F494647

General Info

Members Datasets Scaffolds Average Seq Length
1539 445 1537 174

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100134356|Ga0070714_1001343562
Length 188
Sequence VARCSATCGESMSRIGRKPITVPSGVDVEIGRGSVTVKGPKGTLSERVSPDMTVTLDDGTLLVTRPSDRGDHRALHGLTRSLVANMVTGVTDGFEKRLEIQGVGYRAALRGSDLEMQLGFSHPVSVKAPEGVTFEVPQPTQIVVRGISKQVVGEVAAQIRKWRPPEPYKGKGIRYADEHVVRKVGKRA

Samples

Sample ID Description Type Environment
1 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
141 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
215 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
231 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
232 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
262 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
263 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
266 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
267 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
270 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
271 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
272 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
273 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
293 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
294 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
295 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
296 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
315 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
374 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
375 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
392 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
393 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
394 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
395 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
396 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
397 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
398 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
399 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
427 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
428 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
429 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
430 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
431 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
432 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
433 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
434 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
435 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
436 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
437 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
438 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
439 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
445 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 3.25
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 8.9
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1011685 3300000546 Bacteria 935
2 JGI24746J21847_1000007 3300001977 Bacteria 20037
3 JGI24740J21852_10002914 3300001979 Bacteria 7630
4 JGI24735J21928_10080911 3300002067 Bacteria 930
5 JGI24748J21848_1033473 3300002074 Bacteria 640
6 JGI24751J29686_10011031 3300002459 Bacteria 1863
7 rootH1_10074761 3300003316 Bacteria 1035
8 JGI25407J50210_10056190 3300003373 Bacteria 993
9 Ga0058863_11570617 3300004799 Bacteria 1646
10 Ga0058861_11650416 3300004800 Bacteria 683
11 Ga0058862_12634493 3300004803 Bacteria 667
12 Ga0065704_10110588 3300005289 Bacteria 1935
13 Ga0065712_10078746 3300005290 Bacteria 3305
14 Ga0070658_10000015 3300005327 Bacteria 230579
15 Ga0070658_10000118 3300005327 Bacteria 71171
16 Ga0070658_10007473 3300005327 Bacteria 8820
17 Ga0070658_10019454 3300005327 Bacteria 5437
18 Ga0070658_10122863 3300005327 Bacteria 2158
19 Ga0070658_10305862 3300005327 Bacteria 1356
20 Ga0070676_10715942 3300005328 Bacteria 732
21 Ga0070683_100004183 3300005329 Bacteria 11830
22 Ga0070683_100011264 3300005329 Bacteria 7719
23 Ga0070683_100029181 3300005329 Bacteria 4992
24 Ga0070683_100062690 3300005329 Bacteria 3457
25 Ga0070683_100120685 3300005329 Bacteria 2476
26 Ga0070683_100126915 3300005329 Bacteria 2412
27 Ga0070683_100400204 3300005329 Bacteria 1309
28 Ga0070683_100439158 3300005329 Bacteria 1245
29 Ga0070683_100902682 3300005329 Bacteria 847
30 Ga0070690_100222031 3300005330 Bacteria 1324
31 Ga0070670_100075753 3300005331 Bacteria 2891
32 Ga0070670_100189978 3300005331 Bacteria 1784
33 Ga0070670_100207091 3300005331 Bacteria 1705
34 Ga0068869_100158217 3300005334 Bacteria 1762
35 Ga0068869_100201608 3300005334 Bacteria 1569
36 Ga0070666_10037083 3300005335 Bacteria 3240
37 Ga0070666_10042517 3300005335 Bacteria 3041
38 Ga0070666_10783074 3300005335 Bacteria 702
39 Ga0070680_100174812 3300005336 Bacteria 1808
40 Ga0070680_100470389 3300005336 Bacteria 1074
41 Ga0070680_100473139 3300005336 Bacteria 1071
42 Ga0070680_100485266 3300005336 Bacteria 1056
43 Ga0070680_100676750 3300005336 Bacteria 887
44 Ga0070682_100000032 3300005337 Bacteria 155141
45 Ga0070682_100010869 3300005337 Bacteria 5182
46 Ga0070682_100077562 3300005337 Bacteria 2141
47 Ga0070682_100158343 3300005337 Bacteria 1561
48 Ga0070682_100629081 3300005337 Bacteria 851
49 Ga0068868_100005144 3300005338 Bacteria 9183
50 Ga0068868_100008360 3300005338 Bacteria 7408
51 Ga0068868_100016812 3300005338 Bacteria 5440
52 Ga0068868_100041349 3300005338 Bacteria 3591
53 Ga0068868_100180134 3300005338 Bacteria 1753
54 Ga0068868_100433537 3300005338 Bacteria 1140
55 Ga0070660_100003497 3300005339 Bacteria 10822
56 Ga0070660_100004072 3300005339 Bacteria 10086
57 Ga0070689_100034029 3300005340 Bacteria 3886
58 Ga0070689_100058352 3300005340 Bacteria 2997
59 Ga0070689_100657789 3300005340 Bacteria 912
60 Ga0070691_10004069 3300005341 Bacteria 6629
61 Ga0070691_10034566 3300005341 Bacteria 2380
62 Ga0070691_10161418 3300005341 Bacteria 1156
63 Ga0070691_10335183 3300005341 Bacteria 836
64 Ga0070661_100000236 3300005344 Bacteria 45535
65 Ga0070661_100149640 3300005344 Bacteria 1764
66 Ga0070661_100263565 3300005344 Bacteria 1333
67 Ga0070692_10022554 3300005345 Bacteria 3075
68 Ga0070668_100012868 3300005347 Bacteria 6228
69 Ga0070668_100034700 3300005347 Bacteria 3845
70 Ga0070668_100261558 3300005347 Bacteria 1439
71 Ga0070669_100129229 3300005353 Bacteria 1936
72 Ga0070669_100966953 3300005353 Bacteria 729
73 Ga0070669_101118095 3300005353 Bacteria 679
74 Ga0070675_100003153 3300005354 Bacteria 12477
75 Ga0070675_100015253 3300005354 Bacteria 6069
76 Ga0070675_100055442 3300005354 Bacteria 3263
77 Ga0070675_100479127 3300005354 Bacteria 1119
78 Ga0070671_100035416 3300005355 Bacteria 4136
79 Ga0070671_100097555 3300005355 Bacteria 2465
80 Ga0070671_100569907 3300005355 Bacteria 977
81 Ga0070674_100000047 3300005356 Bacteria 52597
82 Ga0070674_100002494 3300005356 Bacteria 10191
83 Ga0070674_100013671 3300005356 Bacteria 5023
84 Ga0070674_100239505 3300005356 Bacteria 1420
85 Ga0070673_100088256 3300005364 Bacteria 2529
86 Ga0070688_100001088 3300005365 Bacteria 13570
87 Ga0070688_100011350 3300005365 Bacteria 4949
88 Ga0070688_100099832 3300005365 Bacteria 1912
89 Ga0070688_100168985 3300005365 Bacteria 1508
90 Ga0070688_100591745 3300005365 Bacteria 848
91 Ga0070659_100000983 3300005366 Bacteria 20974
92 Ga0070659_100012148 3300005366 Bacteria 6380
93 Ga0070659_100020922 3300005366 Bacteria 4975
94 Ga0070659_100199395 3300005366 Bacteria 1647
95 Ga0070659_100229298 3300005366 Bacteria 1535
96 Ga0070667_100001611 3300005367 Bacteria 20202
97 Ga0070667_100088657 3300005367 Bacteria 2657
98 Ga0070667_100239468 3300005367 Bacteria 1620
99 Ga0070667_100456329 3300005367 Bacteria 1168
100 Ga0070667_100577375 3300005367 Bacteria 1035
101 Ga0070709_10276115 3300005434 Bacteria 1219
102 Ga0070709_10340980 3300005434 Bacteria 1105
103 Ga0070714_100001163 3300005435 Bacteria 18957
104 Ga0070714_100048906 3300005435 Bacteria 3599
105 Ga0070714_100134356 3300005435 Bacteria 2213
106 Ga0070714_100265334 3300005435 Bacteria 1591
107 Ga0070714_100280218 3300005435 Bacteria 1548
108 Ga0070713_100000171 3300005436 Bacteria 43503
109 Ga0070713_100113570 3300005436 Bacteria 2365
110 Ga0070713_100504725 3300005436 Bacteria 1142
111 Ga0070710_10150605 3300005437 Bacteria 1434
112 Ga0070701_10066647 3300005438 Bacteria 1914
113 Ga0070701_10340196 3300005438 Bacteria 934
114 Ga0070711_100074674 3300005439 Bacteria 2398
115 Ga0070711_100107198 3300005439 Bacteria 2044
116 Ga0070711_100296794 3300005439 Bacteria 1284
117 Ga0070711_100672659 3300005439 Bacteria 870
118 Ga0070711_101123675 3300005439 Bacteria 678
119 Ga0070705_100017093 3300005440 Bacteria 3781
120 Ga0070705_100408265 3300005440 Bacteria 1008
121 Ga0070705_100809940 3300005440 Bacteria 746
122 Ga0070700_100036039 3300005441 Bacteria 2998
123 Ga0070700_100038179 3300005441 Bacteria 2926
124 Ga0070700_100058347 3300005441 Bacteria 2424
125 Ga0070700_100192473 3300005441 Bacteria 1427
126 Ga0070700_100217771 3300005441 Bacteria 1351
127 Ga0070694_100111319 3300005444 Bacteria 1951
128 Ga0070694_100519600 3300005444 Bacteria 950
129 Ga0070694_100978175 3300005444 Bacteria 702
130 Ga0070708_100555341 3300005445 Bacteria 1083
131 Ga0070708_100645117 3300005445 Bacteria 998
132 Ga0070663_100005936 3300005455 Bacteria 7308
133 Ga0070663_100178952 3300005455 Bacteria 1643
134 Ga0070678_100077056 3300005456 Bacteria 2514
135 Ga0070678_100092027 3300005456 Bacteria 2329
136 Ga0070678_100215648 3300005456 Bacteria 1593
137 Ga0070678_101084109 3300005456 Bacteria 739
138 Ga0070662_100012555 3300005457 Bacteria 5619
139 Ga0070662_100050321 3300005457 Bacteria 3006
140 Ga0070681_10030447 3300005458 Bacteria 5415
141 Ga0070681_10128861 3300005458 Bacteria 2463
142 Ga0070681_10227043 3300005458 Bacteria 1782
143 Ga0070681_10351113 3300005458 Unclassified 1385
144 Ga0068867_100006857 3300005459 Bacteria 8056
145 Ga0068867_100064935 3300005459 Bacteria 2714
146 Ga0068867_100140260 3300005459 Bacteria 1889
147 Ga0068867_100225818 3300005459 Bacteria 1511
148 Ga0070685_10001772 3300005466 Bacteria 11292
149 Ga0070685_10010414 3300005466 Bacteria 4831
150 Ga0070685_10027085 3300005466 Bacteria 3165
151 Ga0070685_10033076 3300005466 Bacteria 2901
152 Ga0070685_10083878 3300005466 Bacteria 1915
153 Ga0070685_10148849 3300005466 Bacteria 1482
154 Ga0070698_100436141 3300005471 Bacteria 1245
155 Ga0070679_100000190 3300005530 Bacteria 49809
156 Ga0070679_100014538 3300005530 Bacteria 7561
157 Ga0070679_100131625 3300005530 Bacteria 2482
158 Ga0070679_100232319 3300005530 Bacteria 1803
159 Ga0070679_100286093 3300005530 Bacteria 1600
160 Ga0070679_101322433 3300005530 Bacteria 666
161 Ga0070684_100022207 3300005535 Bacteria 5289
162 Ga0070684_100024915 3300005535 Bacteria 5022
163 Ga0070684_100107233 3300005535 Bacteria 2502
164 Ga0070684_100159000 3300005535 Bacteria 2049
165 Ga0070684_100180116 3300005535 Bacteria 1921
166 Ga0070684_100430446 3300005535 Bacteria 1218
167 Ga0070684_100815672 3300005535 Bacteria 872
168 Ga0068853_100011462 3300005539 Bacteria 7206
169 Ga0068853_100044541 3300005539 Bacteria 3798
170 Ga0068853_100209649 3300005539 Bacteria 1775
171 Ga0068853_100217776 3300005539 Bacteria 1742
172 Ga0068853_100247124 3300005539 Bacteria 1636
173 Ga0068853_100329816 3300005539 Bacteria 1416
174 Ga0070672_100000104 3300005543 Bacteria 42077
175 Ga0070672_100336465 3300005543 Bacteria 1285
176 Ga0070672_100508960 3300005543 Bacteria 1042
177 Ga0070686_100022071 3300005544 Bacteria 3789
178 Ga0070686_100539234 3300005544 Bacteria 911
179 Ga0070695_100036224 3300005545 Bacteria 3103
180 Ga0070693_100002598 3300005547 Bacteria 8314
181 Ga0070693_100005222 3300005547 Bacteria 6214
182 Ga0070693_100032488 3300005547 Bacteria 2871
183 Ga0070693_100055837 3300005547 Bacteria 2277
184 Ga0070693_100283429 3300005547 Bacteria 1110
185 Ga0070693_100386568 3300005547 Bacteria 967
186 Ga0070665_100000022 3300005548 Bacteria 379286
187 Ga0070665_100015972 3300005548 Bacteria 7536
188 Ga0070665_100096550 3300005548 Bacteria 2960
189 Ga0070665_100140907 3300005548 Bacteria 2414
190 Ga0070665_100206783 3300005548 Bacteria 1964
191 Ga0070665_100707115 3300005548 Bacteria 1021
192 Ga0070704_100108839 3300005549 Bacteria 2105
193 Ga0070704_100187708 3300005549 Bacteria 1659
194 Ga0068855_100006349 3300005563 Bacteria 14406
195 Ga0068855_100047827 3300005563 Bacteria 5052
196 Ga0068855_100178483 3300005563 Bacteria 2402
197 Ga0068855_100211085 3300005563 Bacteria 2181
198 Ga0068855_100279670 3300005563 Bacteria 1854
199 Ga0068855_100993881 3300005563 Bacteria 882
200 Ga0068855_101881237 3300005563 Bacteria 607
201 Ga0070664_100020446 3300005564 Bacteria 5450
202 Ga0070664_100347635 3300005564 Bacteria 1348
203 Ga0068857_100002203 3300005577 Bacteria 15874
204 Ga0068857_100083374 3300005577 Bacteria 2856
205 Ga0068857_100155712 3300005577 Bacteria 2072
206 Ga0068857_100180038 3300005577 Bacteria 1924
207 Ga0068857_100369462 3300005577 Bacteria 1331
208 Ga0068854_100000939 3300005578 Bacteria 17543
209 Ga0068854_100005645 3300005578 Bacteria 7903
210 Ga0068854_100067138 3300005578 Bacteria 2612
211 Ga0068854_100130717 3300005578 Bacteria 1917
212 Ga0068854_100275376 3300005578 Bacteria 1353
213 Ga0068854_100655853 3300005578 Bacteria 901
214 Ga0068854_100717453 3300005578 Bacteria 864
215 Ga0068856_100007857 3300005614 Bacteria 10417
216 Ga0068856_100032988 3300005614 Bacteria 5071
217 Ga0068856_100058414 3300005614 Bacteria 3809
218 Ga0068856_100174813 3300005614 Bacteria 2160
219 Ga0068856_100195146 3300005614 Bacteria 2038
220 Ga0068856_100437144 3300005614 Bacteria 1329
221 Ga0068856_101240572 3300005614 Bacteria 761
