703 3300003322 Bacteria 2463
33 rootL2_10100931 3300003322 Bacteria 1931
34 rootL2_10108093 3300003322 Bacteria 1470
35 rootL2_10338439 3300003322 Bacteria 3243
36 rootH1_10002666 3300003323 Bacteria 23641
37 rootH1_10010261 3300003323 Bacteria 16255
38 rootH1_10010262 3300003323 Bacteria 7405
39 rootH1_10029472 3300003323 Bacteria 17623
40 rootH1_10030425 3300003316 Bacteria 1369
41 rootH1_10030425 3300003323 Bacteria 4598
42 rootH1_10063152 3300003323 Bacteria 5945
43 rootH1_10082354 3300003323 Bacteria 3629
44 rootH1_10148113 3300003323 Bacteria 1718
45 rootH1_10230439 3300003323 Bacteria 4761
46 JGI25160J50197_1000981 3300003354 Bacteria 14875
47 JGI25160J50197_1006733 3300003354 Bacteria 4611
48 JGI25160J50197_1009613 3300003354 Bacteria 3569
49 Ga0006562J51391_1012235 3300003578 Bacteria 4418
50 Ga0006562J51391_1026618 3300003578 Bacteria 1873
51 Ga0055535_1001731 3300003761 Bacteria 9801
52 Ga0055542_1004590 3300003762 Bacteria 3311
53 Ga0055526_1008317 3300003771 Bacteria 5202
54 Ga0055536_1000010 3300003781 Bacteria 304614
55 Ga0055536_1001611 3300003781 Bacteria 13467
56 Ga0055528_1000701 3300003790 Bacteria 23758
57 Ga0055530_10000911 3300003791 Bacteria 24271
58 Ga0055530_10002214 3300003791 Bacteria 12844
59 Ga0055531_10000245 3300003794 Bacteria 59122
60 Ga0055531_10000435 3300003794 Bacteria 39538
61 Ga0058863_11371296 3300004799 Bacteria 2287
62 Ga0058862_12893042 3300004803 Bacteria 4420
63 Ga0065165_1000131 3300005262 Bacteria 128880
64 Ga0065165_1000725 3300005262 Bacteria 46083
65 Ga0065165_1001074 3300005262 Bacteria 32602
66 Ga0065714_10003996 3300005288 Bacteria 10318
67 Ga0065714_10007893 3300005288 Bacteria 4048
68 Ga0065714_10064770 3300005288 Bacteria 19370
69 Ga0065714_10067085 3300005288 Bacteria 5864
70 Ga0065714_10068951 3300005288 Bacteria 4451
71 Ga0065714_10081337 3300005288 Bacteria 2377
72 Ga0065704_10070136 3300005289 Bacteria 560402
73 Ga0065704_10070374 3300005289 Bacteria 28734
74 Ga0065704_10070934 3300005289 Bacteria 14451
75 Ga0065704_10071262 3300005289 Bacteria 12166
76 Ga0065704_10073279 3300005289 Bacteria 7354
77 Ga0065704_10074546 3300005289 Bacteria 6194
78 Ga0065704_10082725 3300005289 Bacteria 3559
79 Ga0065704_10084719 3300005289 Bacteria 3304
80 Ga0065704_10095111 3300005289 Bacteria 2505
81 Ga0065704_10098586 3300005289 Bacteria 2347
82 Ga0065712_10001912 3300005290 Bacteria 13957
83 Ga0065712_10099197 3300005290 Bacteria 2098
84 Ga0065715_10005294 3300005293 Bacteria 4057
85 Ga0065715_10088952 3300005293 Bacteria 20962
86 Ga0065715_10133208 3300005293 Bacteria 1976
87 Ga0065715_10165505 3300005293 Bacteria 1590
88 Ga0065707_10175618 3300005295 Bacteria 1453
89 Ga0070658_10000011 3300005327 Bacteria 294396
90 Ga0070658_10000515 3300005327 Bacteria 33566
91 Ga0070658_10008589 3300005327 Bacteria 8214
92 Ga0070658_10115992 3300005327 Bacteria 2222
93 Ga0070658_10134793 3300005327 Bacteria 2059
94 Ga0070658_10224479 3300005327 Bacteria 1589
95 Ga0070658_10278492 3300005327 Bacteria 1423
96 Ga0070676_10000277 3300005328 Bacteria 22624
97 Ga0070676_10002355 3300005328 Bacteria 9671
98 Ga0070676_10094701 3300005328 Bacteria 1835
99 Ga0070683_100002536 3300005329 Bacteria 14576
100 Ga0070683_100003504 3300005329 Bacteria 12763
101 Ga0070683_100004268 3300005329 Bacteria 11731
102 Ga0070683_100006103 3300005329 Bacteria 10103
103 Ga0070683_100010704 3300005329 Bacteria 7886
104 Ga0070683_100075911 3300005329 Bacteria 3141
105 Ga0070690_100010328 3300005330 Bacteria 5430
106 Ga0070690_100022642 3300005330 Bacteria 3845
107 Ga0070670_100015632 3300005331 Bacteria 6517
108 Ga0070670_100032500 3300005331 Bacteria 4494
109 Ga0070670_100038445 3300005331 Bacteria 4115
110 Ga0070670_100081448 3300005331 Bacteria 2781
111 Ga0070670_100188523 3300005331 Bacteria 1791
112 Ga0068869_100000827 3300005334 Bacteria 17676
113 Ga0068869_100005917 3300005334 Bacteria 7728
114 Ga0068869_100007558 3300005334 Bacteria 6955
115 Ga0068869_100032239 3300005334 Bacteria 3691
116 Ga0070666_10000323 3300005335 Bacteria 30548
117 Ga0070666_10001233 3300005335 Bacteria 15463
118 Ga0070666_10151143 3300005335 Bacteria 1620
119 Ga0070666_10199298 3300005335 Bacteria 1408
120 Ga0070680_100010203 3300005336 Bacteria 7242
121 Ga0070680_100024474 3300005336 Bacteria 4824
122 Ga0070680_100070642 3300005336 Bacteria 2868
123 Ga0070680_100088593 3300005336 Bacteria 2560
124 Ga0070680_100138593 3300005336 Bacteria 2039
125 Ga0070680_100250961 3300005336 Bacteria 1496
126 Ga0070682_100000039 3300005337 Bacteria 144400
127 Ga0070682_100000625 3300005337 Bacteria 21518
128 Ga0070682_100009958 3300005337 Bacteria 5384
129 Ga0070682_100026312 3300005337 Bacteria 3481
130 Ga0068868_100004571 3300005338 Bacteria 9714
131 Ga0068868_100009633 3300005338 Bacteria 6967
132 Ga0068868_100035974 3300005338 Bacteria 3830
133 Ga0070660_100001306 3300005339 Bacteria 16984
134 Ga0070660_100002764 3300005339 Bacteria 12054
135 Ga0070660_100015693 3300005339 Bacteria 5477
136 Ga0070660_100130765 3300005339 Bacteria 2009
137 Ga0070689_100010555 3300005340 Bacteria 6584
138 Ga0070689_100028711 3300005340 Bacteria 4207
139 Ga0070689_100080880 3300005340 Bacteria 2550
140 Ga0070689_100299370 3300005340 Bacteria 1338
141 Ga0070691_10000660 3300005341 Bacteria 13368
142 Ga0070691_10020602 3300005341 Bacteria 3047
143 Ga0070687_100001432 3300005343 Bacteria 8384
144 Ga0070687_100069461 3300005343 Bacteria 1886
145 Ga0070661_100002636 3300005344 Bacteria 12270
146 Ga0070661_100010432 3300005344 Bacteria 6460
147 Ga0070661_100011068 3300005344 Bacteria 6283
148 Ga0070668_100004869 3300005347 Bacteria 9948
149 Ga0070668_100014483 3300005347 Bacteria 5895
150 Ga0070668_100023632 3300005347 Bacteria 4651
151 Ga0070668_100041596 3300005347 Bacteria 3521
152 Ga0070669_100057612 3300005353 Bacteria 2851
153 Ga0070669_100078997 3300005353 Bacteria 2446
154 Ga0070669_100174934 3300005353 Bacteria 1676
155 Ga0070669_100254111 3300005353 Bacteria 1400
156 Ga0070675_100003849 3300005354 Bacteria 11389
157 Ga0070675_100016358 3300005354 Bacteria 5886
158 Ga0070675_100036218 3300005354 Bacteria 4014
159 Ga0070675_100059652 3300005354 Bacteria 3148
160 Ga0070671_100019758 3300005355 Bacteria 5487
161 Ga0070671_100030050 3300005355 Bacteria 4483
162 Ga0070671_100061292 3300005355 Bacteria 3133
163 Ga0070671_100111333 3300005355 Bacteria 2300
164 Ga0070671_100124488 3300005355 Bacteria 2170
165 Ga0070673_100002393 3300005364 Bacteria 11418
166 Ga0070673_100003782 3300005364 Bacteria 9493
167 Ga0070673_100004396 3300005364 Bacteria 8911
168 Ga0070673_100012715 3300005364 Bacteria 5789
169 Ga0070673_100018686 3300005364 Bacteria 4959
170 Ga0070673_100149118 3300005364 Bacteria 1979
171 Ga0070688_100012071 3300005365 Bacteria 4826
172 Ga0070688_100026240 3300005365 Bacteria 3460
173 Ga0070659_100002083 3300005366 Bacteria 14235
174 Ga0070659_100003545 3300005366 Bacteria 11112
175 Ga0070659_100010122 3300005366 Bacteria 6941
176 Ga0070659_100018139 3300005366 Bacteria 5308
177 Ga0070667_100005690 3300005367 Bacteria 10406
178 Ga0070667_100068663 3300005367 Bacteria 3016
179 Ga0070667_100244374 3300005367 Bacteria 1603
180 Ga0070678_100004999 3300005456 Bacteria 7599
181 Ga0070678_100006236 3300005456 Bacteria 6976
182 Ga0070678_100018818 3300005456 Bacteria 4485
183 Ga0070678_100151126 3300005456 Bacteria 1870
184 Ga0070662_100000032 3300005457 Bacteria 78824
185 Ga0070662_100022191 3300005457 Bacteria 4342
186 Ga0070662_100030585 3300005457 Bacteria 3769
187 Ga0070662_100056919 3300005457 Bacteria 2839
188 Ga0070662_100059188 3300005457 Bacteria 2790
189 Ga0070662_100086776 3300005457 Bacteria 2341
190 Ga0070681_10017068 3300005458 Bacteria 7255
191 Ga0070681_10018726 3300005458 Bacteria 6929
192 Ga0070681_10034740 3300005458 Bacteria 5063
193 Ga0070681_10036428 3300005458 Bacteria 4940
194 Ga0070681_10064666 3300005458 Bacteria 3628
195 Ga0068867_100009759 3300005459 Bacteria 6765
196 Ga0068867_100010951 3300005459 Bacteria 6395
197 Ga0068867_100023644 3300005459 Bacteria 4400
198 Ga0068867_100033878 3300005459 Bacteria 3701
199 Ga0068867_100059230 3300005459 Bacteria 2839
200 Ga0068867_100163733 3300005459 Bacteria 1756
201 Ga0068867_100276500 3300005459 Unclassified 1375
202 Ga0070685_10048201 3300005466 Bacteria 2453
203 Ga0070685_10072252 3300005466 Bacteria 2047
204 Ga0070685_10117310 3300005466 Bacteria 1648
205 Ga0070698_100002644 3300005471 Bacteria 19745
206 Ga0070698_100016067 3300005471 Bacteria 7903
207 Ga0070679_100025505 3300005530 Bacteria 5802
208 Ga0070679_100030821 3300005530 Bacteria 5298
209 Ga0070679_100042499 3300005530 Bacteria 4527
210 Ga0070679_100042689 3300005530 Bacteria 4516
211 Ga0070679_100066869 3300005530 Bacteria 3584
212 Ga0070679_100111026 3300005530 Bacteria 2728
213 Ga0070684_100000097 3300005535 Bacteria 56477
214 Ga0070684_100011014 3300005535 Bacteria 7193
215 Ga0070684_100027061 3300005535 Bacteria 4836
216 Ga0070684_100036492 3300005535 Bacteria 4212
217 Ga0070684_100056838 3300005535 Bacteria 3416
218 Ga0068853_100004545 3300005539 Bacteria 10768
219 Ga0068853_100008299 3300005539 Bacteria 8339
220 Ga0068853_100008727 3300005539 Bacteria 8154
221 Ga0068853_100028221 3300005539 Bacteria 4719
222 Ga0068853_100057738 3300005539 Bacteria 3350
223 Ga0068853_100082062 3300005539 Bacteria 2823
224 Ga0068853_100105194 3300005539 Bacteria 2500
225 Ga0068853_100234405 3300005539 Bacteria 1680
226 Ga0070672_100000061 3300005543 Bacteria 49701
227 Ga0070672_100017587 3300005543 Bacteria 5150
228 Ga0070672_100050540 3300005543 Bacteria 3238
229 Ga0070686_100023709 3300005544 Bacteria 3671
230 Ga0070686_100048162 3300005544 Bacteria 2699
231 Ga0070693_100006957 3300005547 Bacteria 5503
232 Ga0070693_100117735 3300005547 Bacteria 1644
233 Ga0070665_100000002 3300005548 Bacteria 849037
234 Ga0070665_100000003 3300005548 Bacteria 811857
235 Ga0070665_100005248 3300005548 Bacteria 13397
236 Ga0070665_100008467 3300005548 Bacteria 10406
237 Ga0070665_100049998 3300005548 Bacteria 4195
238 Ga0070665_100311945 3300005548 Bacteria 1577
239 Ga0068855_100000042 3300005563 Bacteria 149332
240 Ga0068855_100000439 3300005563 Bacteria 51399
241 Ga0068855_100000508 3300005563 Bacteria 48055
242 Ga0068855_100011561 3300005563 Bacteria 10660
243 Ga0068855_100027104 3300005563 Bacteria 6856
244 Ga0068855_100032170 3300005563 Bacteria 6263
245 Ga0068855_100039110 3300005563 Bacteria 5631
246 Ga0068855_100048633 3300005563 Bacteria 5004
247 Ga0068855_100062885 3300005563 Bacteria 4333
248 Ga0068855_100066337 3300005563 Bacteria 4208
249 Ga0068855_100116249 3300005563 Bacteria 3066
250 Ga0068855_100152650 3300005563 Bacteria 2626
251 Ga0068855_100253898 3300005563 Bacteria 1961
252 Ga0068855_100282407 3300005563 Bacteria 1843
253 Ga0070664_100002153 3300005564 Bacteria 15793
254 Ga0070664_100003785 3300005564 Bacteria 12203
255 Ga0070664_100004253 3300005564 Bacteria 11514
256 Ga0070664_100022827 3300005564 Bacteria 5161
257 Ga0070664_100052278 3300005564 Bacteria 3460
258 Ga0068857_100001948 3300005577 Bacteria 16668
259 Ga0068857_100010962 3300005577 Bacteria 7888
260 Ga0068857_100025799 3300005577 Bacteria 5175
261 Ga0068857_100125503 3300005577 Bacteria 2313
262 Ga0068857_100137879 3300005577 Bacteria 2204
263 Ga0068857_100222750 3300005577 Bacteria 1723
264 Ga0068854_100007137 3300005578 Bacteria 7133
265 Ga0068854_100020090 3300005578 Bacteria 4511
266 Ga0068854_100054632 3300005578 Bacteria 2873
267 Ga0068856_100000794 3300005614 Bacteria 34105
268 Ga0068856_100024601 3300005614 Bacteria 5862
269 Ga0068856_100040048 3300005614 Bacteria 4601
270 Ga0068856_100113608 3300005614 Bacteria 2706
271 Ga0068856_100223899 3300005614 Bacteria 1896
272 Ga0070702_100051565 3300005615 Bacteria 2356
273 Ga0068852_100002452 3300005616 Bacteria 12774
274 Ga0068852_100010222 3300005616 Bacteria 6996
275 Ga0068852_100016457 3300005616 Bacteria 5768
276 Ga0068852_100024730 3300005616 Bacteria 4858
277 Ga0068852_100047320 3300005616 Bacteria 3669
278 Ga0068852_100080351 3300005616 Bacteria 2890
279 Ga0068859_100000106 3300005617 Bacteria 78128
280 Ga0068859_100007461 3300005617 Bacteria 11100
281 Ga0068859_100008808 3300005617 Bacteria 10188
282 Ga0068859_100080263 3300005617 Bacteria 3303
283 Ga0068859_100136898 3300005617 Bacteria 2522
284 Ga0068859_100305465 3300005617 Bacteria 1684
285 Ga0068864_100003370 3300005618 Bacteria 13210
286 Ga0068864_100011427 3300005618 Bacteria 7334
287 Ga0068864_100043993 3300005618 Bacteria 3825
288 Ga0068864_100111824 3300005618 Bacteria 2434
289 Ga0068861_100013324 3300005719 Bacteria 5753
290 Ga0068861_100034298 3300005719 Bacteria 3752
291 Ga0068861_100160171 3300005719 Unclassified 1856
292 Ga0068861_100268986 3300005719 Bacteria 1463
293 Ga0068851_10000465 3300005834 Bacteria 17865
294 Ga0068851_10047056 3300005834 Bacteria 2183
295 Ga0068851_10075702 3300005834 Bacteria 1749
296 Ga0068870_10028876 3300005840 Bacteria 2789
297 Ga0068870_10088051 3300005840 Bacteria 1730
298 Ga0068863_100001273 3300005841 Bacteria 25131
299 Ga0068863_100006081 3300005841 Bacteria 11840
300 Ga0068863_100011467 3300005841 Bacteria 8571
301 Ga0068863_100032496 3300005841 Bacteria 4975
302 Ga0068863_100048536 3300005841 Bacteria 4026
303 Ga0068863_100076978 3300005841 Bacteria 3156
304 Ga0068863_100177698 3300005841 Bacteria 2043
305 Ga0068863_100238773 3300005841 Bacteria 1754
306 Ga0068863_100302941 3300005841 Bacteria 1550
307 Ga0068858_100000930 3300005842 Bacteria 30365
308 Ga0068858_100006822 3300005842 Bacteria 11107
309 Ga0068858_100016470 3300005842 Bacteria 6941
310 Ga0068858_100149041 3300005842 Bacteria 2199
311 Ga0068860_100000003 3300005843 Bacteria 575741
312 Ga0068860_100003491 3300005843 Bacteria 16182
313 Ga0068860_100009409 3300005843 Bacteria 9711
314 Ga0068860_100011027 3300005843 Bacteria 8911
315 Ga0068860_100026307 3300005843 Bacteria 5610
316 Ga0068862_100006586 3300005844 Bacteria 9629
317 Ga0068862_100076920 3300005844 Bacteria 2889
318 Ga0068862_100142298 3300005844 Bacteria 2130
319 Ga0081540_1040101 3300005983 Unclassified 2445
320 Ga0081539_10001169 3300005985 Bacteria 47510
321 Ga0081539_10029490 3300005985 Bacteria 3426
322 Ga0075366_10001072 3300006195 Bacteria 13441
323 Ga0075366_10007887 3300006195 Bacteria 5889
324 Ga0075366_10009701 3300006195 Bacteria 5381
325 Ga0075366_10021500 3300006195 Bacteria 3750
326 Ga0075366_10021509 3300006195 Bacteria 3750
327 Ga0075366_10106071 3300006195 Bacteria 1689
328 Ga0097621_100000165 3300006237 Bacteria 41398
329 Ga0097621_100000531 3300006237 Bacteria 26760
330 Ga0097621_100006425 3300006237 Bacteria 8342
331 Ga0097621_100016683 3300006237 Bacteria 5559
332 Ga0097621_100068802 3300006237 Bacteria 2921
333 Ga0097621_100070099 3300006237 Bacteria 2894
334 Ga0097621_100109977 3300006237 Bacteria 2328
335 Ga0097621_100156438 3300006237 Bacteria 1957
336 Ga0068871_100000018 3300006358 Bacteria 89690
337 Ga0068871_100000042 3300006358 Bacteria 67951
338 Ga0068871_100001712 3300006358 Bacteria 14753
339 Ga0068871_100002324 3300006358 Bacteria 12946
340 Ga0068871_100002902 3300006358 Bacteria 11755
341 Ga0068871_100007826 3300006358 Bacteria 7657
342 Ga0068871_100012489 3300006358 Bacteria 6266
343 Ga0068871_100039588 3300006358 Bacteria 3772
344 Ga0075428_100004442 3300006844 Bacteria 15481
345 Ga0075428_100010463 3300006844 Bacteria 10305
346 Ga0075428_100011907 3300006844 Bacteria 9675
347 Ga0075430_100004975 3300006846 Bacteria 11184
348 Ga0075431_100026391 3300006847 Bacteria 5960
349 Ga0075429_100030837 3300006880 Bacteria 4659
350 Ga0075429_100071292 3300006880 Bacteria 3025
351 Ga0068865_100000396 3300006881 Bacteria 24307
352 Ga0068865_100001997 3300006881 Bacteria 12048
353 Ga0068865_100051065 3300006881 Bacteria 2860
354 Ga0097620_100000106 3300006931 Bacteria 78128
355 Ga0097620_100007461 3300006931 Bacteria 11100
356 Ga0097620_100008808 3300006931 Bacteria 10188
357 Ga0097620_100080264 3300006931 Bacteria 3303
358 Ga0097620_100136895 3300006931 Bacteria 2522
359 Ga0097620_100305481 3300006931 Bacteria 1684
360 Ga0099824_1002886 3300006942 Bacteria 25147
361 Ga0079104_1000179 3300006946 Bacteria 90381
362 Ga0099826_10037265 3300006948 Bacteria 3428
363 Ga0105251_10043569 3300009011 Bacteria 2172
364 Ga0105244_10000004 3300009036 Bacteria 492478
365 Ga0105244_10000011 3300009036 Bacteria 263939
366 Ga0105240_10000037 3300009093 Bacteria 270462
367 Ga0105240_10000237 3300009093 Bacteria 109895
368 Ga0105240_10000367 3300009093 Bacteria 84666
369 Ga0105240_10000487 3300009093 Bacteria 73453
370 Ga0105240_10005515 3300009093 Bacteria 18851
371 Ga0105240_10022011 3300009093 Bacteria 8465
372 Ga0105240_10039540 3300009093 Bacteria 6039
373 Ga0105240_10042495 3300009093 Bacteria 5791
374 Ga0105240_10043261 3300009093 Bacteria 5732
375 Ga0105240_10069454 3300009093 Bacteria 4360
376 Ga0105240_10104541 3300009093 Bacteria 3439
377 Ga0105240_10113999 3300009093 Bacteria 3266
378 Ga0105240_10181056 3300009093 Bacteria 2487
379 Ga0105240_10245699 3300009093 Bacteria 2073
380 Ga0111539_10014918 3300009094 Bacteria 9685
381 Ga0111539_10017967 3300009094 Bacteria 8760
382 Ga0111539_10066976 3300009094 Bacteria 4242
383 Ga0111539_10162149 3300009094 Bacteria 2615
384 Ga0105245_10173353 3300009098 Unclassified 2056
385 Ga0105247_10000918 3300009101 Bacteria 22128
386 Ga0105247_10011475 3300009101 Bacteria 5342
387 Ga0105247_10037908 3300009101 Bacteria 2941
388 Ga0114129_10012446 3300009147 Bacteria 12112
389 Ga0114129_10052518 3300009147 Bacteria 5720
390 Ga0105243_10000009 3300009148 Bacteria 354419
391 Ga0105243_10000145 3300009148 Bacteria 81468
392 Ga0105243_10172389 3300009148 Unclassified 1875
393 Ga0105241_10001462 3300009174 Bacteria 18113
394 Ga0105241_10002922 3300009174 Bacteria 12760
395 Ga0105241_10003042 3300009174 Bacteria 12514
396 Ga0105241_10005760 3300009174 Bacteria 9147
397 Ga0105241_10007004 3300009174 Bacteria 8292
398 Ga0105241_10030640 3300009174 Bacteria 4022
399 Ga0105241_10084882 3300009174 Bacteria 2487
400 Ga0105241_10114505 3300009174 Unclassified 2163
401 Ga0105242_10006535 3300009176 Bacteria 8974
402 Ga0105242_10036683 3300009176 Bacteria 3934
403 Ga0105242_10086686 3300009176 Bacteria 2628
404 Ga0105242_10121133 3300009176 Bacteria 2245
405 Ga0105248_10004482 3300009177 Bacteria 15453
406 Ga0105248_10032533 3300009177 Bacteria 5828
407 Ga0105248_10256759 3300009177 Unclassified 1967
408 Ga0105237_10000224 3300009545 Bacteria 79854
409 Ga0105237_10000729 3300009545 Bacteria 45381
410 Ga0105237_10000952 3300009545 Bacteria 38921
411 Ga0105237_10000963 3300009545 Bacteria 38740
412 Ga0105237_10001948 3300009545 Bacteria 26296
413 Ga0105237_10002321 3300009545 Bacteria 23628
414 Ga0105237_10003093 3300009545 Bacteria 20049
415 Ga0105237_10004043 3300009545 Bacteria 17124
416 Ga0105237_10008222 3300009545 Bacteria 11332
417 Ga0105237_10009903 3300009545 Bacteria 10175
418 Ga0105237_10019011 3300009545 Bacteria 7101
419 Ga0105237_10021687 3300009545 Bacteria 6601
420 Ga0105237_10033447 3300009545 Bacteria 5208
421 Ga0105237_10040318 3300009545 Bacteria 4710
422 Ga0105237_10179810 3300009545 Bacteria 2116
423 Ga0105237_10192111 3300009545 Bacteria 2041
424 Ga0105237_10217300 3300009545 Bacteria 1911
425 Ga0105237_10297085 3300009545 Bacteria 1618
426 Ga0105238_10004274 3300009551 Bacteria 14194
427 Ga0105238_10013318 3300009551 Bacteria 8298
428 Ga0105238_10037769 3300009551 Bacteria 4907
429 Ga0105238_10203974 3300009551 Bacteria 1953
430 Ga0105238_10279964 3300009551 Bacteria 1649
431 Ga0105249_10001226 3300009553 Bacteria 22548
432 Ga0105249_10002137 3300009553 Bacteria 17128
433 Ga0105249_10019422 3300009553 Bacteria 6064
434 Ga0105249_10021227 3300009553 Bacteria 5814
435 Ga0105249_10024010 3300009553 Bacteria 5476
436 Ga0105249_10035542 3300009553 Bacteria 4519
437 Ga0105249_10115485 3300009553 Bacteria 2543
438 Ga0105249_10180744 3300009553 Bacteria 2052
439 Ga0105249_10198919 3300009553 Bacteria 1960
440 Ga0105249_10315500 3300009553 Unclassified 1573
441 Ga0105239_10000002 3300010375 Bacteria 610298
442 Ga0105239_10000013 3300010375 Bacteria 327371
443 Ga0105239_10000283 3300010375 Bacteria 74612
444 Ga0105239_10001207 3300010375 Bacteria 35283
445 Ga0105239_10001438 3300010375 Bacteria 31747
446 Ga0105239_10003665 3300010375 Bacteria 18762
447 Ga0105239_10006888 3300010375 Bacteria 13111
448 Ga0105239_10024908 3300010375 Bacteria 6590
449 Ga0105239_10025175 3300010375 Bacteria 6554