222 Ga0070702_100010103 3300005615 Bacteria 4639
223 Ga0070702_100025867 3300005615 Bacteria 3149
224 Ga0070702_100097970 3300005615 Bacteria 1793
225 Ga0070702_100141916 3300005615 Bacteria 1531
226 Ga0068852_100001042 3300005616 Bacteria 18249
227 Ga0068852_100008410 3300005616 Bacteria 7606
228 Ga0068852_100044592 3300005616 Bacteria 3767
229 Ga0068852_100082661 3300005616 Bacteria 2854
230 Ga0068852_100414582 3300005616 Bacteria 1327
231 Ga0068852_101101210 3300005616 Bacteria 814
232 Ga0068859_100281472 3300005617 Bacteria 1756
233 Ga0068859_100284381 3300005617 Bacteria 1747
234 Ga0068864_100082274 3300005618 Bacteria 2825
235 Ga0068864_100097001 3300005618 Bacteria 2610
236 Ga0068864_100178344 3300005618 Bacteria 1941
237 Ga0068866_10000274 3300005718 Bacteria 24536
238 Ga0068866_10012947 3300005718 Bacteria 3646
239 Ga0068866_10042370 3300005718 Bacteria 2265
240 Ga0068866_10110638 3300005718 Bacteria 1532
241 Ga0068866_10134589 3300005718 Bacteria 1410
242 Ga0068861_100213707 3300005719 Bacteria 1626
243 Ga0068861_100214600 3300005719 Bacteria 1623
244 Ga0068861_100528701 3300005719 Bacteria 1071
245 Ga0068851_10012553 3300005834 Bacteria 3996
246 Ga0068851_10017683 3300005834 Bacteria 3428
247 Ga0068851_10052359 3300005834 Bacteria 2076
248 Ga0068851_10063119 3300005834 Bacteria 1902
249 Ga0068851_10259012 3300005834 Bacteria 989
250 Ga0068851_10537491 3300005834 Bacteria 705
251 Ga0068870_10157767 3300005840 Bacteria 1343
252 Ga0068870_10684856 3300005840 Bacteria 706
253 Ga0068863_100022347 3300005841 Bacteria 6040
254 Ga0068863_100022829 3300005841 Bacteria 5978
255 Ga0068863_100401959 3300005841 Bacteria 1340
256 Ga0068858_100000150 3300005842 Bacteria 73075
257 Ga0068858_100000287 3300005842 Bacteria 54456
258 Ga0068858_100042254 3300005842 Bacteria 4227
259 Ga0068858_100212734 3300005842 Bacteria 1830
260 Ga0068858_100284152 3300005842 Bacteria 1576
261 Ga0068858_100454298 3300005842 Bacteria 1235
262 Ga0068860_100187700 3300005843 Bacteria 1999
263 Ga0068860_100230527 3300005843 Bacteria 1800
264 Ga0068860_100521315 3300005843 Bacteria 1188
265 Ga0068860_100910753 3300005843 Bacteria 896
266 Ga0068862_100001247 3300005844 Bacteria 23931
267 Ga0068862_100085173 3300005844 Bacteria 2747
268 Ga0068862_100223998 3300005844 Bacteria 1704
269 Ga0068862_100366143 3300005844 Bacteria 1341
270 Ga0068862_101456934 3300005844 Bacteria 689
271 Ga0081455_10000003 3300005937 Bacteria 367763
272 Ga0081455_10006416 3300005937 Bacteria 12613
273 Ga0081455_10012340 3300005937 Bacteria 8525
274 Ga0081455_10021974 3300005937 Bacteria 5973
275 Ga0081455_10025075 3300005937 Bacteria 5511
276 Ga0081455_10031114 3300005937 Bacteria 4834
277 Ga0081455_10050580 3300005937 Bacteria 3573
278 Ga0081455_10073187 3300005937 Bacteria 2834
279 Ga0081455_10128075 3300005937 Bacteria 1989
280 Ga0081455_10236680 3300005937 Bacteria 1344
281 Ga0081455_10307183 3300005937 Bacteria 1135
282 Ga0081455_10745981 3300005937 Bacteria 619
283 Ga0081538_10000208 3300005981 Bacteria 65347
284 Ga0081538_10000396 3300005981 Bacteria 49639
285 Ga0081538_10017543 3300005981 Bacteria 5427
286 Ga0081538_10026960 3300005981 Bacteria 3999
287 Ga0081538_10031480 3300005981 Bacteria 3576
288 Ga0081538_10054863 3300005981 Bacteria 2351
289 Ga0081540_1000281 3300005983 Bacteria 52990
290 Ga0081540_1000553 3300005983 Bacteria 36267
291 Ga0081540_1037072 3300005983 Bacteria 2589
292 Ga0081539_10002195 3300005985 Bacteria 28613
293 Ga0081539_10007216 3300005985 Bacteria 10224
294 Ga0081539_10079529 3300005985 Bacteria 1727
295 Ga0070717_10546230 3300006028 Bacteria 1049
296 Ga0075365_10048694 3300006038 Bacteria 2790
297 Ga0075365_10055135 3300006038 Bacteria 2638
298 Ga0075363_100009790 3300006048 Bacteria 4517
299 Ga0075363_100089279 3300006048 Bacteria 1695
300 Ga0075363_100109474 3300006048 Bacteria 1535
301 Ga0075364_10143065 3300006051 Bacteria 1609
302 Ga0075364_10164933 3300006051 Bacteria 1496
303 Ga0070715_10169092 3300006163 Bacteria 1087
304 Ga0070712_100003252 3300006175 Bacteria 10001
305 Ga0070712_100054680 3300006175 Bacteria 2792
306 Ga0070712_100088319 3300006175 Bacteria 2265
307 Ga0070712_100150232 3300006175 Bacteria 1788
308 Ga0070712_100257000 3300006175 Bacteria 1398
309 Ga0070712_100348338 3300006175 Bacteria 1211
310 Ga0070712_101155653 3300006175 Bacteria 673
311 Ga0075367_10154198 3300006178 Bacteria 1427
312 Ga0075367_10170497 3300006178 Bacteria 1356
313 Ga0075369_10039405 3300006186 Bacteria 2018
314 Ga0075366_10000065 3300006195 Bacteria 39633
315 Ga0097621_100000264 3300006237 Bacteria 35498
316 Ga0097621_100048344 3300006237 Bacteria 3451
317 Ga0097621_100116173 3300006237 Bacteria 2265
318 Ga0097621_100225765 3300006237 Bacteria 1633
319 Ga0097621_100799015 3300006237 Bacteria 874
320 Ga0097621_100876354 3300006237 Bacteria 835
321 Ga0068871_100000039 3300006358 Bacteria 69204
322 Ga0068871_100016147 3300006358 Bacteria 5612
323 Ga0068871_100063004 3300006358 Bacteria 3032
324 Ga0068871_100745261 3300006358 Bacteria 900
325 Ga0075428_100046826 3300006844 Bacteria 4750
326 Ga0075430_100049708 3300006846 Bacteria 3539
327 Ga0075430_100051923 3300006846 Bacteria 3453
328 Ga0075431_100008449 3300006847 Bacteria 10310
329 Ga0075431_100119473 3300006847 Bacteria 2720
330 Ga0075433_10004429 3300006852 Bacteria 10932
331 Ga0075433_10199216 3300006852 Bacteria 1780
332 Ga0075434_100007021 3300006871 Bacteria 10385
333 Ga0075434_100011481 3300006871 Bacteria 8359
334 Ga0075434_100040672 3300006871 Bacteria 4604
335 Ga0075434_100289492 3300006871 Bacteria 1658
336 Ga0068865_100000056 3300006881 Bacteria 62122
337 Ga0068865_100047901 3300006881 Bacteria 2939
338 Ga0068865_100342588 3300006881 Bacteria 1208
339 Ga0075436_100004770 3300006914 Bacteria 9309
340 Ga0097620_100281502 3300006931 Bacteria 1756
341 Ga0097620_100284382 3300006931 Bacteria 1747
342 Ga0075435_100005293 3300007076 Bacteria 8987
343 Ga0075435_100011052 3300007076 Bacteria 6623
344 Ga0075435_100064160 3300007076 Bacteria 2984
345 Ga0099795_10261319 3300007788 Bacteria 750
346 Ga0105240_10006736 3300009093 Bacteria 16822
347 Ga0105240_10311681 3300009093 Bacteria 1797
348 Ga0105240_10346610 3300009093 Bacteria 1686
349 Ga0105240_10758720 3300009093 Bacteria 1054
350 Ga0105240_10822894 3300009093 Bacteria 1004
351 Ga0105240_11277054 3300009093 Bacteria 775
352 Ga0111539_10046654 3300009094 Bacteria 5182
353 Ga0111539_10124228 3300009094 Bacteria 3025
354 Ga0111539_10502947 3300009094 Bacteria 1411
355 Ga0111539_10790485 3300009094 Bacteria 1104
356 Ga0111539_12768004 3300009094 Bacteria 568
357 Ga0105245_10000002 3300009098 Bacteria 634374
358 Ga0105245_10000528 3300009098 Bacteria 35016
359 Ga0105245_10003202 3300009098 Bacteria 14647
360 Ga0105245_10006370 3300009098 Bacteria 10387
361 Ga0105245_10011993 3300009098 Bacteria 7535
362 Ga0105245_10028801 3300009098 Bacteria 4901
363 Ga0105245_10051809 3300009098 Bacteria 3680
364 Ga0105245_10118112 3300009098 Bacteria 2474
365 Ga0105245_10296712 3300009098 Bacteria 1584
366 Ga0105247_10000064 3300009101 Bacteria 123994
367 Ga0105247_10068106 3300009101 Bacteria 2219
368 Ga0105247_10079500 3300009101 Bacteria 2064
369 Ga0105247_10402446 3300009101 Bacteria 976
370 Ga0105247_10884445 3300009101 Bacteria 688
371 Ga0114129_10038141 3300009147 Bacteria 6780
372 Ga0114129_10055173 3300009147 Bacteria 5570
373 Ga0114129_10300349 3300009147 Bacteria 2140
374 Ga0114129_10727935 3300009147 Bacteria 1272
375 Ga0114129_10791523 3300009147 Bacteria 1210
376 Ga0105243_10009298 3300009148 Bacteria 7497
377 Ga0105243_10151802 3300009148 Bacteria 1988
378 Ga0105243_10321933 3300009148 Bacteria 1409
379 Ga0105243_10356194 3300009148 Bacteria 1345
380 Ga0105243_10926707 3300009148 Bacteria 868
381 Ga0105241_10156143 3300009174 Bacteria 1871
382 Ga0105241_10331739 3300009174 Bacteria 1315
383 Ga0105241_10380953 3300009174 Bacteria 1232
384 Ga0105241_10539503 3300009174 Bacteria 1046
385 Ga0105241_10706018 3300009174 Bacteria 921
386 Ga0105241_11619825 3300009174 Bacteria 627
387 Ga0105242_10000123 3300009176 Bacteria 56900
388 Ga0105242_10003277 3300009176 Bacteria 12618
389 Ga0105242_10015377 3300009176 Bacteria 5942
390 Ga0105242_10066186 3300009176 Bacteria 2983
391 Ga0105242_10082853 3300009176 Bacteria 2685
392 Ga0105242_10130118 3300009176 Bacteria 2171
393 Ga0105242_10228906 3300009176 Bacteria 1665
394 Ga0105242_11162319 3300009176 Bacteria 789
395 Ga0105248_10001735 3300009177 Bacteria 24226
396 Ga0105248_10065805 3300009177 Bacteria 4070
397 Ga0105248_10100212 3300009177 Bacteria 3264
398 Ga0105248_10443536 3300009177 Bacteria 1462
399 Ga0105248_10459819 3300009177 Bacteria 1435
400 Ga0105248_10558017 3300009177 Bacteria 1292
401 Ga0105237_10059780 3300009545 Bacteria 3813
402 Ga0105237_10061198 3300009545 Bacteria 3765
403 Ga0105237_10216807 3300009545 Bacteria 1914
404 Ga0105237_10392389 3300009545 Bacteria 1393
405 Ga0105238_10067131 3300009551 Bacteria 3588
406 Ga0105238_10131331 3300009551 Bacteria 2483
407 Ga0105238_10153585 3300009551 Bacteria 2277
408 Ga0105238_10172824 3300009551 Bacteria 2137
409 Ga0105238_10515498 3300009551 Bacteria 1198
410 Ga0105238_10520702 3300009551 Bacteria 1192
411 Ga0105238_11854966 3300009551 Bacteria 635
412 Ga0105249_10000181 3300009553 Bacteria 73946
413 Ga0105249_10003640 3300009553 Bacteria 13325
414 Ga0105249_10020972 3300009553 Bacteria 5846
415 Ga0105249_10044378 3300009553 Bacteria 4042
416 Ga0105249_10304613 3300009553 Bacteria 1599
417 Ga0105249_10415983 3300009553 Bacteria 1377
418 Ga0105249_10429359 3300009553 Bacteria 1356
419 Ga0105239_10024932 3300010375 Bacteria 6588
420 Ga0105239_10063402 3300010375 Bacteria 4057
421 Ga0105239_10142086 3300010375 Bacteria 2675
422 Ga0105239_10161441 3300010375 Bacteria 2503
423 Ga0105239_10162422 3300010375 Bacteria 2496
424 Ga0105239_10189923 3300010375 Bacteria 2299
425 Ga0105239_10225732 3300010375 Bacteria 2101
426 Ga0105239_10479465 3300010375 Bacteria 1413
427 Ga0105239_10617371 3300010375 Bacteria 1237
428 Ga0105239_11080683 3300010375 Bacteria 923
429 Ga0105239_11423915 3300010375 Bacteria 800
430 Ga0105246_10023148 3300011119 Bacteria 4017
431 Ga0105246_10036447 3300011119 Bacteria 3295
432 Ga0105246_10553700 3300011119 Bacteria 986
433 Ga0154012_155380 3300013059 Bacteria 783
434 Ga0157373_10071697 3300013100 Bacteria 2446
435 Ga0157371_10017630 3300013102 Bacteria 5298
436 Ga0157371_10100010 3300013102 Bacteria 2056
437 Ga0157371_10225506 3300013102 Bacteria 1346
438 Ga0157371_10791850 3300013102 Bacteria 714
439 Ga0157370_10019846 3300013104 Bacteria 6727
440 Ga0157370_10152375 3300013104 Bacteria 2151
441 Ga0157370_10411144 3300013104 Bacteria 1245
442 Ga0157369_10000068 3300013105 Bacteria 144274
443 Ga0157369_10155965 3300013105 Bacteria 2411
444 Ga0157369_10223079 3300013105 Bacteria 1972
445 Ga0157369_10253672 3300013105 Bacteria 1836
446 Ga0157369_10290843 3300013105 Bacteria 1701
447 Ga0157369_10308657 3300013105 Bacteria 1645
448 Ga0157369_10440542 3300013105 Bacteria 1350
449 Ga0157369_11052111 3300013105 Bacteria 833
450 Ga0157369_11094754 3300013105 Bacteria 814
451 Ga0157374_10000031 3300013296 Bacteria 204840
452 Ga0157374_10007487 3300013296 Bacteria 9310
453 Ga0157374_10049184 3300013296 Bacteria 3916
454 Ga0157374_10389560 3300013296 Bacteria 1389
455 Ga0157374_10449298 3300013296 Bacteria 1290
456 Ga0157378_10026190 3300013297 Bacteria 5140
457 Ga0157378_10036743 3300013297 Bacteria 4335
458 Ga0157378_10390154 3300013297 Bacteria 1369
459 Ga0163162_10234909 3300013306 Bacteria 1964
460 Ga0163162_10392910 3300013306 Bacteria 1520
461 Ga0163162_10491905 3300013306 Bacteria 1357
462 Ga0163162_10726749 3300013306 Bacteria 1113
463 Ga0163162_10997519 3300013306 Bacteria 947
464 Ga0163162_11150743 3300013306 Bacteria 880
465 Ga0157372_10000809 3300013307 Bacteria 33940
466 Ga0157372_10043850 3300013307 Bacteria 4955
467 Ga0157372_10144542 3300013307 Bacteria 2743
468 Ga0157372_10333254 3300013307 Bacteria 1767
469 Ga0157372_10472159 3300013307 Bacteria 1462
470 Ga0157372_10868018 3300013307 Bacteria 1047
471 Ga0157372_10904055 3300013307 Bacteria 1024
472 Ga0157372_11605889 3300013307 Bacteria 749
473 Ga0157375_10000126 3300013308 Bacteria 75410
474 Ga0157375_10062797 3300013308 Bacteria 3692
475 Ga0157375_10231424 3300013308 Bacteria 2007
476 Ga0157375_10505993 3300013308 Bacteria 1372
477 Ga0157375_10586201 3300013308 Bacteria 1275
478 Ga0157375_11335368 3300013308 Bacteria 844
479 Ga0163163_10161117 3300014325 Bacteria 2289
480 Ga0163163_10197945 3300014325 Bacteria 2057
481 Ga0163163_10930423 3300014325 Bacteria 933
482 Ga0163163_11942625 3300014325 Bacteria 648
483 Ga0157380_10000560 3300014326 Bacteria 22835
484 Ga0157380_10000808 3300014326 Bacteria 19608
485 Ga0157380_10010840 3300014326 Bacteria 6571
486 Ga0157380_10242813 3300014326 Bacteria 1625
487 Ga0157380_10354710 3300014326 Bacteria 1374
488 Ga0157377_10005570 3300014745 Bacteria 5930
489 Ga0157377_10055609 3300014745 Bacteria 2244
490 Ga0157379_10035775 3300014968 Bacteria 4428
491 Ga0157379_10036674 3300014968 Bacteria 4371
492 Ga0157379_10151797 3300014968 Bacteria 2089
493 Ga0157379_10317800 3300014968 Bacteria 1421
494 Ga0157379_10331925 3300014968 Bacteria 1390
495 Ga0157379_10431970 3300014968 Bacteria 1214
496 Ga0157379_10453386 3300014968 Bacteria 1184
497 Ga0157376_10068638 3300014969 Bacteria 3003
498 Ga0157376_10171187 3300014969 Bacteria 1978
499 Ga0157376_10190310 3300014969 Bacteria 1881
500 Ga0157376_10202240 3300014969 Bacteria 1828
501 Ga0157376_10814688 3300014969 Bacteria 947
502 Ga0163161_10026094 3300017792 Bacteria 4139
503 Ga0163161_10154484 3300017792 Bacteria 1746
504 Ga0197907_10374124 3300020069 Bacteria 1786
505 Ga0197907_10806034 3300020069 Bacteria 2142
506 Ga0197907_11061596 3300020069 Bacteria 1851
507 Ga0206356_10172704 3300020070 Bacteria 2119
508 Ga0206356_10263773 3300020070 Bacteria 811
509 Ga0206356_11170571 3300020070 Bacteria 1793
510 Ga0206349_1180813 3300020075 Bacteria 2239
511 Ga0206355_1489689 3300020076 Bacteria 1957
512 Ga0206352_10474987 3300020078 Bacteria 3204
513 Ga0206352_10514711 3300020078 Bacteria 2126
514 Ga0206350_10358935 3300020080 Bacteria 2417
515 Ga0206350_10478609 3300020080 Bacteria 1979
516 Ga0206350_10883997 3300020080 Bacteria 1512
517 Ga0206354_10637918 3300020081 Bacteria 2291
518 Ga0206354_11580278 3300020081 Bacteria 918
519 Ga0206353_10631379 3300020082 Bacteria 1834
520 Ga0206353_10821093 3300020082 Bacteria 624
521 Ga0206353_11197058 3300020082 Bacteria 1851
522 Ga0206353_11748998 3300020082 Bacteria 2764
523 Ga0213873_10000029 3300021358 Bacteria 59669
524 Ga0213876_10020166 3300021384 Bacteria 3523
525 Ga0213876_10040339 3300021384 Bacteria 2466
526 Ga0213875_10000107 3300021388 Bacteria 95120
527 Ga0224712_10001255 3300022467 Bacteria 5730
528 Ga0224712_10001920 3300022467 Bacteria 5006
529 Ga0224712_10030109 3300022467 Bacteria 1956
530 Ga0224712_10090631 3300022467 Bacteria 1280
531 Ga0224712_10168342 3300022467 Bacteria 981
532 Ga0224712_10203812 3300022467 Bacteria 900
533 Ga0207697_10111218 3300025315 Bacteria 1173
534 Ga0207656_10001048 3300025321 Bacteria 9048
535 Ga0207656_10001578 3300025321 Bacteria 7582
536 Ga0207656_10015654 3300025321 Bacteria 2939
537 Ga0207656_10520519 3300025321 Bacteria 604
538 Ga0207692_10047628 3300025898 Bacteria 2153
539 Ga0207692_10094434 3300025898 Bacteria 1629
540 Ga0207642_10000290 3300025899 Bacteria 15000
541 Ga0207642_10001731 3300025899 Bacteria 6725
542 Ga0207642_10016604 3300025899 Bacteria 2777
543 Ga0207642_10278862 3300025899 Bacteria 960
544 Ga0207710_10000220 3300025900 Bacteria 50023
545 Ga0207710_10049726 3300025900 Bacteria 1879
546 Ga0207710_10058926 3300025900 Bacteria 1737
547 Ga0207688_10003165 3300025901 Bacteria 8975
548 Ga0207688_10006351 3300025901 Bacteria 6434
549 Ga0207688_10013562 3300025901 Bacteria 4430
550 Ga0207680_10077588 3300025903 Bacteria 2078
551 Ga0207680_10725882 3300025903 Bacteria 712
552 Ga0207647_10008577 3300025904 Bacteria 7315
553 Ga0207647_10072100 3300025904 Bacteria 2083
554 Ga0207647_10179056 3300025904 Bacteria 1232
555 Ga0207685_10142126 3300025905 Bacteria 1077
556 Ga0207643_10090540 3300025908 Bacteria 1783
557 Ga0207643_10197574 3300025908 Bacteria 1223
558 Ga0207643_10708799 3300025908 Bacteria 651
559 Ga0207705_10000011 3300025909 Bacteria 517768
560 Ga0207705_10000167 3300025909 Bacteria 71284
561 Ga0207705_10007444 3300025909 Bacteria 8051
562 Ga0207705_10014343 3300025909 Bacteria 5703
563 Ga0207705_10073917 3300025909 Bacteria 2474
564 Ga0207705_10159270 3300025909 Bacteria 1695
565 Ga0207705_10783522 3300025909 Bacteria 740
566 Ga0207654_10018225 3300025911 Bacteria 3680
567 Ga0207654_10465371 3300025911 Bacteria 889
568 Ga0207707_10023272 3300025912 Bacteria 5421
569 Ga0207707_10044938 3300025912 Bacteria 3850
570 Ga0207707_10094215 3300025912 Bacteria 2616
571 Ga0207695_10006377 3300025913 Bacteria 15351
572 Ga0207695_10024364 3300025913 Bacteria 6812
573 Ga0207695_10053583 3300025913 Bacteria 4218
574 Ga0207695_10827714 3300025913 Bacteria 806
575 Ga0207695_11230853 3300025913 Bacteria 629
576 Ga0207671_10073969 3300025914 Bacteria 2546
577 Ga0207671_10159889 3300025914 Bacteria 1744
578 Ga0207671_10414997 3300025914 Bacteria 1071
579 Ga0207693_10001647 3300025915 Bacteria 19699
580 Ga0207693_10012090 3300025915 Bacteria 6979
581 Ga0207693_10021498 3300025915 Bacteria 5126
582 Ga0207693_10033589 3300025915 Bacteria 4047
583 Ga0207693_10108337 3300025915 Bacteria 2179
584 Ga0207663_10004707 3300025916 Bacteria 6816
585 Ga0207663_10036461 3300025916 Bacteria 2959
586 Ga0207663_10997553 3300025916 Bacteria 672
587 Ga0207660_10081356 3300025917 Bacteria 2380
588 Ga0207660_10175795 3300025917 Bacteria 1660
589 Ga0207660_10229768 3300025917 Bacteria 1458
590 Ga0207660_10308126 3300025917 Bacteria 1262
591 Ga0207662_10068507 3300025918 Bacteria 2143
592 Ga0207662_10295167 3300025918 Bacteria 1076
593 Ga0207657_10001826 3300025919 Bacteria 22969
594 Ga0207657_10006521 3300025919 Bacteria 12089
595 Ga0207657_10057557 3300025919 Bacteria 3350
596 Ga0207657_10387592 3300025919 Bacteria 1100
597 Ga0207649_10000166 3300025920 Bacteria 53758
598 Ga0207652_10000242 3300025921 Bacteria 56966
599 Ga0207652_10027609 3300025921 Bacteria 4730
600 Ga0207652_10061664 3300025921 Bacteria 3239
601 Ga0207652_10580586 3300025921 Bacteria 1006
602 Ga0207694_10006100 3300025924 Bacteria 9215
603 Ga0207694_10092117 3300025924 Bacteria 2392
604 Ga0207694_10115581 3300025924 Bacteria 2138
605 Ga0207694_10140636 3300025924 Bacteria 1941
606 Ga0207694_10160387 3300025924 Bacteria 1816
607 Ga0207694_10396218 3300025924 Bacteria 1148
608 Ga0207650_10151787 3300025925 Bacteria 1829
609 Ga0207650_10173283 3300025925 Bacteria 1716
610 Ga0207659_10000138 3300025926 Bacteria 42755
611 Ga0207659_10084754 3300025926 Bacteria 2352
612 Ga0207659_10162720 3300025926 Bacteria 1754
613 Ga0207659_11132238 3300025926 Bacteria 673
614 Ga0207687_10000001 3300025927 Bacteria 1130810
615 Ga0207687_10000025 3300025927 Bacteria 175177
616 Ga0207687_10000132 3300025927 Bacteria 50024
617 Ga0207687_10000332 3300025927 Bacteria 31692
618 Ga0207687_10002690 3300025927 Bacteria 12023
619 Ga0207687_10017439 3300025927 Bacteria 4728
620 Ga0207687_10211527 3300025927 Bacteria 1522
621 Ga0207687_10713360 3300025927 Bacteria 852
622 Ga0207687_11115275 3300025927 Bacteria 678
623 Ga0207700_10000019 3300025928 Bacteria 183117
624 Ga0207700_10142380 3300025928 Bacteria 1972
625 Ga0207664_10006241 3300025929 Bacteria 8187
626 Ga0207664_10017195 3300025929 Bacteria 5296
627 Ga0207664_10111635 3300025929 Bacteria 2275
628 Ga0207664_10203949 3300025929 Bacteria 1708
629 Ga0207664_10305464 3300025929 Bacteria 1401
630 Ga0207664_10764445 3300025929 Bacteria 869
631 Ga0207644_10000001 3300025931 Bacteria 1243214
632 Ga0207644_10081707 3300025931 Bacteria 2389
633 Ga0207644_10106804 3300025931 Bacteria 2111
634 Ga0207644_10249849 3300025931 Bacteria 1415
635 Ga0207690_10012718 3300025932 Bacteria 5044
636 Ga0207690_10018842 3300025932 Bacteria 4238
637 Ga0207690_10057954 3300025932 Bacteria 2618
638 Ga0207690_10064977 3300025932 Bacteria 2493
639 Ga0207690_10226334 3300025932 Bacteria 1434
640 Ga0207690_10756764 3300025932 Bacteria 801
641 Ga0207706_10010003 3300025933 Bacteria 8692
642 Ga0207706_10038324 3300025933 Bacteria 4252
643 Ga0207706_10061710 3300025933 Bacteria 3301
644 Ga0207706_11129644 3300025933 Bacteria 654
645 Ga0207686_10000066 3300025934 Bacteria 95095
646 Ga0207686_10001614 3300025934 Bacteria 12622
647 Ga0207686_10033231 3300025934 Bacteria 3077
648 Ga0207709_10113945 3300025935 Bacteria 1813
649 Ga0207709_10145220 3300025935 Bacteria 1636
650 Ga0207709_10183989 3300025935 Bacteria 1478
651 Ga0207709_10217571 3300025935 Bacteria 1375
652 Ga0207709_10218028 3300025935 Bacteria 1374
653 Ga0207709_10347456 3300025935 Bacteria 1118
654 Ga0207670_10123348 3300025936 Bacteria 1887
655 Ga0207670_10344528 3300025936 Bacteria 1179
656 Ga0207670_10553904 3300025936 Bacteria 940
657 Ga0207669_10000002 3300025937 Bacteria 377651
658 Ga0207669_10004557 3300025937 Bacteria 6112
659 Ga0207669_10027599 3300025937 Bacteria 3111
660 Ga0207669_10269841 3300025937 Bacteria 1277
661 Ga0207669_10282036 3300025937 Bacteria 1253
662 Ga0207669_10308753 3300025937 Bacteria 1205
663 Ga0207704_10000308 3300025938 Bacteria 22892
664 Ga0207704_10028005 3300025938 Bacteria 3119
665 Ga0207704_10032037 3300025938 Bacteria 2969
666 Ga0207704_10043014 3300025938 Bacteria 2663
667 Ga0207665_10006238 3300025939 Bacteria 7917
668 Ga0207691_10000430 3300025940 Bacteria 41789
669 Ga0207691_10051899 3300025940 Bacteria 3747
670 Ga0207691_10296099 3300025940 Bacteria 1391
671 Ga0207711_10000011 3300025941 Bacteria 518817
672 Ga0207711_10035265 3300025941 Bacteria 4240
673 Ga0207711_10180575 3300025941 Bacteria 1919
674 Ga0207711_10708492 3300025941 Bacteria 939
675 Ga0207711_10799925 3300025941 Bacteria 878
676 Ga0207711_11225190 3300025941 Bacteria 692
677 Ga0207689_10034455 3300025942 Bacteria 4206
678 Ga0207689_10212854 3300025942 Bacteria 1597
679 Ga0207689_10951246 3300025942 Bacteria 725
680 Ga0207661_10000518 3300025944 Bacteria 24943
681 Ga0207661_10000616 3300025944 Bacteria 22858
682 Ga0207661_10002864 3300025944 Bacteria 11918
683 Ga0207661_10046081 3300025944 Bacteria 3456
684 Ga0207661_10075445 3300025944 Bacteria 2767
685 Ga0207661_10086229 3300025944 Bacteria 2605
686 Ga0207661_10158506 3300025944 Bacteria 1962
687 Ga0207661_10159071 3300025944 Bacteria 1959
688 Ga0207661_10406912 3300025944 Bacteria 1234
689 Ga0207661_10940006 3300025944 Bacteria 796
690 Ga0207679_10006381 3300025945 Bacteria 7448
691 Ga0207679_10438763 3300025945 Bacteria 1156
692 Ga0207679_10707905 3300025945 Bacteria 914
693 Ga0207667_10023417 3300025949 Bacteria 6800
694 Ga0207667_10039658 3300025949 Bacteria 5018
695 Ga0207667_10065417 3300025949 Bacteria 3792
696 Ga0207667_10087215 3300025949 Bacteria 3229
697 Ga0207667_10500452 3300025949 Bacteria 1233
698 Ga0207667_10578982 3300025949 Bacteria 1133
699 Ga0207667_10676677 3300025949 Bacteria 1036
700 Ga0207712_10000067 3300025961 Bacteria 130079
701 Ga0207712_10003459 3300025961 Bacteria 9970
702 Ga0207712_10176641 3300025961 Bacteria 1674
703 Ga0207712_10426927 3300025961 Bacteria 1119
704 Ga0207668_10002563 3300025972 Bacteria 10620
705 Ga0207668_10125124 3300025972 Bacteria 1953
706 Ga0207668_10354899 3300025972 Bacteria 1227
707 Ga0207640_10000821 3300025981 Bacteria 17670
708 Ga0207640_10045237 3300025981 Bacteria 2825
709 Ga0207640_10054025 3300025981 Bacteria 2624
710 Ga0207640_10092534 3300025981 Bacteria 2098
711 Ga0207640_10130092 3300025981 Bacteria 1818
712 Ga0207640_10751205 3300025981 Bacteria 841
713 Ga0207658_10000840 3300025986 Bacteria 25652
714 Ga0207658_10075552 3300025986 Bacteria 2564
715 Ga0207658_10235231 3300025986 Bacteria 1549
716 Ga0207658_10235938 3300025986 Bacteria 1546
717 Ga0207658_10367480 3300025986 Bacteria 1257
718 Ga0207658_10507298 3300025986 Bacteria 1075
719 Ga0207677_10001476 3300026023 Bacteria 12436
720 Ga0207677_10006465 3300026023 Bacteria 6435
721 Ga0207677_10020116 3300026023 Bacteria 4046
722 Ga0207677_10089682 3300026023 Bacteria 2233
723 Ga0207677_10153421 3300026023 Bacteria 1780
724 Ga0207677_10559921 3300026023 Bacteria 998
725 Ga0207703_10000122 3300026035 Bacteria 92656
726 Ga0207703_10001133 3300026035 Bacteria 25156
727 Ga0207703_10038713 3300026035 Bacteria 3808
728 Ga0207703_10080329 3300026035 Bacteria 2715
729 Ga0207703_10085920 3300026035 Bacteria 2634
730 Ga0207703_10387407 3300026035 Bacteria 1294
731 Ga0207639_10024085 3300026041 Bacteria 4401
732 Ga0207639_10038539 3300026041 Bacteria 3556
733 Ga0207639_10220990 3300026041 Bacteria 1636
734 Ga0207639_10395364 3300026041 Bacteria 1244
735 Ga0207639_11319629 3300026041 Bacteria 677
736 Ga0207678_10013734 3300026067 Bacteria 7113
737 Ga0207678_10418263 3300026067 Bacteria 1162
738 Ga0207678_10844560 3300026067 Bacteria 809
739 Ga0207708_10020783 3300026075 Bacteria 4952
740 Ga0207708_10051542 3300026075 Bacteria 3133
741 Ga0207708_10062091 3300026075 Bacteria 2854
742 Ga0207708_10140372 3300026075 Bacteria 1895
743 Ga0207708_10236466 3300026075 Bacteria 1468
744 Ga0207708_10306002 3300026075 Bacteria 1294
745 Ga0207708_10592652 3300026075 Bacteria 938
746 Ga0207702_10000001 3300026078 Bacteria 895738
747 Ga0207702_10002042 3300026078 Bacteria 19546
748 Ga0207702_10045123 3300026078 Bacteria 3708
749 Ga0207702_10046943 3300026078 Bacteria 3638
750 Ga0207702_10055370 3300026078 Bacteria 3363
751 Ga0207702_10252572 3300026078 Bacteria 1656
752 Ga0207702_10260642 3300026078 Bacteria 1632
753 Ga0207702_11693933 3300026078 Bacteria 625
754 Ga0207641_10016220 3300026088 Bacteria 6101
755 Ga0207641_10016989 3300026088 Bacteria 5958
756 Ga0207641_10293407 3300026088 Bacteria 1533
757 Ga0207641_11405485 3300026088 Bacteria 699
758 Ga0207648_10004057 3300026089 Bacteria 15196
759 Ga0207648_10013324 3300026089 Bacteria 7656
760 Ga0207648_10035378 3300026089 Bacteria 4399
761 Ga0207648_10113415 3300026089 Bacteria 2380
762 Ga0207648_10388551 3300026089 Bacteria 1263
763 Ga0207676_10078386 3300026095 Bacteria 2676
764 Ga0207676_10185697 3300026095 Bacteria 1825
765 Ga0207676_10784883 3300026095 Bacteria 928
766 Ga0207674_10006903 3300026116 Bacteria 13305
767 Ga0207674_10033290 3300026116 Bacteria 5396
768 Ga0207674_10097306 3300026116 Bacteria 2927
769 Ga0207674_10181508 3300026116 Bacteria 2056
770 Ga0207675_100064910 3300026118 Bacteria 3412
771 Ga0207675_100137578 3300026118 Bacteria 2319
772 Ga0207675_100633580 3300026118 Bacteria 1074
773 Ga0207683_10042517 3300026121 Bacteria 3969
774 Ga0207683_10107504 3300026121 Bacteria 2496
775 Ga0207683_10123809 3300026121 Bacteria 2322
776 Ga0207698_10000014 3300026142 Bacteria 240703
777 Ga0207698_10033531 3300026142 Bacteria 3732
778 Ga0207698_10067783 3300026142 Bacteria 2815
779 Ga0207698_10145954 3300026142 Bacteria 2046
780 Ga0207698_10222758 3300026142 Bacteria 1706
781 Ga0207698_10329183 3300026142 Bacteria 1434
782 Ga0207698_10394392 3300026142 Bacteria 1321
783 Ga0207698_10649899 3300026142 Bacteria 1045
784 Ga0207698_10719489 3300026142 Bacteria 995
785 Ga0209813_10086401 3300027866 Bacteria 1045
786 Ga0207428_10266213 3300027907 Bacteria 1275
787 Ga0268266_10000029 3300028379 Bacteria 424015
788 Ga0268266_10001628 3300028379 Bacteria 26120
789 Ga0268266_10003734 3300028379 Bacteria 14969