450 Ga0105239_10061828 3300010375 Bacteria 4110
451 Ga0105239_10123544 3300010375 Bacteria 2876
452 Ga0105239_10150086 3300010375 Bacteria 2601
453 Ga0105239_10258859 3300010375 Bacteria 1955
454 Ga0105239_10291504 3300010375 Bacteria 1837
455 Ga0105239_10383807 3300010375 Bacteria 1588
456 Ga0157373_10000002 3300013100 Bacteria 750094
457 Ga0157373_10000005 3300013100 Bacteria 262158
458 Ga0157373_10000256 3300013100 Bacteria 43374
459 Ga0157373_10000936 3300013100 Bacteria 22553
460 Ga0157373_10001318 3300013100 Bacteria 18986
461 Ga0157373_10002482 3300013100 Bacteria 14050
462 Ga0157373_10003984 3300013100 Bacteria 11138
463 Ga0157373_10024469 3300013100 Bacteria 4373
464 Ga0157373_10025270 3300013100 Bacteria 4297
465 Ga0157373_10031635 3300013100 Bacteria 3808
466 Ga0157373_10032956 3300013100 Bacteria 3729
467 Ga0157373_10033565 3300013100 Bacteria 3691
468 Ga0157373_10087296 3300013100 Bacteria 2198
469 Ga0157373_10087541 3300013100 Bacteria 2194
470 Ga0157373_10219732 3300013100 Bacteria 1340
471 Ga0157371_10000046 3300013102 Bacteria 187304
472 Ga0157371_10000079 3300013102 Bacteria 152295
473 Ga0157371_10000216 3300013102 Bacteria 83975
474 Ga0157371_10000741 3300013102 Bacteria 38124
475 Ga0157371_10001331 3300013102 Bacteria 25968
476 Ga0157371_10002552 3300013102 Bacteria 17284
477 Ga0157371_10003861 3300013102 Bacteria 13371
478 Ga0157371_10011763 3300013102 Bacteria 6723
479 Ga0157371_10015344 3300013102 Bacteria 5750
480 Ga0157371_10017592 3300013102 Bacteria 5306
481 Ga0157371_10017639 3300013102 Bacteria 5296
482 Ga0157371_10018024 3300013102 Bacteria 5229
483 Ga0157371_10027826 3300013102 Bacteria 4097
484 Ga0157371_10040330 3300013102 Bacteria 3335
485 Ga0157371_10104115 3300013102 Bacteria 2014
486 Ga0157370_10001014 3300013104 Bacteria 35409
487 Ga0157370_10002361 3300013104 Bacteria 22770
488 Ga0157370_10003143 3300013104 Bacteria 19558
489 Ga0157370_10003236 3300013104 Bacteria 19218
490 Ga0157370_10003785 3300013104 Bacteria 17653
491 Ga0157370_10007303 3300013104 Bacteria 12057
492 Ga0157370_10017885 3300013104 Bacteria 7141
493 Ga0157370_10018487 3300013104 Bacteria 7006
494 Ga0157370_10020395 3300013104 Bacteria 6621
495 Ga0157370_10020909 3300013104 Bacteria 6528
496 Ga0157370_10022590 3300013104 Bacteria 6259
497 Ga0157370_10023049 3300013104 Bacteria 6188
498 Ga0157370_10030370 3300013104 Bacteria 5295
499 Ga0157370_10052885 3300013104 Bacteria 3875
500 Ga0157370_10074178 3300013104 Bacteria 3209
501 Ga0157370_10117145 3300013104 Bacteria 2488
502 Ga0157370_10120995 3300013104 Bacteria 2444
503 Ga0157370_10121149 3300013104 Bacteria 2442
504 Ga0157370_10179980 3300013104 Bacteria 1965
505 Ga0157370_10196518 3300013104 Bacteria 1872
506 Ga0157370_10208645 3300013104 Bacteria 1811
507 Ga0157370_10274035 3300013104 Bacteria 1559
508 Ga0157370_10277171 3300013104 Bacteria 1549
509 Ga0157369_10000046 3300013105 Bacteria 172851
510 Ga0157369_10002118 3300013105 Bacteria 23921
511 Ga0157369_10002262 3300013105 Bacteria 23146
512 Ga0157369_10009363 3300013105 Bacteria 11200
513 Ga0157369_10013763 3300013105 Bacteria 9145
514 Ga0157369_10019087 3300013105 Bacteria 7676
515 Ga0157369_10023605 3300013105 Bacteria 6850
516 Ga0157369_10026663 3300013105 Bacteria 6408
517 Ga0157369_10041152 3300013105 Bacteria 5044
518 Ga0157369_10061645 3300013105 Bacteria 4043
519 Ga0157369_10141071 3300013105 Unclassified 2550
520 Ga0157374_10000013 3300013296 Bacteria 461240
521 Ga0157374_10000348 3300013296 Bacteria 42744
522 Ga0157374_10003727 3300013296 Bacteria 12805
523 Ga0157374_10010061 3300013296 Bacteria 8119
524 Ga0157374_10010541 3300013296 Bacteria 7955
525 Ga0157374_10013448 3300013296 Bacteria 7142
526 Ga0157374_10019587 3300013296 Bacteria 5990
527 Ga0157374_10020034 3300013296 Bacteria 5930
528 Ga0157378_10000859 3300013297 Bacteria 28140
529 Ga0157378_10009983 3300013297 Bacteria 8279
530 Ga0157378_10018192 3300013297 Bacteria 6170
531 Ga0157378_10024509 3300013297 Bacteria 5310
532 Ga0157378_10035235 3300013297 Bacteria 4426
533 Ga0157378_10057795 3300013297 Bacteria 3458
534 Ga0157378_10084952 3300013297 Bacteria 2867
535 Ga0157378_10102551 3300013297 Bacteria 2613
536 Ga0163162_10000031 3300013306 Bacteria 157666
537 Ga0163162_10000037 3300013306 Bacteria 138420
538 Ga0163162_10000244 3300013306 Bacteria 49260
539 Ga0163162_10000952 3300013306 Bacteria 26875
540 Ga0163162_10001265 3300013306 Bacteria 23633
541 Ga0163162_10001894 3300013306 Bacteria 19706
542 Ga0163162_10002681 3300013306 Bacteria 16870
543 Ga0163162_10003934 3300013306 Bacteria 14252
544 Ga0163162_10011449 3300013306 Bacteria 8650
545 Ga0163162_10013001 3300013306 Bacteria 8123
546 Ga0163162_10041760 3300013306 Bacteria 4589
547 Ga0163162_10061943 3300013306 Bacteria 3780
548 Ga0163162_10109520 3300013306 Bacteria 2859
549 Ga0163162_10141494 3300013306 Bacteria 2520
550 Ga0163162_10177711 3300013306 Bacteria 2254
551 Ga0163162_10180543 3300013306 Bacteria 2237
552 Ga0163162_10304066 3300013306 Bacteria 1727
553 Ga0163162_10368026 3300013306 Bacteria 1570
554 Ga0163162_10385396 3300013306 Bacteria 1535
555 Ga0157372_10000001 3300013307 Bacteria 791349
556 Ga0157372_10000707 3300013307 Bacteria 36672
557 Ga0157372_10003090 3300013307 Bacteria 17926
558 Ga0157372_10005652 3300013307 Bacteria 13296
559 Ga0157372_10014060 3300013307 Bacteria 8549
560 Ga0157372_10018492 3300013307 Bacteria 7492
561 Ga0157372_10023207 3300013307 Bacteria 6723
562 Ga0157372_10038494 3300013307 Bacteria 5278
563 Ga0157372_10040958 3300013307 Bacteria 5120
564 Ga0157372_10051481 3300013307 Bacteria 4583
565 Ga0157372_10052820 3300013307 Bacteria 4527
566 Ga0157372_10071932 3300013307 Bacteria 3896
567 Ga0157372_10104350 3300013307 Bacteria 3240
568 Ga0157372_10117099 3300013307 Bacteria 3055
569 Ga0157372_10139872 3300013307 Bacteria 2788
570 Ga0157372_10304866 3300013307 Bacteria 1853
571 Ga0157372_10474873 3300013307 Bacteria 1458
572 Ga0157372_10547311 3300013307 Bacteria 1349
573 Ga0157375_10000182 3300013308 Bacteria 59120
574 Ga0157375_10000722 3300013308 Bacteria 29134
575 Ga0157375_10005427 3300013308 Bacteria 11084
576 Ga0157375_10023572 3300013308 Bacteria 5680
577 Ga0157375_10033488 3300013308 Bacteria 4883
578 Ga0157375_10043772 3300013308 Bacteria 4344
579 Ga0157375_10053361 3300013308 Bacteria 3977
580 Ga0157375_10108003 3300013308 Bacteria 2877
581 Ga0157375_10136084 3300013308 Bacteria 2581
582 Ga0157375_10137542 3300013308 Unclassified 2568
583 Ga0157375_10525828 3300013308 Bacteria 1346
584 Ga0163163_10000088 3300014325 Bacteria 101126
585 Ga0163163_10000272 3300014325 Bacteria 51699
586 Ga0163163_10000557 3300014325 Bacteria 32741
587 Ga0163163_10005005 3300014325 Bacteria 11420
588 Ga0163163_10069653 3300014325 Bacteria 3502
589 Ga0163163_10106889 3300014325 Bacteria 2825
590 Ga0163163_10193974 3300014325 Bacteria 2079
591 Ga0157380_10000165 3300014326 Bacteria 38063
592 Ga0157380_10005528 3300014326 Bacteria 8835
593 Ga0157380_10089543 3300014326 Bacteria 2535
594 Ga0182008_10000025 3300014497 Bacteria 191222
595 Ga0182008_10000037 3300014497 Bacteria 129884
596 Ga0182008_10000058 3300014497 Bacteria 100175
597 Ga0182008_10000208 3300014497 Bacteria 46272
598 Ga0157377_10006557 3300014745 Bacteria 5561
599 Ga0157377_10012438 3300014745 Bacteria 4279
600 Ga0157377_10081857 3300014745 Unclassified 1889
601 Ga0157379_10000103 3300014968 Bacteria 58102
602 Ga0157379_10018557 3300014968 Bacteria 6135
603 Ga0157379_10019354 3300014968 Bacteria 6012
604 Ga0157379_10082847 3300014968 Bacteria 2874
605 Ga0157379_10115491 3300014968 Bacteria 2413
606 Ga0157376_10000484 3300014969 Bacteria 25711
607 Ga0157376_10002418 3300014969 Bacteria 12621
608 Ga0157376_10003397 3300014969 Bacteria 10958
609 Ga0157376_10005152 3300014969 Bacteria 9116
610 Ga0157376_10045090 3300014969 Bacteria 3628
611 Ga0157376_10162598 3300014969 Bacteria 2025
612 Ga0182006_1000039 3300015261 Bacteria 211568
613 Ga0182006_1000333 3300015261 Bacteria 40401
614 Ga0182006_1000576 3300015261 Bacteria 27061
615 Ga0182006_1002025 3300015261 Bacteria 11378
616 Ga0182006_1003058 3300015261 Bacteria 8777
617 Ga0182006_1003255 3300015261 Bacteria 8413
618 Ga0182006_1007354 3300015261 Bacteria 5045
619 Ga0182006_1008043 3300015261 Bacteria 4791
620 Ga0182007_10000009 3300015262 Bacteria 316298
621 Ga0182007_10037797 3300015262 Bacteria 1620
622 Ga0182005_1000023 3300015265 Bacteria 246328
623 Ga0183373_1008 3300015682 Bacteria 255339
624 Ga0163161_10000007 3300017792 Bacteria 301614
625 Ga0163161_10000343 3300017792 Bacteria 39534
626 Ga0163161_10000628 3300017792 Bacteria 28142
627 Ga0163161_10001101 3300017792 Bacteria 20390
628 Ga0163161_10002195 3300017792 Bacteria 14086
629 Ga0163161_10015712 3300017792 Bacteria 5279
630 Ga0163161_10039788 3300017792 Bacteria 3377
631 Ga0163161_10051457 3300017792 Bacteria 2983
632 Ga0163161_10140016 3300017792 Unclassified 1831
633 Ga0163161_10196122 3300017792 Bacteria 1554
634 Ga0163161_10302341 3300017792 Bacteria 1260
635 Ga0206351_10868731 3300020077 Bacteria 3041
636 Ga0154015_1577688 3300020610 Bacteria 2133
637 Ga0213876_10002723 3300021384 Bacteria 10296
638 Ga0224712_10004532 3300022467 Bacteria 3757
639 Ga0209436_101725 3300025208 Bacteria 7199
640 Ga0207427_100103 3300025231 Bacteria 119618
641 Ga0209437_100017 3300025233 Bacteria 694471
642 Ga0209437_100101 3300025233 Bacteria 226668
643 Ga0209258_100068 3300025242 Bacteria 286288
644 Ga0207425_1000008 3300025245 Bacteria 618024
645 Ga0209646_1000003 3300025246 Bacteria 1160860
646 Ga0209646_1010115 3300025246 Bacteria 1485
647 Ga0209026_1000222 3300025250 Bacteria 77765
648 Ga0209026_1000244 3300025250 Bacteria 69490
649 Ga0209026_1001716 3300025250 Bacteria 9131
650 Ga0209026_1003574 3300025250 Bacteria 5024
651 Ga0209148_1000182 3300025254 Bacteria 123558
652 Ga0209129_1000042 3300025258 Bacteria 305537
653 Ga0209233_1000124 3300025261 Bacteria 226743
654 Ga0209233_1003362 3300025261 Bacteria 5655
655 Ga0209455_1005644 3300025272 Bacteria 3825
656 Ga0209673_1000194 3300025273 Bacteria 122640
657 Ga0209130_1002722 3300025284 Bacteria 8381
658 Ga0209675_1000935 3300025291 Bacteria 18609
659 Ga0209676_1000009 3300025292 Bacteria 981719
660 Ga0209676_1001085 3300025292 Bacteria 30593
661 Ga0209025_1000020 3300025294 Bacteria 618024
662 Ga0209564_1003234 3300025295 Bacteria 11407
663 Ga0209758_1000022 3300025297 Bacteria 618024
664 Ga0209758_1013178 3300025297 Bacteria 4540
665 Ga0209758_1016995 3300025297 Bacteria 3655
666 Ga0209758_1039628 3300025297 Bacteria 1789
667 Ga0209050_1000103 3300025298 Bacteria 229225
668 Ga0209050_1000136 3300025298 Bacteria 179113
669 Ga0209050_1005897 3300025298 Bacteria 7482
670 Ga0209050_1023844 3300025298 Bacteria 2137
671 Ga0207426_1000026 3300025302 Bacteria 515228
672 Ga0207426_1000341 3300025302 Bacteria 87735
673 Ga0207426_1000455 3300025302 Bacteria 64858
674 Ga0207426_1006168 3300025302 Bacteria 5273
675 Ga0209257_1000005 3300025304 Bacteria 1592528
676 Ga0209257_1000025 3300025304 Bacteria 724838
677 Ga0209257_1003301 3300025304 Bacteria 14056
678 Ga0207697_10058643 3300025315 Bacteria 1599
679 Ga0207656_10003369 3300025321 Bacteria 5487
680 Ga0207656_10078196 3300025321 Bacteria 1482
681 Ga0207655_1000008 3300025728 Bacteria 734289
682 Ga0207655_1000242 3300025728 Bacteria 89450
683 Ga0207713_1046416 3300025735 Bacteria 1766
684 Ga0207682_10013648 3300025893 Bacteria 3165
685 Ga0207682_10073287 3300025893 Bacteria 1454
686 Ga0207710_10001124 3300025900 Bacteria 13659
687 Ga0207688_10002010 3300025901 Bacteria 10907
688 Ga0207688_10018186 3300025901 Bacteria 3826
689 Ga0207680_10000125 3300025903 Bacteria 35925
690 Ga0207680_10004003 3300025903 Bacteria 6962
691 Ga0207680_10090488 3300025903 Bacteria 1945
692 Ga0207680_10114292 3300025903 Bacteria 1756
693 Ga0207647_10000104 3300025904 Bacteria 65696
694 Ga0207647_10005038 3300025904 Bacteria 9737
695 Ga0207647_10015091 3300025904 Bacteria 5307
696 Ga0207647_10021853 3300025904 Bacteria 4260
697 Ga0207647_10050404 3300025904 Bacteria 2577
698 Ga0207647_10075592 3300025904 Bacteria 2027
699 Ga0207645_10000650 3300025907 Bacteria 28882
700 Ga0207645_10000793 3300025907 Bacteria 26435
701 Ga0207645_10002278 3300025907 Bacteria 15224
702 Ga0207645_10010687 3300025907 Bacteria 6296
703 Ga0207645_10132455 3300025907 Bacteria 1623
704 Ga0207643_10003896 3300025908 Bacteria 8031
705 Ga0207643_10049960 3300025908 Bacteria 2371
706 Ga0207643_10068017 3300025908 Bacteria 2046
707 Ga0207705_10000015 3300025909 Bacteria 382901
708 Ga0207705_10015947 3300025909 Bacteria 5394
709 Ga0207705_10030739 3300025909 Bacteria 3833
710 Ga0207705_10043306 3300025909 Bacteria 3234
711 Ga0207705_10066747 3300025909 Bacteria 2603
712 Ga0207705_10168295 3300025909 Bacteria 1649
713 Ga0207654_10003790 3300025911 Bacteria 7624
714 Ga0207654_10012469 3300025911 Bacteria 4356
715 Ga0207654_10019327 3300025911 Bacteria 3594
716 Ga0207654_10031761 3300025911 Bacteria 2911
717 Ga0207654_10035887 3300025911 Bacteria 2766
718 Ga0207654_10054274 3300025911 Bacteria 2316
719 Ga0207707_10000160 3300025912 Bacteria 70695
720 Ga0207707_10027427 3300025912 Bacteria 4981
721 Ga0207707_10063492 3300025912 Bacteria 3214
722 Ga0207707_10080305 3300025912 Bacteria 2848
723 Ga0207695_10000013 3300025913 Bacteria 821265
724 Ga0207695_10000051 3300025913 Bacteria 399641
725 Ga0207695_10000056 3300025913 Bacteria 382433
726 Ga0207695_10000066 3300025913 Bacteria 334103
727 Ga0207695_10000081 3300025913 Bacteria 284797
728 Ga0207695_10000092 3300025913 Bacteria 270514
729 Ga0207695_10000156 3300025913 Bacteria 204576
730 Ga0207695_10000550 3300025913 Bacteria 77346
731 Ga0207695_10002404 3300025913 Bacteria 27705
732 Ga0207695_10005846 3300025913 Bacteria 16163
733 Ga0207695_10005995 3300025913 Bacteria 15895
734 Ga0207695_10006542 3300025913 Bacteria 15089
735 Ga0207695_10012058 3300025913 Bacteria 10392
736 Ga0207695_10016372 3300025913 Bacteria 8678
737 Ga0207695_10021656 3300025913 Bacteria 7328
738 Ga0207695_10042663 3300025913 Bacteria 4841
739 Ga0207695_10265002 3300025913 Bacteria 1615
740 Ga0207671_10000257 3300025914 Bacteria 79555
741 Ga0207671_10001789 3300025914 Bacteria 24075
742 Ga0207671_10002116 3300025914 Bacteria 21680
743 Ga0207671_10002707 3300025914 Bacteria 18581
744 Ga0207671_10003054 3300025914 Bacteria 17141
745 Ga0207671_10005700 3300025914 Bacteria 11378
746 Ga0207671_10005976 3300025914 Bacteria 11017
747 Ga0207671_10007245 3300025914 Bacteria 9660
748 Ga0207671_10145754 3300025914 Bacteria 1826
749 Ga0207671_10253396 3300025914 Bacteria 1384
750 Ga0207660_10001905 3300025917 Bacteria 13897
751 Ga0207660_10051818 3300025917 Bacteria 2919
752 Ga0207660_10074562 3300025917 Bacteria 2477
753 Ga0207662_10004278 3300025918 Bacteria 7493
754 Ga0207657_10001653 3300025919 Bacteria 24053
755 Ga0207657_10003392 3300025919 Bacteria 17025
756 Ga0207657_10015945 3300025919 Bacteria 7259
757 Ga0207657_10029952 3300025919 Bacteria 4946
758 Ga0207657_10042107 3300025919 Bacteria 4032
759 Ga0207657_10063853 3300025919 Bacteria 3146
760 Ga0207657_10232459 3300025919 Bacteria 1474
761 Ga0207649_10025366 3300025920 Bacteria 3455
762 Ga0207649_10029127 3300025920 Bacteria 3258
763 Ga0207649_10061177 3300025920 Bacteria 2369
764 Ga0207652_10000029 3300025921 Bacteria 149054
765 Ga0207652_10000115 3300025921 Bacteria 87927
766 Ga0207652_10000406 3300025921 Bacteria 44756
767 Ga0207652_10000961 3300025921 Bacteria 26939
768 Ga0207652_10039601 3300025921 Bacteria 4000
769 Ga0207652_10054962 3300025921 Bacteria 3423
770 Ga0207652_10067110 3300025921 Bacteria 3110
771 Ga0207681_10102685 3300025923 Bacteria 2065
772 Ga0207694_10006715 3300025924 Bacteria 8744
773 Ga0207694_10032448 3300025924 Bacteria 3998
774 Ga0207694_10220231 3300025924 Bacteria 1548
775 Ga0207650_10027506 3300025925 Bacteria 4072
776 Ga0207650_10032513 3300025925 Bacteria 3773
777 Ga0207650_10062568 3300025925 Bacteria 2781
778 Ga0207650_10093737 3300025925 Bacteria 2299
779 Ga0207650_10141491 3300025925 Bacteria 1892
780 Ga0207650_10150022 3300025925 Bacteria 1839
781 Ga0207659_10011402 3300025926 Bacteria 5614
782 Ga0207659_10014561 3300025926 Bacteria 5078
783 Ga0207659_10054617 3300025926 Bacteria 2853
784 Ga0207659_10102119 3300025926 Bacteria 2164
785 Ga0207687_10101975 3300025927 Unclassified 2113
786 Ga0207687_10258044 3300025927 Bacteria 1388
787 Ga0207644_10020232 3300025931 Bacteria 4523
788 Ga0207644_10052439 3300025931 Bacteria 2931
789 Ga0207644_10071229 3300025931 Bacteria 2543
790 Ga0207644_10167003 3300025931 Bacteria 1715
791 Ga0207690_10003150 3300025932 Bacteria 9903
792 Ga0207690_10060376 3300025932 Bacteria 2573
793 Ga0207690_10109253 3300025932 Bacteria 1989
794 Ga0207706_10000191 3300025933 Bacteria 68535
795 Ga0207706_10024864 3300025933 Bacteria 5368
796 Ga0207706_10106618 3300025933 Bacteria 2466
797 Ga0207686_10017976 3300025934 Bacteria 3995
798 Ga0207709_10000026 3300025935 Bacteria 354467
799 Ga0207709_10000365 3300025935 Bacteria 45523
800 Ga0207670_10005454 3300025936 Bacteria 6979
801 Ga0207670_10091135 3300025936 Bacteria 2155
802 Ga0207670_10106251 3300025936 Bacteria 2013
803 Ga0207669_10088178 3300025937 Bacteria 2011
804 Ga0207704_10000053 3300025938 Bacteria 79904
805 Ga0207704_10104416 3300025938 Bacteria 1898
806 Ga0207704_10150556 3300025938 Bacteria 1641
807 Ga0207691_10000154 3300025940 Bacteria 64281
808 Ga0207691_10005078 3300025940 Bacteria 12705
809 Ga0207691_10030946 3300025940 Bacteria 4998
810 Ga0207691_10059353 3300025940 Bacteria 3479
811 Ga0207691_10079855 3300025940 Bacteria 2943
812 Ga0207691_10083196 3300025940 Bacteria 2873
813 Ga0207691_10188552 3300025940 Bacteria 1799
814 Ga0207711_10025883 3300025941 Bacteria 4921
815 Ga0207711_10049439 3300025941 Bacteria 3601
816 Ga0207689_10000360 3300025942 Bacteria 42854
817 Ga0207689_10001010 3300025942 Bacteria 27038
818 Ga0207689_10006093 3300025942 Bacteria 10665
819 Ga0207689_10006592 3300025942 Bacteria 10237
820 Ga0207689_10011320 3300025942 Bacteria 7653
821 Ga0207689_10011416 3300025942 Bacteria 7613
822 Ga0207689_10012630 3300025942 Bacteria 7216
823 Ga0207689_10041818 3300025942 Bacteria 3792
824 Ga0207689_10094157 3300025942 Bacteria 2460
825 Ga0207689_10171472 3300025942 Bacteria 1789
826 Ga0207689_10190025 3300025942 Bacteria 1694
827 Ga0207661_10002590 3300025944 Bacteria 12431
828 Ga0207661_10018276 3300025944 Bacteria 5207
829 Ga0207661_10022471 3300025944 Bacteria 4752
830 Ga0207661_10314785 3300025944 Bacteria 1406
831 Ga0207679_10001022 3300025945 Bacteria 17875
832 Ga0207679_10006038 3300025945 Bacteria 7630
833 Ga0207679_10006841 3300025945 Bacteria 7230
834 Ga0207679_10026302 3300025945 Bacteria 4011
835 Ga0207667_10000037 3300025949 Bacteria 297252
836 Ga0207667_10001658 3300025949 Bacteria 28052
837 Ga0207667_10002366 3300025949 Bacteria 23615
838 Ga0207667_10005373 3300025949 Bacteria 15618
839 Ga0207667_10009017 3300025949 Bacteria 11800
840 Ga0207667_10009279 3300025949 Bacteria 11610
841 Ga0207667_10037027 3300025949 Bacteria 5220
842 Ga0207667_10043276 3300025949 Bacteria 4780
843 Ga0207667_10054870 3300025949 Bacteria 4191
844 Ga0207667_10057723 3300025949 Bacteria 4073
845 Ga0207667_10080369 3300025949 Bacteria 3378
846 Ga0207667_10092593 3300025949 Bacteria 3122
847 Ga0207667_10126280 3300025949 Bacteria 2635
848 Ga0207667_10168833 3300025949 Bacteria 2249
849 Ga0207651_10003771 3300025960 Bacteria 7507
850 Ga0207651_10008489 3300025960 Bacteria 5553
851 Ga0207651_10017358 3300025960 Bacteria 4251
852 Ga0207651_10065649 3300025960 Bacteria 2546
853 Ga0207712_10001164 3300025961 Bacteria 18264
854 Ga0207712_10001801 3300025961 Bacteria 14178
855 Ga0207712_10011162 3300025961 Bacteria 5720
856 Ga0207712_10025404 3300025961 Bacteria 3935
857 Ga0207712_10032321 3300025961 Bacteria 3531
858 Ga0207712_10050010 3300025961 Bacteria 2917
859 Ga0207712_10202644 3300025961 Bacteria 1574
860 Ga0207668_10001272 3300025972 Bacteria 15031
861 Ga0207668_10043236 3300025972 Bacteria 3056
862 Ga0207668_10181590 3300025972 Bacteria 1660
863 Ga0207640_10025871 3300025981 Bacteria 3558
864 Ga0207640_10091812 3300025981 Bacteria 2104
865 Ga0207658_10020272 3300025986 Bacteria 4603
866 Ga0207658_10035132 3300025986 Bacteria 3588
867 Ga0207658_10057653 3300025986 Bacteria 2887
868 Ga0207677_10001948 3300026023 Bacteria 10925
869 Ga0207677_10010537 3300026023 Bacteria 5236
870 Ga0207677_10067060 3300026023 Bacteria 2512