790 Ga0268266_10005543 3300028379 Bacteria 11749
791 Ga0268266_10027445 3300028379 Bacteria 4841
792 Ga0268266_10187682 3300028379 Bacteria 1886
793 Ga0268266_10200233 3300028379 Bacteria 1827
794 Ga0268266_10260429 3300028379 Bacteria 1607
795 Ga0268266_10622892 3300028379 Bacteria 1037
796 Ga0268265_10000667 3300028380 Bacteria 34047
797 Ga0268265_10064910 3300028380 Bacteria 2815
798 Ga0268264_10098144 3300028381 Bacteria 2540
799 Ga0268264_10111100 3300028381 Bacteria 2401
800 Ga0268264_10199127 3300028381 Bacteria 1831
801 Ga0268264_10715754 3300028381 Bacteria 995
802 Ga0265319_1000030 3300028563 Bacteria 129742
803 Ga0265334_10087041 3300028573 Bacteria 1144
804 Ga0265338_10000156 3300028800 Bacteria 125065
805 Ga0265338_10000543 3300028800 Bacteria 66162
806 Ga0265338_10006510 3300028800 Bacteria 14847
807 Ga0307511_10243532 3300030521 Bacteria 874
808 Ga0314311_1244055 3300030733 Bacteria 2784
809 Ga0265325_10024792 3300031241 Bacteria 3259
810 Ga0265327_10006243 3300031251 Bacteria 9601
811 Ga0307509_10009247 3300031507 Bacteria 12366
812 Ga0316579_10093934 3300031691 Bacteria 1433
813 Ga0316576_10002694 3300031727 Bacteria 10159
814 Ga0316576_10623254 3300031727 Bacteria 786
815 Ga0316576_10722834 3300031727 Bacteria 720
816 Ga0316578_10015694 3300031728 Bacteria 4080
817 Ga0316578_10071340 3300031728 Bacteria 2057
818 Ga0316578_10347904 3300031728 Bacteria 882
819 Ga0307410_10125302 3300031852 Bacteria 1879
820 Ga0307406_10234510 3300031901 Bacteria 1372
821 Ga0307416_100399734 3300032002 Bacteria 1411
822 Ga0307416_101299659 3300032002 Bacteria 833
823 Ga0307411_10229543 3300032005 Bacteria 1446
824 Ga0307415_100016735 3300032126 Bacteria 4378
825 Ga0307415_100173979 3300032126 Bacteria 1682
826 Ga0307415_100574418 3300032126 Bacteria 999
827 Ga0316583_10212997 3300032133 Bacteria 670
828 Ga0316583_10229534 3300032133 Bacteria 643
829 Ga0316585_10046937 3300032137 Bacteria 1383
830 Ga0316593_10000042 3300032168 Bacteria 13946
831 Ga0316593_10000090 3300032168 Bacteria 11405
832 Ga0316593_10001942 3300032168 Bacteria 4743
833 Ga0316593_10004621 3300032168 Bacteria 3550
834 Ga0316593_10014395 3300032168 Bacteria 2358
835 Ga0316593_10017362 3300032168 Bacteria 2194
836 Ga0316593_10047889 3300032168 Bacteria 1438
837 Ga0316593_10058929 3300032168 Bacteria 1310
838 Ga0316593_10078429 3300032168 Bacteria 1150
839 Ga0316593_10090494 3300032168 Bacteria 1077
840 Ga0316593_10096505 3300032168 Bacteria 1045
841 Ga0316592_1001276 3300033524 Bacteria 3995
842 Ga0316592_1073005 3300033524 Bacteria 777
843 Ga0316586_1003876 3300033527 Bacteria 2000
844 Ga0316596_1000028 3300033541 Bacteria 14394
845 Ga0316596_1016809 3300033541 Unclassified 1835
846 Ga0316596_1068827 3300033541 Bacteria 947
847 Ga0316596_1103022 3300033541 Bacteria 772
848 Ga0373934_0016127 3300035086 Bacteria 2838
849 Ga0373934_0092206 3300035086 Bacteria 1222
850 Ga0373944_0023014 3300035089 Bacteria 1814
851 Ga0373952_0122477 3300035092 Bacteria 707
852 Ga0373936_0019812 3300035113 Bacteria 2609
853 Ga0373941_0322218 3300035115 Bacteria 622
854 Ga0373953_0150862 3300035117 Bacteria 996
855 Ga0373953_0220139 3300035117 Bacteria 822
856 Ga0373954_0049735 3300035118 Bacteria 1966
857 Ga0373956_0020417 3300035119 Bacteria 2819
858 Ga0373960_0178392 3300035121 Bacteria 740
859 Ga0373955_0052220 3300035172 Bacteria 2229
860 Ga0373955_0264473 3300035172 Bacteria 1033
861 Ga0373962_0039136 3300035242 Bacteria 1330
862 Ga0316574_0033631 3300035398 Bacteria 3121
863 Ga0316574_0038096 3300035398 Bacteria 2951
864 Ga0316574_0115815 3300035398 Bacteria 1719
865 Ga0316574_0998130 3300035398 Bacteria 504
866 Ga0373924_0015173 3300035410 Bacteria 2923
867 Ga0373924_0017975 3300035410 Bacteria 2720
868 Ga0373931_0818925 3300035691 Bacteria 622
869 Ga0373935_0045296 3300035692 Bacteria 2775
870 Ga0373927_0022164 3300035695 Bacteria 4161
871 Ga0373933_0247447 3300035724 Bacteria 1148
872 Ga0373947_0467021 3300035725 Bacteria 855
873 Ga0373937_0045561 3300036401 Bacteria 4008
874 Ga0373937_0046449 3300036401 Bacteria 3971
875 Ga0373937_0166140 3300036401 Bacteria 2069
876 Ga0373937_0318923 3300036401 Bacteria 1470
877 Ga0316582_0086506 3300036647 Bacteria 2056
878 Ga0316584_0024637 3300036712 Bacteria 4406
879 Ga0316584_0028035 3300036712 Bacteria 4149
880 Ga0373925_0176562 3300037068 Bacteria 1688
881 Ga0373925_0420616 3300037068 Bacteria 1092
882 Ga0395899_0003098 3300037312 Bacteria 13233
883 Ga0395899_0003309 3300037312 Bacteria 12769
884 Ga0395899_0058565 3300037312 Bacteria 2841
885 Ga0395900_0001412 3300037418 Bacteria 28734
886 Ga0395900_0147541 3300037418 Bacteria 2405
887 Ga0395900_0154425 3300037418 Bacteria 2344
888 Ga0395900_0254362 3300037418 Bacteria 1756
889 Ga0395900_0939664 3300037418 Bacteria 787
890 Ga0395898_0002536 3300037466 Bacteria 21416
891 Ga0395898_0006193 3300037466 Bacteria 12819
892 Ga0395898_0106644 3300037466 Bacteria 2687
893 Ga0395898_0335096 3300037466 Bacteria 1443
894 Ga0395898_0745670 3300037466 Bacteria 921
895 Ga0395905_0008237 3300037471 Bacteria 10294
896 Ga0395905_0039862 3300037471 Bacteria 4407
897 Ga0395905_0090635 3300037471 Bacteria 2866
898 Ga0395905_0227819 3300037471 Bacteria 1743
899 Ga0395905_0941978 3300037471 Bacteria 766
900 Ga0436364_0184253 3300037853 Bacteria 13885
901 Ga0436364_0588322 3300037853 Bacteria 80195
902 Ga0395901_0013538 3300038443 Bacteria 8294
903 Ga0395901_0025765 3300038443 Bacteria 6037
904 Ga0395901_0035304 3300038443 Bacteria 5165
905 Ga0395901_0069107 3300038443 Bacteria 3678
906 Ga0395901_0107084 3300038443 Bacteria 2934
907 Ga0395901_0154202 3300038443 Bacteria 2413
908 Ga0395901_0308540 3300038443 Bacteria 1639
909 Ga0395901_0567805 3300038443 Bacteria 1148
910 Ga0395901_0687863 3300038443 Bacteria 1022
911 Ga0395901_0693074 3300038443 Bacteria 1017
912 Ga0436365_1374876 3300039437 Bacteria 3120
913 Ga0436365_1846767 3300039437 Bacteria 6161
914 Ga0436362_0041472 3300039453 Bacteria 1884
915 Ga0436362_0396626 3300039453 Bacteria 1498
916 Ga0436362_1138695 3300039453 Bacteria 75889
917 Ga0451797_1224919 3300041453 Bacteria 786
918 Ga0451807_0891281 3300041486 Bacteria 1133
919 Ga0451837_0722841 3300041494 Bacteria 847
920 Ga0451839_0924585 3300041496 Bacteria 1137
921 Ga0451853_0263163 3300041512 Bacteria 963
922 Ga0451853_1575804 3300041512 Bacteria 2215
923 Ga0439441_113641 3300042001 Bacteria 616
924 Ga0439444_0132903 3300042437 Bacteria 590
925 Ga0439460_0120626 3300042461 Bacteria 857
926 Ga0451577_0252111 3300042876 Bacteria 1598
927 Ga0466972_0036141 3300044658 Bacteria 2418
928 Ga0466965_0261174 3300044683 Bacteria 931
929 Ga0466965_0457111 3300044683 Bacteria 712
930 Ga0466966_0000383 3300044684 Bacteria 28757
931 Ga0466966_0267638 3300044684 Bacteria 1028
932 Ga0466961_0160350 3300044693 Bacteria 1402
933 Ga0466961_0453154 3300044693 Bacteria 776
934 Ga0466961_0516845 3300044693 Bacteria 720
935 Ga0466963_0000325 3300044694 Bacteria 21618
936 Ga0466963_0004436 3300044694 Bacteria 8157
937 Ga0466963_0009016 3300044694 Bacteria 5991
938 Ga0466963_0013239 3300044694 Bacteria 5062
939 Ga0466963_0199244 3300044694 Bacteria 1400
940 Ga0453684_0003980 3300044712 Bacteria 32269
941 Ga0453684_0011806 3300044712 Bacteria 14554
942 Ga0453684_0055586 3300044712 Bacteria 5145
943 Ga0466970_0015123 3300044765 Bacteria 3969
944 Ga0466957_0004792 3300044842 Bacteria 7572
945 Ga0466957_0009243 3300044842 Bacteria 5623
946 Ga0466957_0072417 3300044842 Bacteria 2133
947 Ga0466957_0135852 3300044842 Bacteria 1580
948 Ga0466957_0146651 3300044842 Bacteria 1524
949 Ga0466960_0069158 3300044901 Bacteria 1754
950 Ga0466960_0136449 3300044901 Bacteria 1299
951 Ga0466960_0178182 3300044901 Bacteria 1151
952 Ga0466960_0192880 3300044901 Bacteria 1109
953 Ga0466959_0017822 3300045049 Bacteria 5209
954 Ga0466958_0000206 3300045836 Bacteria 21886
955 Ga0466958_0014240 3300045836 Bacteria 4541
956 Ga0466958_0041904 3300045836 Bacteria 2755
957 Ga0466958_0097396 3300045836 Bacteria 1825
958 Ga0466958_0113983 3300045836 Bacteria 1688
959 Ga0466958_0369294 3300045836 Bacteria 924
960 Ga0466967_0000003 3300045976 Bacteria 169144
961 Ga0466967_0005406 3300045976 Bacteria 8846
962 Ga0466967_0007938 3300045976 Bacteria 7719
963 Ga0466967_0044621 3300045976 Bacteria 3846
964 Ga0466967_0048797 3300045976 Bacteria 3699
965 Ga0466967_0054093 3300045976 Bacteria 3531
966 Ga0466967_0055664 3300045976 Bacteria 3485
967 Ga0466967_0074584 3300045976 Bacteria 3047
968 Ga0466967_0357480 3300045976 Bacteria 1414
969 Ga0466967_0367630 3300045976 Bacteria 1394
970 Ga0466967_0678778 3300045976 Bacteria 1020
971 Ga0466967_0864276 3300045976 Bacteria 899
972 Ga0466967_1332792 3300045976 Bacteria 715
973 Ga0466967_1439476 3300045976 Bacteria 686
974 Ga0466967_1579433 3300045976 Bacteria 653
975 Ga0495592_0133368 3300046454 Bacteria 1735
976 Ga0495592_0204708 3300046454 Bacteria 1329
977 Ga0495592_0458285 3300046454 Bacteria 798
978 Ga0495603_0000323 3300046455 Bacteria 25798
979 Ga0495603_0000641 3300046455 Bacteria 19699
980 Ga0495603_0123208 3300046455 Bacteria 1510
981 Ga0495590_0092337 3300046457 Bacteria 1072
982 Ga0495629_0000543 3300046459 Bacteria 31107
983 Ga0495629_0004371 3300046459 Bacteria 10589
984 Ga0495629_0007604 3300046459 Bacteria 7983
985 Ga0495629_0047429 3300046459 Bacteria 3013
986 Ga0495629_0106021 3300046459 Bacteria 1960
987 Ga0495629_0177074 3300046459 Bacteria 1479
988 Ga0495629_0312652 3300046459 Bacteria 1074
989 Ga0495638_0113049 3300046460 Bacteria 1611
990 Ga0495641_0000400 3300046461 Bacteria 36235
991 Ga0495641_0014568 3300046461 Bacteria 4248
992 Ga0495641_0030173 3300046461 Bacteria 2603
993 Ga0495641_0036780 3300046461 Bacteria 2298
994 Ga0495641_0063245 3300046461 Bacteria 1668
995 Ga0495641_0141990 3300046461 Bacteria 1073
996 Ga0495651_0000169 3300046462 Bacteria 48128
997 Ga0495651_0047021 3300046462 Bacteria 3339
998 Ga0495651_0093678 3300046462 Bacteria 2248
999 Ga0495653_0029693 3300046463 Bacteria 4360
1000 Ga0495653_0033508 3300046463 Bacteria 4069
1001 Ga0495653_0141583 3300046463 Bacteria 1691
1002 Ga0495580_0022805 3300046472 Bacteria 4602
1003 Ga0495582_0004746 3300046473 Bacteria 7640
1004 Ga0495639_0098236 3300046475 Bacteria 1380
1005 Ga0495639_0117467 3300046475 Bacteria 1266
1006 Ga0495662_0000236 3300046476 Bacteria 23206
1007 Ga0495662_0007474 3300046476 Bacteria 5403
1008 Ga0495664_0035587 3300046477 Bacteria 2933
1009 Ga0495664_0084699 3300046477 Bacteria 1903
1010 Ga0495584_0103771 3300046491 Bacteria 1437
1011 Ga0495594_0000001 3300046499 Bacteria 293051
1012 Ga0495594_0052080 3300046499 Bacteria 2253
1013 Ga0495596_0319027 3300046500 Bacteria 604
1014 Ga0495583_0018179 3300046506 Bacteria 3707
1015 Ga0495606_0000283 3300046507 Bacteria 88309
1016 Ga0495608_0000010 3300046511 Bacteria 258660
1017 Ga0495608_0029074 3300046511 Bacteria 3752
1018 Ga0495608_0043315 3300046511 Bacteria 3007
1019 Ga0495618_0014163 3300046514 Bacteria 4855
1020 Ga0495618_0029788 3300046514 Bacteria 3406
1021 Ga0495628_0000864 3300046516 Bacteria 28036
1022 Ga0495628_0004361 3300046516 Bacteria 12548
1023 Ga0495628_0054541 3300046516 Bacteria 3151
1024 Ga0495628_0165298 3300046516 Bacteria 1680
1025 Ga0495628_0224494 3300046516 Bacteria 1410
1026 Ga0495628_0542213 3300046516 Bacteria 836
1027 Ga0495630_0000148 3300046517 Bacteria 54619
1028 Ga0495630_0000395 3300046517 Bacteria 34351
1029 Ga0495630_0058365 3300046517 Bacteria 2893
1030 Ga0495630_0066542 3300046517 Bacteria 2708
1031 Ga0495630_0119710 3300046517 Bacteria 1997
1032 Ga0495630_0154016 3300046517 Bacteria 1749
1033 Ga0495630_0507095 3300046517 Bacteria 925
1034 Ga0495644_0110530 3300046523 Bacteria 1043
1035 Ga0495644_0311280 3300046523 Bacteria 617
1036 Ga0495663_0109342 3300046525 Bacteria 917
1037 Ga0495666_0178250 3300046526 Bacteria 982
1038 Ga0495652_0000009 3300046529 Bacteria 311000
1039 Ga0495652_0011903 3300046529 Bacteria 7865
1040 Ga0495652_0023756 3300046529 Bacteria 5433
1041 Ga0495652_0323834 3300046529 Bacteria 1112
1042 Ga0495665_0027804 3300046531 Bacteria 3035
1043 Ga0495640_0009674 3300046533 Bacteria 7495
1044 Ga0495640_0024081 3300046533 Bacteria 4429
1045 Ga0495586_0001318 3300046535 Bacteria 13783
1046 Ga0495586_0472305 3300046535 Bacteria 723
1047 Ga0495587_0004030 3300046536 Bacteria 9732
1048 Ga0495587_0025867 3300046536 Bacteria 3583
1049 Ga0495587_0093797 3300046536 Bacteria 1733
1050 Ga0495587_0143372 3300046536 Bacteria 1362
1051 Ga0495587_0277453 3300046536 Bacteria 939
1052 Ga0495598_0003179 3300046537 Bacteria 3462
1053 Ga0495621_0006342 3300046539 Bacteria 3446
1054 Ga0495645_0015381 3300046543 Bacteria 5441
1055 Ga0495645_0049315 3300046543 Bacteria 3066
1056 Ga0495645_0097775 3300046543 Bacteria 2090
1057 Ga0495645_0109813 3300046543 Bacteria 1952
1058 Ga0495645_0373965 3300046543 Bacteria 913
1059 Ga0495645_0540396 3300046543 Bacteria 723
1060 Ga0495622_0000069 3300046557 Bacteria 89759
1061 Ga0495667_0039119 3300046559 Bacteria 3155
1062 Ga0495667_0145389 3300046559 Bacteria 1527
1063 Ga0495667_0347411 3300046559 Bacteria 937
1064 Ga0495656_0000412 3300046615 Bacteria 14129
1065 Ga0495634_0022437 3300046642 Bacteria 4448
1066 Ga0495634_0028786 3300046642 Bacteria 3852
1067 Ga0495634_0031228 3300046642 Bacteria 3670
1068 Ga0495611_0171638 3300046648 Bacteria 1014
1069 Ga0495625_0000109 3300046660 Bacteria 125064
1070 Ga0495635_0000922 3300046663 Bacteria 19354
1071 Ga0495635_0057374 3300046663 Bacteria 2679
1072 Ga0495635_0112146 3300046663 Bacteria 1862
1073 Ga0495635_0176289 3300046663 Bacteria 1453
1074 Ga0495588_0000175 3300046674 Bacteria 80911
1075 Ga0495588_0519195 3300046674 Bacteria 624
1076 Ga0495657_0000005 3300046675 Bacteria 254860
1077 Ga0495657_0003110 3300046675 Bacteria 13700
1078 Ga0495657_0036529 3300046675 Bacteria 3395
1079 Ga0495599_0025046 3300046678 Bacteria 3734
1080 Ga0495599_0047469 3300046678 Bacteria 2691
1081 Ga0495599_0139371 3300046678 Bacteria 1505
1082 Ga0495599_0363503 3300046678 Bacteria 866
1083 Ga0495623_0003245 3300046679 Bacteria 10749
1084 Ga0495623_0482604 3300046679 Bacteria 656
1085 Ga0495646_0018379 3300046680 Bacteria 4428
1086 Ga0495646_0311010 3300046680 Bacteria 831
1087 Ga0495646_0331730 3300046680 Bacteria 799
1088 Ga0495646_0426453 3300046680 Bacteria 687
1089 Ga0495647_0000114 3300046681 Bacteria 20349
1090 Ga0495647_0003117 3300046681 Bacteria 5301
1091 Ga0495658_0001182 3300046683 Bacteria 13746
1092 Ga0495658_0009022 3300046683 Bacteria 4957
1093 Ga0495658_0158495 3300046683 Bacteria 1394
1094 Ga0495658_0396878 3300046683 Bacteria 879
1095 Ga0495613_0000087 3300046689 Bacteria 88644
1096 Ga0495613_0028786 3300046689 Bacteria 4132
1097 Ga0495613_0043476 3300046689 Bacteria 3323
1098 Ga0495624_0000429 3300046690 Bacteria 33305
1099 Ga0495624_0100809 3300046690 Bacteria 1778
1100 Ga0495624_0184452 3300046690 Bacteria 1270
1101 Ga0495670_0001585 3300046691 Bacteria 11108
1102 Ga0495670_0063306 3300046691 Bacteria 1862
1103 Ga0495670_0198861 3300046691 Bacteria 1061
1104 Ga0495649_0004973 3300046694 Bacteria 8555
1105 Ga0495600_0006577 3300046809 Bacteria 7076
1106 Ga0495600_0042492 3300046809 Bacteria 2963
1107 Ga0495600_0044869 3300046809 Bacteria 2883
1108 Ga0495600_0056406 3300046809 Bacteria 2566
1109 Ga0495600_0065764 3300046809 Bacteria 2371
1110 Ga0495600_0165651 3300046809 Bacteria 1428
1111 Ga0495600_0180531 3300046809 Bacteria 1360
1112 Ga0495600_0347614 3300046809 Bacteria 929
1113 Ga0495581_0038851 3300047315 Bacteria 2755
1114 Ga0495604_0000218 3300047317 Bacteria 52385
1115 Ga0495604_0000322 3300047317 Bacteria 42966
1116 Ga0495604_0047307 3300047317 Bacteria 3350
1117 Ga0495604_0078464 3300047317 Bacteria 2478
1118 Ga0495604_0429270 3300047317 Bacteria 866
1119 Ga0495604_0530600 3300047317 Bacteria 761
1120 Ga0495674_0000141 3300047319 Bacteria 55539
1121 Ga0495674_0076908 3300047319 Bacteria 2870
1122 Ga0495672_0000016 3300047320 Bacteria 500601
1123 Ga0495672_0036499 3300047320 Bacteria 3018
1124 Ga0495676_0012216 3300047321 Bacteria 7743
1125 Ga0495676_0040217 3300047321 Bacteria 3861
1126 Ga0495676_0057791 3300047321 Bacteria 3056
1127 Ga0495676_0113010 3300047321 Bacteria 1989
1128 Ga0495676_0364595 3300047321 Bacteria 964
1129 Ga0495680_0001951 3300047322 Bacteria 21721
1130 Ga0495680_0029124 3300047322 Bacteria 4523
1131 Ga0495680_0090508 3300047322 Bacteria 2295
1132 Ga0495680_0280174 3300047322 Bacteria 1175
1133 Ga0495675_0000398 3300047444 Bacteria 30075
1134 Ga0495675_0014758 3300047444 Bacteria 4938
1135 Ga0495675_0193057 3300047444 Bacteria 1242
1136 Ga0495685_168793 3300047447 Bacteria 707
1137 Ga0495673_0106980 3300047469 Bacteria 1123
1138 Ga0495684_0200003 3300047471 Bacteria 1473
1139 Ga0495684_0381076 3300047471 Bacteria 995
1140 Ga0495686_0032955 3300047472 Bacteria 3349
1141 Ga0495593_0016327 3300047673 Bacteria 4189
1142 Ga0495602_0000038 3300048088 Bacteria 130758
1143 Ga0495602_0003702 3300048088 Bacteria 15861
1144 Ga0495602_0140799 3300048088 Bacteria 1909
1145 Ga0495602_0150401 3300048088 Bacteria 1831
1146 Ga0495602_0234245 3300048088 Bacteria 1377
1147 Ga0495602_0430233 3300048088 Bacteria 935
1148 Ga0495602_0450293 3300048088 Bacteria 909
1149 Ga0495602_0735634 3300048088 Bacteria 667
1150 Ga0495614_0024070 3300048089 Bacteria 2628
1151 Ga0496100_0019069 3300048903 Bacteria 4084
1152 Ga0496100_0031021 3300048903 Bacteria 3319
1153 Ga0496100_0033531 3300048903 Bacteria 3213
1154 Ga0496100_0047639 3300048903 Bacteria 2763
1155 Ga0496100_0167304 3300048903 Bacteria 1580
1156 Ga0496100_0364770 3300048903 Bacteria 1094
1157 Ga0496100_1096061 3300048903 Bacteria 627
1158 Ga0496101_0002912 3300048904 Bacteria 10529
1159 Ga0496101_0013023 3300048904 Bacteria 5564
1160 Ga0496101_0061288 3300048904 Bacteria 2732
1161 Ga0496101_0066191 3300048904 Bacteria 2635
1162 Ga0496101_0252038 3300048904 Bacteria 1375
1163 Ga0496101_0375508 3300048904 Bacteria 1118
1164 Ga0496102_0000021 3300048905 Bacteria 246920
1165 Ga0496102_0010286 3300048905 Bacteria 8044
1166 Ga0496102_0032988 3300048905 Bacteria 4652
1167 Ga0496102_0106099 3300048905 Bacteria 2614
1168 Ga0496102_0130356 3300048905 Bacteria 2353
1169 Ga0496102_0175588 3300048905 Bacteria 2017
1170 Ga0496102_0188141 3300048905 Bacteria 1945
1171 Ga0496102_0321373 3300048905 Bacteria 1458
1172 Ga0496102_0482685 3300048905 Bacteria 1161
1173 Ga0496102_0590941 3300048905 Bacteria 1033
1174 Ga0496102_0952872 3300048905 Bacteria 779
1175 Ga0496103_0000001 3300048906 Bacteria 643471
1176 Ga0496103_0037187 3300048906 Bacteria 2982
1177 Ga0496103_0434164 3300048906 Bacteria 843
1178 Ga0496104_0000001 3300048907 Bacteria 711867
1179 Ga0496104_0000029 3300048907 Bacteria 202968
1180 Ga0496104_0057144 3300048907 Bacteria 3692
1181 Ga0496104_0143937 3300048907 Bacteria 2289
1182 Ga0496104_0242417 3300048907 Bacteria 1715
1183 Ga0496104_0263093 3300048907 Bacteria 1637
1184 Ga0496104_0729275 3300048907 Bacteria 898
1185 Ga0496105_0000002 3300048908 Bacteria 753215
1186 Ga0496105_0073103 3300048908 Bacteria 2833
1187 Ga0496105_0080385 3300048908 Bacteria 2692
1188 Ga0496105_1031186 3300048908 Bacteria 614
1189 Ga0496106_0000838 3300048909 Bacteria 22301
1190 Ga0496106_0007743 3300048909 Bacteria 7950
1191 Ga0496106_0015086 3300048909 Bacteria 5719
1192 Ga0496106_0030477 3300048909 Bacteria 4022
1193 Ga0496106_0050277 3300048909 Bacteria 3141
1194 Ga0496106_0165044 3300048909 Bacteria 1753
1195 Ga0496106_0216492 3300048909 Bacteria 1526
1196 Ga0496106_0374678 3300048909 Bacteria 1144
1197 Ga0496106_0618077 3300048909 Bacteria 867
1198 Ga0496107_0000371 3300048910 Bacteria 24322
1199 Ga0496107_0017709 3300048910 Bacteria 5013
1200 Ga0496107_0037346 3300048910 Bacteria 3485
1201 Ga0496107_0058400 3300048910 Bacteria 2789
1202 Ga0496107_0232167 3300048910 Bacteria 1373
1203 Ga0496108_0000042 3300048911 Bacteria 146397
1204 Ga0496108_0000339 3300048911 Bacteria 39428
1205 Ga0496108_0002451 3300048911 Bacteria 14838
1206 Ga0496108_0021329 3300048911 Bacteria 5324
1207 Ga0496108_0074397 3300048911 Bacteria 2868
1208 Ga0496108_0132946 3300048911 Bacteria 2138
1209 Ga0496108_0339633 3300048911 Bacteria 1310
1210 Ga0496108_0416446 3300048911 Bacteria 1173
1211 Ga0496108_0635271 3300048911 Bacteria 929
1212 Ga0496109_0000034 3300048912 Bacteria 160397
1213 Ga0496109_0000062 3300048912 Bacteria 112843
1214 Ga0496109_0000550 3300048912 Bacteria 31748
1215 Ga0496109_0003257 3300048912 Bacteria 13535
1216 Ga0496109_0008015 3300048912 Bacteria 8957
1217 Ga0496109_0024699 3300048912 Bacteria 5346
1218 Ga0496109_0038802 3300048912 Bacteria 4307
1219 Ga0496109_0077735 3300048912 Bacteria 3054
1220 Ga0496109_0119801 3300048912 Bacteria 2451
1221 Ga0496109_0327544 3300048912 Bacteria 1446
1222 Ga0496109_0484619 3300048912 Bacteria 1167
1223 Ga0496109_0621254 3300048912 Unclassified 1017
1224 Ga0496109_0729771 3300048912 Bacteria 928
1225 Ga0496110_0000152 3300048913 Bacteria 41561
1226 Ga0496110_0000325 3300048913 Bacteria 31707
1227 Ga0496110_0003959 3300048913 Bacteria 11394
1228 Ga0496110_0018233 3300048913 Bacteria 5882
1229 Ga0496110_0022729 3300048913 Bacteria 5328
1230 Ga0496110_0035533 3300048913 Bacteria 4324
1231 Ga0496110_0041415 3300048913 Bacteria 4019
1232 Ga0496110_0120715 3300048913 Bacteria 2361
1233 Ga0496110_0203004 3300048913 Bacteria 1801
1234 Ga0496110_0970112 3300048913 Bacteria 757
1235 Ga0496111_0000123 3300048914 Bacteria 33765
1236 Ga0496111_0000171 3300048914 Bacteria 29367
1237 Ga0496111_0005234 3300048914 Bacteria 8270
1238 Ga0496111_0011147 3300048914 Bacteria 6052
1239 Ga0496111_0062842 3300048914 Bacteria 2692
1240 Ga0496111_0093413 3300048914 Bacteria 2205
1241 Ga0496111_0125452 3300048914 Bacteria 1897
1242 Ga0496111_0273435 3300048914 Bacteria 1253
1243 Ga0496111_0294876 3300048914 Bacteria 1202
1244 Ga0496111_0323216 3300048914 Bacteria 1143
1245 Ga0496111_0356409 3300048914 Bacteria 1083
1246 Ga0496111_0522343 3300048914 Bacteria 873
1247 Ga0496111_0598258 3300048914 Bacteria 807
1248 Ga0496112_0002149 3300048915 Bacteria 15656
1249 Ga0496112_0007934 3300048915 Bacteria 9463
1250 Ga0496112_0008451 3300048915 Bacteria 9223
1251 Ga0496112_0038994 3300048915 Bacteria 4640
1252 Ga0496112_0064232 3300048915 Bacteria 3622
1253 Ga0496112_0086863 3300048915 Bacteria 3094
1254 Ga0496112_0118975 3300048915 Bacteria 2612
1255 Ga0496112_0136580 3300048915 Bacteria 2422
1256 Ga0496112_0311169 3300048915 Bacteria 1520
1257 Ga0496112_0829778 3300048915 Bacteria 848
1258 Ga0496113_0000002 3300048916 Bacteria 220193
1259 Ga0496113_0005100 3300048916 Bacteria 8158
1260 Ga0496113_0023067 3300048916 Bacteria 4410
1261 Ga0496113_0030295 3300048916 Bacteria 3916
1262 Ga0496113_0062651 3300048916 Bacteria 2809
1263 Ga0496113_0097854 3300048916 Bacteria 2270
1264 Ga0496113_0234778 3300048916 Bacteria 1463
1265 Ga0496113_0300458 3300048916 Bacteria 1285
1266 Ga0496113_0669666 3300048916 Bacteria 829
1267 Ga0496113_0675684 3300048916 Bacteria 825
1268 Ga0496114_0000097 3300048917 Bacteria 63410
1269 Ga0496114_0006753 3300048917 Bacteria 9038
1270 Ga0496114_0028056 3300048917 Bacteria 4617
1271 Ga0496114_0030424 3300048917 Bacteria 4442
1272 Ga0496114_0064791 3300048917 Bacteria 3061
1273 Ga0496114_0130282 3300048917 Bacteria 2171
1274 Ga0496114_0131568 3300048917 Bacteria 2161
1275 Ga0496114_0219100 3300048917 Bacteria 1670
1276 Ga0496114_0356045 3300048917 Bacteria 1295
1277 Ga0496114_0847176 3300048917 Bacteria 794
1278 Ga0496114_1454547 3300048917 Bacteria 573
1279 Ga0496115_0000005 3300048918 Bacteria 290756
1280 Ga0496115_0000151 3300048918 Bacteria 64493
1281 Ga0496115_0002589 3300048918 Bacteria 12979
1282 Ga0496115_0052058 3300048918 Bacteria 3284
1283 Ga0496115_0072896 3300048918 Bacteria 2786
1284 Ga0496115_0103084 3300048918 Bacteria 2340
1285 Ga0496115_0264013 3300048918 Bacteria 1416
1286 Ga0496117_0030866 3300048920 Bacteria 4102
1287 Ga0496118_0006751 3300048921 Bacteria 12485
1288 Ga0496118_0247675 3300048921 Bacteria 1015
1289 Ga0496119_0015281 3300048922 Bacteria 5929
1290 Ga0496120_0003833 3300048923 Bacteria 13218
1291 Ga0496124_0152301 3300048927 Bacteria 1812
1292 Ga0496124_0173053 3300048927 Bacteria 1670
1293 Ga0496124_0732844 3300048927 Bacteria 622
1294 Ga0496125_0304662 3300048928 Bacteria 974
1295 Ga0496126_0089445 3300048929 Bacteria 2710
1296 Ga0496126_0128675 3300048929 Bacteria 2190
1297 Ga0501031_0026171 3300049568 Bacteria 3805
1298 Ga0501031_0176449 3300049568 Bacteria 1396
1299 Ga0501032_0000394 3300049569 Bacteria 36017
1300 Ga0501032_0099533 3300049569 Bacteria 1926
1301 Ga0501032_0255132 3300049569 Bacteria 1138
1302 Ga0501032_0421393 3300049569 Bacteria 856
1303 Ga0501033_0044482 3300049570 Bacteria 3305
1304 Ga0501033_0064058 3300049570 Bacteria 2705
1305 Ga0501034_0020539 3300049571 Bacteria 6745
1306 Ga0501034_0069447 3300049571 Bacteria 3534
1307 Ga0501034_0711972 3300049571 Bacteria 902
1308 Ga0501036_0018306 3300049572 Bacteria 5865
1309 Ga0501036_0051280 3300049572 Bacteria 3493
1310 Ga0501036_0056541 3300049572 Bacteria 3324
1311 Ga0501036_0058031 3300049572 Bacteria 3279
1312 Ga0501036_0336763 3300049572 Bacteria 1260
1313 Ga0501037_0000133 3300049573 Bacteria 69741
1314 Ga0501037_0006661 3300049573 Bacteria 8447
1315 Ga0501037_0377338 3300049573 Unclassified 975
1316 Ga0501037_0811918 3300049573 Bacteria 617
1317 Ga0501038_0023933 3300049574 Bacteria 5454
1318 Ga0501038_0102284 3300049574 Bacteria 2384
1319 Ga0501038_0194975 3300049574 Bacteria 1628
1320 Ga0501039_0028940 3300049575 Bacteria 4266
1321 Ga0501039_0099545 3300049575 Bacteria 2269
1322 Ga0501039_0245664 3300049575 Bacteria 1407
1323 Ga0501040_0018448 3300049576 Bacteria 4631
1324 Ga0501040_0070528 3300049576 Bacteria 2411
1325 Ga0501040_0392566 3300049576 Bacteria 996
1326 Ga0501040_0469972 3300049576 Bacteria 906
1327 Ga0501041_0013799 3300049577 Bacteria 4789
1328 Ga0501041_0043948 3300049577 Bacteria 2716
1329 Ga0501041_0054276 3300049577 Bacteria 2444
1330 Ga0501041_0068821 3300049577 Bacteria 2170
1331 Ga0501041_0756420 3300049577 Bacteria 622
1332 Ga0501042_0005622 3300049578 Bacteria 8084
1333 Ga0501042_0030096 3300049578 Bacteria 3833
1334 Ga0501042_0035728 3300049578 Bacteria 3525
1335 Ga0501042_0056952 3300049578 Bacteria 2789
1336 Ga0501042_0533184 3300049578 Bacteria 853
1337 Ga0501042_0740475 3300049578 Bacteria 715
1338 Ga0501042_0907641 3300049578 Bacteria 642
1339 Ga0501043_0000404 3300049579 Bacteria 38801
1340 Ga0501043_0032912 3300049579 Bacteria 4078
1341 Ga0501046_0000038 3300049580 Bacteria 159193
1342 Ga0501046_0433475 3300049580 Bacteria 946
1343 Ga0501047_0006066 3300049581 Bacteria 11360
1344 Ga0501047_0375061 3300049581 Bacteria 1257
1345 Ga0501048_0000033 3300049582 Bacteria 64896
1346 Ga0501048_0012062 3300049582 Bacteria 6441
1347 Ga0501048_0040441 3300049582 Bacteria 3341
1348 Ga0501048_0045135 3300049582 Bacteria 3149
1349 Ga0501048_0083634 3300049582 Bacteria 2250
1350 Ga0501048_0738095 3300049582 Bacteria 707
1351 Ga0501067_0002332 3300049583 Bacteria 10497
1352 Ga0501067_0025723 3300049583 Bacteria 3262
1353 Ga0501067_0028629 3300049583 Bacteria 3088
1354 Ga0501067_0032866 3300049583 Bacteria 2879
1355 Ga0501068_0003192 3300049584 Bacteria 8777
1356 Ga0501068_0006756 3300049584 Bacteria 6338
1357 Ga0501068_0024472 3300049584 Bacteria 3546
1358 Ga0501068_0035937 3300049584 Bacteria 2959
1359 Ga0501068_0055462 3300049584 Bacteria 2401
1360 Ga0501068_0087008 3300049584 Bacteria 1924
1361 Ga0501068_0294829 3300049584 Bacteria 1037
1362 Ga0501068_0540563 3300049584 Bacteria 757