871 Ga0207677_10071853 3300026023 Bacteria 2444
872 Ga0207677_10202809 3300026023 Bacteria 1578
873 Ga0207703_10001922 3300026035 Bacteria 18410
874 Ga0207703_10026323 3300026035 Bacteria 4577
875 Ga0207703_10173273 3300026035 Unclassified 1899
876 Ga0207639_10001747 3300026041 Bacteria 14635
877 Ga0207639_10006469 3300026041 Bacteria 7969
878 Ga0207639_10018045 3300026041 Bacteria 5007
879 Ga0207639_10020682 3300026041 Bacteria 4714
880 Ga0207639_10049062 3300026041 Bacteria 3199
881 Ga0207639_10056788 3300026041 Bacteria 3002
882 Ga0207639_10080730 3300026041 Bacteria 2574
883 Ga0207639_10235946 3300026041 Bacteria 1588
884 Ga0207678_10094925 3300026067 Bacteria 2549
885 Ga0207702_10000201 3300026078 Bacteria 70471
886 Ga0207702_10024798 3300026078 Bacteria 4975
887 Ga0207702_10029614 3300026078 Bacteria 4557
888 Ga0207702_10076949 3300026078 Bacteria 2884
889 Ga0207641_10000082 3300026088 Bacteria 138385
890 Ga0207641_10003172 3300026088 Bacteria 14709
891 Ga0207641_10009438 3300026088 Bacteria 8039
892 Ga0207641_10015009 3300026088 Bacteria 6350
893 Ga0207641_10021690 3300026088 Bacteria 5278
894 Ga0207641_10082894 3300026088 Bacteria 2787
895 Ga0207641_10197553 3300026088 Bacteria 1852
896 Ga0207648_10000175 3300026089 Bacteria 66839
897 Ga0207648_10001709 3300026089 Bacteria 24030
898 Ga0207648_10002098 3300026089 Bacteria 21717
899 Ga0207648_10015449 3300026089 Bacteria 7022
900 Ga0207648_10019442 3300026089 Bacteria 6131
901 Ga0207648_10026330 3300026089 Bacteria 5170
902 Ga0207648_10049799 3300026089 Bacteria 3664
903 Ga0207648_10059413 3300026089 Bacteria 3335
904 Ga0207648_10064952 3300026089 Bacteria 3181
905 Ga0207648_10109467 3300026089 Bacteria 2425
906 Ga0207648_10129399 3300026089 Bacteria 2222
907 Ga0207676_10007584 3300026095 Bacteria 7700
908 Ga0207676_10007982 3300026095 Bacteria 7526
909 Ga0207676_10014437 3300026095 Bacteria 5683
910 Ga0207676_10042623 3300026095 Bacteria 3491
911 Ga0207676_10050937 3300026095 Bacteria 3231
912 Ga0207674_10003993 3300026116 Bacteria 17924
913 Ga0207674_10005014 3300026116 Bacteria 15819
914 Ga0207674_10005225 3300026116 Bacteria 15451
915 Ga0207674_10024952 3300026116 Bacteria 6381
916 Ga0207674_10069416 3300026116 Bacteria 3544
917 Ga0207674_10090955 3300026116 Bacteria 3043
918 Ga0207674_10134865 3300026116 Bacteria 2431
919 Ga0207674_10170481 3300026116 Bacteria 2130
920 Ga0207674_10260018 3300026116 Bacteria 1683
921 Ga0207675_100005095 3300026118 Bacteria 12643
922 Ga0207675_100025419 3300026118 Bacteria 5512
923 Ga0207675_100039652 3300026118 Bacteria 4395
924 Ga0207675_100199108 3300026118 Unclassified 1923
925 Ga0207675_100218011 3300026118 Bacteria 1838
926 Ga0207675_100258912 3300026118 Unclassified 1686
927 Ga0207675_100262591 3300026118 Bacteria 1674
928 Ga0207683_10000974 3300026121 Bacteria 26229
929 Ga0207683_10007830 3300026121 Bacteria 9145
930 Ga0207683_10041067 3300026121 Bacteria 4038
931 Ga0207683_10080928 3300026121 Bacteria 2882
932 Ga0207683_10187572 3300026121 Bacteria 1876
933 Ga0207698_10001166 3300026142 Bacteria 15330
934 Ga0207698_10004722 3300026142 Bacteria 8333
935 Ga0207698_10009220 3300026142 Bacteria 6279
936 Ga0207698_10073819 3300026142 Bacteria 2718
937 Ga0207698_10132043 3300026142 Bacteria 2136
938 Ga0207698_10174264 3300026142 Bacteria 1898
939 Ga0207698_10181498 3300026142 Unclassified 1865
940 Ga0209281_1000116 3300027111 Bacteria 209707
941 Ga0209489_117024 3300027361 Bacteria 3533
942 Ga0209282_1038144 3300027666 Bacteria 2882
943 Ga0209974_10037550 3300027876 Bacteria 1608
944 Ga0268266_10000018 3300028379 Bacteria 569141
945 Ga0268266_10000022 3300028379 Bacteria 508060
946 Ga0268266_10005211 3300028379 Bacteria 12231
947 Ga0268266_10005285 3300028379 Bacteria 12122
948 Ga0268265_10007650 3300028380 Bacteria 7291
949 Ga0268265_10102470 3300028380 Bacteria 2315
950 Ga0268265_10160055 3300028380 Bacteria 1911
951 Ga0268264_10000082 3300028381 Bacteria 246913
952 Ga0268264_10005842 3300028381 Bacteria 10425
953 Ga0268264_10005919 3300028381 Bacteria 10351
954 Ga0268264_10006777 3300028381 Bacteria 9622
955 Ga0268264_10011786 3300028381 Bacteria 7208
956 Ga0268264_10013496 3300028381 Bacteria 6727
957 Ga0268264_10059634 3300028381 Bacteria 3197
958 Ga0268264_10377511 3300028381 Bacteria 1357
959 Ga0265334_10008517 3300028573 Bacteria 4359
960 Ga0307517_10002197 3300028786 Bacteria 31568
961 Ga0307517_10006633 3300028786 Bacteria 17060
962 Ga0307515_10000001 3300028794 Bacteria 4259510
963 Ga0307515_10000061 3300028794 Bacteria 251841
964 Ga0307515_10000190 3300028794 Bacteria 150300
965 Ga0307515_10000927 3300028794 Bacteria 67260
966 Ga0307515_10001771 3300028794 Bacteria 48123
967 Ga0307515_10011605 3300028794 Bacteria 16701
968 Ga0307515_10177925 3300028794 Bacteria 2090
969 Ga0265338_10001011 3300028800 Bacteria 47254
970 Ga0265338_10143578 3300028800 Bacteria 1866
971 Ga0265324_10018826 3300029957 Bacteria 2491
972 Ga0307511_10000027 3300030521 Bacteria 109500
973 Ga0316177_1132213 3300030731 Bacteria 3865
974 Ga0316183_1068856 3300030742 Bacteria 6445
975 Ga0265327_10000048 3300031251 Bacteria 269173
976 Ga0265327_10000248 3300031251 Bacteria 107284
977 Ga0265327_10000272 3300031251 Bacteria 102100
978 Ga0265327_10000551 3300031251 Bacteria 64082
979 Ga0265327_10002514 3300031251 Bacteria 19140
980 Ga0265327_10003148 3300031251 Bacteria 16186
981 Ga0265327_10006450 3300031251 Bacteria 9375
982 Ga0265327_10009085 3300031251 Bacteria 7253
983 Ga0265327_10025709 3300031251 Bacteria 3427
984 Ga0265327_10085354 3300031251 Bacteria 1550
985 Ga0265327_10085890 3300031251 Bacteria 1544
986 Ga0307513_10033920 3300031456 Bacteria 5733
987 Ga0307509_10020755 3300031507 Bacteria 7452
988 Ga0307509_10036852 3300031507 Bacteria 5351
989 Ga0307509_10045900 3300031507 Bacteria 4707
990 Ga0307509_10174065 3300031507 Bacteria 2027
991 Ga0307408_100000310 3300031548 Bacteria 46693
992 Ga0307408_100000534 3300031548 Bacteria 32864
993 Ga0307408_100000564 3300031548 Bacteria 31968
994 Ga0307408_100040113 3300031548 Bacteria 3314
995 Ga0307408_100084815 3300031548 Bacteria 2377
996 Ga0265313_10042550 3300031595 Bacteria 2230
997 Ga0307508_10007752 3300031616 Bacteria 9980
998 Ga0316579_10088628 3300031691 Bacteria 1477
999 Ga0316576_10047393 3300031727 Bacteria 3114
1000 Ga0316578_10044657 3300031728 Bacteria 2578
1001 Ga0316578_10057303 3300031728 Bacteria 2289
1002 Ga0316578_10123818 3300031728 Bacteria 1555
1003 Ga0307516_10000869 3300031730 Bacteria 41512
1004 Ga0307516_10059174 3300031730 Bacteria 3727
1005 Ga0307405_10000002 3300031731 Bacteria 575196
1006 Ga0307405_10000016 3300031731 Bacteria 197180
1007 Ga0307405_10014744 3300031731 Bacteria 4212
1008 Ga0307405_10137656 3300031731 Bacteria 1697
1009 Ga0316577_10114114 3300031733 Bacteria 1516
1010 Ga0307413_10000019 3300031824 Bacteria 45584
1011 Ga0307413_10002415 3300031824 Bacteria 7587
1012 Ga0307410_10000115 3300031852 Bacteria 28127
1013 Ga0307410_10142957 3300031852 Bacteria 1772
1014 Ga0307406_10000111 3300031901 Bacteria 46791
1015 Ga0307407_10000006 3300031903 Bacteria 218714
1016 Ga0307407_10001642 3300031903 Bacteria 8267
1017 Ga0307412_10000001 3300031911 Bacteria 822691
1018 Ga0307412_10000034 3300031911 Bacteria 206033
1019 Ga0307412_10000154 3300031911 Bacteria 49488
1020 Ga0307412_10003359 3300031911 Bacteria 8890
1021 Ga0307412_10237299 3300031911 Bacteria 1408
1022 Ga0307416_100000030 3300032002 Bacteria 162430
1023 Ga0307416_100000032 3300032002 Bacteria 156777
1024 Ga0307416_100025328 3300032002 Bacteria 4347
1025 Ga0307414_10000001 3300032004 Bacteria 1352954
1026 Ga0307414_10000127 3300032004 Bacteria 53237
1027 Ga0307414_10000392 3300032004 Bacteria 23857
1028 Ga0307414_10001064 3300032004 Bacteria 14054
1029 Ga0307414_10001471 3300032004 Bacteria 12250
1030 Ga0307414_10035636 3300032004 Bacteria 3313
1031 Ga0307414_10055020 3300032004 Bacteria 2784
1032 Ga0307414_10068187 3300032004 Bacteria 2551
1033 Ga0307414_10075521 3300032004 Bacteria 2446
1034 Ga0307414_10129539 3300032004 Bacteria 1956
1035 Ga0307414_10178501 3300032004 Bacteria 1705
1036 Ga0307411_10000013 3300032005 Bacteria 145335
1037 Ga0307411_10071513 3300032005 Bacteria 2352
1038 Ga0307415_100025409 3300032126 Bacteria 3716
1039 Ga0307415_100143214 3300032126 Bacteria 1829
1040 Ga0307507_10000064 3300033179 Bacteria 161226
1041 Ga0307510_10000328 3300033180 Bacteria 44214
1042 Ga0307510_10007920 3300033180 Bacteria 12650
1043 Ga0307510_10023468 3300033180 Bacteria 7150
1044 Ga0373936_0062866 3300035113 Bacteria 1519
1045 Ga0373955_0093023 3300035172 Bacteria 1721
1046 Ga0373955_0106131 3300035172 Bacteria 1619
1047 Ga0373924_0018705 3300035410 Bacteria 2674
1048 Ga0373927_0021777 3300035695 Bacteria 4201
1049 Ga0373937_0010206 3300036401 Bacteria 8196
1050 Ga0373937_0064488 3300036401 Bacteria 3370
1051 Ga0316582_0005102 3300036647 Bacteria 6721
1052 Ga0316584_0026927 3300036712 Bacteria 4228
1053 Ga0316584_0052520 3300036712 Bacteria 3048
1054 Ga0316584_0056089 3300036712 Bacteria 2950
1055 Ga0316584_0246152 3300036712 Bacteria 1307
1056 Ga0395899_0000033 3300037312 Bacteria 306589
1057 Ga0395899_0000411 3300037312 Bacteria 49949
1058 Ga0395899_0000435 3300037312 Bacteria 47985
1059 Ga0395899_0001077 3300037312 Bacteria 24592
1060 Ga0395899_0002144 3300037312 Bacteria 16228
1061 Ga0395899_0031560 3300037312 Bacteria 3981
1062 Ga0395899_0044380 3300037312 Bacteria 3312
1063 Ga0395899_0059981 3300037312 Bacteria 2803
1064 Ga0395900_0001393 3300037418 Bacteria 28920
1065 Ga0395900_0001452 3300037418 Bacteria 28269
1066 Ga0395900_0003225 3300037418 Bacteria 17664
1067 Ga0395900_0005622 3300037418 Bacteria 13110
1068 Ga0395900_0072380 3300037418 Bacteria 3544
1069 Ga0395900_0098786 3300037418 Bacteria 2999
1070 Ga0395900_0101122 3300037418 Bacteria 2960
1071 Ga0395900_0109400 3300037418 Bacteria 2839
1072 Ga0395900_0130510 3300037418 Bacteria 2575
1073 Ga0395898_0013831 3300037466 Bacteria 8295
1074 Ga0395898_0031676 3300037466 Bacteria 5281
1075 Ga0395898_0158125 3300037466 Bacteria 2167
1076 Ga0395905_0000998 3300037471 Bacteria 36231
1077 Ga0395905_0001914 3300037471 Bacteria 23897
1078 Ga0395905_0007067 3300037471 Bacteria 11222
1079 Ga0395905_0034426 3300037471 Bacteria 4756
1080 Ga0395901_0000789 3300038443 Bacteria 35205
1081 Ga0395901_0002351 3300038443 Bacteria 19230
1082 Ga0395901_0014642 3300038443 Bacteria 7970
1083 Ga0395901_0017854 3300038443 Bacteria 7241
1084 Ga0395901_0030985 3300038443 Bacteria 5513
1085 Ga0395901_0091000 3300038443 Bacteria 3193
1086 Ga0395901_0272603 3300038443 Bacteria 1759
1087 Ga0395901_0315933 3300038443 Bacteria 1617
1088 Ga0436365_0079092 3300039437 Bacteria 37171
1089 Ga0436361_0307685 3300039447 Bacteria 5871
1090 Ga0439439_0009748 3300041406 Bacteria 2290
1091 Ga0439447_003769 3300041407 Bacteria 5325
1092 Ga0439466_0015063 3300041411 Bacteria 2811
1093 Ga0451795_0356222 3300041456 Bacteria 2451
1094 Ga0451795_1501558 3300041456 Bacteria 2101
1095 Ga0451807_1155230 3300041486 Bacteria 1369
1096 Ga0451849_1009127 3300041505 Bacteria 1610
1097 Ga0451855_1236631 3300041511 Bacteria 3919
1098 Ga0451855_1803231 3300041511 Bacteria 1582
1099 Ga0439431_0000122 3300041997 Bacteria 13578
1100 Ga0439442_002574 3300042002 Bacteria 3560
1101 Ga0439445_0003161 3300042004 Bacteria 3689
1102 Ga0439448_0004334 3300042005 Bacteria 4001
1103 Ga0439449_0006488 3300042007 Bacteria 4471
1104 Ga0439455_0019582 3300042012 Bacteria 1597
1105 Ga0439457_007860 3300042014 Bacteria 2539
1106 Ga0439457_009122 3300042014 Bacteria 2317
1107 Ga0439462_0001515 3300042015 Bacteria 5197
1108 Ga0450923_001237 3300042125 Bacteria 3309
1109 Ga0450898_002493 3300042134 Bacteria 2569
1110 Ga0451577_0000042 3300042876 Bacteria 332086
1111 Ga0451577_0000418 3300042876 Bacteria 77022
1112 Ga0451577_0005315 3300042876 Bacteria 13237
1113 Ga0451577_0016491 3300042876 Bacteria 6840
1114 Ga0451577_0047761 3300042876 Bacteria 3826
1115 Ga0451577_0066330 3300042876 Bacteria 3220
1116 Ga0451577_0066793 3300042876 Bacteria 3207
1117 Ga0451577_0077739 3300042876 Bacteria 2959
1118 Ga0451577_0098078 3300042876 Bacteria 2617
1119 Ga0451577_0103906 3300042876 Bacteria 2539
1120 Ga0451577_0158178 3300042876 Unclassified 2040
1121 Ga0451577_0302681 3300042876 Bacteria 1449
1122 Ga0466969_0001347 3300044656 Bacteria 13251
1123 Ga0466972_0000001 3300044658 Bacteria 412457
1124 Ga0466972_0000280 3300044658 Bacteria 31990
1125 Ga0466972_0076144 3300044658 Bacteria 1598
1126 Ga0453683_0000286 3300044673 Bacteria 65332
1127 Ga0453683_0000572 3300044673 Bacteria 40700
1128 Ga0453683_0000680 3300044673 Bacteria 36070
1129 Ga0453683_0008542 3300044673 Bacteria 6870
1130 Ga0453683_0009555 3300044673 Bacteria 6470
1131 Ga0453683_0019047 3300044673 Bacteria 4400
1132 Ga0453683_0040595 3300044673 Bacteria 2921
1133 Ga0453683_0046010 3300044673 Bacteria 2736
1134 Ga0453683_0183173 3300044673 Bacteria 1328
1135 Ga0453684_0000452 3300044712 Bacteria 165844
1136 Ga0453684_0001009 3300044712 Bacteria 91051
1137 Ga0453684_0001431 3300044712 Bacteria 68233
1138 Ga0453684_0001697 3300044712 Bacteria 59504
1139 Ga0453684_0002271 3300044712 Bacteria 47454
1140 Ga0453684_0004934 3300044712 Bacteria 27202
1141 Ga0453684_0005946 3300044712 Bacteria 23666
1142 Ga0453684_0008008 3300044712 Bacteria 19130
1143 Ga0453684_0014163 3300044712 Bacteria 12809
1144 Ga0453684_0024385 3300044712 Bacteria 8842
1145 Ga0453684_0025246 3300044712 Bacteria 8636
1146 Ga0453684_0034365 3300044712 Bacteria 7038
1147 Ga0453684_0037166 3300044712 Bacteria 6689
1148 Ga0453684_0040283 3300044712 Bacteria 6349
1149 Ga0453684_0120207 3300044712 Bacteria 3173
1150 Ga0453684_0156804 3300044712 Bacteria 2698
1151 Ga0466971_0014790 3300044719 Bacteria 3434
1152 Ga0466968_0028469 3300044735 Bacteria 2304
1153 Ga0466970_0000495 3300044765 Bacteria 19372
1154 Ga0466957_0001670 3300044842 Bacteria 11655
1155 Ga0466957_0007722 3300044842 Bacteria 6085
1156 Ga0466959_0000004 3300045049 Bacteria 216815
1157 Ga0466959_0000446 3300045049 Bacteria 24054
1158 Ga0466959_0055794 3300045049 Bacteria 2883
1159 Ga0451576_0000002 3300045051 Bacteria 1670975
1160 Ga0451576_0000254 3300045051 Bacteria 131595
1161 Ga0451576_0000589 3300045051 Bacteria 77022
1162 Ga0451576_0001052 3300045051 Bacteria 50794
1163 Ga0451576_0005169 3300045051 Bacteria 16516
1164 Ga0451576_0009640 3300045051 Bacteria 11174
1165 Ga0451576_0044662 3300045051 Bacteria 4670
1166 Ga0451576_0047009 3300045051 Bacteria 4540
1167 Ga0451576_0059430 3300045051 Bacteria 3990
1168 Ga0451576_0072309 3300045051 Bacteria 3589
1169 Ga0451576_0087081 3300045051 Unclassified 3248
1170 Ga0451576_0111131 3300045051 Bacteria 2851
1171 Ga0451576_0152198 3300045051 Bacteria 2412
1172 Ga0466958_0082156 3300045836 Bacteria 1984
1173 Ga0495627_000034 3300046453 Bacteria 214913
1174 Ga0495627_006812 3300046453 Bacteria 4445
1175 Ga0495627_007928 3300046453 Bacteria 4023
1176 Ga0495627_045014 3300046453 Bacteria 1345
1177 Ga0495592_0163888 3300046454 Bacteria 1527
1178 Ga0495590_0005877 3300046457 Bacteria 4819
1179 Ga0495638_0000171 3300046460 Bacteria 101044
1180 Ga0495638_0018471 3300046460 Bacteria 4630
1181 Ga0495651_0045960 3300046462 Bacteria 3381
1182 Ga0495650_0000003 3300046471 Bacteria 900730
1183 Ga0495650_0021678 3300046471 Bacteria 3096
1184 Ga0495650_0051350 3300046471 Bacteria 1699
1185 Ga0495585_0000079 3300046492 Bacteria 100159
1186 Ga0495585_0000411 3300046492 Bacteria 41565
1187 Ga0495596_0000865 3300046500 Bacteria 18244
1188 Ga0495607_0011024 3300046501 Bacteria 6038
1189 Ga0495606_0000116 3300046507 Bacteria 134901
1190 Ga0495606_0011506 3300046507 Bacteria 7214
1191 Ga0495606_0012165 3300046507 Bacteria 6938
1192 Ga0495606_0014159 3300046507 Bacteria 6243
1193 Ga0495606_0017762 3300046507 Bacteria 5363
1194 Ga0495606_0023782 3300046507 Bacteria 4431
1195 Ga0495610_0000001 3300046512 Bacteria 1620061
1196 Ga0495610_0000992 3300046512 Bacteria 26173
1197 Ga0495610_0001007 3300046512 Bacteria 25962
1198 Ga0495610_0004188 3300046512 Bacteria 10774
1199 Ga0495616_0008226 3300046513 Bacteria 6192
1200 Ga0495616_0043233 3300046513 Bacteria 2289
1201 Ga0495616_0113617 3300046513 Bacteria 1256
1202 Ga0495618_0121596 3300046514 Bacteria 1672
1203 Ga0495628_0009018 3300046516 Bacteria 8534
1204 Ga0495630_0064766 3300046517 Bacteria 2747
1205 Ga0495630_0078966 3300046517 Bacteria 2482
1206 Ga0495632_0023621 3300046519 Bacteria 3280
1207 Ga0495637_0003326 3300046520 Bacteria 8549
1208 Ga0495643_0000506 3300046522 Bacteria 48801
1209 Ga0495643_0003411 3300046522 Bacteria 11675
1210 Ga0495648_0000879 3300046524 Bacteria 31662
1211 Ga0495648_0002877 3300046524 Bacteria 15501
1212 Ga0495663_0000406 3300046525 Bacteria 15767
1213 Ga0495654_0000001 3300046530 Bacteria 1513197
1214 Ga0495665_0104353 3300046531 Bacteria 1487
1215 Ga0495586_0131063 3300046535 Bacteria 1404
1216 Ga0495587_0064905 3300046536 Bacteria 2133
1217 Ga0495609_0000025 3300046538 Bacteria 256898
1218 Ga0495609_0015343 3300046538 Bacteria 3587
1219 Ga0495621_0012524 3300046539 Bacteria 2645
1220 Ga0495622_0014656 3300046557 Bacteria 3642
1221 Ga0495622_0036520 3300046557 Bacteria 2291
1222 Ga0495622_0060076 3300046557 Bacteria 1760
1223 Ga0495633_0000056 3300046558 Bacteria 149334
1224 Ga0495633_0000057 3300046558 Bacteria 148536
1225 Ga0495633_0000344 3300046558 Bacteria 51775
1226 Ga0495668_0000021 3300046616 Bacteria 381308
1227 Ga0495668_0000257 3300046616 Bacteria 75166
1228 Ga0495668_0001099 3300046616 Bacteria 28007
1229 Ga0495668_0004989 3300046616 Bacteria 9180
1230 Ga0495625_0000159 3300046660 Bacteria 104355
1231 Ga0495625_0001186 3300046660 Bacteria 33408
1232 Ga0495625_0002144 3300046660 Bacteria 21944
1233 Ga0495625_0005105 3300046660 Bacteria 12142
1234 Ga0495625_0008186 3300046660 Bacteria 8953
1235 Ga0495625_0019973 3300046660 Bacteria 5182
1236 Ga0495625_0033793 3300046660 Bacteria 3777
1237 Ga0495625_0119956 3300046660 Bacteria 1790
1238 Ga0495635_0137075 3300046663 Bacteria 1668
1239 Ga0495661_0001360 3300046665 Bacteria 20657
1240 Ga0495661_0015325 3300046665 Bacteria 5118
1241 Ga0495658_0025645 3300046683 Bacteria 3153
1242 Ga0495613_0146383 3300046689 Bacteria 1686
1243 Ga0495671_0071739 3300046692 Bacteria 1701
1244 Ga0495649_0000003 3300046694 Bacteria 880817
1245 Ga0495672_0002547 3300047320 Bacteria 16619
1246 Ga0495672_0024143 3300047320 Bacteria 3923
1247 Ga0495672_0066796 3300047320 Bacteria 2050
1248 Ga0495680_0045059 3300047322 Bacteria 3485
1249 Ga0495687_000179 3300047443 Bacteria 92387
1250 Ga0495687_002135 3300047443 Bacteria 16518
1251 Ga0495687_002367 3300047443 Bacteria 15256
1252 Ga0495675_0107839 3300047444 Bacteria 1740
1253 Ga0495684_0015951 3300047471 Bacteria 5786
1254 Ga0495686_0000010 3300047472 Bacteria 573229
1255 Ga0495686_0000160 3300047472 Bacteria 128437
1256 Ga0495686_0000234 3300047472 Bacteria 101539
1257 Ga0495686_0000489 3300047472 Bacteria 58459
1258 Ga0495686_0001122 3300047472 Bacteria 31676
1259 Ga0495686_0002126 3300047472 Bacteria 19394
1260 Ga0495686_0012985 3300047472 Bacteria 5804
1261 Ga0495686_0066077 3300047472 Bacteria 2236
1262 Ga0495686_0082255 3300047472 Bacteria 1965
1263 Ga0495686_0117769 3300047472 Bacteria 1586
1264 Ga0495614_0030275 3300048089 Bacteria 2329
1265 Ga0496103_0054877 3300048906 Bacteria 2470
1266 Ga0496104_0376680 3300048907 Bacteria 1332
1267 Ga0496109_0164106 3300048912 Unclassified 2082
1268 Ga0496109_0340329 3300048912 Bacteria 1417
1269 Ga0496110_0086573 3300048913 Bacteria 2798
1270 Ga0496111_0087451 3300048914 Bacteria 2281
1271 Ga0496113_0198306 3300048916 Bacteria 1595
1272 Ga0496114_0000412 3300048917 Bacteria 31760
1273 Ga0496115_0005714 3300048918 Bacteria 9055
1274 Ga0496115_0027455 3300048918 Bacteria 4452
1275 Ga0496115_0088816 3300048918 Bacteria 2524
1276 Ga0496116_0000047 3300048919 Bacteria 315121
1277 Ga0496116_0000266 3300048919 Bacteria 91468
1278 Ga0496116_0034662 3300048919 Bacteria 3557
1279 Ga0496117_0000365 3300048920 Bacteria 78847
1280 Ga0496118_0000672 3300048921 Bacteria 55573
1281 Ga0496118_0052195 3300048921 Bacteria 3122
1282 Ga0496119_0000227 3300048922 Bacteria 78848
1283 Ga0496121_0001581 3300048924 Bacteria 37894
1284 Ga0496121_0010116 3300048924 Bacteria 10693
1285 Ga0496122_0000045 3300048925 Bacteria 279912
1286 Ga0496122_0000277 3300048925 Bacteria 114200
1287 Ga0496122_0000668 3300048925 Bacteria 69054
1288 Ga0496122_0000698 3300048925 Bacteria 66677
1289 Ga0496122_0004620 3300048925 Bacteria 16941