1363 Ga0501069_0000453 3300049585 Bacteria 18732
1364 Ga0501069_0036099 3300049585 Bacteria 2724
1365 Ga0501070_0075131 3300049586 Bacteria 2797
1366 Ga0501070_0090385 3300049586 Bacteria 2534
1367 Ga0501070_0121421 3300049586 Bacteria 2159
1368 Ga0501070_0149937 3300049586 Bacteria 1924
1369 Ga0501070_0180852 3300049586 Bacteria 1735
1370 Ga0501070_0376306 3300049586 Bacteria 1150
1371 Ga0501070_1056823 3300049586 Bacteria 628
1372 Ga0501070_1106173 3300049586 Bacteria 611
1373 Ga0501071_0004097 3300049587 Bacteria 9216
1374 Ga0501071_0020990 3300049587 Bacteria 4546
1375 Ga0501071_0194956 3300049587 Bacteria 1520
1376 Ga0501071_0208123 3300049587 Bacteria 1471
1377 Ga0501071_0261028 3300049587 Bacteria 1308
1378 Ga0501071_0328198 3300049587 Bacteria 1163
1379 Ga0501071_0413681 3300049587 Bacteria 1030
1380 Ga0501072_0010784 3300049588 Bacteria 6965
1381 Ga0501072_0019597 3300049588 Bacteria 5231
1382 Ga0501072_0084645 3300049588 Bacteria 2514
1383 Ga0501072_0108676 3300049588 Bacteria 2207
1384 Ga0501072_0226216 3300049588 Bacteria 1490
1385 Ga0501072_0267290 3300049588 Bacteria 1361
1386 Ga0501072_0325955 3300049588 Bacteria 1220
1387 Ga0501072_0939350 3300049588 Bacteria 675
1388 Ga0501073_0012572 3300049589 Bacteria 6177
1389 Ga0501073_0047488 3300049589 Bacteria 3017
1390 Ga0501074_0015990 3300049590 Bacteria 5455
1391 Ga0501074_0019513 3300049590 Bacteria 4922
1392 Ga0501074_0047115 3300049590 Bacteria 3116
1393 Ga0501074_0109316 3300049590 Bacteria 1978
1394 Ga0501074_0176133 3300049590 Bacteria 1526
1395 Ga0501074_0805338 3300049590 Bacteria 662
1396 Ga0501075_0012379 3300049591 Bacteria 6063
1397 Ga0501075_0013808 3300049591 Bacteria 5774
1398 Ga0501075_0022192 3300049591 Bacteria 4634
1399 Ga0501076_0000421 3300049592 Bacteria 26662
1400 Ga0501076_0012859 3300049592 Bacteria 6263
1401 Ga0501076_0214851 3300049592 Bacteria 1572
1402 Ga0501077_0100644 3300049593 Bacteria 1831
1403 Ga0501077_0101576 3300049593 Bacteria 1822
1404 Ga0501077_0497431 3300049593 Bacteria 782
1405 Ga0501214_023456 3300049659 Bacteria 801
1406 Ga0501079_0082759 3300049741 Bacteria 2482
1407 Ga0501079_0133261 3300049741 Bacteria 1934
1408 Ga0501079_0218330 3300049741 Bacteria 1489
1409 Ga0501079_0252153 3300049741 Bacteria 1379
1410 Ga0501079_0602260 3300049741 Bacteria 865
1411 Ga0501080_0003052 3300049742 Bacteria 14782
1412 Ga0501080_0034921 3300049742 Bacteria 4695
1413 Ga0501080_0050692 3300049742 Bacteria 3863
1414 Ga0501080_0339968 3300049742 Bacteria 1356
1415 Ga0501080_1482591 3300049742 Bacteria 577
1416 Ga0501081_0009235 3300049743 Bacteria 6422
1417 Ga0501083_0014244 3300049744 Bacteria 5563
1418 Ga0501083_0021493 3300049744 Bacteria 4484
1419 Ga0501083_0022386 3300049744 Bacteria 4386
1420 Ga0501083_0024382 3300049744 Bacteria 4191
1421 Ga0501083_0177744 3300049744 Bacteria 1390
1422 Ga0501083_0195334 3300049744 Bacteria 1320
1423 Ga0501083_0541365 3300049744 Bacteria 758
1424 Ga0501035_0000562 3300049822 Bacteria 41104
1425 Ga0501035_0021108 3300049822 Bacteria 5988
1426 Ga0501035_0050399 3300049822 Bacteria 3731
1427 Ga0501035_0057867 3300049822 Bacteria 3455
1428 Ga0501044_0028311 3300049823 Bacteria 5914
1429 Ga0501044_0123906 3300049823 Bacteria 2583
1430 Ga0501044_0133387 3300049823 Bacteria 2476
1431 Ga0501044_0207263 3300049823 Bacteria 1916
1432 Ga0501044_0598542 3300049823 Bacteria 996
1433 Ga0501045_0008167 3300049824 Bacteria 7292
1434 Ga0501045_0047269 3300049824 Bacteria 3134
1435 Ga0501045_0212834 3300049824 Bacteria 1440
1436 Ga0501045_0299619 3300049824 Bacteria 1197
1437 nmdc:mga03n38_192086_c1 3300050490 Bacteria 1052
1438 nmdc:mga03n38_4164_c1 3300050490 Bacteria 4753
1439 nmdc:mga03n38_648101_c1 3300050490 Bacteria 605
1440 nmdc:mga00v17_124843_c1 3300050491 Bacteria 1642
1441 nmdc:mga00v17_166784_c1 3300050491 Bacteria 1419
1442 nmdc:mga00v17_80063_c1 3300050491 Bacteria 1565
1443 nmdc:mga0yw44_10371_c1 3300050492 Bacteria 4757
1444 nmdc:mga0yw44_279059_c1 3300050492 Bacteria 1116
1445 nmdc:mga0yw44_495256_c1 3300050492 Bacteria 829
1446 nmdc:mga0yw44_63138_c1 3300050492 Bacteria 2277
1447 nmdc:mga0yw44_6972_c1 3300050492 Bacteria 5518
1448 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
1449 nmdc:mga06z11_363418_c1 3300050494 Bacteria 868
1450 nmdc:mga06z11_382806_c1 3300050494 Bacteria 845
1451 nmdc:mga05p37_43303_c1 3300050507 Bacteria 5538
1452 nmdc:mga05p37_759979_c1 3300050507 Bacteria 1067
1453 nmdc:mga05p37_796258_c1 3300050507 Bacteria 1035
1454 nmdc:mga0qj67_50568_c1 3300050509 Bacteria 3287
1455 nmdc:mga0qj67_91623_c1 3300050509 Bacteria 2443
1456 nmdc:mga06r32_196750_c1 3300050510 Bacteria 2003
1457 nmdc:mga06r32_32833_c1 3300050510 Bacteria 4887
1458 nmdc:mga06r32_950158_c1 3300050510 Bacteria 814
1459 nmdc:mga08y16_67946_c1 3300050511 Bacteria 3717
1460 nmdc:mga08y16_800124_c1 3300050511 Bacteria 936
1461 nmdc:mga0n895_16060_c1 3300050512 Bacteria 6859
1462 nmdc:mga0n895_25936_c1 3300050512 Bacteria 5543
1463 nmdc:mga0n895_346336_c1 3300050512 Bacteria 1505
1464 nmdc:mga0n895_910855_c1 3300050512 Bacteria 864
1465 nmdc:mga0rr50_1038818_c1 3300050513 Bacteria 698
1466 nmdc:mga0rr50_20072_c1 3300050513 Bacteria 4528
1467 nmdc:mga0rr50_2084_c1 3300050513 Bacteria 11171
1468 nmdc:mga08x19_332382_c1 3300050514 Bacteria 1059
1469 nmdc:mga08x19_478247_c1 3300050514 Bacteria 878
1470 nmdc:mga08x19_7845_c1 3300050514 Bacteria 6340
1471 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
1472 nmdc:mga0a205_40470_c1 3300050515 Bacteria 4486
1473 nmdc:mga0a205_437186_c1 3300050515 Bacteria 1169
1474 nmdc:mga0sz30_25947_c1 3300050516 Bacteria 2398
1475 Ga0495601_0000065 3300053077 Bacteria 58386
1476 Ga0495601_0003864 3300053077 Bacteria 8624
1477 Ga0495601_0023616 3300053077 Bacteria 3779
1478 Ga0495601_0028965 3300053077 Bacteria 3433
1479 Ga0495601_0099960 3300053077 Bacteria 1873
1480 Ga0495601_0170302 3300053077 Bacteria 1423
1481 Ga0495601_0199663 3300053077 Bacteria 1307
1482 Ga0495601_0207348 3300053077 Bacteria 1280
1483 Ga0495601_0248820 3300053077 Bacteria 1161
1484 Ga0495612_0000820 3300053078 Bacteria 12636
1485 Ga0495612_0006879 3300053078 Bacteria 4653
1486 Ga0495612_0063947 3300053078 Bacteria 1526
1487 Ga0495612_0069600 3300053078 Bacteria 1466
1488 Ga0495612_0170306 3300053078 Bacteria 953
1489 Ga0495612_0214804 3300053078 Bacteria 850
1490 Ga0495612_0435401 3300053078 Bacteria 598
1491 Ga0495655_0000013 3300053083 Bacteria 63264
1492 Ga0495655_0000120 3300053083 Bacteria 14477
1493 Ga0495655_0007117 3300053083 Bacteria 2065
1494 Ga0495595_0000005 3300053084 Bacteria 258660
1495 Ga0495595_0010466 3300053084 Bacteria 3855
1496 Ga0495595_0079108 3300053084 Bacteria 1563
1497 Ga0495619_0000036 3300053085 Bacteria 125188
1498 Ga0495619_0000069 3300053085 Bacteria 82755
1499 Ga0495619_0000489 3300053085 Bacteria 26595
1500 Ga0495619_0005994 3300053085 Bacteria 7695
1501 Ga0495619_0020941 3300053085 Bacteria 4170
1502 Ga0495619_0036124 3300053085 Bacteria 3216
1503 Ga0495619_0038703 3300053085 Bacteria 3111
1504 Ga0495619_0063121 3300053085 Bacteria 2467
1505 Ga0495619_0079672 3300053085 Bacteria 2203
1506 Ga0495619_0139945 3300053085 Bacteria 1666
1507 Ga0500643_000010 3300053087 Bacteria 408084
1508 Ga0500566_0001523 3300053094 Bacteria 13612
1509 Ga0500641_0001013 3300053096 Bacteria 9986
1510 Ga0500554_079816 3300053102 Bacteria 1076
1511 Ga0500556_0000829 3300053104 Bacteria 17806
1512 Ga0500595_095378 3300053119 Bacteria 857
1513 Ga0500628_000045 3300053129 Bacteria 45042
1514 Ga0500568_0011040 3300053139 Bacteria 4207
1515 Ga0501084_0022899 3300054114 Bacteria 5213
1516 Ga0501084_0077198 3300054114 Bacteria 2792
1517 Ga0501084_0732562 3300054114 Bacteria 833
1518 Ga0590071_087587 3300059421 Bacteria 778
1519 Ga0587066_093256 3300059490 Bacteria 672
1520 Ga0587073_0081770 3300059492 Bacteria 803
1521 Ga0587083_0207521 3300059505 Bacteria 563
1522 Ga0501082_0015085 3300060353 Bacteria 6656
1523 Ga0501082_0109073 3300060353 Bacteria 2396
1524 Ga0501082_0116933 3300060353 Bacteria 2309
1525 Ga0501082_0164879 3300060353 Bacteria 1925
1526 Ga0501082_0635045 3300060353 Bacteria 934
1527 Ga0501082_1278133 3300060353 Bacteria 641
1528 Ga0466962_0003094 3300061719 Bacteria 7915
1529 Ga0466962_0032338 3300061719 Bacteria 2504
1530 Ga0466962_0089633 3300061719 Bacteria 1473
1531 Ga0466962_0153789 3300061719 Bacteria 1116
1532 Ga0530510_0006251 3300061734 Bacteria 8284
1533 Ga0530510_0022325 3300061734 Bacteria 4506
1534 Ga0530510_0076649 3300061734 Bacteria 2430
1535 Ga0530510_0078777 3300061734 Bacteria 2396
1536 Ga0530510_0240380 3300061734 Bacteria 1348
1537 Ga0530510_0862280 3300061734 Bacteria 692

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046680 Ga0495646_0426453 Ga0495646_0426453_179_661 134
2 3300047317 Ga0495604_0000218 Ga0495604_0000218_40210_40692 134
3 3300048907 Ga0496104_0000001 Ga0496104_0000001_327383_327874 137
4 3300048913 Ga0496110_0000152 Ga0496110_0000152_27222_27713 137
5 3300048914 Ga0496111_0000123 Ga0496111_0000123_10962_11453 137
6 3300036712 Ga0316584_0024637 Ga0316584_0024637_2259_2750 141
7 3300049659 Ga0501214_023456 Ga0501214_023456_36_533 147
8 3300005435 Ga0070714_100265334 Ga0070714_1002653344 151
9 3300009093 Ga0105240_10006736 Ga0105240_1000673611 151
10 3300025913 Ga0207695_10024364 Ga0207695_100243645 151
11 3300025926 Ga0207659_10000138 Ga0207659_1000013839 151
12 3300025929 Ga0207664_10305464 Ga0207664_103054642 151
13 3300046516 Ga0495628_0165298 Ga0495628_0165298_121_654 152
14 3300049588 Ga0501072_0939350 Ga0501072_0939350_14_472 152
15 3300005985 Ga0081539_10007216 Ga0081539_1000721614 153
16 3300013105 Ga0157369_10253672 Ga0157369_102536724 153
17 3300038443 Ga0395901_0567805 Ga0395901_0567805_368_829 153
18 3300042461 Ga0439460_0120626 Ga0439460_0120626_28_489 153
19 3300046461 Ga0495641_0141990 Ga0495641_0141990_411_872 153
20 3300048088 Ga0495602_0150401 Ga0495602_0150401_408_941 153
21 3300059421 Ga0590071_087587 Ga0590071_087587_225_758 153
22 3300005441 Ga0070700_100058347 Ga0070700_1000583473 154
23 3300005459 Ga0068867_100225818 Ga0068867_1002258183 154
24 3300007788 Ga0099795_10261319 Ga0099795_102613191 154
25 3300013102 Ga0157371_10225506 Ga0157371_102255062 154
26 3300014326 Ga0157380_10000560 Ga0157380_100005606 154
27 3300026075 Ga0207708_10140372 Ga0207708_101403723 154
28 3300035086 Ga0373934_0092206 Ga0373934_0092206_172_705 154
29 3300035117 Ga0373953_0220139 Ga0373953_0220139_125_658 154
30 3300035121 Ga0373960_0178392 Ga0373960_0178392_264_728 154
31 3300035172 Ga0373955_0264473 Ga0373955_0264473_525_989 154
32 3300036401 Ga0373937_0046449 Ga0373937_0046449_1575_2108 154
33 3300044684 Ga0466966_0267638 Ga0466966_0267638_544_1014 154
34 3300044693 Ga0466961_0453154 Ga0466961_0453154_302_766 154
35 3300045976 Ga0466967_0005406 Ga0466967_0005406_11_475 154
36 3300046463 Ga0495653_0141583 Ga0495653_0141583_856_1389 154
37 3300046500 Ga0495596_0319027 Ga0495596_0319027_13_477 154
38 3300046537 Ga0495598_0003179 Ga0495598_0003179_1855_2388 154
39 3300046691 Ga0495670_0001585 Ga0495670_0001585_167_700 154
40 3300046809 Ga0495600_0065764 Ga0495600_0065764_1478_2011 154
41 3300047322 Ga0495680_0090508 Ga0495680_0090508_81_614 154
42 3300047444 Ga0495675_0193057 Ga0495675_0193057_239_772 154
43 3300048088 Ga0495602_0735634 Ga0495602_0735634_30_563 154
44 3300048905 Ga0496102_0188141 Ga0496102_0188141_620_1153 154
45 3300048917 Ga0496114_0028056 Ga0496114_0028056_3025_3558 154
46 3300050490 nmdc:mga03n38_648101_c1 nmdc:mga03n38_648101_c1_124_588 154
47 3300053085 Ga0495619_0020941 Ga0495619_0020941_969_1502 154
48 3300009176 Ga0105242_10066186 Ga0105242_100661862 155
49 3300013104 Ga0157370_10019846 Ga0157370_100198466 155
50 3300017792 Ga0163161_10154484 Ga0163161_101544844 155
51 3300031727 Ga0316576_10002694 Ga0316576_100026948 155
52 3300031728 Ga0316578_10015694 Ga0316578_100156942 155
53 3300032168 Ga0316593_10004621 Ga0316593_100046216 155
54 3300033541 Ga0316596_1000028 Ga0316596_100002813 155
55 3300035398 Ga0316574_0998130 Ga0316574_0998130_14_481 155
56 3300044694 Ga0466963_0000325 Ga0466963_0000325_4880_5413 155
57 3300046511 Ga0495608_0000010 Ga0495608_0000010_242817_243350 155
58 3300046559 Ga0495667_0347411 Ga0495667_0347411_167_700 155
59 3300046675 Ga0495657_0000005 Ga0495657_0000005_11511_12044 155
60 3300046683 Ga0495658_0396878 Ga0495658_0396878_66_599 155
61 3300047444 Ga0495675_0000398 Ga0495675_0000398_7689_8222 155
62 3300048911 Ga0496108_0000339 Ga0496108_0000339_7837_8370 155
63 3300048912 Ga0496109_0000550 Ga0496109_0000550_17388_17921 155
64 3300053078 Ga0495612_0000820 Ga0495612_0000820_5582_6115 155
65 3300053084 Ga0495595_0000005 Ga0495595_0000005_15311_15844 155
66 3300053085 Ga0495619_0000036 Ga0495619_0000036_88527_89060 155
67 3300053085 Ga0495619_0000489 Ga0495619_0000489_18376_18909 155
68 3300053085 Ga0495619_0063121 Ga0495619_0063121_762_1295 155
69 3300026023 Ga0207677_10559921 Ga0207677_105599211 156
70 3300041494 Ga0451837_0722841 Ga0451837_0722841_100_570 156
71 3300006186 Ga0075369_10039405 Ga0075369_100394052 157
72 3300013308 Ga0157375_10000126 Ga0157375_1000012619 157
73 3300045836 Ga0466958_0041904 Ga0466958_0041904_1109_1624 157
74 3300050491 nmdc:mga00v17_124843_c1 nmdc:mga00v17_124843_c1_1075_1608 157
75 3300050516 nmdc:mga0sz30_25947_c1 nmdc:mga0sz30_25947_c1_1303_1836 157
76 3300061719 Ga0466962_0032338 Ga0466962_0032338_1180_1695 157
77 3300046809 Ga0495600_0347614 Ga0495600_0347614_361_894 158
78 3300048911 Ga0496108_0002451 Ga0496108_0002451_10936_11469 158
79 3300048912 Ga0496109_0000062 Ga0496109_0000062_13501_14034 158
80 3300005329 Ga0070683_100011264 Ga0070683_1000112649 159
81 3300005329 Ga0070683_100029181 Ga0070683_1000291813 159
82 3300005354 Ga0070675_100003153 Ga0070675_1000031534 159
83 3300005458 Ga0070681_10351113 Ga0070681_103511133 159
84 3300009101 Ga0105247_10000064 Ga0105247_10000064116 159
85 3300009148 Ga0105243_10926707 Ga0105243_109267071 159
86 3300025900 Ga0207710_10000220 Ga0207710_1000022044 159
87 3300025944 Ga0207661_10000518 Ga0207661_1000051810 159
88 3300025944 Ga0207661_10000616 Ga0207661_1000061623 159
89 3300049586 Ga0501070_0180852 Ga0501070_0180852_674_1207 159
90 3300050515 nmdc:mga0a205_437186_c1 nmdc:mga0a205_437186_c1_14_547 160
91 3300006175 Ga0070712_100003252 Ga0070712_1000032525 161
92 3300009551 Ga0105238_11854966 Ga0105238_118549661 161
93 3300025915 Ga0207693_10001647 Ga0207693_100016473 161
94 3300044712 Ga0453684_0055586 Ga0453684_0055586_2664_3200 161
95 3300045976 Ga0466967_0864276 Ga0466967_0864276_67_552 161
96 3300046539 Ga0495621_0006342 Ga0495621_0006342_76_609 161
97 3300048916 Ga0496113_0005100 Ga0496113_0005100_214_747 161
98 3300048917 Ga0496114_1454547 Ga0496114_1454547_46_531 161
99 3300048927 Ga0496124_0152301 Ga0496124_0152301_872_1357 161
100 3300048928 Ga0496125_0304662 Ga0496125_0304662_107_592 161
101 3300048929 Ga0496126_0128675 Ga0496126_0128675_1486_1971 161
102 3300049581 Ga0501047_0375061 Ga0501047_0375061_471_956 161
103 3300049590 Ga0501074_0176133 Ga0501074_0176133_353_838 161
104 3300049744 Ga0501083_0021493 Ga0501083_0021493_3300_3842 161
105 3300049823 Ga0501044_0133387 Ga0501044_0133387_469_954 161
106 3300061734 Ga0530510_0862280 Ga0530510_0862280_37_522 161
107 3300046462 Ga0495651_0047021 Ga0495651_0047021_2430_2918 162
108 3300046477 Ga0495664_0035587 Ga0495664_0035587_2244_2732 162
109 3300046514 Ga0495618_0029788 Ga0495618_0029788_242_730 162
110 3300046543 Ga0495645_0049315 Ga0495645_0049315_942_1430 162
111 3300046559 Ga0495667_0145389 Ga0495667_0145389_903_1391 162
112 3300046663 Ga0495635_0057374 Ga0495635_0057374_1308_1796 162
113 3300046675 Ga0495657_0036529 Ga0495657_0036529_1280_1768 162
114 3300046809 Ga0495600_0044869 Ga0495600_0044869_1493_1981 162
115 3300047317 Ga0495604_0530600 Ga0495604_0530600_255_743 162
116 3300047320 Ga0495672_0000016 Ga0495672_0000016_37511_38050 162
117 3300049582 Ga0501048_0045135 Ga0501048_0045135_628_1161 162
118 3300053077 Ga0495601_0207348 Ga0495601_0207348_175_663 162
119 3300053085 Ga0495619_0036124 Ga0495619_0036124_885_1373 162
120 3300005327 Ga0070658_10000118 Ga0070658_100001188 163
121 3300005327 Ga0070658_10019454 Ga0070658_100194542 163
122 3300005367 Ga0070667_100577375 Ga0070667_1005773752 163
123 3300005434 Ga0070709_10340980 Ga0070709_103409802 163
124 3300005435 Ga0070714_100001163 Ga0070714_10000116322 163
125 3300005437 Ga0070710_10150605 Ga0070710_101506051 163
126 3300005439 Ga0070711_100074674 Ga0070711_1000746742 163
127 3300005439 Ga0070711_101123675 Ga0070711_1011236751 163
128 3300005548 Ga0070665_100140907 Ga0070665_1001409073 163
129 3300005834 Ga0068851_10012553 Ga0068851_100125539 163
130 3300006175 Ga0070712_100054680 Ga0070712_1000546803 163
131 3300013297 Ga0157378_10026190 Ga0157378_100261906 163
132 3300025321 Ga0207656_10001048 Ga0207656_100010489 163
133 3300025909 Ga0207705_10000167 Ga0207705_1000016781 163
134 3300025909 Ga0207705_10014343 Ga0207705_100143434 163
135 3300025916 Ga0207663_10004707 Ga0207663_100047074 163
136 3300025916 Ga0207663_10997553 Ga0207663_109975532 163
137 3300025929 Ga0207664_10006241 Ga0207664_100062412 163
138 3300046455 Ga0495603_0000641 Ga0495603_0000641_887_1420 163
139 3300046459 Ga0495629_0000543 Ga0495629_0000543_13460_13993 163
140 3300046463 Ga0495653_0033508 Ga0495653_0033508_3074_3607 163
141 3300046476 Ga0495662_0000236 Ga0495662_0000236_7401_7934 163
142 3300046525 Ga0495663_0109342 Ga0495663_0109342_140_631 163
143 3300046674 Ga0495588_0519195 Ga0495588_0519195_58_591 163
144 3300046691 Ga0495670_0198861 Ga0495670_0198861_141_632 163
145 3300047447 Ga0495685_168793 Ga0495685_168793_48_539 163
146 3300048904 Ga0496101_0061288 Ga0496101_0061288_2154_2687 163
147 3300048907 Ga0496104_0242417 Ga0496104_0242417_575_1108 163
148 3300048909 Ga0496106_0165044 Ga0496106_0165044_531_1064 163
149 3300048916 Ga0496113_0300458 Ga0496113_0300458_310_843 163
150 3300048916 Ga0496113_0669666 Ga0496113_0669666_238_771 163
151 3300048918 Ga0496115_0103084 Ga0496115_0103084_904_1437 163
152 3300005335 Ga0070666_10037083 Ga0070666_100370836 164
153 3300005543 Ga0070672_100000104 Ga0070672_10000010423 164
154 3300005548 Ga0070665_100015972 Ga0070665_1000159725 164
155 3300005937 Ga0081455_10031114 Ga0081455_100311144 164
156 3300014969 Ga0157376_10814688 Ga0157376_108146882 164
157 3300025898 Ga0207692_10047628 Ga0207692_100476283 164
158 3300025940 Ga0207691_10000430 Ga0207691_1000043023 164
159 3300028379 Ga0268266_10005543 Ga0268266_100055436 164
160 3300046454 Ga0495592_0133368 Ga0495592_0133368_1049_1582 164
161 3300046461 Ga0495641_0014568 Ga0495641_0014568_2309_2842 164
162 3300046506 Ga0495583_0018179 Ga0495583_0018179_1843_2382 164
163 3300046517 Ga0495630_0000148 Ga0495630_0000148_45119_45652 164
164 3300046678 Ga0495599_0139371 Ga0495599_0139371_914_1447 164
165 3300046679 Ga0495623_0482604 Ga0495623_0482604_61_594 164
166 3300046681 Ga0495647_0000114 Ga0495647_0000114_11342_11875 164
167 3300046690 Ga0495624_0000429 Ga0495624_0000429_17461_17994 164
168 3300047321 Ga0495676_0057791 Ga0495676_0057791_1568_2101 164
169 3300049586 Ga0501070_0121421 Ga0501070_0121421_651_1184 164
170 3300005356 Ga0070674_100000047 Ga0070674_10000004726 165
171 3300005365 Ga0070688_100168985 Ga0070688_1001689853 165
172 3300005436 Ga0070713_100113570 Ga0070713_1001135702 165
173 3300005439 Ga0070711_100296794 Ga0070711_1002967943 165
174 3300005466 Ga0070685_10027085 Ga0070685_100270855 165
175 3300005718 Ga0068866_10000274 Ga0068866_1000027414 165
176 3300006852 Ga0075433_10004429 Ga0075433_100044299 165
177 3300009148 Ga0105243_10321933 Ga0105243_103219333 165
178 3300013308 Ga0157375_10231424 Ga0157375_102314243 165
179 3300013308 Ga0157375_11335368 Ga0157375_113353682 165
180 3300014326 Ga0157380_10242813 Ga0157380_102428133 165
181 3300025899 Ga0207642_10000290 Ga0207642_1000029016 165
182 3300025928 Ga0207700_10142380 Ga0207700_101423804 165
183 3300025935 Ga0207709_10217571 Ga0207709_102175714 165
184 3300025935 Ga0207709_10218028 Ga0207709_102180283 165
185 3300025936 Ga0207670_10123348 Ga0207670_101233482 165
186 3300025937 Ga0207669_10000002 Ga0207669_10000002384 165
187 3300032126 Ga0307415_100016735 Ga0307415_1000167357 165
188 3300050515 nmdc:mga0a205_15_c2 nmdc:mga0a205_15_c2_20667_21200 165
189 3300005466 Ga0070685_10148849 Ga0070685_101488493 166
190 3300046462 Ga0495651_0000169 Ga0495651_0000169_27214_27753 166
191 3300046514 Ga0495618_0014163 Ga0495618_0014163_2685_3224 166
192 3300046516 Ga0495628_0004361 Ga0495628_0004361_5708_6247 166
193 3300046529 Ga0495652_0011903 Ga0495652_0011903_1924_2463 166
194 3300046536 Ga0495587_0025867 Ga0495587_0025867_2206_2745 166
195 3300046543 Ga0495645_0109813 Ga0495645_0109813_1162_1701 166
196 3300046663 Ga0495635_0176289 Ga0495635_0176289_70_603 166
197 3300046679 Ga0495623_0003245 Ga0495623_0003245_572_1111 166
198 3300046680 Ga0495646_0018379 Ga0495646_0018379_952_1491 166
199 3300047321 Ga0495676_0364595 Ga0495676_0364595_255_788 166
200 3300048088 Ga0495602_0430233 Ga0495602_0430233_275_814 166
201 3300048918 Ga0496115_0002589 Ga0496115_0002589_4231_4764 166
202 3300053077 Ga0495601_0028965 Ga0495601_0028965_2313_2852 166
203 3300053078 Ga0495612_0214804 Ga0495612_0214804_188_727 166
204 3300053085 Ga0495619_0079672 Ga0495619_0079672_727_1266 166
205 3300001979 JGI24740J21852_10002914 JGI24740J21852_1000291411 167
206 3300005548 Ga0070665_100707115 Ga0070665_1007071152 167
207 3300005616 Ga0068852_100082661 Ga0068852_1000826613 167
208 3300009176 Ga0105242_10000123 Ga0105242_1000012318 167
209 3300013306 Ga0163162_10491905 Ga0163162_104919052 167
210 3300025934 Ga0207686_10000066 Ga0207686_1000006688 167
211 3300025949 Ga0207667_10065417 Ga0207667_100654176 167
212 3300025961 Ga0207712_10000067 Ga0207712_1000006766 167
213 3300028379 Ga0268266_10622892 Ga0268266_106228922 167
214 3300028573 Ga0265334_10087041 Ga0265334_100870412 167
215 3300037312 Ga0395899_0003309 Ga0395899_0003309_6400_6903 167
216 3300037418 Ga0395900_0154425 Ga0395900_0154425_1821_2324 167
217 3300037466 Ga0395898_0006193 Ga0395898_0006193_7787_8290 167
218 3300037471 Ga0395905_0090635 Ga0395905_0090635_21_524 167
219 3300038443 Ga0395901_0025765 Ga0395901_0025765_295_798 167
220 3300044901 Ga0466960_0178182 Ga0466960_0178182_28_531 167
221 3300045976 Ga0466967_0055664 Ga0466967_0055664_2065_2568 167
222 3300046460 Ga0495638_0113049 Ga0495638_0113049_237_740 167
223 3300047469 Ga0495673_0106980 Ga0495673_0106980_126_629 167
224 3300048903 Ga0496100_0047639 Ga0496100_0047639_455_958 167
225 3300048905 Ga0496102_0590941 Ga0496102_0590941_75_578 167
226 3300048913 Ga0496110_0970112 Ga0496110_0970112_12_515 167
227 3300048915 Ga0496112_0829778 Ga0496112_0829778_197_700 167
228 3300048916 Ga0496113_0030295 Ga0496113_0030295_1898_2401 167
229 3300049578 Ga0501042_0035728 Ga0501042_0035728_888_1421 167
230 3300053078 Ga0495612_0435401 Ga0495612_0435401_71_574 167
231 3300053083 Ga0495655_0000013 Ga0495655_0000013_30270_30773 167
232 3300053083 Ga0495655_0000120 Ga0495655_0000120_8155_8658 167
233 3300053129 Ga0500628_000045 Ga0500628_000045_11708_12211 167
234 3300005937 Ga0081455_10050580 Ga0081455_100505806 168
235 3300005549 Ga0070704_100187708 Ga0070704_1001877082 169
236 3300046455 Ga0495603_0000323 Ga0495603_0000323_8877_9428 170
237 3300004803 Ga0058862_12634493 Ga0058862_126344931 171
238 3300005329 Ga0070683_100400204 Ga0070683_1004002042 171
239 3300005336 Ga0070680_100485266 Ga0070680_1004852661 171
240 3300005336 Ga0070680_100676750 Ga0070680_1006767501 171
241 3300005337 Ga0070682_100629081 Ga0070682_1006290812 171
242 3300005338 Ga0068868_100041349 Ga0068868_1000413493 171
243 3300005341 Ga0070691_10161418 Ga0070691_101614182 171
244 3300005355 Ga0070671_100569907 Ga0070671_1005699072 171
245 3300005366 Ga0070659_100229298 Ga0070659_1002292982 171
246 3300005439 Ga0070711_100672659 Ga0070711_1006726591 171
247 3300005530 Ga0070679_100131625 Ga0070679_1001316253 171
248 3300005530 Ga0070679_100286093 Ga0070679_1002860933 171
249 3300005535 Ga0070684_100430446 Ga0070684_1004304461 171
250 3300005535 Ga0070684_100815672 Ga0070684_1008156721 171
251 3300005547 Ga0070693_100283429 Ga0070693_1002834292 171
252 3300005563 Ga0068855_100211085 Ga0068855_1002110852 171
253 3300005578 Ga0068854_100655853 Ga0068854_1006558532 171
254 3300005578 Ga0068854_100717453 Ga0068854_1007174531 171
255 3300005614 Ga0068856_101240572 Ga0068856_1012405721 171
256 3300005616 Ga0068852_100414582 Ga0068852_1004145823 171
257 3300005616 Ga0068852_101101210 Ga0068852_1011012102 171
258 3300005834 Ga0068851_10052359 Ga0068851_100523592 171
259 3300006175 Ga0070712_100348338 Ga0070712_1003483382 171
260 3300006237 Ga0097621_100799015 Ga0097621_1007990151 171
261 3300006871 Ga0075434_100011481 Ga0075434_10001148112 171
262 3300006914 Ga0075436_100004770 Ga0075436_10000477010 171
263 3300007076 Ga0075435_100005293 Ga0075435_1000052939 171
264 3300009093 Ga0105240_10346610 Ga0105240_103466102 171
265 3300009093 Ga0105240_11277054 Ga0105240_112770542 171
266 3300009098 Ga0105245_10296712 Ga0105245_102967122 171
267 3300009101 Ga0105247_10402446 Ga0105247_104024462 171
268 3300009174 Ga0105241_10706018 Ga0105241_107060182 171
269 3300009177 Ga0105248_10443536 Ga0105248_104435362 171
270 3300009545 Ga0105237_10392389 Ga0105237_103923892 171
271 3300009551 Ga0105238_10515498 Ga0105238_105154983 171
272 3300010375 Ga0105239_10479465 Ga0105239_104794652 171
273 3300011119 Ga0105246_10553700 Ga0105246_105537002 171
274 3300013104 Ga0157370_10152375 Ga0157370_101523752 171
275 3300013105 Ga0157369_10440542 Ga0157369_104405423 171
276 3300013105 Ga0157369_11094754 Ga0157369_110947541 171
277 3300013296 Ga0157374_10007487 Ga0157374_100074878 171
278 3300013297 Ga0157378_10390154 Ga0157378_103901542 171
279 3300013307 Ga0157372_10472159 Ga0157372_104721594 171
280 3300013307 Ga0157372_10868018 Ga0157372_108680183 171
281 3300014968 Ga0157379_10431970 Ga0157379_104319701 171
282 3300020069 Ga0197907_11061596 Ga0197907_110615964 171
283 3300020070 Ga0206356_11170571 Ga0206356_111705711 171
284 3300020078 Ga0206352_10474987 Ga0206352_104749879 171
285 3300020080 Ga0206350_10358935 Ga0206350_103589354 171
286 3300020081 Ga0206354_11580278 Ga0206354_115802781 171
287 3300020082 Ga0206353_10821093 Ga0206353_108210931 171
288 3300020082 Ga0206353_11197058 Ga0206353_111970581 171
289 3300022467 Ga0224712_10090631 Ga0224712_100906311 171
290 3300022467 Ga0224712_10168342 Ga0224712_101683422 171
291 3300025321 Ga0207656_10520519 Ga0207656_105205191 171
292 3300025898 Ga0207692_10094434 Ga0207692_100944343 171
293 3300025912 Ga0207707_10044938 Ga0207707_100449382 171
294 3300025912 Ga0207707_10094215 Ga0207707_100942153 171
295 3300025913 Ga0207695_10006377 Ga0207695_100063776 171
296 3300025914 Ga0207671_10159889 Ga0207671_101598892 171
297 3300025914 Ga0207671_10414997 Ga0207671_104149972 171
298 3300025915 Ga0207693_10021498 Ga0207693_100214988 171
299 3300025916 Ga0207663_10036461 Ga0207663_100364613 171
300 3300025917 Ga0207660_10081356 Ga0207660_100813562 171
301 3300025917 Ga0207660_10308126 Ga0207660_103081262 171
302 3300025919 Ga0207657_10387592 Ga0207657_103875921 171
303 3300025921 Ga0207652_10027609 Ga0207652_100276094 171
304 3300025924 Ga0207694_10160387 Ga0207694_101603872 171
305 3300025927 Ga0207687_10211527 Ga0207687_102115272 171
306 3300025929 Ga0207664_10764445 Ga0207664_107644451 171
307 3300025932 Ga0207690_10756764 Ga0207690_107567642 171