1290 Ga0496122_0024722 3300048925 Bacteria 5247
1291 Ga0496122_0064153 3300048925 Bacteria 2674
1292 Ga0496123_0000728 3300048926 Bacteria 53516
1293 Ga0496123_0018435 3300048926 Bacteria 5554
1294 Ga0496124_0008911 3300048927 Bacteria 10400
1295 Ga0496124_0094661 3300048927 Bacteria 2429
1296 Ga0496125_0000050 3300048928 Bacteria 286703
1297 Ga0496125_0001041 3300048928 Bacteria 42891
1298 Ga0496125_0001313 3300048928 Bacteria 36792
1299 Ga0496126_0002717 3300048929 Bacteria 23390
1300 Ga0496126_0003177 3300048929 Bacteria 21151
1301 Ga0496126_0004416 3300048929 Bacteria 16838
1302 Ga0501298_001720 3300049521 Bacteria 3239
1303 Ga0501299_014295 3300049522 Bacteria 1379
1304 Ga0501032_0003483 3300049569 Bacteria 12039
1305 Ga0501033_0088258 3300049570 Bacteria 2269
1306 Ga0501033_0137637 3300049570 Bacteria 1767
1307 Ga0501034_0012481 3300049571 Bacteria 8775
1308 Ga0501034_0023798 3300049571 Bacteria 6237
1309 Ga0501034_0176353 3300049571 Bacteria 2103
1310 Ga0501036_0001169 3300049572 Bacteria 19962
1311 Ga0501037_0008589 3300049573 Bacteria 7492
1312 Ga0501037_0027220 3300049573 Bacteria 4223
1313 Ga0501038_0025547 3300049574 Bacteria 5264
1314 Ga0501038_0142314 3300049574 Bacteria 1961
1315 Ga0501039_0012075 3300049575 Bacteria 6586
1316 Ga0501039_0066169 3300049575 Bacteria 2805
1317 Ga0501043_0003386 3300049579 Bacteria 13133
1318 Ga0501043_0025390 3300049579 Bacteria 4649
1319 Ga0501043_0035477 3300049579 Bacteria 3922
1320 Ga0501043_0052405 3300049579 Bacteria 3205
1321 Ga0501046_0032815 3300049580 Bacteria 4201
1322 Ga0501046_0032890 3300049580 Bacteria 4196
1323 Ga0501047_0030028 3300049581 Bacteria 5240
1324 Ga0501047_0278566 3300049581 Bacteria 1517
1325 Ga0501067_0006422 3300049583 Bacteria 6513
1326 Ga0501067_0006775 3300049583 Bacteria 6354
1327 Ga0501069_0025041 3300049585 Bacteria 3259
1328 Ga0501070_0050057 3300049586 Bacteria 3469
1329 Ga0501072_0196270 3300049588 Bacteria 1610
1330 Ga0501073_0000839 3300049589 Bacteria 21859
1331 Ga0501073_0082775 3300049589 Bacteria 2233
1332 Ga0501074_0019469 3300049590 Bacteria 4929
1333 Ga0501201_000519 3300049651 Bacteria 3571
1334 Ga0501207_000155 3300049654 Bacteria 6350
1335 Ga0501210_000224 3300049657 Bacteria 2337
1336 Ga0501217_000256 3300049661 Bacteria 8309
1337 Ga0501223_000278 3300049663 Bacteria 12853
1338 Ga0501223_000532 3300049663 Bacteria 9180
1339 Ga0501223_013191 3300049663 Bacteria 1647
1340 Ga0501233_009188 3300049668 Bacteria 1924
1341 Ga0501235_009750 3300049669 Bacteria 2101
1342 Ga0501240_001884 3300049673 Bacteria 2129
1343 Ga0501243_001134 3300049675 Bacteria 3784
1344 Ga0501249_000009 3300049679 Bacteria 173938
1345 Ga0501249_003392 3300049679 Bacteria 3195
1346 Ga0501257_002266 3300049686 Bacteria 4035
1347 Ga0501259_000291 3300049688 Bacteria 7912
1348 Ga0501261_001011 3300049690 Bacteria 3451
1349 Ga0501221_000194 3300049704 Bacteria 8527
1350 Ga0501225_0003187 3300049705 Bacteria 5012
1351 Ga0501245_009025 3300049708 Bacteria 1427
1352 Ga0501079_0036852 3300049741 Bacteria 3767
1353 Ga0501083_0003883 3300049744 Bacteria 10494
1354 Ga0501083_0007152 3300049744 Bacteria 7922
1355 Ga0501241_001025 3300049758 Bacteria 5911
1356 Ga0501241_003468 3300049758 Bacteria 2977
1357 Ga0501241_003584 3300049758 Bacteria 2930
1358 Ga0501241_004068 3300049758 Bacteria 2751
1359 Ga0501266_000005 3300049763 Bacteria 346750
1360 Ga0501280_000686 3300049776 Bacteria 7481
1361 Ga0501035_0010433 3300049822 Bacteria 8611
1362 Ga0501035_0085782 3300049822 Bacteria 2775
1363 Ga0501044_0004241 3300049823 Bacteria 16092
1364 Ga0501044_0121188 3300049823 Bacteria 2616
1365 Ga0501044_0129100 3300049823 Bacteria 2523
1366 Ga0501044_0130494 3300049823 Bacteria 2507
1367 Ga0501044_0175672 3300049823 Bacteria 2111
1368 Ga0501044_0251193 3300049823 Bacteria 1709
1369 Ga0501284_00072 3300050005 Bacteria 30088
1370 nmdc:mga0k408_102378_c1 3300050493 Bacteria 1689
1371 nmdc:mga0k408_16257_c1 3300050493 Bacteria 4126
1372 nmdc:mga0k408_2327_c1 3300050493 Bacteria 10111
1373 nmdc:mga0k408_2685_c2 3300050493 Bacteria 2779
1374 nmdc:mga0k408_27353_c1 3300050493 Bacteria 3239
1375 nmdc:mga0k408_7355_c1 3300050493 Bacteria 5881
1376 nmdc:mga05p37_40325_c1 3300050507 Bacteria 5733
1377 nmdc:mga05p37_91937_c1 3300050507 Bacteria 3738
1378 nmdc:mga09592_174604_c1 3300050508 Bacteria 1859
1379 nmdc:mga09592_66506_c1 3300050508 Bacteria 3055
1380 nmdc:mga0qj67_32376_c1 3300050509 Bacteria 4077
1381 nmdc:mga06r32_4922_c1 3300050510 Bacteria 12034
1382 nmdc:mga06r32_70338_c1 3300050510 Bacteria 3384
1383 nmdc:mga08y16_171069_c1 3300050511 Bacteria 2256
1384 nmdc:mga08y16_54887_c1 3300050511 Bacteria 4164
1385 nmdc:mga08y16_57072_c1 3300050511 Bacteria 4081
1386 nmdc:mga08y16_77453_c1 3300050511 Bacteria 3467
1387 Ga0495612_0047800 3300053078 Bacteria 1754
1388 Ga0500635_0000883 3300053080 Bacteria 7288
1389 Ga0500578_0000010 3300053086 Bacteria 217642
1390 Ga0500578_0155323 3300053086 Bacteria 1423
1391 Ga0500644_0000127 3300053088 Bacteria 46652
1392 Ga0500646_0004247 3300053090 Bacteria 3630
1393 Ga0500583_0000064 3300053092 Bacteria 66001
1394 Ga0500583_0008434 3300053092 Bacteria 3698
1395 Ga0500583_0016023 3300053092 Bacteria 2982
1396 Ga0500583_0023006 3300053092 Bacteria 2620
1397 Ga0500651_0000230 3300053093 Bacteria 34750
1398 Ga0500641_0000027 3300053096 Bacteria 106908
1399 Ga0500641_0000289 3300053096 Bacteria 18776
1400 Ga0500641_0001919 3300053096 Bacteria 7371
1401 Ga0500556_0014297 3300053104 Bacteria 2421
1402 Ga0500562_000053 3300053108 Bacteria 58984
1403 Ga0500607_021068 3300053121 Bacteria 3676
1404 Ga0500608_018150 3300053122 Bacteria 3207
1405 Ga0500618_000003 3300053125 Bacteria 338706
1406 Ga0500559_0098817 3300053136 Bacteria 1343
1407 Ga0500568_0001188 3300053139 Bacteria 17406
1408 Ga0500568_0003322 3300053139 Bacteria 9060
1409 Ga0500577_0002076 3300053142 Bacteria 5115
1410 Ga0500588_0001245 3300053146 Bacteria 4742
1411 Ga0500590_036340 3300053148 Bacteria 2546
1412 Ga0500604_0003342 3300053151 Bacteria 4314
1413 Ga0500616_0000037 3300053153 Bacteria 390473
1414 Ga0500616_0002187 3300053153 Bacteria 16855
1415 Ga0500622_0000141 3300053156 Bacteria 76332
1416 Ga0500622_0000155 3300053156 Bacteria 72050
1417 Ga0500622_0000258 3300053156 Bacteria 53957
1418 Ga0500622_0000481 3300053156 Bacteria 37439
1419 Ga0500622_0004074 3300053156 Bacteria 9383
1420 Ga0500622_0007189 3300053156 Bacteria 6343
1421 Ga0500622_0007499 3300053156 Bacteria 6192
1422 Ga0500622_0084009 3300053156 Bacteria 1590
1423 Ga0500624_000167 3300053157 Bacteria 26625
1424 Ga0500627_0004961 3300053158 Bacteria 4357
1425 Ga0500627_0075512 3300053158 Bacteria 1498
1426 Ga0500634_0024399 3300053161 Bacteria 3289
1427 Ga0500611_000004 3300053727 Bacteria 253326
1428 Ga0500661_004470 3300055283 Bacteria 2616

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003578 Ga0006562J51391_1012235 Ga0006562J51391_10122352 344
2 3300025949 Ga0207667_10092593 Ga0207667_100925933 355
3 3300046471 Ga0495650_0051350 Ga0495650_0051350_49_1155 367
4 iso_pu_bacteria 2911138879 2911140313 367
5 3300017792 Ga0163161_10302341 Ga0163161_103023412 371
6 3300032004 Ga0307414_10129539 Ga0307414_101295392 374
7 3300048925 Ga0496122_0064153 Ga0496122_0064153_1303_2487 375
8 3300009553 Ga0105249_10021227 Ga0105249_100212275 376
9 3300025961 Ga0207712_10032321 Ga0207712_100323213 376
10 3300041511 Ga0451855_1803231 Ga0451855_1803231_52_1197 379
11 3300053136 Ga0500559_0098817 Ga0500559_0098817_22_1164 379
12 3300013100 Ga0157373_10000002 Ga0157373_1000000244 380
13 3300015261 Ga0182006_1000576 Ga0182006_100057623 380
14 3300037418 Ga0395900_0072380 Ga0395900_0072380_477_1685 380
15 3300053092 Ga0500583_0016023 Ga0500583_0016023_1828_2970 380
16 3300003781 Ga0055536_1000010 Ga0055536_1000010124 382
17 3300003791 Ga0055530_10002214 Ga0055530_100022143 382
18 3300015682 Ga0183373_1008 Ga0183373_1008163 382
19 3300025292 Ga0209676_1000009 Ga0209676_1000009751 382
20 3300025298 Ga0209050_1000103 Ga0209050_1000103122 382
21 3300032004 Ga0307414_10075521 Ga0307414_100755213 386
22 iso_pu_bacteria 2833640130 2833642258 386
23 3300009551 Ga0105238_10279964 Ga0105238_102799642 387
24 3300009553 Ga0105249_10024010 Ga0105249_100240107 388
25 2162886007 SwRhRL2b_contig_3047449 SwRhRL2b_0848.00000010 389
26 3300005289 Ga0065704_10073279 Ga0065704_100732795 389
27 iso_pu_bacteria 2898713307 2898713935 389
28 iso_pu_bacteria 2910245624 2910247849 389
29 iso_pu_bacteria 2721755487 2722726235 390
30 iso_pu_bacteria 2904780799 2904782842 390
31 iso_pu_bacteria 2919177583 2919180453 390
32 iso_pu_bacteria 2977232053 2977232886 390
33 iso_pu_bacteria 8055588893 8055591254 390
34 iso_pu_bacteria 2585427687 2586210423 391
35 iso_pu_bacteria 2739367651 2739587620 391
36 iso_pu_bacteria 2739367866 2740033893 391
37 iso_pu_bacteria 2818991437 2819545527 391
38 iso_pu_bacteria 2839989709 2839991375 391
39 iso_pu_bacteria 2842722452 2842724593 391
40 iso_pu_bacteria 2842903701 2842907174 391
41 iso_pu_bacteria 2842909656 2842911913 391
42 iso_pu_bacteria 2849281842 2849283552 391
43 iso_pu_bacteria 2852623160 2852623540 391
44 iso_pu_bacteria 2890737413 2890740744 391
45 iso_pu_bacteria 2896344016 2896345355 391
46 iso_pu_bacteria 2904445276 2904448022 391
47 iso_pu_bacteria 2945924605 2945927621 391
48 iso_pu_bacteria 2945997725 2945998547 391
49 iso_pu_bacteria 2954016120 2954021014 391
50 iso_pu_bacteria 2993372514 2993373950 391
51 3300036712 Ga0316584_0056089 Ga0316584_0056089_330_1511 392
52 3300037312 Ga0395899_0000411 Ga0395899_0000411_22980_24188 392
53 iso_pu_bacteria 2513020052 2513233497 392
54 iso_pu_bacteria 2519899754 2520878823 392
55 iso_pu_bacteria 2643221600 2644011466 392
56 iso_pu_bacteria 2643221667 2644369868 392
57 iso_pu_bacteria 2643221716 2644642290 392
58 iso_pu_bacteria 2643221725 2644685259 392
59 iso_pu_bacteria 2738541279 2738731945 392
60 iso_pu_bacteria 2738541285 2738764510 392
61 iso_pu_bacteria 2738541302 2738854136 392
62 iso_pu_bacteria 2738543007 2739213525 392
63 iso_pu_bacteria 2738543023 2739303027 392
64 iso_pu_bacteria 2739367857 2740000790 392
65 iso_pu_bacteria 2739367858 2740005606 392
66 iso_pu_bacteria 2802428842 2802654174 392
67 iso_pu_bacteria 2816332280 2817415801 392
68 iso_pu_bacteria 2818991460 2819680535 392
69 iso_pu_bacteria 2857613821 2857614539 392
70 iso_pu_bacteria 2857618242 2857619078 392
71 iso_pu_bacteria 2857627736 2857630511 392
72 iso_pu_bacteria 2881359912 2881360446 392
73 iso_pu_bacteria 2884634485 2884635190 392
74 iso_pu_bacteria 2884791551 2884798041 392
75 iso_pu_bacteria 2902048731 2902050710 392
76 iso_pu_bacteria 2903895155 2903898590 392
77 iso_pu_bacteria 2904419702 2904419827 392
78 iso_pu_bacteria 2904555929 2904556616 392
79 iso_pu_bacteria 2919191525 2919194059 392
80 iso_pu_bacteria 2919683626 2919688422 392
81 iso_pu_bacteria 2928147474 2928149514 392
82 iso_pu_bacteria 2929150217 2929153045 392
83 iso_pu_bacteria 2929177148 2929182829 392
84 iso_pu_bacteria 2929921140 2929927224 392
85 iso_pu_bacteria 2945977869 2945978784 392
86 iso_pu_bacteria 2946013367 2946015351 392
87 iso_pu_bacteria 2958458903 2958460899 392
88 iso_pu_bacteria 2977268062 2977269710 392
89 iso_pu_bacteria 8054307821 8054308225 392
90 iso_pu_bacteria 8055419101 8055421477 392
91 iso_pu_bacteria 8055592153 8055594050 392
92 iso_pu_bacteria 8056440228 8056441415 392
93 3300005338 Ga0068868_100009633 Ga0068868_1000096335 393
94 3300005466 Ga0070685_10048201 Ga0070685_100482012 393
95 3300005841 Ga0068863_100011467 Ga0068863_1000114673 393
96 3300013308 Ga0157375_10108003 Ga0157375_101080032 393
97 3300025321 Ga0207656_10078196 Ga0207656_100781962 393
98 3300026023 Ga0207677_10067060 Ga0207677_100670603 393
99 3300026088 Ga0207641_10015009 Ga0207641_100150093 393
100 iso_pu_bacteria 2511231000 2511234604 393
101 iso_pu_bacteria 2582581281 2585159122 393
102 iso_pu_bacteria 2582581282 2585163410 393
103 iso_pu_bacteria 2582581873 2585425261 393
104 iso_pu_bacteria 2585428060 2587749732 393
105 iso_pu_bacteria 2588253712 2588445873 393
106 iso_pu_bacteria 2588254257 2590611466 393
107 iso_pu_bacteria 2738541283 2738755878 393
108 iso_pu_bacteria 2738541284 2738761462 393
109 iso_pu_bacteria 2739367656 2739614667 393
110 iso_pu_bacteria 2739367663 2739648076 393
111 iso_pu_bacteria 2775506987 2776615907 393
112 iso_pu_bacteria 2840677318 2840677666 393
113 iso_pu_bacteria 2842083920 2842086517 393
114 iso_pu_bacteria 2852627209 2852628109 393
115 iso_pu_bacteria 2895498888 2895501672 393
116 iso_pu_bacteria 2896085136 2896085484 393
117 iso_pu_bacteria 2896109856 2896113688 393
118 iso_pu_bacteria 2896317667 2896320786 393
119 iso_pu_bacteria 2905999023 2906000612 393
120 iso_pu_bacteria 2919186247 2919188473 393
121 iso_pu_bacteria 2919399522 2919400618 393
122 iso_pu_bacteria 2919509842 2919512599 393
123 iso_pu_bacteria 2919692658 2919693353 393
124 iso_pu_bacteria 2928078545 2928080311 393
125 iso_pu_bacteria 2932082852 2932083345 393
126 iso_pu_bacteria 2939664404 2939667442 393
127 iso_pu_bacteria 2946019816 2946020766 393
128 iso_pu_bacteria 2958512119 2958513425 393
129 iso_pu_bacteria 2993480792 2993480851 393
130 iso_pu_bacteria 3003233435 3003234846 393
131 3300005289 Ga0065704_10070934 Ga0065704_100709346 394
132 3300009148 Ga0105243_10000009 Ga0105243_10000009269 394
133 3300025935 Ga0207709_10000026 Ga0207709_10000026270 394
134 3300037312 Ga0395899_0000033 Ga0395899_0000033_55854_57041 394
135 3300048919 Ga0496116_0034662 Ga0496116_0034662_2345_3529 394
136 3300053156 Ga0500622_0007189 Ga0500622_0007189_4718_5905 394
137 iso_pu_bacteria 2582581278 2585144550 394
138 iso_pu_bacteria 2585428045 2587677211 394
139 iso_pu_bacteria 2585428061 2587751805 394
140 iso_pu_bacteria 2585428115 2587943928 394
141 iso_pu_bacteria 2585428182 2588208744 394
142 iso_pu_bacteria 2585428183 2588212546 394
143 iso_pu_bacteria 2585428184 2588220121 394
144 iso_pu_bacteria 2585428185 2588224917 394
145 iso_pu_bacteria 2585428187 2588231805 394
146 iso_pu_bacteria 2588254255 2590602170 394
147 iso_pu_bacteria 2739367874 2740057089 394
148 iso_pu_bacteria 2765235839 2765572118 394
149 iso_pu_bacteria 2816332188 2816872329 394
150 iso_pu_bacteria 2818991444 2819585917 394
151 iso_pu_bacteria 2871720351 2871722952 394
152 iso_pu_bacteria 2883068021 2883071180 394
153 iso_pu_bacteria 2889290771 2889292410 394
154 iso_pu_bacteria 2929239360 2929244971 394
155 iso_pu_bacteria 2965320100 2965323712 394
156 iso_pu_bacteria 2977243572 2977246618 394
157 iso_pu_bacteria 2984572630 2984575556 394
158 iso_pu_bacteria 2984606641 2984609009 394
159 3300002737 JGI25162J39368_1001318 JGI25162J39368_10013188 395
160 3300002772 JGI25164J39214_1000855 JGI25164J39214_10008558 395
161 3300003323 rootH1_10002666 rootH1_1000266616 395
162 3300005288 Ga0065714_10068951 Ga0065714_100689512 395
163 3300005353 Ga0070669_100174934 Ga0070669_1001749342 395
164 3300005539 Ga0068853_100234405 Ga0068853_1002344052 395
165 3300005563 Ga0068855_100116249 Ga0068855_1001162494 395
166 3300005614 Ga0068856_100040048 Ga0068856_1000400484 395
167 3300005614 Ga0068856_100113608 Ga0068856_1001136083 395
168 3300005617 Ga0068859_100080263 Ga0068859_1000802632 395
169 3300005841 Ga0068863_100076978 Ga0068863_1000769782 395
170 3300005842 Ga0068858_100016470 Ga0068858_1000164705 395
171 3300005843 Ga0068860_100026307 Ga0068860_1000263074 395
172 3300005844 Ga0068862_100142298 Ga0068862_1001422982 395
173 3300006195 Ga0075366_10001072 Ga0075366_1000107211 395
174 3300006931 Ga0097620_100080264 Ga0097620_1000802642 395
175 3300009093 Ga0105240_10245699 Ga0105240_102456992 395
176 3300009176 Ga0105242_10121133 Ga0105242_101211332 395
177 3300009545 Ga0105237_10000963 Ga0105237_1000096315 395
178 3300009545 Ga0105237_10019011 Ga0105237_100190116 395
179 3300010375 Ga0105239_10000013 Ga0105239_10000013198 395
180 3300013100 Ga0157373_10000005 Ga0157373_10000005198 395
181 3300013100 Ga0157373_10032956 Ga0157373_100329562 395
182 3300013104 Ga0157370_10002361 Ga0157370_1000236123 395
183 3300013104 Ga0157370_10052885 Ga0157370_100528852 395
184 3300013104 Ga0157370_10117145 Ga0157370_101171452 395
185 3300013105 Ga0157369_10000046 Ga0157369_1000004689 395
186 3300013306 Ga0163162_10000037 Ga0163162_10000037117 395
187 3300013306 Ga0163162_10368026 Ga0163162_103680261 395
188 3300013307 Ga0157372_10018492 Ga0157372_100184923 395
189 3300013307 Ga0157372_10023207 Ga0157372_100232075 395
190 3300014497 Ga0182008_10000037 Ga0182008_1000003784 395
191 3300014497 Ga0182008_10000208 Ga0182008_1000020819 395
192 3300015261 Ga0182006_1000333 Ga0182006_100033330 395
193 3300015262 Ga0182007_10000009 Ga0182007_10000009120 395
194 3300017792 Ga0163161_10000343 Ga0163161_1000034330 395
195 3300025231 Ga0207427_100103 Ga0207427_10010325 395
196 3300025233 Ga0209437_100101 Ga0209437_10010146 395
197 3300025261 Ga0209233_1000124 Ga0209233_1000124190 395
198 3300025272 Ga0209455_1005644 Ga0209455_10056442 395
199 3300025911 Ga0207654_10019327 Ga0207654_100193272 395
200 3300025914 Ga0207671_10005976 Ga0207671_100059764 395
201 3300025923 Ga0207681_10102685 Ga0207681_101026852 395
202 3300025936 Ga0207670_10005454 Ga0207670_100054542 395
203 3300025961 Ga0207712_10050010 Ga0207712_100500102 395
204 3300026035 Ga0207703_10026323 Ga0207703_100263233 395
205 3300026078 Ga0207702_10024798 Ga0207702_100247983 395
206 3300026088 Ga0207641_10003172 Ga0207641_100031722 395
207 3300028381 Ga0268264_10013496 Ga0268264_100134965 395
208 3300028794 Ga0307515_10000927 Ga0307515_1000092718 395
209 3300031251 Ga0265327_10002514 Ga0265327_1000251413 395
210 3300031251 Ga0265327_10025709 Ga0265327_100257091 395
211 3300031507 Ga0307509_10045900 Ga0307509_100459003 395
212 3300031548 Ga0307408_100000564 Ga0307408_1000005647 395
213 3300031691 Ga0316579_10088628 Ga0316579_100886282 395
214 3300031728 Ga0316578_10044657 Ga0316578_100446574 395
215 3300031728 Ga0316578_10123818 Ga0316578_101238182 395
216 3300031731 Ga0307405_10000016 Ga0307405_10000016142 395
217 3300031733 Ga0316577_10114114 Ga0316577_101141142 395
218 3300031903 Ga0307407_10000006 Ga0307407_10000006106 395
219 3300031911 Ga0307412_10003359 Ga0307412_100033597 395
220 3300032002 Ga0307416_100000032 Ga0307416_10000003216 395
221 3300032004 Ga0307414_10000127 Ga0307414_1000012715 395
222 3300036647 Ga0316582_0005102 Ga0316582_0005102_942_2138 395
223 3300036712 Ga0316584_0052520 Ga0316584_0052520_838_2034 395
224 3300036712 Ga0316584_0246152 Ga0316584_0246152_61_1257 395
225 3300037418 Ga0395900_0109400 Ga0395900_0109400_1618_2805 395
226 3300037471 Ga0395905_0001914 Ga0395905_0001914_4957_6144 395
227 3300042876 Ga0451577_0000042 Ga0451577_0000042_64576_65793 395
228 3300042876 Ga0451577_0016491 Ga0451577_0016491_3071_4264 395
229 3300042876 Ga0451577_0066330 Ga0451577_0066330_576_1766 395
230 3300042876 Ga0451577_0103906 Ga0451577_0103906_1095_2300 395
231 3300044673 Ga0453683_0000680 Ga0453683_0000680_25605_26798 395
232 3300044673 Ga0453683_0008542 Ga0453683_0008542_4190_5377 395
233 3300044712 Ga0453684_0000452 Ga0453684_0000452_31912_33129 395
234 3300044712 Ga0453684_0004934 Ga0453684_0004934_24475_25665 395
235 3300044712 Ga0453684_0008008 Ga0453684_0008008_15398_16585 395
236 3300044712 Ga0453684_0034365 Ga0453684_0034365_76_1269 395
237 3300045051 Ga0451576_0000254 Ga0451576_0000254_31926_33143 395
238 3300045051 Ga0451576_0009640 Ga0451576_0009640_929_2134 395
239 3300045051 Ga0451576_0047009 Ga0451576_0047009_1005_2192 395
240 3300045051 Ga0451576_0059430 Ga0451576_0059430_2458_3648 395
241 3300045051 Ga0451576_0087081 Ga0451576_0087081_1979_3172 395
242 3300046462 Ga0495651_0045960 Ga0495651_0045960_1938_3125 395
243 3300046512 Ga0495610_0001007 Ga0495610_0001007_2616_3803 395
244 3300046520 Ga0495637_0003326 Ga0495637_0003326_1864_3051 395
245 3300046525 Ga0495663_0000406 Ga0495663_0000406_13397_14584 395
246 3300046558 Ga0495633_0000056 Ga0495633_0000056_46869_48065 395
247 3300046660 Ga0495625_0002144 Ga0495625_0002144_8848_10044 395
248 3300046665 Ga0495661_0001360 Ga0495661_0001360_13079_14278 395
249 3300047472 Ga0495686_0000489 Ga0495686_0000489_31684_32871 395
250 3300047472 Ga0495686_0082255 Ga0495686_0082255_663_1850 395
251 3300049708 Ga0501245_009025 Ga0501245_009025_85_1299 395
252 3300050493 nmdc:mga0k408_2327_c1 nmdc:mga0k408_2327_c1_4267_5457 395
253 3300050493 nmdc:mga0k408_2685_c2 nmdc:mga0k408_2685_c2_1559_2746 395
254 3300053122 Ga0500608_018150 Ga0500608_018150_1931_3127 395
255 3300053125 Ga0500618_000003 Ga0500618_000003_100281_101477 395
256 iso_pu_bacteria 2522125168 2522549498 395
257 iso_pu_bacteria 2738541273 2738698530 395
258 iso_pu_bacteria 2738543014 2739252856 395
259 iso_pu_bacteria 2914759650 2914763111 395
260 iso_pu_bacteria 8003151029 8003151102 395
261 3300001979 JGI24740J21852_10004979 JGI24740J21852_100049794 396
262 3300001989 JGI24739J22299_10004155 JGI24739J22299_100041555 396
263 3300002738 JGI25154J39366_1000047 JGI25154J39366_100004763 396
264 3300002739 JGI25158J39367_1004804 JGI25158J39367_10048042 396
265 3300002741 JGI25157J39369_1002465 JGI25157J39369_10024652 396
266 3300003215 JGI25153J46596_10007229 JGI25153J46596_100072294 396
267 3300003354 JGI25160J50197_1006733 JGI25160J50197_10067334 396
268 3300005289 Ga0065704_10071262 Ga0065704_100712623 396
269 3300005289 Ga0065704_10095111 Ga0065704_100951112 396
270 3300005289 Ga0065704_10098586 Ga0065704_100985862 396
271 3300005293 Ga0065715_10165505 Ga0065715_101655052 396
272 3300005339 Ga0070660_100015693 Ga0070660_1000156934 396
273 3300005354 Ga0070675_100059652 Ga0070675_1000596523 396
274 3300005466 Ga0070685_10117310 Ga0070685_101173102 396
275 3300005618 Ga0068864_100043993 Ga0068864_1000439934 396
276 3300005841 Ga0068863_100302941 Ga0068863_1003029412 396
277 3300006237 Ga0097621_100068802 Ga0097621_1000688022 396
278 3300006358 Ga0068871_100039588 Ga0068871_1000395882 396
279 3300006844 Ga0075428_100011907 Ga0075428_1000119077 396
280 3300006846 Ga0075430_100004975 Ga0075430_1000049756 396
281 3300006847 Ga0075431_100026391 Ga0075431_1000263916 396
282 3300006942 Ga0099824_1002886 Ga0099824_100288612 396
283 3300006946 Ga0079104_1000179 Ga0079104_100017961 396
284 3300006948 Ga0099826_10037265 Ga0099826_100372653 396
285 3300009011 Ga0105251_10043569 Ga0105251_100435692 396
286 3300009036 Ga0105244_10000004 Ga0105244_10000004374 396
287 3300009101 Ga0105247_10000918 Ga0105247_100009189 396
288 3300013102 Ga0157371_10000046 Ga0157371_1000004697 396
289 3300013102 Ga0157371_10002552 Ga0157371_100025529 396
290 3300013104 Ga0157370_10003236 Ga0157370_100032369 396
291 3300013104 Ga0157370_10023049 Ga0157370_100230493 396
292 3300013104 Ga0157370_10074178 Ga0157370_100741782 396
293 3300013104 Ga0157370_10196518 Ga0157370_101965182 396
294 3300013104 Ga0157370_10208645 Ga0157370_102086452 396
295 3300013105 Ga0157369_10002262 Ga0157369_1000226224 396
296 3300013105 Ga0157369_10013763 Ga0157369_100137639 396
297 3300013306 Ga0163162_10180543 Ga0163162_101805432 396
298 3300013307 Ga0157372_10000001 Ga0157372_10000001383 396
299 3300014969 Ga0157376_10045090 Ga0157376_100450902 396
300 3300015261 Ga0182006_1007354 Ga0182006_10073545 396
301 3300015261 Ga0182006_1008043 Ga0182006_10080435 396
302 3300017792 Ga0163161_10000007 Ga0163161_10000007168 396
303 3300017792 Ga0163161_10039788 Ga0163161_100397883 396
304 3300020077 Ga0206351_10868731 Ga0206351_108687312 396
305 3300020610 Ga0154015_1577688 Ga0154015_15776882 396
306 3300022467 Ga0224712_10004532 Ga0224712_100045322 396
307 3300025208 Ga0209436_101725 Ga0209436_1017255 396
308 3300025246 Ga0209646_1000003 Ga0209646_1000003849 396
309 3300025250 Ga0209026_1000244 Ga0209026_100024432 396
310 3300025284 Ga0209130_1002722 Ga0209130_10027226 396
311 3300025297 Ga0209758_1013178 Ga0209758_10131783 396
312 3300025302 Ga0207426_1000341 Ga0207426_100034155 396
313 3300025302 Ga0207426_1000455 Ga0207426_100045514 396
314 3300025728 Ga0207655_1000008 Ga0207655_1000008214 396
315 3300025735 Ga0207713_1046416 Ga0207713_10464162 396
316 3300025893 Ga0207682_10073287 Ga0207682_100732871 396
317 3300025900 Ga0207710_10001124 Ga0207710_100011246 396
318 3300025919 Ga0207657_10029952 Ga0207657_100299525 396
319 3300025926 Ga0207659_10011402 Ga0207659_100114027 396
320 3300025934 Ga0207686_10017976 Ga0207686_100179763 396
321 3300025936 Ga0207670_10091135 Ga0207670_100911352 396
322 3300025940 Ga0207691_10059353 Ga0207691_100593532 396
323 3300026088 Ga0207641_10197553 Ga0207641_101975532 396
324 3300026095 Ga0207676_10042623 Ga0207676_100426233 396
325 3300027111 Ga0209281_1000116 Ga0209281_100011683 396
326 3300027361 Ga0209489_117024 Ga0209489_1170244 396
327 3300027666 Ga0209282_1038144 Ga0209282_10381441 396
328 3300031251 Ga0265327_10006450 Ga0265327_100064508 396
329 3300031251 Ga0265327_10085890 Ga0265327_100858901 396
330 3300031548 Ga0307408_100040113 Ga0307408_1000401132 396
331 3300031731 Ga0307405_10000002 Ga0307405_10000002331 396
332 3300031824 Ga0307413_10000019 Ga0307413_1000001932 396
333 3300031852 Ga0307410_10000115 Ga0307410_100001154 396
334 3300031901 Ga0307406_10000111 Ga0307406_100001114 396
335 3300031903 Ga0307407_10001642 Ga0307407_100016423 396
336 3300032004 Ga0307414_10000001 Ga0307414_10000001772 396
337 3300032004 Ga0307414_10035636 Ga0307414_100356363 396
338 3300032004 Ga0307414_10068187 Ga0307414_100681872 396
339 3300032005 Ga0307411_10000013 Ga0307411_1000001370 396
340 3300033180 Ga0307510_10023468 Ga0307510_100234687 396
341 3300037312 Ga0395899_0000435 Ga0395899_0000435_8220_9413 396
342 3300038443 Ga0395901_0030985 Ga0395901_0030985_4197_5399 396
343 3300041407 Ga0439447_003769 Ga0439447_003769_2524_3717 396
344 3300041411 Ga0439466_0015063 Ga0439466_0015063_82_1275 396
345 3300041456 Ga0451795_0356222 Ga0451795_0356222_334_1524 396
346 3300041511 Ga0451855_1236631 Ga0451855_1236631_2183_3379 396
347 3300042876 Ga0451577_0005315 Ga0451577_0005315_4423_5628 396
348 3300042876 Ga0451577_0077739 Ga0451577_0077739_1154_2359 396
349 3300044658 Ga0466972_0076144 Ga0466972_0076144_61_1251 396
350 3300044712 Ga0453684_0037166 Ga0453684_0037166_3668_4858 396
351 3300045049 Ga0466959_0055794 Ga0466959_0055794_1511_2701 396
352 3300046507 Ga0495606_0011506 Ga0495606_0011506_5159_6352 396
353 3300046512 Ga0495610_0000992 Ga0495610_0000992_768_1958 396
354 3300046513 Ga0495616_0043233 Ga0495616_0043233_664_1857 396
355 3300046522 Ga0495643_0000506 Ga0495643_0000506_16294_17487 396
356 3300046539 Ga0495621_0012524 Ga0495621_0012524_405_1607 396
357 3300046660 Ga0495625_0008186 Ga0495625_0008186_546_1739 396
358 3300046692 Ga0495671_0071739 Ga0495671_0071739_245_1438 396
359 3300048918 Ga0496115_0027455 Ga0496115_0027455_1205_2398 396
360 3300048918 Ga0496115_0088816 Ga0496115_0088816_1153_2343 396
361 3300048919 Ga0496116_0000047 Ga0496116_0000047_269346_270539 396
362 3300048921 Ga0496118_0052195 Ga0496118_0052195_1375_2568 396
363 3300048924 Ga0496121_0010116 Ga0496121_0010116_2488_3681 396
364 3300048927 Ga0496124_0008911 Ga0496124_0008911_2162_3355 396
365 3300048928 Ga0496125_0000050 Ga0496125_0000050_45485_46678 396
366 3300048928 Ga0496125_0001041 Ga0496125_0001041_18268_19461 396
367 3300048929 Ga0496126_0003177 Ga0496126_0003177_9012_10205 396
368 3300048929 Ga0496126_0004416 Ga0496126_0004416_12300_13493 396
369 3300049570 Ga0501033_0137637 Ga0501033_0137637_261_1451 396
370 3300049679 Ga0501249_000009 Ga0501249_000009_82588_83781 396
371 3300049679 Ga0501249_003392 Ga0501249_003392_889_2082 396
372 3300049758 Ga0501241_003584 Ga0501241_003584_1043_2236 396
373 3300049763 Ga0501266_000005 Ga0501266_000005_22223_23416 396
374 3300049776 Ga0501280_000686 Ga0501280_000686_3274_4467 396
375 3300050507 nmdc:mga05p37_91937_c1 nmdc:mga05p37_91937_c1_2144_3409 396
376 3300050508 nmdc:mga09592_174604_c1 nmdc:mga09592_174604_c1_380_1645 396
377 3300050509 nmdc:mga0qj67_32376_c1 nmdc:mga0qj67_32376_c1_841_2106 396
378 3300050510 nmdc:mga06r32_70338_c1 nmdc:mga06r32_70338_c1_500_1765 396
379 3300053096 Ga0500641_0000027 Ga0500641_0000027_62614_63807 396
380 3300053096 Ga0500641_0000289 Ga0500641_0000289_1586_2779 396
381 3300053096 Ga0500641_0001919 Ga0500641_0001919_5364_6557 396
382 3300053156 Ga0500622_0084009 Ga0500622_0084009_31_1224 396
383 iso_pu_bacteria 2599185184 2599478631 396
384 iso_pu_bacteria 2738541278 2738724679 396
385 iso_pu_bacteria 2818991442 2819572472 396
386 iso_pu_bacteria 2821136567 2821140143 396
387 iso_pu_bacteria 2904467357 2904472265 396
388 iso_pu_bacteria 2919437846 2919441315 396
389 iso_pu_bacteria 2929154850 2929159320 396
390 3300001990 JGI24737J22298_10002176 JGI24737J22298_100021763 397
391 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002313 397
392 3300002773 JGI25152J39213_1000007 JGI25152J39213_1000007123 397
393 3300002774 JGI25150J39212_1000013 JGI25150J39212_1000013147 397
394 3300003187 JGI25151J46595_10000004 JGI25151J46595_1000000423 397
395 3300003215 JGI25153J46596_10000004 JGI25153J46596_1000000423 397
396 3300003320 rootH2_10005719 rootH2_1000571985 397
397 3300003761 Ga0055535_1001731 Ga0055535_10017315 397
398 3300003762 Ga0055542_1004590 Ga0055542_10045903 397
399 3300005288 Ga0065714_10003996 Ga0065714_100039965 397
400 3300005288 Ga0065714_10064770 Ga0065714_1006477017 397
401 3300005288 Ga0065714_10081337 Ga0065714_100813372 397
402 3300005289 Ga0065704_10070374 Ga0065704_1007037429 397
403 3300005290 Ga0065712_10099197 Ga0065712_100991972 397
404 3300005328 Ga0070676_10000277 Ga0070676_100002774 397
405 3300005331 Ga0070670_100188523 Ga0070670_1001885232 397
406 3300005340 Ga0070689_100299370 Ga0070689_1002993701 397
407 3300005343 Ga0070687_100069461 Ga0070687_1000694611 397
408 3300005364 Ga0070673_100003782 Ga0070673_1000037822 397
409 3300005456 Ga0070678_100006236 Ga0070678_1000062367 397
410 3300005457 Ga0070662_100000032 Ga0070662_10000003254 397
411 3300005459 Ga0068867_100009759 Ga0068867_1000097594 397
412 3300005466 Ga0070685_10072252 Ga0070685_100722522 397
413 3300005539 Ga0068853_100008727 Ga0068853_1000087272 397
414 3300005544 Ga0070686_100048162 Ga0070686_1000481622 397
415 3300005548 Ga0070665_100000003 Ga0070665_100000003690 397
416 3300005563 Ga0068855_100000508 Ga0068855_10000050814 397
417 3300005563 Ga0068855_100032170 Ga0068855_1000321704 397
418 3300005616 Ga0068852_100002452 Ga0068852_1000024522 397
419 3300005719 Ga0068861_100268986 Ga0068861_1002689862 397
420 3300006195 Ga0075366_10106071 Ga0075366_101060712 397
421 3300006237 Ga0097621_100000165 Ga0097621_10000016519 397
422 3300006358 Ga0068871_100000018 Ga0068871_10000001824 397
423 3300006881 Ga0068865_100000396 Ga0068865_1000003965 397
424 3300009093 Ga0105240_10022011 Ga0105240_100220119 397
425 3300009174 Ga0105241_10007004 Ga0105241_100070044 397
426 3300009174 Ga0105241_10030640 Ga0105241_100306402 397
427 3300009176 Ga0105242_10036683 Ga0105242_100366834 397
428 3300009545 Ga0105237_10000729 Ga0105237_1000072910 397
429 3300009545 Ga0105237_10001948 Ga0105237_1000194810 397
430 3300009545 Ga0105237_10008222 Ga0105237_100082223 397
431 3300009551 Ga0105238_10037769 Ga0105238_100377694 397
432 3300009551 Ga0105238_10203974 Ga0105238_102039742 397
433 3300009553 Ga0105249_10115485 Ga0105249_101154852 397
434 3300010375 Ga0105239_10000002 Ga0105239_10000002397 397
435 3300010375 Ga0105239_10150086 Ga0105239_101500863 397
436 3300013100 Ga0157373_10000256 Ga0157373_100002566 397
437 3300013100 Ga0157373_10000936 Ga0157373_100009366 397
438 3300013100 Ga0157373_10001318 Ga0157373_1000131811 397
439 3300013100 Ga0157373_10087296 Ga0157373_100872962 397
440 3300013100 Ga0157373_10219732 Ga0157373_102197321 397
441 3300013102 Ga0157371_10000079 Ga0157371_100000795 397
442 3300013102 Ga0157371_10017592 Ga0157371_100175921 397
443 3300013102 Ga0157371_10017639 Ga0157371_100176391 397
444 3300013104 Ga0157370_10001014 Ga0157370_1000101420 397
445 3300013104 Ga0157370_10007303 Ga0157370_100073035 397
446 3300013104 Ga0157370_10022590 Ga0157370_100225903 397
447 3300013104 Ga0157370_10030370 Ga0157370_100303701 397
448 3300013104 Ga0157370_10120995 Ga0157370_101209952 397
449 3300013104 Ga0157370_10121149 Ga0157370_101211492 397
450 3300013104 Ga0157370_10277171 Ga0157370_102771712 397
451 3300013105 Ga0157369_10002118 Ga0157369_100021186 397
452 3300013105 Ga0157369_10023605 Ga0157369_100236053 397
453 3300013105 Ga0157369_10061645 Ga0157369_100616454 397
454 3300013296 Ga0157374_10000348 Ga0157374_1000034816 397
455 3300013297 Ga0157378_10035235 Ga0157378_100352354 397
456 3300013297 Ga0157378_10057795 Ga0157378_100577952 397
457 3300013306 Ga0163162_10000031 Ga0163162_1000003196 397
458 3300013306 Ga0163162_10141494 Ga0163162_101414942 397
459 3300013307 Ga0157372_10038494 Ga0157372_100384942 397
460 3300013308 Ga0157375_10000722 Ga0157375_1000072212 397
461 3300013308 Ga0157375_10033488 Ga0157375_100334885 397
462 3300013308 Ga0157375_10136084 Ga0157375_101360843 397
463 3300013308 Ga0157375_10525828 Ga0157375_105258281 397
464 3300014326 Ga0157380_10000165 Ga0157380_1000016526 397
465 3300014497 Ga0182008_10000025 Ga0182008_10000025127 397
466 3300014497 Ga0182008_10000058 Ga0182008_1000005882 397
467 3300015261 Ga0182006_1000039 Ga0182006_100003930 397
468 3300015261 Ga0182006_1002025 Ga0182006_10020256 397
469 3300015261 Ga0182006_1003058 Ga0182006_10030588 397
470 3300015261 Ga0182006_1003255 Ga0182006_10032558 397
471 3300017792 Ga0163161_10000628 Ga0163161_1000062825 397
472 3300017792 Ga0163161_10001101 Ga0163161_1000110122 397
473 3300017792 Ga0163161_10002195 Ga0163161_100021957 397
474 3300017792 Ga0163161_10196122 Ga0163161_101961221 397
475 3300025242 Ga0209258_100068 Ga0209258_100068121 397
476 3300025245 Ga0207425_1000008 Ga0207425_1000008409 397
477 3300025246 Ga0209646_1010115 Ga0209646_10101152 397
478 3300025250 Ga0209026_1000222 Ga0209026_10002222 397
479 3300025254 Ga0209148_1000182 Ga0209148_1000182113 397
480 3300025258 Ga0209129_1000042 Ga0209129_1000042144 397
481 3300025294 Ga0209025_1000020 Ga0209025_1000020409 397
482 3300025297 Ga0209758_1000022 Ga0209758_1000022409 397
483 3300025904 Ga0207647_10050404 Ga0207647_100504042 397
484 3300025907 Ga0207645_10000650 Ga0207645_1000065019 397
485 3300025911 Ga0207654_10012469 Ga0207654_100124694 397
486 3300025913 Ga0207695_10005995 Ga0207695_100059959 397
487 3300025913 Ga0207695_10012058 Ga0207695_100120588 397
488 3300025914 Ga0207671_10001789 Ga0207671_1000178910 397
489 3300025925 Ga0207650_10141491 Ga0207650_101414912 397
490 3300025927 Ga0207687_10258044 Ga0207687_102580441 397
491 3300025933 Ga0207706_10000191 Ga0207706_1000019116 397
492 3300025936 Ga0207670_10106251 Ga0207670_101062512 397
493 3300025938 Ga0207704_10000053 Ga0207704_1000005320 397
494 3300025942 Ga0207689_10190025 Ga0207689_101900252 397
495 3300025949 Ga0207667_10009017 Ga0207667_100090174 397
496 3300025949 Ga0207667_10054870 Ga0207667_100548704 397
497 3300025961 Ga0207712_10025404 Ga0207712_100254042 397
498 3300026023 Ga0207677_10202809 Ga0207677_102028091 397
499 3300026041 Ga0207639_10006469 Ga0207639_100064692 397
500 3300026041 Ga0207639_10080730 Ga0207639_100807303 397
501 3300026089 Ga0207648_10000175 Ga0207648_1000017526 397
502 3300026118 Ga0207675_100262591 Ga0207675_1002625912 397
503 3300026121 Ga0207683_10080928 Ga0207683_100809282 397
504 3300026142 Ga0207698_10004722 Ga0207698_100047222 397
505 3300028379 Ga0268266_10000018 Ga0268266_1000001810 397
506 3300028786 Ga0307517_10002197 Ga0307517_1000219725 397
507 3300029957 Ga0265324_10018826 Ga0265324_100188262 397
508 3300031548 Ga0307408_100000310 Ga0307408_10000031045 397
509 3300031548 Ga0307408_100000534 Ga0307408_10000053417 397
510 3300031727 Ga0316576_10047393 Ga0316576_100473932 397
511 3300031728 Ga0316578_10057303 Ga0316578_100573033 397
512 3300031911 Ga0307412_10000001 Ga0307412_10000001439 397
513 3300031911 Ga0307412_10000034 Ga0307412_10000034166 397
514 3300031911 Ga0307412_10000154 Ga0307412_1000015444 397
515 3300032002 Ga0307416_100000030 Ga0307416_100000030124 397
516 3300032004 Ga0307414_10000392 Ga0307414_1000039220 397
517 3300032004 Ga0307414_10001064 Ga0307414_100010645 397
518 3300032004 Ga0307414_10001471 Ga0307414_100014712 397
519 3300032004 Ga0307414_10178501 Ga0307414_101785012 397
520 3300033180 Ga0307510_10000328 Ga0307510_1000032833 397
521 3300036712 Ga0316584_0026927 Ga0316584_0026927_2155_3363 397
522 3300037312 Ga0395899_0001077 Ga0395899_0001077_8107_9300 397
523 3300037418 Ga0395900_0003225 Ga0395900_0003225_4321_5514 397
524 3300037466 Ga0395898_0013831 Ga0395898_0013831_5777_6970 397
525 3300037471 Ga0395905_0034426 Ga0395905_0034426_2455_3648 397
526 3300038443 Ga0395901_0017854 Ga0395901_0017854_3870_5063 397
527 3300039447 Ga0436361_0307685 Ga0436361_0307685_4506_5699 397
528 3300042004 Ga0439445_0003161 Ga0439445_0003161_1209_2435 397
529 3300042005 Ga0439448_0004334 Ga0439448_0004334_1323_2516 397
530 3300042012 Ga0439455_0019582 Ga0439455_0019582_245_1438 397
531 3300042876 Ga0451577_0000418 Ga0451577_0000418_37303_38496 397
532 3300042876 Ga0451577_0047761 Ga0451577_0047761_1903_3096 397
533 3300042876 Ga0451577_0098078 Ga0451577_0098078_235_1428 397
534 3300042876 Ga0451577_0158178 Ga0451577_0158178_26_1219 397
535 3300044658 Ga0466972_0000001 Ga0466972_0000001_224670_225863 397
536 3300044673 Ga0453683_0000286 Ga0453683_0000286_38523_39716 397
537 3300044673 Ga0453683_0000572 Ga0453683_0000572_22903_24096 397
538 3300044673 Ga0453683_0019047 Ga0453683_0019047_3022_4215 397
539 3300044673 Ga0453683_0183173 Ga0453683_0183173_36_1229 397
540 3300044712 Ga0453684_0001431 Ga0453684_0001431_66914_68107 397
541 3300044712 Ga0453684_0001697 Ga0453684_0001697_38527_39720 397
542 3300044712 Ga0453684_0002271 Ga0453684_0002271_29882_31075 397
543 3300044712 Ga0453684_0005946 Ga0453684_0005946_19012_20205 397
544 3300044712 Ga0453684_0024385 Ga0453684_0024385_6445_7638 397
545 3300044719 Ga0466971_0014790 Ga0466971_0014790_1988_3181 397
546 3300044765 Ga0466970_0000495 Ga0466970_0000495_1532_2725 397
547 3300045049 Ga0466959_0000446 Ga0466959_0000446_1152_2345 397
548 3300045051 Ga0451576_0000589 Ga0451576_0000589_38527_39720 397
549 3300045051 Ga0451576_0001052 Ga0451576_0001052_19845_21038 397
550 3300045051 Ga0451576_0044662 Ga0451576_0044662_2586_3779 397
551 3300045051 Ga0451576_0111131 Ga0451576_0111131_1235_2428 397
552 3300045051 Ga0451576_0152198 Ga0451576_0152198_456_1649 397
553 3300045836 Ga0466958_0082156 Ga0466958_0082156_541_1734 397
554 3300046453 Ga0495627_006812 Ga0495627_006812_1430_2626 397
555 3300046453 Ga0495627_045014 Ga0495627_045014_23_1249 397
556 3300046457 Ga0495590_0005877 Ga0495590_0005877_283_1476 397
557 3300046501 Ga0495607_0011024 Ga0495607_0011024_406_1602 397
558 3300046512 Ga0495610_0000001 Ga0495610_0000001_923697_924890 397
559 3300047320 Ga0495672_0024143 Ga0495672_0024143_2558_3751 397
560 3300047443 Ga0495687_002367 Ga0495687_002367_9947_11140 397
561 3300048925 Ga0496122_0000668 Ga0496122_0000668_53533_54726 397
562 3300048926 Ga0496123_0000728 Ga0496123_0000728_14145_15338 397
563 3300049570 Ga0501033_0088258 Ga0501033_0088258_951_2162 397
564 3300049758 Ga0501241_003468 Ga0501241_003468_1616_2809 397
565 3300049758 Ga0501241_004068 Ga0501241_004068_679_1872 397
566 3300049823 Ga0501044_0121188 Ga0501044_0121188_255_1466 397
567 3300049823 Ga0501044_0175672 Ga0501044_0175672_541_1734 397
568 3300050493 nmdc:mga0k408_102378_c1 nmdc:mga0k408_102378_c1_384_1580 397
569 3300050493 nmdc:mga0k408_7355_c1 nmdc:mga0k408_7355_c1_2650_3846 397
570 3300053088 Ga0500644_0000127 Ga0500644_0000127_39188_40381 397
571 3300053090 Ga0500646_0004247 Ga0500646_0004247_324_1517 397
572 3300053093 Ga0500651_0000230 Ga0500651_0000230_14608_15801 397
573 3300053121 Ga0500607_021068 Ga0500607_021068_2135_3328 397
574 3300053142 Ga0500577_0002076 Ga0500577_0002076_1659_2852 397
575 3300053148 Ga0500590_036340 Ga0500590_036340_510_1703 397
576 3300053153 Ga0500616_0002187 Ga0500616_0002187_6642_7835 397
577 iso_pu_bacteria 2881955468 2881957556 397
578 iso_pu_bacteria 2884933994 2884937559 397
579 3300001989 JGI24739J22299_10005815 JGI24739J22299_100058153 398
580 3300003316 rootH1_10160863 rootH1_101608634 398
581 3300003320 rootH2_10006783 rootH2_100067838 398
582 3300003320 rootH2_10061691 rootH2_100616913 398
583 3300003322 rootL2_10338439 rootL2_103384392 398
584 3300003323 rootH1_10230439 rootH1_102304393 398
585 3300003354 JGI25160J50197_1000981 JGI25160J50197_10009812 398
586 3300003578 Ga0006562J51391_1026618 Ga0006562J51391_10266182 398
587 3300003771 Ga0055526_1008317 Ga0055526_10083174 398
588 3300003790 Ga0055528_1000701 Ga0055528_100070117 398
589 3300003791 Ga0055530_10000911 Ga0055530_100009116 398
590 3300004799 Ga0058863_11371296 Ga0058863_113712963 398
591 3300004803 Ga0058862_12893042 Ga0058862_128930423 398
592 3300005262 Ga0065165_1000725 Ga0065165_10007254 398
593 3300005288 Ga0065714_10067085 Ga0065714_100670854 398
594 3300005289 Ga0065704_10074546 Ga0065704_100745466 398
595 3300005289 Ga0065704_10082725 Ga0065704_100827252 398
596 3300005327 Ga0070658_10115992 Ga0070658_101159923 398
597 3300005327 Ga0070658_10224479 Ga0070658_102244792 398
598 3300005327 Ga0070658_10278492 Ga0070658_102784921 398
599 3300005329 Ga0070683_100004268 Ga0070683_1000042684 398
600 3300005334 Ga0068869_100000827 Ga0068869_1000008276 398
601 3300005334 Ga0068869_100007558 Ga0068869_1000075582 398
602 3300005335 Ga0070666_10000323 Ga0070666_1000032314 398
603 3300005336 Ga0070680_100010203 Ga0070680_1000102037 398
604 3300005336 Ga0070680_100138593 Ga0070680_1001385933 398
605 3300005336 Ga0070680_100250961 Ga0070680_1002509612 398
606 3300005337 Ga0070682_100000625 Ga0070682_10000062515 398
607 3300005339 Ga0070660_100130765 Ga0070660_1001307652 398
608 3300005340 Ga0070689_100028711 Ga0070689_1000287112 398
609 3300005341 Ga0070691_10020602 Ga0070691_100206022 398
610 3300005344 Ga0070661_100011068 Ga0070661_1000110682 398
611 3300005347 Ga0070668_100041596 Ga0070668_1000415962 398
612 3300005354 Ga0070675_100036218 Ga0070675_1000362183 398
613 3300005355 Ga0070671_100030050 Ga0070671_1000300504 398
614 3300005364 Ga0070673_100149118 Ga0070673_1001491183 398
615 3300005365 Ga0070688_100012071 Ga0070688_1000120713 398
616 3300005366 Ga0070659_100002083 Ga0070659_1000020836 398
617 3300005366 Ga0070659_100018139 Ga0070659_1000181392 398
618 3300005367 Ga0070667_100244374 Ga0070667_1002443742 398
619 3300005458 Ga0070681_10018726 Ga0070681_100187262 398
620 3300005458 Ga0070681_10034740 Ga0070681_100347405 398
621 3300005459 Ga0068867_100163733 Ga0068867_1001637332 398
622 3300005530 Ga0070679_100030821 Ga0070679_1000308214 398
623 3300005530 Ga0070679_100042499 Ga0070679_1000424993 398
624 3300005530 Ga0070679_100042689 Ga0070679_1000426894 398
625 3300005535 Ga0070684_100036492 Ga0070684_1000364922 398
626 3300005539 Ga0068853_100082062 Ga0068853_1000820622 398
627 3300005547 Ga0070693_100117735 Ga0070693_1001177351 398
628 3300005548 Ga0070665_100000002 Ga0070665_100000002401 398
629 3300005548 Ga0070665_100005248 Ga0070665_10000524812 398
630 3300005563 Ga0068855_100000439 Ga0068855_1000004397 398
631 3300005563 Ga0068855_100011561 Ga0068855_1000115615 398
632 3300005563 Ga0068855_100027104 Ga0068855_1000271046 398
633 3300005563 Ga0068855_100039110 Ga0068855_1000391104 398
634 3300005563 Ga0068855_100066337 Ga0068855_1000663373 398
635 3300005564 Ga0070664_100052278 Ga0070664_1000522782 398
636 3300005577 Ga0068857_100025799 Ga0068857_1000257993 398
637 3300005577 Ga0068857_100222750 Ga0068857_1002227502 398
638 3300005614 Ga0068856_100024601 Ga0068856_1000246015 398
639 3300005616 Ga0068852_100024730 Ga0068852_1000247302 398
640 3300005616 Ga0068852_100047320 Ga0068852_1000473203 398
641 3300005616 Ga0068852_100080351 Ga0068852_1000803514 398
642 3300005617 Ga0068859_100000106 Ga0068859_10000010647 398
643 3300005617 Ga0068859_100305465 Ga0068859_1003054652 398
644 3300005618 Ga0068864_100011427 Ga0068864_1000114273 398
645 3300005834 Ga0068851_10047056 Ga0068851_100470562 398
646 3300005841 Ga0068863_100006081 Ga0068863_1000060818 398
647 3300005841 Ga0068863_100032496 Ga0068863_1000324965 398
648 3300005842 Ga0068858_100006822 Ga0068858_1000068223 398
649 3300005843 Ga0068860_100000003 Ga0068860_10000000321 398
650 3300005843 Ga0068860_100009409 Ga0068860_1000094097 398
651 3300005983 Ga0081540_1040101 Ga0081540_10401013 398
652 3300005985 Ga0081539_10029490 Ga0081539_100294904 398
653 3300006195 Ga0075366_10007887 Ga0075366_100078876 398
654 3300006237 Ga0097621_100000531 Ga0097621_10000053122 398
655 3300006237 Ga0097621_100016683 Ga0097621_1000166834 398
656 3300006237 Ga0097621_100156438 Ga0097621_1001564382 398
657 3300006358 Ga0068871_100000042 Ga0068871_10000004219 398
658 3300006358 Ga0068871_100002902 Ga0068871_1000029024 398
659 3300006931 Ga0097620_100000106 Ga0097620_10000010647 398
660 3300006931 Ga0097620_100305481 Ga0097620_1003054812 398
661 3300009036 Ga0105244_10000011 Ga0105244_1000001117 398
662 3300009093 Ga0105240_10000367 Ga0105240_1000036720 398
663 3300009093 Ga0105240_10000487 Ga0105240_1000048735 398
664 3300009093 Ga0105240_10039540 Ga0105240_100395404 398
665 3300009093 Ga0105240_10042495 Ga0105240_100424953 398
666 3300009093 Ga0105240_10113999 Ga0105240_101139991 398
667 3300009093 Ga0105240_10181056 Ga0105240_101810562 398
668 3300009101 Ga0105247_10037908 Ga0105247_100379083 398
669 3300009148 Ga0105243_10000145 Ga0105243_1000014523 398
670 3300009174 Ga0105241_10001462 Ga0105241_100014625 398
671 3300009174 Ga0105241_10005760 Ga0105241_100057602 398
672 3300009176 Ga0105242_10086686 Ga0105242_100866862 398
673 3300009177 Ga0105248_10004482 Ga0105248_100044827 398
674 3300009545 Ga0105237_10003093 Ga0105237_100030936 398
675 3300009545 Ga0105237_10004043 Ga0105237_100040435 398
676 3300009545 Ga0105237_10009903 Ga0105237_1000990310 398
677 3300009545 Ga0105237_10033447 Ga0105237_100334472 398
678 3300009545 Ga0105237_10040318 Ga0105237_100403182 398
679 3300009545 Ga0105237_10179810 Ga0105237_101798102 398
680 3300009545 Ga0105237_10297085 Ga0105237_102970852 398
681 3300009551 Ga0105238_10013318 Ga0105238_100133183 398
682 3300009553 Ga0105249_10002137 Ga0105249_100021378 398
683 3300010375 Ga0105239_10000283 Ga0105239_100002839 398
684 3300010375 Ga0105239_10001438 Ga0105239_1000143822 398
685 3300010375 Ga0105239_10003665 Ga0105239_1000366510 398
686 3300010375 Ga0105239_10061828 Ga0105239_100618282 398
687 3300010375 Ga0105239_10123544 Ga0105239_101235442 398
688 3300010375 Ga0105239_10258859 Ga0105239_102588592 398
689 3300010375 Ga0105239_10291504 Ga0105239_102915042 398
690 3300013100 Ga0157373_10002482 Ga0157373_1000248211 398
691 3300013100 Ga0157373_10031635 Ga0157373_100316353 398
692 3300013100 Ga0157373_10087541 Ga0157373_100875412 398
693 3300013102 Ga0157371_10000216 Ga0157371_1000021639 398
694 3300013102 Ga0157371_10000741 Ga0157371_1000074123 398
695 3300013102 Ga0157371_10018024 Ga0157371_100180243 398
696 3300013102 Ga0157371_10040330 Ga0157371_100403302 398
697 3300013104 Ga0157370_10003143 Ga0157370_100031438 398
698 3300013104 Ga0157370_10003785 Ga0157370_1000378511 398
699 3300013104 Ga0157370_10017885 Ga0157370_100178852 398
700 3300013104 Ga0157370_10020395 Ga0157370_100203953 398
701 3300013104 Ga0157370_10020909 Ga0157370_100209096 398
702 3300013105 Ga0157369_10026663 Ga0157369_100266632 398
703 3300013105 Ga0157369_10041152 Ga0157369_100411526 398
704 3300013296 Ga0157374_10000013 Ga0157374_10000013147 398
705 3300013296 Ga0157374_10003727 Ga0157374_1000372711 398
706 3300013297 Ga0157378_10018192 Ga0157378_100181922 398
707 3300013306 Ga0163162_10000952 Ga0163162_1000095225 398
708 3300013306 Ga0163162_10001265 Ga0163162_100012654 398
709 3300013306 Ga0163162_10002681 Ga0163162_1000268113 398
710 3300013306 Ga0163162_10061943 Ga0163162_100619431 398
711 3300013307 Ga0157372_10000707 Ga0157372_1000070711 398
712 3300013307 Ga0157372_10003090 Ga0157372_100030904 398
713 3300013307 Ga0157372_10005652 Ga0157372_100056523 398
714 3300013307 Ga0157372_10051481 Ga0157372_100514815 398
715 3300013307 Ga0157372_10117099 Ga0157372_101170993 398
716 3300013307 Ga0157372_10139872 Ga0157372_101398722 398
717 3300013307 Ga0157372_10547311 Ga0157372_105473112 398
718 3300013308 Ga0157375_10000182 Ga0157375_1000018246 398
719 3300013308 Ga0157375_10023572 Ga0157375_100235724 398
720 3300014325 Ga0163163_10000088 Ga0163163_1000008894 398
721 3300014325 Ga0163163_10000557 Ga0163163_1000055719 398
722 3300014325 Ga0163163_10069653 Ga0163163_100696533 398
723 3300014745 Ga0157377_10012438 Ga0157377_100124382 398
724 3300014968 Ga0157379_10019354 Ga0157379_100193543 398
725 3300014969 Ga0157376_10002418 Ga0157376_100024185 398
726 3300014969 Ga0157376_10003397 Ga0157376_100033972 398
727 3300014969 Ga0157376_10005152 Ga0157376_100051525 398
728 3300021384 Ga0213876_10002723 Ga0213876_100027237 398
729 3300025261 Ga0209233_1003362 Ga0209233_10033625 398
730 3300025273 Ga0209673_1000194 Ga0209673_100019494 398
731 3300025291 Ga0209675_1000935 Ga0209675_10009359 398
732 3300025295 Ga0209564_1003234 Ga0209564_10032342 398
733 3300025297 Ga0209758_1039628 Ga0209758_10396281 398
734 3300025298 Ga0209050_1000136 Ga0209050_100013626 398
735 3300025302 Ga0207426_1006168 Ga0207426_10061683 398
736 3300025304 Ga0209257_1003301 Ga0209257_100330110 398
737 3300025728 Ga0207655_1000242 Ga0207655_100024217 398
738 3300025903 Ga0207680_10000125 Ga0207680_1000012528 398
739 3300025904 Ga0207647_10000104 Ga0207647_1000010437 398
740 3300025904 Ga0207647_10005038 Ga0207647_100050388 398
741 3300025904 Ga0207647_10015091 Ga0207647_100150916 398
742 3300025904 Ga0207647_10021853 Ga0207647_100218532 398
743 3300025909 Ga0207705_10043306 Ga0207705_100433064 398
744 3300025909 Ga0207705_10168295 Ga0207705_101682952 398
745 3300025911 Ga0207654_10035887 Ga0207654_100358872 398
746 3300025912 Ga0207707_10027427 Ga0207707_100274272 398
747 3300025912 Ga0207707_10080305 Ga0207707_100803052 398
748 3300025913 Ga0207695_10000051 Ga0207695_1000005199 398
749 3300025913 Ga0207695_10000056 Ga0207695_10000056143 398
750 3300025913 Ga0207695_10000081 Ga0207695_1000008199 398
751 3300025913 Ga0207695_10000550 Ga0207695_1000055018 398
752 3300025913 Ga0207695_10005846 Ga0207695_1000584612 398
753 3300025913 Ga0207695_10016372 Ga0207695_100163724 398
754 3300025913 Ga0207695_10042663 Ga0207695_100426633 398
755 3300025913 Ga0207695_10265002 Ga0207695_102650022 398
756 3300025914 Ga0207671_10000257 Ga0207671_1000025736 398
757 3300025914 Ga0207671_10002116 Ga0207671_100021167 398
758 3300025914 Ga0207671_10003054 Ga0207671_1000305411 398
759 3300025914 Ga0207671_10007245 Ga0207671_100072456 398
760 3300025914 Ga0207671_10145754 Ga0207671_101457541 398
761 3300025917 Ga0207660_10074562 Ga0207660_100745622 398
762 3300025919 Ga0207657_10232459 Ga0207657_102324592 398
763 3300025920 Ga0207649_10061177 Ga0207649_100611772 398
764 3300025921 Ga0207652_10000029 Ga0207652_1000002993 398
765 3300025921 Ga0207652_10000115 Ga0207652_1000011562 398
766 3300025921 Ga0207652_10039601 Ga0207652_100396014 398
767 3300025921 Ga0207652_10067110 Ga0207652_100671103 398
768 3300025924 Ga0207694_10006715 Ga0207694_100067153 398
769 3300025931 Ga0207644_10020232 Ga0207644_100202324 398
770 3300025931 Ga0207644_10167003 Ga0207644_101670032 398
771 3300025932 Ga0207690_10003150 Ga0207690_100031504 398
772 3300025932 Ga0207690_10109253 Ga0207690_101092532 398
773 3300025933 Ga0207706_10024864 Ga0207706_100248642 398
774 3300025935 Ga0207709_10000365 Ga0207709_1000036537 398
775 3300025938 Ga0207704_10150556 Ga0207704_101505562 398
776 3300025940 Ga0207691_10083196 Ga0207691_100831962 398
777 3300025941 Ga0207711_10049439 Ga0207711_100494393 398
778 3300025942 Ga0207689_10000360 Ga0207689_1000036031 398
779 3300025942 Ga0207689_10006592 Ga0207689_100065927 398
780 3300025944 Ga0207661_10022471 Ga0207661_100224714 398
781 3300025945 Ga0207679_10001022 Ga0207679_100010227 398
782 3300025949 Ga0207667_10001658 Ga0207667_1000165817 398
783 3300025949 Ga0207667_10002366 Ga0207667_1000236614 398
784 3300025949 Ga0207667_10005373 Ga0207667_100053735 398
785 3300025949 Ga0207667_10080369 Ga0207667_100803693 398
786 3300025960 Ga0207651_10065649 Ga0207651_100656491 398
787 3300025961 Ga0207712_10001164 Ga0207712_1000116410 398
788 3300025972 Ga0207668_10181590 Ga0207668_101815901 398
789 3300025986 Ga0207658_10057653 Ga0207658_100576533 398
790 3300026035 Ga0207703_10001922 Ga0207703_100019224 398
791 3300026041 Ga0207639_10049062 Ga0207639_100490623 398
792 3300026067 Ga0207678_10094925 Ga0207678_100949253 398
793 3300026078 Ga0207702_10076949 Ga0207702_100769492 398
794 3300026088 Ga0207641_10000082 Ga0207641_10000082101 398
795 3300026088 Ga0207641_10082894 Ga0207641_100828942 398
796 3300026095 Ga0207676_10007584 Ga0207676_100075845 398
797 3300026116 Ga0207674_10003993 Ga0207674_1000399313 398
798 3300026116 Ga0207674_10134865 Ga0207674_101348652 398
799 3300026116 Ga0207674_10170481 Ga0207674_101704812 398
800 3300026142 Ga0207698_10001166 Ga0207698_1000116611 398
801 3300027876 Ga0209974_10037550 Ga0209974_100375502 398
802 3300028379 Ga0268266_10000022 Ga0268266_1000002237 398
803 3300028379 Ga0268266_10005285 Ga0268266_100052857 398
804 3300028381 Ga0268264_10000082 Ga0268264_10000082178 398
805 3300028381 Ga0268264_10011786 Ga0268264_100117865 398
806 3300028573 Ga0265334_10008517 Ga0265334_100085173 398
807 3300028794 Ga0307515_10000190 Ga0307515_1000019027 398
808 3300030521 Ga0307511_10000027 Ga0307511_1000002731 398
809 3300031251 Ga0265327_10009085 Ga0265327_100090857 398
810 3300031595 Ga0265313_10042550 Ga0265313_100425502 398
811 3300031731 Ga0307405_10014744 Ga0307405_100147444 398
812 3300032004 Ga0307414_10055020 Ga0307414_100550203 398
813 3300033180 Ga0307510_10007920 Ga0307510_100079208 398
814 3300035172 Ga0373955_0093023 Ga0373955_0093023_280_1527 398
815 3300035410 Ga0373924_0018705 Ga0373924_0018705_198_1445 398
816 3300036401 Ga0373937_0010206 Ga0373937_0010206_325_1572 398
817 3300037312 Ga0395899_0002144 Ga0395899_0002144_14381_15577 398
818 3300037312 Ga0395899_0031560 Ga0395899_0031560_274_1470 398
819 3300037418 Ga0395900_0005622 Ga0395900_0005622_1332_2528 398
820 3300037418 Ga0395900_0098786 Ga0395900_0098786_1691_2887 398
821 3300037466 Ga0395898_0031676 Ga0395898_0031676_2457_3653 398
822 3300038443 Ga0395901_0002351 Ga0395901_0002351_4673_5869 398
823 3300038443 Ga0395901_0014642 Ga0395901_0014642_970_2166 398
824 3300038443 Ga0395901_0315933 Ga0395901_0315933_89_1285 398
825 3300039437 Ga0436365_0079092 Ga0436365_0079092_15521_16774 398
826 3300041456 Ga0451795_1501558 Ga0451795_1501558_756_1964 398
827 3300042876 Ga0451577_0066793 Ga0451577_0066793_762_1958 398
828 3300044673 Ga0453683_0009555 Ga0453683_0009555_3407_4603 398
829 3300044712 Ga0453684_0001009 Ga0453684_0001009_41233_42429 398
830 3300044712 Ga0453684_0156804 Ga0453684_0156804_977_2173 398
831 3300045051 Ga0451576_0000002 Ga0451576_0000002_1271347_1272564 398
832 3300045051 Ga0451576_0072309 Ga0451576_0072309_2130_3326 398
833 3300046453 Ga0495627_000034 Ga0495627_000034_97290_98486 398
834 3300046454 Ga0495592_0163888 Ga0495592_0163888_206_1453 398
835 3300046460 Ga0495638_0018471 Ga0495638_0018471_2076_3272 398
836 3300046500 Ga0495596_0000865 Ga0495596_0000865_13358_14554 398
837 3300046507 Ga0495606_0014159 Ga0495606_0014159_1317_2513 398
838 3300046507 Ga0495606_0017762 Ga0495606_0017762_2059_3255 398
839 3300046514 Ga0495618_0121596 Ga0495618_0121596_38_1285 398
840 3300046516 Ga0495628_0009018 Ga0495628_0009018_3666_4913 398
841 3300046517 Ga0495630_0078966 Ga0495630_0078966_1023_2270 398
842 3300046519 Ga0495632_0023621 Ga0495632_0023621_198_1394 398
843 3300046524 Ga0495648_0000879 Ga0495648_0000879_2869_4065 398
844 3300046530 Ga0495654_0000001 Ga0495654_0000001_343770_344966 398
845 3300046535 Ga0495586_0131063 Ga0495586_0131063_137_1384 398
846 3300046558 Ga0495633_0000057 Ga0495633_0000057_119192_120391 398
847 3300046616 Ga0495668_0001099 Ga0495668_0001099_9552_10748 398
848 3300046660 Ga0495625_0005105 Ga0495625_0005105_2498_3694 398
849 3300046660 Ga0495625_0119956 Ga0495625_0119956_203_1405 398
850 3300046663 Ga0495635_0137075 Ga0495635_0137075_312_1559 398
851 3300046689 Ga0495613_0146383 Ga0495613_0146383_223_1470 398
852 3300047322 Ga0495680_0045059 Ga0495680_0045059_2059_3306 398
853 3300047443 Ga0495687_000179 Ga0495687_000179_59961_61157 398
854 3300047444 Ga0495675_0107839 Ga0495675_0107839_319_1566 398
855 3300047471 Ga0495684_0015951 Ga0495684_0015951_189_1436 398
856 3300047472 Ga0495686_0000010 Ga0495686_0000010_265939_267135 398
857 3300047472 Ga0495686_0002126 Ga0495686_0002126_8459_9655 398
858 3300047472 Ga0495686_0117769 Ga0495686_0117769_342_1541 398
859 3300048906 Ga0496103_0054877 Ga0496103_0054877_21_1217 398
860 3300048914 Ga0496111_0087451 Ga0496111_0087451_923_2197 398
861 3300048916 Ga0496113_0198306 Ga0496113_0198306_304_1500 398
862 3300048919 Ga0496116_0000266 Ga0496116_0000266_62196_63392 398
863 3300048920 Ga0496117_0000365 Ga0496117_0000365_62040_63236 398
864 3300048921 Ga0496118_0000672 Ga0496118_0000672_15585_16781 398
865 3300048922 Ga0496119_0000227 Ga0496119_0000227_15613_16809 398
866 3300048925 Ga0496122_0000045 Ga0496122_0000045_159260_160456 398
867 3300048925 Ga0496122_0000277 Ga0496122_0000277_100656_101852 398
868 3300048925 Ga0496122_0000698 Ga0496122_0000698_62040_63236 398
869 3300048925 Ga0496122_0024722 Ga0496122_0024722_1272_2468 398
870 3300048926 Ga0496123_0018435 Ga0496123_0018435_1685_2881 398
871 3300048927 Ga0496124_0094661 Ga0496124_0094661_669_1865 398
872 3300048928 Ga0496125_0001313 Ga0496125_0001313_30101_31297 398
873 3300048929 Ga0496126_0002717 Ga0496126_0002717_8095_9291 398
874 3300049579 Ga0501043_0052405 Ga0501043_0052405_1938_3134 398
875 3300049663 Ga0501223_000532 Ga0501223_000532_740_1936 398
876 3300053080 Ga0500635_0000883 Ga0500635_0000883_5837_7033 398
877 3300053092 Ga0500583_0008434 Ga0500583_0008434_403_1599 398
878 3300053139 Ga0500568_0003322 Ga0500568_0003322_5450_6646 398
879 3300053151 Ga0500604_0003342 Ga0500604_0003342_2316_3512 398
880 3300053156 Ga0500622_0007499 Ga0500622_0007499_2378_3574 398
881 3300055283 Ga0500661_004470 Ga0500661_004470_701_1897 398
882 iso_pu_bacteria 2585428095 2587865767 398
883 iso_pu_bacteria 2728369107 2729201888 398
884 3300003322 rootL2_10018664 rootL2_100186642 399
885 3300003322 rootL2_10100931 rootL2_101009311 399
886 3300003322 rootL2_10108093 rootL2_101080931 399
887 3300003323 rootH1_10010262 rootH1_100102622 399
888 3300003323 rootH1_10029472 rootH1_100294724 399
889 3300003323 rootH1_10030425 rootH1_100304253 399
890 3300003323 rootH1_10063152 rootH1_100631528 399
891 3300003781 Ga0055536_1001611 Ga0055536_10016113 399
892 3300003794 Ga0055531_10000245 Ga0055531_1000024551 399
893 3300003794 Ga0055531_10000435 Ga0055531_1000043521 399
894 3300005262 Ga0065165_1000131 Ga0065165_1000131124 399
895 3300005293 Ga0065715_10088952 Ga0065715_100889529 399
896 3300005329 Ga0070683_100003504 Ga0070683_1000035048 399
897 3300005329 Ga0070683_100006103 Ga0070683_10000610311 399
898 3300005329 Ga0070683_100010704 Ga0070683_1000107045 399
899 3300005331 Ga0070670_100015632 Ga0070670_1000156327 399
900 3300005331 Ga0070670_100032500 Ga0070670_1000325003 399
901 3300005335 Ga0070666_10151143 Ga0070666_101511432 399
902 3300005337 Ga0070682_100009958 Ga0070682_1000099584 399
903 3300005339 Ga0070660_100002764 Ga0070660_1000027644 399
904 3300005344 Ga0070661_100010432 Ga0070661_1000104325 399
905 3300005347 Ga0070668_100023632 Ga0070668_1000236324 399
906 3300005353 Ga0070669_100078997 Ga0070669_1000789972 399
907 3300005354 Ga0070675_100016358 Ga0070675_1000163585 399
908 3300005355 Ga0070671_100061292 Ga0070671_1000612923 399
909 3300005355 Ga0070671_100111333 Ga0070671_1001113332 399
910 3300005355 Ga0070671_100124488 Ga0070671_1001244882 399
911 3300005364 Ga0070673_100018686 Ga0070673_1000186863 399
912 3300005366 Ga0070659_100010122 Ga0070659_1000101224 399
913 3300005456 Ga0070678_100004999 Ga0070678_1000049997 399
914 3300005457 Ga0070662_100022191 Ga0070662_1000221911 399
915 3300005458 Ga0070681_10064666 Ga0070681_100646664 399
916 3300005459 Ga0068867_100033878 Ga0068867_1000338782 399
917 3300005530 Ga0070679_100066869 Ga0070679_1000668693 399
918 3300005530 Ga0070679_100111026 Ga0070679_1001110262 399
919 3300005535 Ga0070684_100011014 Ga0070684_1000110146 399
920 3300005535 Ga0070684_100027061 Ga0070684_1000270613 399
921 3300005547 Ga0070693_100006957 Ga0070693_1000069574 399
922 3300005563 Ga0068855_100152650 Ga0068855_1001526503 399
923 3300005564 Ga0070664_100003785 Ga0070664_1000037851 399
924 3300005564 Ga0070664_100004253 Ga0070664_1000042535 399
925 3300005577 Ga0068857_100125503 Ga0068857_1001255032 399
926 3300005578 Ga0068854_100007137 Ga0068854_1000071378 399
927 3300005614 Ga0068856_100223899 Ga0068856_1002238992 399
928 3300005616 Ga0068852_100010222 Ga0068852_1000102228 399
929 3300005617 Ga0068859_100007461 Ga0068859_10000746111 399
930 3300005834 Ga0068851_10075702 Ga0068851_100757022 399
931 3300005841 Ga0068863_100048536 Ga0068863_1000485363 399
932 3300006195 Ga0075366_10021500 Ga0075366_100215002 399
933 3300006358 Ga0068871_100012489 Ga0068871_1000124894 399
934 3300006881 Ga0068865_100051065 Ga0068865_1000510652 399
935 3300006931 Ga0097620_100007461 Ga0097620_10000746111 399
936 3300009093 Ga0105240_10069454 Ga0105240_100694543 399
937 3300009545 Ga0105237_10021687 Ga0105237_100216874 399
938 3300010375 Ga0105239_10383807 Ga0105239_103838072 399
939 3300013100 Ga0157373_10025270 Ga0157373_100252704 399
940 3300013102 Ga0157371_10011763 Ga0157371_100117635 399
941 3300013102 Ga0157371_10104115 Ga0157371_101041152 399
942 3300013296 Ga0157374_10019587 Ga0157374_100195874 399
943 3300013297 Ga0157378_10009983 Ga0157378_100099832 399
944 3300013297 Ga0157378_10024509 Ga0157378_100245093 399
945 3300013306 Ga0163162_10385396 Ga0163162_103853962 399
946 3300013307 Ga0157372_10040958 Ga0157372_100409584 399
947 3300013307 Ga0157372_10104350 Ga0157372_101043503 399
948 3300014325 Ga0163163_10005005 Ga0163163_100050052 399
949 3300014969 Ga0157376_10162598 Ga0157376_101625982 399
950 3300025250 Ga0209026_1001716 Ga0209026_10017164 399
951 3300025292 Ga0209676_1001085 Ga0209676_100108518 399
952 3300025304 Ga0209257_1000005 Ga0209257_1000005898 399
953 3300025304 Ga0209257_1000025 Ga0209257_1000025489 399
954 3300025901 Ga0207688_10002010 Ga0207688_100020103 399
955 3300025903 Ga0207680_10114292 Ga0207680_101142922 399
956 3300025907 Ga0207645_10002278 Ga0207645_100022785 399
957 3300025909 Ga0207705_10030739 Ga0207705_100307392 399
958 3300025911 Ga0207654_10031761 Ga0207654_100317612 399
959 3300025912 Ga0207707_10063492 Ga0207707_100634923 399
960 3300025913 Ga0207695_10000013 Ga0207695_100000136 399
961 3300025914 Ga0207671_10002707 Ga0207671_100027074 399
962 3300025914 Ga0207671_10253396 Ga0207671_102533961 399
963 3300025919 Ga0207657_10001653 Ga0207657_100016538 399
964 3300025920 Ga0207649_10025366 Ga0207649_100253662 399
965 3300025924 Ga0207694_10220231 Ga0207694_102202312 399
966 3300025925 Ga0207650_10032513 Ga0207650_100325132 399
967 3300025925 Ga0207650_10093737 Ga0207650_100937372 399
968 3300025925 Ga0207650_10150022 Ga0207650_101500221 399
969 3300025926 Ga0207659_10054617 Ga0207659_100546172 399
970 3300025931 Ga0207644_10071229 Ga0207644_100712292 399
971 3300025937 Ga0207669_10088178 Ga0207669_100881782 399
972 3300025940 Ga0207691_10005078 Ga0207691_100050789 399
973 3300025942 Ga0207689_10001010 Ga0207689_1000101016 399
974 3300025944 Ga0207661_10018276 Ga0207661_100182764 399
975 3300025944 Ga0207661_10314785 Ga0207661_103147851 399
976 3300025945 Ga0207679_10006038 Ga0207679_100060381 399
977 3300025949 Ga0207667_10037027 Ga0207667_100370274 399
978 3300025949 Ga0207667_10043276 Ga0207667_100432764 399
979 3300025949 Ga0207667_10126280 Ga0207667_101262802 399
980 3300025960 Ga0207651_10017358 Ga0207651_100173584 399
981 3300026089 Ga0207648_10001709 Ga0207648_1000170914 399
982 3300026116 Ga0207674_10024952 Ga0207674_100249525 399
983 3300026118 Ga0207675_100025419 Ga0207675_1000254193 399
984 3300026121 Ga0207683_10000974 Ga0207683_1000097413 399
985 3300026142 Ga0207698_10073819 Ga0207698_100738192 399
986 3300026142 Ga0207698_10174264 Ga0207698_101742642 399
987 3300028380 Ga0268265_10160055 Ga0268265_101600552 399
988 3300028794 Ga0307515_10000001 Ga0307515_100000011220 399
989 3300028794 Ga0307515_10000061 Ga0307515_1000006157 399
990 3300028794 Ga0307515_10011605 Ga0307515_1001160513 399
991 3300028800 Ga0265338_10001011 Ga0265338_1000101114 399
992 3300031251 Ga0265327_10000551 Ga0265327_1000055118 399
993 3300031251 Ga0265327_10085354 Ga0265327_100853542 399
994 3300031456 Ga0307513_10033920 Ga0307513_100339203 399
995 3300031507 Ga0307509_10036852 Ga0307509_100368522 399
996 3300031730 Ga0307516_10000869 Ga0307516_100008695 399
997 3300031731 Ga0307405_10137656 Ga0307405_101376563 399
998 3300037418 Ga0395900_0001393 Ga0395900_0001393_26961_28160 399
999 3300037418 Ga0395900_0001452 Ga0395900_0001452_756_1955 399
1000 3300044656 Ga0466969_0001347 Ga0466969_0001347_11510_12709 399
1001 3300044712 Ga0453684_0014163 Ga0453684_0014163_6214_7530 399
1002 3300044735 Ga0466968_0028469 Ga0466968_0028469_678_1877 399
1003 3300045049 Ga0466959_0000004 Ga0466959_0000004_11010_12209 399
1004 3300046453 Ga0495627_007928 Ga0495627_007928_814_2013 399
1005 3300046538 Ga0495609_0000025 Ga0495609_0000025_100187_101419 399
1006 3300046558 Ga0495633_0000344 Ga0495633_0000344_5500_6699 399
1007 3300046616 Ga0495668_0000257 Ga0495668_0000257_25356_26576 399
1008 3300046616 Ga0495668_0004989 Ga0495668_0004989_6076_7275 399
1009 3300047472 Ga0495686_0001122 Ga0495686_0001122_19758_20975 399
1010 3300048924 Ga0496121_0001581 Ga0496121_0001581_22186_23385 399
1011 3300049579 Ga0501043_0025390 Ga0501043_0025390_1582_2781 399
1012 3300049581 Ga0501047_0030028 Ga0501047_0030028_416_1615 399
1013 3300049657 Ga0501210_000224 Ga0501210_000224_1085_2287 399
1014 3300049663 Ga0501223_013191 Ga0501223_013191_50_1249 399
1015 3300049686 Ga0501257_002266 Ga0501257_002266_1271_2470 399
1016 3300049822 Ga0501035_0085782 Ga0501035_0085782_495_1694 399
1017 3300049823 Ga0501044_0129100 Ga0501044_0129100_112_1311 399
1018 3300050493 nmdc:mga0k408_27353_c1 nmdc:mga0k408_27353_c1_829_2073 399
1019 3300053104 Ga0500556_0014297 Ga0500556_0014297_546_1745 399
1020 3300053156 Ga0500622_0000258 Ga0500622_0000258_47596_48795 399
1021 3300053157 Ga0500624_000167 Ga0500624_000167_7726_8925 399
1022 3300053158 Ga0500627_0004961 Ga0500627_0004961_2753_3952 399
1023 3300003203 JGI25406J46586_10007660 JGI25406J46586_100076603 400
1024 3300003316 rootH1_10001629 rootH1_100016292 400
1025 3300003320 rootH2_10003246 rootH2_1000324668 400
1026 3300003322 rootL2_10006109 rootL2_100061098 400
1027 3300003322 rootL2_10048389 rootL2_100483892 400
1028 3300003323 rootH1_10010261 rootH1_100102614 400
1029 3300003323 rootH1_10148113 rootH1_101481132 400
1030 3300005262 Ga0065165_1001074 Ga0065165_10010745 400
1031 3300005327 Ga0070658_10000515 Ga0070658_100005156 400
1032 3300005327 Ga0070658_10008589 Ga0070658_100085895 400
1033 3300005327 Ga0070658_10134793 Ga0070658_101347932 400
1034 3300005328 Ga0070676_10002355 Ga0070676_100023555 400
1035 3300005330 Ga0070690_100010328 Ga0070690_1000103282 400
1036 3300005330 Ga0070690_100022642 Ga0070690_1000226422 400
1037 3300005334 Ga0068869_100032239 Ga0068869_1000322392 400
1038 3300005335 Ga0070666_10001233 Ga0070666_1000123311 400
1039 3300005336 Ga0070680_100070642 Ga0070680_1000706423 400
1040 3300005336 Ga0070680_100088593 Ga0070680_1000885932 400
1041 3300005338 Ga0068868_100004571 Ga0068868_1000045715 400
1042 3300005338 Ga0068868_100035974 Ga0068868_1000359742 400
1043 3300005339 Ga0070660_100001306 Ga0070660_10000130610 400
1044 3300005340 Ga0070689_100080880 Ga0070689_1000808802 400
1045 3300005347 Ga0070668_100004869 Ga0070668_1000048692 400
1046 3300005364 Ga0070673_100002393 Ga0070673_1000023935 400
1047 3300005367 Ga0070667_100005690 Ga0070667_1000056906 400
1048 3300005367 Ga0070667_100068663 Ga0070667_1000686632 400
1049 3300005456 Ga0070678_100151126 Ga0070678_1001511261 400
1050 3300005457 Ga0070662_100056919 Ga0070662_1000569194 400
1051 3300005457 Ga0070662_100059188 Ga0070662_1000591882 400
1052 3300005459 Ga0068867_100010951 Ga0068867_1000109515 400
1053 3300005471 Ga0070698_100002644 Ga0070698_1000026442 400
1054 3300005535 Ga0070684_100056838 Ga0070684_1000568381 400
1055 3300005539 Ga0068853_100057738 Ga0068853_1000577382 400
1056 3300005539 Ga0068853_100105194 Ga0068853_1001051942 400
1057 3300005543 Ga0070672_100000061 Ga0070672_1000000616 400
1058 3300005543 Ga0070672_100050540 Ga0070672_1000505403 400
1059 3300005544 Ga0070686_100023709 Ga0070686_1000237092 400
1060 3300005548 Ga0070665_100008467 Ga0070665_1000084676 400
1061 3300005548 Ga0070665_100049998 Ga0070665_1000499983 400
1062 3300005563 Ga0068855_100000042 Ga0068855_100000042113 400
1063 3300005563 Ga0068855_100048633 Ga0068855_1000486335 400
1064 3300005563 Ga0068855_100062885 Ga0068855_1000628853 400
1065 3300005563 Ga0068855_100282407 Ga0068855_1002824072 400
1066 3300005564 Ga0070664_100022827 Ga0070664_1000228275 400
1067 3300005577 Ga0068857_100137879 Ga0068857_1001378792 400
1068 3300005617 Ga0068859_100136898 Ga0068859_1001368982 400
1069 3300005618 Ga0068864_100003370 Ga0068864_1000033706 400
1070 3300005719 Ga0068861_100034298 Ga0068861_1000342983 400
1071 3300005834 Ga0068851_10000465 Ga0068851_1000046512 400
1072 3300005841 Ga0068863_100001273 Ga0068863_1000012736 400
1073 3300005841 Ga0068863_100177698 Ga0068863_1001776982 400
1074 3300005842 Ga0068858_100000930 Ga0068858_10000093024 400
1075 3300005842 Ga0068858_100149041 Ga0068858_1001490412 400
1076 3300005843 Ga0068860_100003491 Ga0068860_1000034915 400
1077 3300005843 Ga0068860_100011027 Ga0068860_10001102710 400
1078 3300005844 Ga0068862_100076920 Ga0068862_1000769203 400
1079 3300005985 Ga0081539_10001169 Ga0081539_1000116940 400
1080 3300006237 Ga0097621_100006425 Ga0097621_1000064254 400
1081 3300006237 Ga0097621_100070099 Ga0097621_1000700993 400
1082 3300006237 Ga0097621_100109977 Ga0097621_1001099772 400
1083 3300006358 Ga0068871_100002324 Ga0068871_1000023245 400
1084 3300006358 Ga0068871_100007826 Ga0068871_1000078265 400
1085 3300006844 Ga0075428_100010463 Ga0075428_1000104636 400
1086 3300006881 Ga0068865_100001997 Ga0068865_1000019976 400
1087 3300006931 Ga0097620_100136895 Ga0097620_1001368952 400
1088 3300009093 Ga0105240_10000037 Ga0105240_1000003733 400
1089 3300009093 Ga0105240_10104541 Ga0105240_101045413 400
1090 3300009094 Ga0111539_10017967 Ga0111539_100179676 400
1091 3300009094 Ga0111539_10162149 Ga0111539_101621492 400
1092 3300009098 Ga0105245_10173353 Ga0105245_101733532 400
1093 3300009101 Ga0105247_10011475 Ga0105247_100114755 400
1094 3300009148 Ga0105243_10172389 Ga0105243_101723892 400
1095 3300009174 Ga0105241_10084882 Ga0105241_100848822 400
1096 3300009174 Ga0105241_10114505 Ga0105241_101145052 400
1097 3300009176 Ga0105242_10006535 Ga0105242_100065356 400
1098 3300009177 Ga0105248_10032533 Ga0105248_100325332 400
1099 3300009545 Ga0105237_10192111 Ga0105237_101921112 400
1100 3300009551 Ga0105238_10004274 Ga0105238_100042745 400
1101 3300009553 Ga0105249_10001226 Ga0105249_1000122622 400
1102 3300009553 Ga0105249_10198919 Ga0105249_101989191 400
1103 3300009553 Ga0105249_10315500 Ga0105249_103155002 400
1104 3300010375 Ga0105239_10006888 Ga0105239_100068883 400
1105 3300013100 Ga0157373_10003984 Ga0157373_100039846 400
1106 3300013100 Ga0157373_10024469 Ga0157373_100244693 400
1107 3300013100 Ga0157373_10033565 Ga0157373_100335654 400
1108 3300013102 Ga0157371_10001331 Ga0157371_1000133110 400
1109 3300013102 Ga0157371_10003861 Ga0157371_100038615 400
1110 3300013102 Ga0157371_10027826 Ga0157371_100278264 400
1111 3300013104 Ga0157370_10274035 Ga0157370_102740351 400
1112 3300013105 Ga0157369_10019087 Ga0157369_100190873 400
1113 3300013296 Ga0157374_10010061 Ga0157374_100100612 400
1114 3300013296 Ga0157374_10013448 Ga0157374_100134482 400
1115 3300013296 Ga0157374_10020034 Ga0157374_100200343 400
1116 3300013297 Ga0157378_10102551 Ga0157378_101025513 400
1117 3300013306 Ga0163162_10000244 Ga0163162_1000024422 400
1118 3300013306 Ga0163162_10011449 Ga0163162_100114492 400
1119 3300013306 Ga0163162_10177711 Ga0163162_101777112 400
1120 3300013306 Ga0163162_10304066 Ga0163162_103040662 400
1121 3300013307 Ga0157372_10014060 Ga0157372_100140604 400
1122 3300013307 Ga0157372_10071932 Ga0157372_100719321 400
1123 3300013307 Ga0157372_10304866 Ga0157372_103048661 400
1124 3300013307 Ga0157372_10474873 Ga0157372_104748731 400
1125 3300013308 Ga0157375_10005427 Ga0157375_100054275 400
1126 3300013308 Ga0157375_10053361 Ga0157375_100533612 400
1127 3300014325 Ga0163163_10000272 Ga0163163_100002725 400
1128 3300014325 Ga0163163_10106889 Ga0163163_101068892 400
1129 3300014325 Ga0163163_10193974 Ga0163163_101939742 400
1130 3300014326 Ga0157380_10005528 Ga0157380_100055285 400
1131 3300014968 Ga0157379_10000103 Ga0157379_100001036 400
1132 3300014968 Ga0157379_10018557 Ga0157379_100185572 400
1133 3300014969 Ga0157376_10000484 Ga0157376_1000048420 400
1134 3300015262 Ga0182007_10037797 Ga0182007_100377972 400
1135 3300015265 Ga0182005_1000023 Ga0182005_100002398 400
1136 3300017792 Ga0163161_10051457 Ga0163161_100514572 400
1137 3300017792 Ga0163161_10140016 Ga0163161_101400162 400
1138 3300025297 Ga0209758_1016995 Ga0209758_10169954 400
1139 3300025298 Ga0209050_1005897 Ga0209050_10058974 400
1140 3300025298 Ga0209050_1023844 Ga0209050_10238442 400
1141 3300025321 Ga0207656_10003369 Ga0207656_100033695 400
1142 3300025893 Ga0207682_10013648 Ga0207682_100136482 400
1143 3300025903 Ga0207680_10004003 Ga0207680_100040035 400
1144 3300025904 Ga0207647_10075592 Ga0207647_100755921 400
1145 3300025907 Ga0207645_10000793 Ga0207645_100007936 400
1146 3300025908 Ga0207643_10068017 Ga0207643_100680172 400
1147 3300025909 Ga0207705_10015947 Ga0207705_100159472 400
1148 3300025909 Ga0207705_10066747 Ga0207705_100667472 400
1149 3300025913 Ga0207695_10000092 Ga0207695_10000092212 400
1150 3300025913 Ga0207695_10021656 Ga0207695_100216566 400
1151 3300025917 Ga0207660_10051818 Ga0207660_100518182 400
1152 3300025919 Ga0207657_10003392 Ga0207657_100033926 400
1153 3300025919 Ga0207657_10015945 Ga0207657_100159452 400
1154 3300025919 Ga0207657_10042107 Ga0207657_100421072 400
1155 3300025921 Ga0207652_10000961 Ga0207652_1000096110 400
1156 3300025924 Ga0207694_10032448 Ga0207694_100324484 400
1157 3300025927 Ga0207687_10101975 Ga0207687_101019752 400
1158 3300025933 Ga0207706_10106618 Ga0207706_101066182 400
1159 3300025938 Ga0207704_10104416 Ga0207704_101044162 400
1160 3300025940 Ga0207691_10000154 Ga0207691_1000015452 400
1161 3300025941 Ga0207711_10025883 Ga0207711_100258832 400
1162 3300025942 Ga0207689_10006093 Ga0207689_100060932 400
1163 3300025942 Ga0207689_10041818 Ga0207689_100418183 400
1164 3300025942 Ga0207689_10094157 Ga0207689_100941572 400
1165 3300025949 Ga0207667_10000037 Ga0207667_10000037166 400
1166 3300025949 Ga0207667_10057723 Ga0207667_100577233 400
1167 3300025949 Ga0207667_10168833 Ga0207667_101688332 400
1168 3300025960 Ga0207651_10003771 Ga0207651_100037715 400
1169 3300025961 Ga0207712_10001801 Ga0207712_1000180110 400
1170 3300025961 Ga0207712_10202644 Ga0207712_102026441 400
1171 3300025972 Ga0207668_10001272 Ga0207668_100012725 400
1172 3300025986 Ga0207658_10020272 Ga0207658_100202724 400
1173 3300025986 Ga0207658_10035132 Ga0207658_100351322 400
1174 3300026023 Ga0207677_10001948 Ga0207677_100019485 400
1175 3300026035 Ga0207703_10173273 Ga0207703_101732732 400
1176 3300026041 Ga0207639_10001747 Ga0207639_100017475 400
1177 3300026041 Ga0207639_10235946 Ga0207639_102359462 400
1178 3300026078 Ga0207702_10029614 Ga0207702_100296142 400
1179 3300026088 Ga0207641_10009438 Ga0207641_100094385 400
1180 3300026089 Ga0207648_10002098 Ga0207648_100020989 400
1181 3300026089 Ga0207648_10026330 Ga0207648_100263304 400
1182 3300026089 Ga0207648_10059413 Ga0207648_100594133 400
1183 3300026089 Ga0207648_10064952 Ga0207648_100649521 400
1184 3300026089 Ga0207648_10109467 Ga0207648_101094672 400
1185 3300026095 Ga0207676_10007982 Ga0207676_100079827 400
1186 3300026095 Ga0207676_10014437 Ga0207676_100144375 400
1187 3300026116 Ga0207674_10069416 Ga0207674_100694164 400
1188 3300026118 Ga0207675_100258912 Ga0207675_1002589122 400
1189 3300026121 Ga0207683_10007830 Ga0207683_100078309 400
1190 3300026142 Ga0207698_10009220 Ga0207698_100092204 400
1191 3300026142 Ga0207698_10132043 Ga0207698_101320432 400
1192 3300026142 Ga0207698_10181498 Ga0207698_101814982 400
1193 3300028379 Ga0268266_10005211 Ga0268266_100052115 400
1194 3300028380 Ga0268265_10007650 Ga0268265_100076506 400
1195 3300028381 Ga0268264_10005842 Ga0268264_100058427 400
1196 3300028381 Ga0268264_10005919 Ga0268264_100059196 400
1197 3300028381 Ga0268264_10006777 Ga0268264_100067773 400
1198 3300028381 Ga0268264_10059634 Ga0268264_100596343 400
1199 3300028381 Ga0268264_10377511 Ga0268264_103775111 400
1200 3300028786 Ga0307517_10006633 Ga0307517_1000663314 400
1201 3300028794 Ga0307515_10177925 Ga0307515_101779252 400
1202 3300028800 Ga0265338_10143578 Ga0265338_101435782 400
1203 3300030731 Ga0316177_1132213 Ga0316177_11322131 400
1204 3300030742 Ga0316183_1068856 Ga0316183_10688566 400
1205 3300031251 Ga0265327_10000248 Ga0265327_1000024840 400
1206 3300031251 Ga0265327_10000272 Ga0265327_1000027268 400
1207 3300031548 Ga0307408_100084815 Ga0307408_1000848152 400
1208 3300031730 Ga0307516_10059174 Ga0307516_100591744 400
1209 3300031824 Ga0307413_10002415 Ga0307413_100024157 400
1210 3300031852 Ga0307410_10142957 Ga0307410_101429572 400
1211 3300031911 Ga0307412_10237299 Ga0307412_102372991 400
1212 3300032002 Ga0307416_100025328 Ga0307416_1000253283 400
1213 3300032005 Ga0307411_10071513 Ga0307411_100715132 400
1214 3300032126 Ga0307415_100025409 Ga0307415_1000254094 400
1215 3300032126 Ga0307415_100143214 Ga0307415_1001432141 400
1216 3300035695 Ga0373927_0021777 Ga0373927_0021777_2008_3246 400
1217 3300037312 Ga0395899_0044380 Ga0395899_0044380_312_1514 400
1218 3300037312 Ga0395899_0059981 Ga0395899_0059981_816_2018 400
1219 3300037418 Ga0395900_0101122 Ga0395900_0101122_981_2183 400
1220 3300037418 Ga0395900_0130510 Ga0395900_0130510_579_1781 400
1221 3300037466 Ga0395898_0158125 Ga0395898_0158125_171_1373 400
1222 3300038443 Ga0395901_0091000 Ga0395901_0091000_737_1939 400
1223 3300038443 Ga0395901_0272603 Ga0395901_0272603_30_1232 400
1224 3300041406 Ga0439439_0009748 Ga0439439_0009748_867_2069 400
1225 3300042007 Ga0439449_0006488 Ga0439449_0006488_381_1631 400
1226 3300042014 Ga0439457_007860 Ga0439457_007860_1039_2241 400
1227 3300042014 Ga0439457_009122 Ga0439457_009122_11_1261 400
1228 3300042015 Ga0439462_0001515 Ga0439462_0001515_3934_5136 400
1229 3300042125 Ga0450923_001237 Ga0450923_001237_505_1707 400
1230 3300042876 Ga0451577_0302681 Ga0451577_0302681_23_1225 400
1231 3300044658 Ga0466972_0000280 Ga0466972_0000280_1022_2224 400
1232 3300044673 Ga0453683_0040595 Ga0453683_0040595_1215_2438 400
1233 3300044673 Ga0453683_0046010 Ga0453683_0046010_226_1428 400
1234 3300044712 Ga0453684_0025246 Ga0453684_0025246_1238_2440 400
1235 3300044712 Ga0453684_0040283 Ga0453684_0040283_4126_5328 400
1236 3300044712 Ga0453684_0120207 Ga0453684_0120207_1667_2890 400
1237 3300045051 Ga0451576_0005169 Ga0451576_0005169_2205_3407 400
1238 3300046460 Ga0495638_0000171 Ga0495638_0000171_51956_53158 400
1239 3300046471 Ga0495650_0000003 Ga0495650_0000003_736667_737920 400
1240 3300046492 Ga0495585_0000079 Ga0495585_0000079_4908_6128 400
1241 3300046507 Ga0495606_0000116 Ga0495606_0000116_112880_114133 400
1242 3300046512 Ga0495610_0004188 Ga0495610_0004188_2079_3335 400
1243 3300046513 Ga0495616_0008226 Ga0495616_0008226_4704_5957 400
1244 3300046513 Ga0495616_0113617 Ga0495616_0113617_32_1234 400
1245 3300046538 Ga0495609_0015343 Ga0495609_0015343_1125_2378 400
1246 3300046557 Ga0495622_0036520 Ga0495622_0036520_422_1654 400
1247 3300046660 Ga0495625_0000159 Ga0495625_0000159_26704_27957 400
1248 3300046660 Ga0495625_0019973 Ga0495625_0019973_1726_2928 400
1249 3300046660 Ga0495625_0033793 Ga0495625_0033793_793_1995 400
1250 3300046665 Ga0495661_0015325 Ga0495661_0015325_2360_3613 400
1251 3300046694 Ga0495649_0000003 Ga0495649_0000003_852857_854110 400
1252 3300047443 Ga0495687_002135 Ga0495687_002135_677_1897 400
1253 3300047472 Ga0495686_0000160 Ga0495686_0000160_80603_81805 400
1254 3300047472 Ga0495686_0000234 Ga0495686_0000234_68844_70046 400
1255 3300047472 Ga0495686_0066077 Ga0495686_0066077_150_1352 400
1256 3300048912 Ga0496109_0164106 Ga0496109_0164106_282_1487 400
1257 3300048912 Ga0496109_0340329 Ga0496109_0340329_37_1239 400
1258 3300048913 Ga0496110_0086573 Ga0496110_0086573_472_1719 400
1259 3300048917 Ga0496114_0000412 Ga0496114_0000412_24109_25314 400
1260 3300048918 Ga0496115_0005714 Ga0496115_0005714_300_1523 400
1261 3300049521 Ga0501298_001720 Ga0501298_001720_163_1374 400
1262 3300049522 Ga0501299_014295 Ga0501299_014295_91_1302 400
1263 3300049571 Ga0501034_0012481 Ga0501034_0012481_486_1688 400
1264 3300049571 Ga0501034_0176353 Ga0501034_0176353_651_1853 400
1265 3300049572 Ga0501036_0001169 Ga0501036_0001169_4679_5881 400
1266 3300049574 Ga0501038_0025547 Ga0501038_0025547_3259_4461 400
1267 3300049575 Ga0501039_0012075 Ga0501039_0012075_5218_6420 400
1268 3300049579 Ga0501043_0035477 Ga0501043_0035477_1651_2853 400
1269 3300049580 Ga0501046_0032890 Ga0501046_0032890_1641_2843 400
1270 3300049581 Ga0501047_0278566 Ga0501047_0278566_150_1352 400
1271 3300049583 Ga0501067_0006422 Ga0501067_0006422_1345_2547 400
1272 3300049586 Ga0501070_0050057 Ga0501070_0050057_2082_3284 400
1273 3300049589 Ga0501073_0000839 Ga0501073_0000839_17532_18734 400
1274 3300049590 Ga0501074_0019469 Ga0501074_0019469_3638_4840 400
1275 3300049651 Ga0501201_000519 Ga0501201_000519_927_2138 400
1276 3300049654 Ga0501207_000155 Ga0501207_000155_4572_5783 400
1277 3300049661 Ga0501217_000256 Ga0501217_000256_6021_7232 400
1278 3300049663 Ga0501223_000278 Ga0501223_000278_11046_12257 400
1279 3300049668 Ga0501233_009188 Ga0501233_009188_160_1371 400
1280 3300049669 Ga0501235_009750 Ga0501235_009750_491_1693 400
1281 3300049673 Ga0501240_001884 Ga0501240_001884_290_1501 400
1282 3300049675 Ga0501243_001134 Ga0501243_001134_268_1479 400
1283 3300049688 Ga0501259_000291 Ga0501259_000291_4847_6058 400
1284 3300049690 Ga0501261_001011 Ga0501261_001011_2009_3220 400
1285 3300049704 Ga0501221_000194 Ga0501221_000194_6039_7250 400
1286 3300049705 Ga0501225_0003187 Ga0501225_0003187_1963_3174 400
1287 3300049741 Ga0501079_0036852 Ga0501079_0036852_1110_2312 400
1288 3300049744 Ga0501083_0003883 Ga0501083_0003883_8610_9812 400
1289 3300049822 Ga0501035_0010433 Ga0501035_0010433_4058_5260 400
1290 3300049823 Ga0501044_0004241 Ga0501044_0004241_1537_2739 400
1291 3300049823 Ga0501044_0130494 Ga0501044_0130494_1134_2336 400
1292 3300050511 nmdc:mga08y16_54887_c1 nmdc:mga08y16_54887_c1_1997_3199 400
1293 3300050511 nmdc:mga08y16_77453_c1 nmdc:mga08y16_77453_c1_1301_2503 400
1294 3300053086 Ga0500578_0000010 Ga0500578_0000010_145217_146419 400
1295 3300053086 Ga0500578_0155323 Ga0500578_0155323_35_1237 400
1296 3300053092 Ga0500583_0000064 Ga0500583_0000064_8214_9416 400
1297 3300053092 Ga0500583_0023006 Ga0500583_0023006_144_1346 400
1298 3300053108 Ga0500562_000053 Ga0500562_000053_45624_46826 400
1299 3300053139 Ga0500568_0001188 Ga0500568_0001188_13570_14784 400
1300 3300053153 Ga0500616_0000037 Ga0500616_0000037_364929_366131 400
1301 3300053156 Ga0500622_0000141 Ga0500622_0000141_50422_51627 400
1302 3300053156 Ga0500622_0000155 Ga0500622_0000155_22353_23558 400
1303 3300053156 Ga0500622_0000481 Ga0500622_0000481_31187_32389 400
1304 3300053156 Ga0500622_0004074 Ga0500622_0004074_5471_6673 400
1305 3300053158 Ga0500627_0075512 Ga0500627_0075512_225_1430 400
1306 iso_pu_bacteria 2751185877 2753672117 400
1307 iso_pu_bacteria 2772190705 2772603924 400
1308 3300002459 JGI24751J29686_10001013 JGI24751J29686_100010133 401
1309 3300002737 JGI25162J39368_1000024 JGI25162J39368_1000024146 401
1310 3300003316 rootH1_10073809 rootH1_100738099 401
1311 3300003322 rootL2_10058703 rootL2_100587031 401
1312 3300005288 Ga0065714_10007893 Ga0065714_100078934 401
1313 3300005289 Ga0065704_10084719 Ga0065704_100847193 401
1314 3300005295 Ga0065707_10175618 Ga0065707_101756181 401
1315 3300005327 Ga0070658_10000011 Ga0070658_1000001128 401
1316 3300005329 Ga0070683_100002536 Ga0070683_1000025369 401
1317 3300005329 Ga0070683_100075911 Ga0070683_1000759113 401
1318 3300005334 Ga0068869_100005917 Ga0068869_1000059176 401
1319 3300005335 Ga0070666_10199298 Ga0070666_101992981 401
1320 3300005337 Ga0070682_100000039 Ga0070682_1000000398 401
1321 3300005337 Ga0070682_100026312 Ga0070682_1000263123 401
1322 3300005343 Ga0070687_100001432 Ga0070687_1000014326 401
1323 3300005344 Ga0070661_100002636 Ga0070661_1000026362 401
1324 3300005353 Ga0070669_100057612 Ga0070669_1000576122 401
1325 3300005353 Ga0070669_100254111 Ga0070669_1002541112 401
1326 3300005355 Ga0070671_100019758 Ga0070671_1000197585 401
1327 3300005364 Ga0070673_100012715 Ga0070673_1000127153 401
1328 3300005366 Ga0070659_100003545 Ga0070659_1000035458 401
1329 3300005456 Ga0070678_100018818 Ga0070678_1000188182 401
1330 3300005457 Ga0070662_100030585 Ga0070662_1000305852 401
1331 3300005457 Ga0070662_100086776 Ga0070662_1000867762 401
1332 3300005458 Ga0070681_10036428 Ga0070681_100364284 401
1333 3300005459 Ga0068867_100023644 Ga0068867_1000236443 401
1334 3300005459 Ga0068867_100059230 Ga0068867_1000592302 401
1335 3300005459 Ga0068867_100276500 Ga0068867_1002765001 401
1336 3300005471 Ga0070698_100016067 Ga0070698_1000160677 401
1337 3300005535 Ga0070684_100000097 Ga0070684_1000000977 401
1338 3300005539 Ga0068853_100004545 Ga0068853_1000045453 401
1339 3300005539 Ga0068853_100008299 Ga0068853_1000082995 401
1340 3300005539 Ga0068853_100028221 Ga0068853_1000282214 401
1341 3300005548 Ga0070665_100311945 Ga0070665_1003119451 401
1342 3300005564 Ga0070664_100002153 Ga0070664_10000215311 401
1343 3300005577 Ga0068857_100001948 Ga0068857_1000019488 401
1344 3300005578 Ga0068854_100054632 Ga0068854_1000546322 401
1345 3300005614 Ga0068856_100000794 Ga0068856_1000007946 401
1346 3300005615 Ga0070702_100051565 Ga0070702_1000515652 401
1347 3300005616 Ga0068852_100016457 Ga0068852_1000164573 401
1348 3300005618 Ga0068864_100111824 Ga0068864_1001118242 401
1349 3300005719 Ga0068861_100160171 Ga0068861_1001601712 401
1350 3300005840 Ga0068870_10088051 Ga0068870_100880512 401
1351 3300005841 Ga0068863_100238773 Ga0068863_1002387732 401
1352 3300006844 Ga0075428_100004442 Ga0075428_10000444212 401
1353 3300006880 Ga0075429_100030837 Ga0075429_1000308374 401
1354 3300006880 Ga0075429_100071292 Ga0075429_1000712922 401
1355 3300009093 Ga0105240_10000237 Ga0105240_100002375 401
1356 3300009094 Ga0111539_10066976 Ga0111539_100669762 401
1357 3300009147 Ga0114129_10012446 Ga0114129_100124464 401
1358 3300009147 Ga0114129_10052518 Ga0114129_100525184 401
1359 3300009177 Ga0105248_10256759 Ga0105248_102567593 401
1360 3300009545 Ga0105237_10000224 Ga0105237_1000022432 401
1361 3300009545 Ga0105237_10000952 Ga0105237_1000095212 401
1362 3300009553 Ga0105249_10019422 Ga0105249_100194224 401
1363 3300009553 Ga0105249_10035542 Ga0105249_100355422 401
1364 3300010375 Ga0105239_10001207 Ga0105239_100012072 401
1365 3300013104 Ga0157370_10179980 Ga0157370_101799802 401
1366 3300013296 Ga0157374_10010541 Ga0157374_100105413 401
1367 3300013297 Ga0157378_10000859 Ga0157378_1000085914 401
1368 3300013306 Ga0163162_10001894 Ga0163162_100018943 401
1369 3300013306 Ga0163162_10013001 Ga0163162_100130013 401
1370 3300013306 Ga0163162_10109520 Ga0163162_101095202 401
1371 3300013308 Ga0157375_10043772 Ga0157375_100437722 401
1372 3300013308 Ga0157375_10137542 Ga0157375_101375422 401
1373 3300014326 Ga0157380_10089543 Ga0157380_100895432 401
1374 3300014745 Ga0157377_10081857 Ga0157377_100818572 401
1375 3300014968 Ga0157379_10082847 Ga0157379_100828472 401
1376 3300014968 Ga0157379_10115491 Ga0157379_101154912 401
1377 3300017792 Ga0163161_10015712 Ga0163161_100157124 401
1378 3300025233 Ga0209437_100017 Ga0209437_100017143 401
1379 3300025250 Ga0209026_1003574 Ga0209026_10035743 401
1380 3300025901 Ga0207688_10018186 Ga0207688_100181864 401
1381 3300025903 Ga0207680_10090488 Ga0207680_100904882 401
1382 3300025907 Ga0207645_10010687 Ga0207645_100106875 401
1383 3300025908 Ga0207643_10049960 Ga0207643_100499602 401
1384 3300025909 Ga0207705_10000015 Ga0207705_1000001529 401
1385 3300025911 Ga0207654_10054274 Ga0207654_100542742 401
1386 3300025913 Ga0207695_10000066 Ga0207695_1000006633 401
1387 3300025913 Ga0207695_10000156 Ga0207695_1000015676 401
1388 3300025913 Ga0207695_10006542 Ga0207695_100065429 401
1389 3300025914 Ga0207671_10005700 Ga0207671_1000570012 401
1390 3300025918 Ga0207662_10004278 Ga0207662_100042782 401
1391 3300025920 Ga0207649_10029127 Ga0207649_100291272 401
1392 3300025921 Ga0207652_10054962 Ga0207652_100549623 401
1393 3300025925 Ga0207650_10027506 Ga0207650_100275064 401
1394 3300025926 Ga0207659_10102119 Ga0207659_101021191 401
1395 3300025931 Ga0207644_10052439 Ga0207644_100524393 401
1396 3300025932 Ga0207690_10060376 Ga0207690_100603762 401
1397 3300025940 Ga0207691_10079855 Ga0207691_100798552 401
1398 3300025940 Ga0207691_10188552 Ga0207691_101885522 401
1399 3300025942 Ga0207689_10011320 Ga0207689_100113206 401
1400 3300025942 Ga0207689_10011416 Ga0207689_100114162 401
1401 3300025942 Ga0207689_10012630 Ga0207689_100126307 401
1402 3300025942 Ga0207689_10171472 Ga0207689_101714722 401
1403 3300025944 Ga0207661_10002590 Ga0207661_1000259010 401
1404 3300025945 Ga0207679_10006841 Ga0207679_100068416 401
1405 3300025945 Ga0207679_10026302 Ga0207679_100263024 401
1406 3300025949 Ga0207667_10009279 Ga0207667_100092796 401
1407 3300025961 Ga0207712_10011162 Ga0207712_100111624 401
1408 3300025981 Ga0207640_10025871 Ga0207640_100258712 401
1409 3300026023 Ga0207677_10010537 Ga0207677_100105373 401
1410 3300026023 Ga0207677_10071853 Ga0207677_100718532 401
1411 3300026041 Ga0207639_10018045 Ga0207639_100180454 401
1412 3300026041 Ga0207639_10020682 Ga0207639_100206823 401
1413 3300026078 Ga0207702_10000201 Ga0207702_1000020136 401
1414 3300026088 Ga0207641_10021690 Ga0207641_100216906 401
1415 3300026089 Ga0207648_10015449 Ga0207648_100154494 401
1416 3300026089 Ga0207648_10019442 Ga0207648_100194423 401
1417 3300026089 Ga0207648_10049799 Ga0207648_100497992 401
1418 3300026089 Ga0207648_10129399 Ga0207648_101293992 401
1419 3300026095 Ga0207676_10050937 Ga0207676_100509373 401
1420 3300026116 Ga0207674_10005014 Ga0207674_100050146 401
1421 3300026116 Ga0207674_10090955 Ga0207674_100909553 401
1422 3300026118 Ga0207675_100039652 Ga0207675_1000396523 401
1423 3300026118 Ga0207675_100199108 Ga0207675_1001991081 401
1424 3300026118 Ga0207675_100218011 Ga0207675_1002180112 401
1425 3300026121 Ga0207683_10041067 Ga0207683_100410672 401
1426 3300028794 Ga0307515_10001771 Ga0307515_1000177133 401
1427 3300031251 Ga0265327_10003148 Ga0265327_1000314815 401
1428 3300031507 Ga0307509_10174065 Ga0307509_101740652 401
1429 3300031616 Ga0307508_10007752 Ga0307508_100077526 401
1430 3300033179 Ga0307507_10000064 Ga0307507_1000006425 401
1431 3300035113 Ga0373936_0062866 Ga0373936_0062866_14_1225 401
1432 3300037471 Ga0395905_0000998 Ga0395905_0000998_8911_10131 401
1433 3300037471 Ga0395905_0007067 Ga0395905_0007067_8704_9966 401
1434 3300038443 Ga0395901_0000789 Ga0395901_0000789_4877_6097 401
1435 3300041997 Ga0439431_0000122 Ga0439431_0000122_5078_6331 401
1436 3300042002 Ga0439442_002574 Ga0439442_002574_641_1852 401
1437 3300042134 Ga0450898_002493 Ga0450898_002493_663_1874 401
1438 3300044842 Ga0466957_0001670 Ga0466957_0001670_1665_2918 401
1439 3300046471 Ga0495650_0021678 Ga0495650_0021678_389_1597 401
1440 3300046492 Ga0495585_0000411 Ga0495585_0000411_24399_25625 401
1441 3300046507 Ga0495606_0012165 Ga0495606_0012165_3670_4896 401
1442 3300046507 Ga0495606_0023782 Ga0495606_0023782_2069_3283 401
1443 3300046522 Ga0495643_0003411 Ga0495643_0003411_3626_4831 401
1444 3300046524 Ga0495648_0002877 Ga0495648_0002877_10310_11536 401
1445 3300046557 Ga0495622_0060076 Ga0495622_0060076_112_1338 401
1446 3300046616 Ga0495668_0000021 Ga0495668_0000021_276495_277721 401
1447 3300046660 Ga0495625_0001186 Ga0495625_0001186_7731_8957 401
1448 3300046683 Ga0495658_0025645 Ga0495658_0025645_1393_2619 401
1449 3300047320 Ga0495672_0002547 Ga0495672_0002547_7150_8382 401
1450 3300047472 Ga0495686_0012985 Ga0495686_0012985_4062_5318 401
1451 3300048089 Ga0495614_0030275 Ga0495614_0030275_850_2076 401
1452 3300049569 Ga0501032_0003483 Ga0501032_0003483_9810_11018 401
1453 3300049571 Ga0501034_0023798 Ga0501034_0023798_1267_2475 401
1454 3300049573 Ga0501037_0008589 Ga0501037_0008589_923_2131 401
1455 3300049573 Ga0501037_0027220 Ga0501037_0027220_1328_2533 401
1456 3300049574 Ga0501038_0142314 Ga0501038_0142314_77_1285 401
1457 3300049575 Ga0501039_0066169 Ga0501039_0066169_1567_2775 401
1458 3300049579 Ga0501043_0003386 Ga0501043_0003386_5118_6323 401
1459 3300049589 Ga0501073_0082775 Ga0501073_0082775_407_1612 401
1460 3300049758 Ga0501241_001025 Ga0501241_001025_554_1783 401
1461 3300049823 Ga0501044_0251193 Ga0501044_0251193_366_1574 401
1462 3300050005 Ga0501284_00072 Ga0501284_00072_17210_18421 401
1463 3300050507 nmdc:mga05p37_40325_c1 nmdc:mga05p37_40325_c1_2413_3660 401
1464 3300050508 nmdc:mga09592_66506_c1 nmdc:mga09592_66506_c1_991_2199 401
1465 3300050510 nmdc:mga06r32_4922_c1 nmdc:mga06r32_4922_c1_7139_8347 401
1466 3300050511 nmdc:mga08y16_171069_c1 nmdc:mga08y16_171069_c1_865_2073 401
1467 3300053146 Ga0500588_0001245 Ga0500588_0001245_1813_3024 401
1468 3300053161 Ga0500634_0024399 Ga0500634_0024399_174_1424 401
1469 3300053727 Ga0500611_000004 Ga0500611_000004_192463_193671 401
1470 3300003323 rootH1_10082354 rootH1_100823544 402
1471 3300003354 JGI25160J50197_1009613 JGI25160J50197_10096133 402
1472 3300005336 Ga0070680_100024474 Ga0070680_1000244745 402
1473 3300005341 Ga0070691_10000660 Ga0070691_100006606 402
1474 3300005458 Ga0070681_10017068 Ga0070681_100170685 402
1475 3300005530 Ga0070679_100025505 Ga0070679_1000255052 402
1476 3300005563 Ga0068855_100253898 Ga0068855_1002538982 402
1477 3300006195 Ga0075366_10009701 Ga0075366_100097013 402
1478 3300006358 Ga0068871_100001712 Ga0068871_1000017126 402
1479 3300009093 Ga0105240_10005515 Ga0105240_100055155 402
1480 3300009093 Ga0105240_10043261 Ga0105240_100432612 402
1481 3300009174 Ga0105241_10002922 Ga0105241_100029222 402
1482 3300009174 Ga0105241_10003042 Ga0105241_100030425 402
1483 3300009545 Ga0105237_10217300 Ga0105237_102173002 402
1484 3300010375 Ga0105239_10024908 Ga0105239_100249084 402
1485 3300013102 Ga0157371_10015344 Ga0157371_100153443 402
1486 3300013104 Ga0157370_10018487 Ga0157370_100184875 402
1487 3300013105 Ga0157369_10009363 Ga0157369_100093639 402
1488 3300013105 Ga0157369_10141071 Ga0157369_101410711 402
1489 3300013297 Ga0157378_10084952 Ga0157378_100849522 402
1490 3300013306 Ga0163162_10003934 Ga0163162_100039342 402
1491 3300013307 Ga0157372_10052820 Ga0157372_100528203 402
1492 3300025302 Ga0207426_1000026 Ga0207426_1000026423 402
1493 3300025911 Ga0207654_10003790 Ga0207654_100037905 402
1494 3300025912 Ga0207707_10000160 Ga0207707_1000016015 402
1495 3300025913 Ga0207695_10002404 Ga0207695_1000240420 402
1496 3300025917 Ga0207660_10001905 Ga0207660_1000190510 402
1497 3300025919 Ga0207657_10063853 Ga0207657_100638534 402
1498 3300025921 Ga0207652_10000406 Ga0207652_1000040616 402
1499 3300026041 Ga0207639_10056788 Ga0207639_100567882 402
1500 3300026116 Ga0207674_10260018 Ga0207674_102600181 402
1501 3300026121 Ga0207683_10187572 Ga0207683_101875722 402
1502 3300031251 Ga0265327_10000048 Ga0265327_10000048142 402
1503 3300031507 Ga0307509_10020755 Ga0307509_100207558 402
1504 3300035172 Ga0373955_0106131 Ga0373955_0106131_382_1596 402
1505 3300036401 Ga0373937_0064488 Ga0373937_0064488_230_1444 402
1506 3300041486 Ga0451807_1155230 Ga0451807_1155230_40_1296 402
1507 3300041505 Ga0451849_1009127 Ga0451849_1009127_17_1279 402
1508 3300044842 Ga0466957_0007722 Ga0466957_0007722_3143_4405 402
1509 3300046517 Ga0495630_0064766 Ga0495630_0064766_397_1620 402
1510 3300046531 Ga0495665_0104353 Ga0495665_0104353_153_1367 402
1511 3300046536 Ga0495587_0064905 Ga0495587_0064905_544_1758 402
1512 3300047320 Ga0495672_0066796 Ga0495672_0066796_471_1691 402
1513 3300048907 Ga0496104_0376680 Ga0496104_0376680_54_1277 402
1514 3300048925 Ga0496122_0004620 Ga0496122_0004620_1360_2571 402
1515 3300049580 Ga0501046_0032815 Ga0501046_0032815_2005_3219 402
1516 3300049583 Ga0501067_0006775 Ga0501067_0006775_1849_3063 402
1517 3300049585 Ga0501069_0025041 Ga0501069_0025041_888_2102 402
1518 3300049588 Ga0501072_0196270 Ga0501072_0196270_367_1581 402
1519 3300049744 Ga0501083_0007152 Ga0501083_0007152_2111_3325 402
1520 3300050493 nmdc:mga0k408_16257_c1 nmdc:mga0k408_16257_c1_1631_2893 402
1521 3300053078 Ga0495612_0047800 Ga0495612_0047800_38_1252 402
1522 2162886007 SwRhRL2b_contig_1663676 SwRhRL2b_0150.00002820 403
1523 3300001979 JGI24740J21852_10006938 JGI24740J21852_100069383 403
1524 3300005289 Ga0065704_10070136 Ga0065704_10070136121 403
1525 3300005290 Ga0065712_10001912 Ga0065712_100019127 403
1526 3300005293 Ga0065715_10005294 Ga0065715_100052943 403
1527 3300005293 Ga0065715_10133208 Ga0065715_101332081 403
1528 3300005328 Ga0070676_10094701 Ga0070676_100947012 403
1529 3300005331 Ga0070670_100038445 Ga0070670_1000384454 403
1530 3300005331 Ga0070670_100081448 Ga0070670_1000814481 403
1531 3300005340 Ga0070689_100010555 Ga0070689_1000105553 403
1532 3300005347 Ga0070668_100014483 Ga0070668_1000144834 403
1533 3300005354 Ga0070675_100003849 Ga0070675_1000038497 403
1534 3300005364 Ga0070673_100004396 Ga0070673_1000043966 403
1535 3300005365 Ga0070688_100026240 Ga0070688_1000262404 403
1536 3300005543 Ga0070672_100017587 Ga0070672_1000175875 403
1537 3300005577 Ga0068857_100010962 Ga0068857_1000109626 403
1538 3300005578 Ga0068854_100020090 Ga0068854_1000200904 403
1539 3300005617 Ga0068859_100008808 Ga0068859_1000088085 403
1540 3300005719 Ga0068861_100013324 Ga0068861_1000133241 403
1541 3300005840 Ga0068870_10028876 Ga0068870_100288763 403
1542 3300005844 Ga0068862_100006586 Ga0068862_1000065866 403
1543 3300006195 Ga0075366_10021509 Ga0075366_100215093 403
1544 3300006931 Ga0097620_100008808 Ga0097620_1000088088 403
1545 3300009094 Ga0111539_10014918 Ga0111539_100149187 403
1546 3300009545 Ga0105237_10002321 Ga0105237_100023214 403
1547 3300009553 Ga0105249_10180744 Ga0105249_101807441 403
1548 3300010375 Ga0105239_10025175 Ga0105239_100251753 403
1549 3300013306 Ga0163162_10041760 Ga0163162_100417602 403
1550 3300014745 Ga0157377_10006557 Ga0157377_100065573 403
1551 3300025315 Ga0207697_10058643 Ga0207697_100586432 403
1552 3300025907 Ga0207645_10132455 Ga0207645_101324552 403
1553 3300025908 Ga0207643_10003896 Ga0207643_100038963 403
1554 3300025925 Ga0207650_10062568 Ga0207650_100625683 403
1555 3300025926 Ga0207659_10014561 Ga0207659_100145612 403
1556 3300025940 Ga0207691_10030946 Ga0207691_100309465 403
1557 3300025960 Ga0207651_10008489 Ga0207651_100084892 403
1558 3300025972 Ga0207668_10043236 Ga0207668_100432364 403
1559 3300025981 Ga0207640_10091812 Ga0207640_100918122 403
1560 3300026116 Ga0207674_10005225 Ga0207674_100052257 403
1561 3300026118 Ga0207675_100005095 Ga0207675_1000050952 403
1562 3300028380 Ga0268265_10102470 Ga0268265_101024702 403
1563 3300046557 Ga0495622_0014656 Ga0495622_0014656_43_1254 403
1564 3300050511 nmdc:mga08y16_57072_c1 nmdc:mga08y16_57072_c1_2697_3947 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00764

Arginosuc_synth

Arginosuccinate synthase N-terminal HUP domain

45

207

0.98

PF20979

Arginosuc_syn_C

Arginosuccinate synthase C-terminal domain

215

431

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kh1-assembly1.cif.gz_A crystal structure of thermus thermophilus hb8 argininosuccinate synthetase 0.9306 6 395
1kh1-assembly1.cif.gz_A crystal structure of thermus thermophilus hb8 argininosuccinate synthetase 0.9212 6 395
2nz2-assembly1.cif.gz_A crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline 0.9209 5 395
1kh2-assembly1.cif.gz_D crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with atp 0.916 6 395
1kh3-assembly1.cif.gz_B crystal structure of thermus thermophilus hb8 argininosuccinate synthetase in complex with inhibitor 0.9154 6 395
ID Description Score Start End Superfamily
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9368 176 342 3.90.1260.10
af_O94354_181_408_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9146 177 390 3.90.1260.10
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9106 176 342 3.90.1260.10
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9102 177 360 3.90.1260.10
af_Q60174_173_395_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9098 177 397 3.90.1260.10
ID Description Score Start End GO Terms
AF-A0A4Q5SHL1-F1-model_v4 Argininosuccinate synthase 0.9888 4 249 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A2E2FP73-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9817 4 396 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A4Q5SHL1-F1-model_v4 Argininosuccinate synthase 0.9809 4 249 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A3D2NCT4-F1-model_v4 deleted 0.9806 4 146
AF-A0A7X8WJU2-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9798 66 397 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526

Feature Viewer

pLDDT pTM Quality
90.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map