308 3300025941 Ga0207711_11225190 Ga0207711_112251902 171
309 3300025949 Ga0207667_10039658 Ga0207667_100396588 171
310 3300025981 Ga0207640_10054025 Ga0207640_100540255 171
311 3300025981 Ga0207640_10751205 Ga0207640_107512051 171
312 3300026023 Ga0207677_10020116 Ga0207677_100201169 171
313 3300026078 Ga0207702_10045123 Ga0207702_100451233 171
314 3300026116 Ga0207674_10097306 Ga0207674_100973066 171
315 3300026142 Ga0207698_10329183 Ga0207698_103291834 171
316 3300026142 Ga0207698_10649899 Ga0207698_106498992 171
317 3300032133 Ga0316583_10229534 Ga0316583_102295341 171
318 3300035115 Ga0373941_0322218 Ga0373941_0322218_63_581 171
319 3300035410 Ga0373924_0017975 Ga0373924_0017975_1988_2503 171
320 3300036401 Ga0373937_0166140 Ga0373937_0166140_144_659 171
321 3300036401 Ga0373937_0318923 Ga0373937_0318923_13_528 171
322 3300044658 Ga0466972_0036141 Ga0466972_0036141_247_762 171
323 3300044694 Ga0466963_0004436 Ga0466963_0004436_991_1506 171
324 3300044694 Ga0466963_0013239 Ga0466963_0013239_2755_3270 171
325 3300044842 Ga0466957_0072417 Ga0466957_0072417_341_856 171
326 3300044842 Ga0466957_0135852 Ga0466957_0135852_1023_1538 171
327 3300044901 Ga0466960_0136449 Ga0466960_0136449_131_646 171
328 3300044901 Ga0466960_0192880 Ga0466960_0192880_394_909 171
329 3300045836 Ga0466958_0097396 Ga0466958_0097396_148_663 171
330 3300045976 Ga0466967_0044621 Ga0466967_0044621_3260_3775 171
331 3300045976 Ga0466967_0048797 Ga0466967_0048797_1612_2127 171
332 3300045976 Ga0466967_0357480 Ga0466967_0357480_52_567 171
333 3300045976 Ga0466967_0367630 Ga0466967_0367630_546_1061 171
334 3300046536 Ga0495587_0093797 Ga0495587_0093797_686_1201 171
335 3300046543 Ga0495645_0373965 Ga0495645_0373965_350_865 171
336 3300046678 Ga0495599_0363503 Ga0495599_0363503_47_562 171
337 3300046809 Ga0495600_0165651 Ga0495600_0165651_883_1398 171
338 3300047322 Ga0495680_0280174 Ga0495680_0280174_103_618 171
339 3300048903 Ga0496100_0033531 Ga0496100_0033531_1247_1762 171
340 3300048904 Ga0496101_0066191 Ga0496101_0066191_1591_2106 171
341 3300048905 Ga0496102_0106099 Ga0496102_0106099_1454_1969 171
342 3300048907 Ga0496104_0263093 Ga0496104_0263093_103_618 171
343 3300048908 Ga0496105_0080385 Ga0496105_0080385_1471_1986 171
344 3300048909 Ga0496106_0216492 Ga0496106_0216492_831_1346 171
345 3300048909 Ga0496106_0618077 Ga0496106_0618077_162_677 171
346 3300048911 Ga0496108_0416446 Ga0496108_0416446_577_1092 171
347 3300048912 Ga0496109_0024699 Ga0496109_0024699_403_918 171
348 3300048915 Ga0496112_0064232 Ga0496112_0064232_793_1308 171
349 3300048916 Ga0496113_0062651 Ga0496113_0062651_458_973 171
350 3300048918 Ga0496115_0072896 Ga0496115_0072896_1250_1765 171
351 3300050512 nmdc:mga0n895_16060_c1 nmdc:mga0n895_16060_c1_3058_3573 171
352 3300050513 nmdc:mga0rr50_2084_c1 nmdc:mga0rr50_2084_c1_10513_11028 171
353 3300050514 nmdc:mga08x19_7845_c1 nmdc:mga08x19_7845_c1_3103_3618 171
354 3300050515 nmdc:mga0a205_40470_c1 nmdc:mga0a205_40470_c1_1753_2268 171
355 3300053077 Ga0495601_0248820 Ga0495601_0248820_347_862 171
356 3300059505 Ga0587083_0207521 Ga0587083_0207521_25_540 171
357 3300061719 Ga0466962_0089633 Ga0466962_0089633_461_976 171
358 iso_pu_bacteria 646564506 646813318 172
359 3300010375 Ga0105239_11080683 Ga0105239_110806832 173
360 3300044712 Ga0453684_0011806 Ga0453684_0011806_13578_14114 173
361 iso_pu_bacteria 2811994880 2812364374 173
362 3300032168 Ga0316593_10001942 Ga0316593_100019429 175
363 3300033541 Ga0316596_1103022 Ga0316596_11030222 175
364 3300036647 Ga0316582_0086506 Ga0316582_0086506_870_1397 175
365 3300005289 Ga0065704_10110588 Ga0065704_101105881 176
366 3300005327 Ga0070658_10000015 Ga0070658_1000001522 176
367 3300005327 Ga0070658_10305862 Ga0070658_103058621 176
368 3300005329 Ga0070683_100439158 Ga0070683_1004391583 176
369 3300005336 Ga0070680_100473139 Ga0070680_1004731392 176
370 3300005353 Ga0070669_100966953 Ga0070669_1009669531 176
371 3300005355 Ga0070671_100035416 Ga0070671_1000354168 176
372 3300005356 Ga0070674_100013671 Ga0070674_1000136712 176
373 3300005366 Ga0070659_100199395 Ga0070659_1001993954 176
374 3300005530 Ga0070679_100014538 Ga0070679_1000145389 176
375 3300005535 Ga0070684_100159000 Ga0070684_1001590005 176
376 3300005548 Ga0070665_100096550 Ga0070665_1000965506 176
377 3300005563 Ga0068855_100006349 Ga0068855_10000634913 176
378 3300005563 Ga0068855_101881237 Ga0068855_1018812371 176
379 3300005577 Ga0068857_100155712 Ga0068857_1001557124 176
380 3300005841 Ga0068863_100022347 Ga0068863_1000223477 176
381 3300005937 Ga0081455_10000003 Ga0081455_10000003279 176
382 3300006038 Ga0075365_10055135 Ga0075365_100551354 176
383 3300006051 Ga0075364_10164933 Ga0075364_101649332 176
384 3300006175 Ga0070712_101155653 Ga0070712_1011556532 176
385 3300006195 Ga0075366_10000065 Ga0075366_1000006540 176
386 3300006237 Ga0097621_100000264 Ga0097621_10000026435 176
387 3300006358 Ga0068871_100000039 Ga0068871_10000003974 176
388 3300009093 Ga0105240_10822894 Ga0105240_108228942 176
389 3300009098 Ga0105245_10000002 Ga0105245_10000002252 176
390 3300009174 Ga0105241_10539503 Ga0105241_105395032 176
391 3300009176 Ga0105242_11162319 Ga0105242_111623192 176
392 3300013100 Ga0157373_10071697 Ga0157373_100716972 176
393 3300013105 Ga0157369_10290843 Ga0157369_102908431 176
394 3300013296 Ga0157374_10000031 Ga0157374_10000031119 176
395 3300013307 Ga0157372_10904055 Ga0157372_109040552 176
396 3300025904 Ga0207647_10008577 Ga0207647_1000857712 176
397 3300025909 Ga0207705_10000011 Ga0207705_10000011324 176
398 3300025909 Ga0207705_10007444 Ga0207705_100074443 176
399 3300025913 Ga0207695_11230853 Ga0207695_112308531 176
400 3300025924 Ga0207694_10115581 Ga0207694_101155814 176
401 3300025927 Ga0207687_10000001 Ga0207687_10000001959 176
402 3300025931 Ga0207644_10000001 Ga0207644_10000001977 176
403 3300025931 Ga0207644_10106804 Ga0207644_101068045 176
404 3300025932 Ga0207690_10226334 Ga0207690_102263342 176
405 3300025937 Ga0207669_10027599 Ga0207669_100275994 176
406 3300025944 Ga0207661_10159071 Ga0207661_101590714 176
407 3300025949 Ga0207667_10023417 Ga0207667_100234179 176
408 3300025949 Ga0207667_10087215 Ga0207667_100872158 176
409 3300026078 Ga0207702_10000001 Ga0207702_10000001846 176
410 3300026088 Ga0207641_10016989 Ga0207641_100169899 176
411 3300026116 Ga0207674_10181508 Ga0207674_101815082 176
412 3300028379 Ga0268266_10003734 Ga0268266_1000373413 176
413 3300028800 Ga0265338_10000543 Ga0265338_1000054340 176
414 3300030733 Ga0314311_1244055 Ga0314311_12440554 176
415 3300032168 Ga0316593_10017362 Ga0316593_100173624 176
416 3300032168 Ga0316593_10090494 Ga0316593_100904942 176
417 3300037312 Ga0395899_0003098 Ga0395899_0003098_10313_10852 176
418 3300037312 Ga0395899_0058565 Ga0395899_0058565_1398_1937 176
419 3300037418 Ga0395900_0001412 Ga0395900_0001412_23419_23958 176
420 3300037418 Ga0395900_0254362 Ga0395900_0254362_825_1364 176
421 3300037466 Ga0395898_0002536 Ga0395898_0002536_12029_12568 176
422 3300037466 Ga0395898_0335096 Ga0395898_0335096_521_1060 176
423 3300037471 Ga0395905_0008237 Ga0395905_0008237_9363_9902 176
424 3300037471 Ga0395905_0039862 Ga0395905_0039862_1166_1705 176
425 3300038443 Ga0395901_0069107 Ga0395901_0069107_1178_1717 176
426 3300048912 Ga0496109_0621254 Ga0496109_0621254_56_595 176
427 3300048915 Ga0496112_0002149 Ga0496112_0002149_7428_7967 176
428 3300049569 Ga0501032_0000394 Ga0501032_0000394_2356_2892 176
429 3300049571 Ga0501034_0020539 Ga0501034_0020539_1054_1590 176
430 3300049572 Ga0501036_0058031 Ga0501036_0058031_1099_1635 176
431 3300049573 Ga0501037_0000133 Ga0501037_0000133_36922_37458 176
432 3300049573 Ga0501037_0377338 Ga0501037_0377338_350_889 176
433 3300049574 Ga0501038_0023933 Ga0501038_0023933_2403_2939 176
434 3300049579 Ga0501043_0000404 Ga0501043_0000404_36091_36627 176
435 3300049580 Ga0501046_0000038 Ga0501046_0000038_112731_113267 176
436 3300049581 Ga0501047_0006066 Ga0501047_0006066_4710_5246 176
437 3300049582 Ga0501048_0000033 Ga0501048_0000033_51296_51832 176
438 3300049586 Ga0501070_1106173 Ga0501070_1106173_23_562 176
439 3300049587 Ga0501071_0194956 Ga0501071_0194956_729_1265 176
440 3300049589 Ga0501073_0012572 Ga0501073_0012572_1949_2485 176
441 3300049744 Ga0501083_0014244 Ga0501083_0014244_3558_4097 176
442 3300049822 Ga0501035_0000562 Ga0501035_0000562_40021_40557 176
443 3300049823 Ga0501044_0028311 Ga0501044_0028311_4051_4587 176
444 3300049823 Ga0501044_0598542 Ga0501044_0598542_324_863 176
445 3300050491 nmdc:mga00v17_80063_c1 nmdc:mga00v17_80063_c1_98_637 176
446 3300050492 nmdc:mga0yw44_6972_c1 nmdc:mga0yw44_6972_c1_3321_3860 176
447 3300050493 nmdc:mga0k408_14_c3 nmdc:mga0k408_14_c3_32845_33384 176
448 3300053087 Ga0500643_000010 Ga0500643_000010_331747_332286 176
449 3300053104 Ga0500556_0000829 Ga0500556_0000829_15540_16079 176
450 3300053139 Ga0500568_0011040 Ga0500568_0011040_1629_2168 176
451 3300000546 LJNas_1011685 LJNas_10116852 177
452 3300001977 JGI24746J21847_1000007 JGI24746J21847_100000720 177
453 3300002067 JGI24735J21928_10080911 JGI24735J21928_100809112 177
454 3300002074 JGI24748J21848_1033473 JGI24748J21848_10334731 177
455 3300002459 JGI24751J29686_10011031 JGI24751J29686_100110312 177
456 3300003316 rootH1_10074761 rootH1_100747612 177
457 3300003373 JGI25407J50210_10056190 JGI25407J50210_100561901 177
458 3300004799 Ga0058863_11570617 Ga0058863_115706173 177
459 3300004800 Ga0058861_11650416 Ga0058861_116504161 177
460 3300005290 Ga0065712_10078746 Ga0065712_100787465 177
461 3300005327 Ga0070658_10007473 Ga0070658_100074734 177
462 3300005327 Ga0070658_10122863 Ga0070658_101228633 177
463 3300005328 Ga0070676_10715942 Ga0070676_107159422 177
464 3300005329 Ga0070683_100004183 Ga0070683_1000041835 177
465 3300005329 Ga0070683_100062690 Ga0070683_1000626902 177
466 3300005329 Ga0070683_100120685 Ga0070683_1001206854 177
467 3300005329 Ga0070683_100126915 Ga0070683_1001269154 177
468 3300005329 Ga0070683_100902682 Ga0070683_1009026821 177
469 3300005330 Ga0070690_100222031 Ga0070690_1002220312 177
470 3300005331 Ga0070670_100075753 Ga0070670_1000757536 177
471 3300005331 Ga0070670_100189978 Ga0070670_1001899783 177
472 3300005331 Ga0070670_100207091 Ga0070670_1002070912 177
473 3300005334 Ga0068869_100158217 Ga0068869_1001582172 177
474 3300005334 Ga0068869_100201608 Ga0068869_1002016082 177
475 3300005335 Ga0070666_10042517 Ga0070666_100425175 177
476 3300005335 Ga0070666_10783074 Ga0070666_107830741 177
477 3300005336 Ga0070680_100174812 Ga0070680_1001748122 177
478 3300005336 Ga0070680_100470389 Ga0070680_1004703892 177
479 3300005337 Ga0070682_100000032 Ga0070682_100000032159 177
480 3300005337 Ga0070682_100010869 Ga0070682_1000108699 177
481 3300005337 Ga0070682_100077562 Ga0070682_1000775622 177
482 3300005337 Ga0070682_100158343 Ga0070682_1001583433 177
483 3300005338 Ga0068868_100005144 Ga0068868_10000514410 177
484 3300005338 Ga0068868_100008360 Ga0068868_1000083606 177
485 3300005338 Ga0068868_100016812 Ga0068868_1000168124 177
486 3300005338 Ga0068868_100180134 Ga0068868_1001801344 177
487 3300005338 Ga0068868_100433537 Ga0068868_1004335372 177
488 3300005339 Ga0070660_100003497 Ga0070660_1000034972 177
489 3300005339 Ga0070660_100004072 Ga0070660_10000407216 177
490 3300005340 Ga0070689_100034029 Ga0070689_1000340296 177
491 3300005340 Ga0070689_100058352 Ga0070689_1000583525 177
492 3300005340 Ga0070689_100657789 Ga0070689_1006577891 177
493 3300005341 Ga0070691_10004069 Ga0070691_100040694 177
494 3300005341 Ga0070691_10034566 Ga0070691_100345664 177
495 3300005341 Ga0070691_10335183 Ga0070691_103351831 177
496 3300005344 Ga0070661_100000236 Ga0070661_10000023625 177
497 3300005344 Ga0070661_100149640 Ga0070661_1001496404 177
498 3300005344 Ga0070661_100263565 Ga0070661_1002635653 177
499 3300005345 Ga0070692_10022554 Ga0070692_100225541 177
500 3300005347 Ga0070668_100012868 Ga0070668_1000128686 177
501 3300005347 Ga0070668_100034700 Ga0070668_1000347006 177
502 3300005347 Ga0070668_100261558 Ga0070668_1002615581 177
503 3300005353 Ga0070669_100129229 Ga0070669_1001292292 177
504 3300005353 Ga0070669_101118095 Ga0070669_1011180951 177
505 3300005354 Ga0070675_100015253 Ga0070675_1000152539 177
506 3300005354 Ga0070675_100055442 Ga0070675_1000554421 177
507 3300005354 Ga0070675_100479127 Ga0070675_1004791273 177
508 3300005355 Ga0070671_100097555 Ga0070671_1000975551 177
509 3300005356 Ga0070674_100002494 Ga0070674_10000249412 177
510 3300005356 Ga0070674_100239505 Ga0070674_1002395053 177
511 3300005364 Ga0070673_100088256 Ga0070673_1000882566 177
512 3300005365 Ga0070688_100001088 Ga0070688_10000108820 177
513 3300005365 Ga0070688_100011350 Ga0070688_1000113503 177
514 3300005365 Ga0070688_100099832 Ga0070688_1000998322 177
515 3300005365 Ga0070688_100591745 Ga0070688_1005917452 177
516 3300005366 Ga0070659_100000983 Ga0070659_10000098321 177
517 3300005366 Ga0070659_100012148 Ga0070659_1000121482 177
518 3300005366 Ga0070659_100020922 Ga0070659_1000209226 177
519 3300005367 Ga0070667_100001611 Ga0070667_10000161114 177
520 3300005367 Ga0070667_100088657 Ga0070667_1000886575 177
521 3300005367 Ga0070667_100239468 Ga0070667_1002394681 177
522 3300005367 Ga0070667_100456329 Ga0070667_1004563292 177
523 3300005434 Ga0070709_10276115 Ga0070709_102761151 177
524 3300005435 Ga0070714_100048906 Ga0070714_1000489064 177
525 3300005435 Ga0070714_100134356 Ga0070714_1001343562 177
526 3300005435 Ga0070714_100280218 Ga0070714_1002802184 177
527 3300005436 Ga0070713_100000171 Ga0070713_10000017142 177
528 3300005436 Ga0070713_100504725 Ga0070713_1005047253 177
529 3300005438 Ga0070701_10066647 Ga0070701_100666472 177
530 3300005438 Ga0070701_10340196 Ga0070701_103401962 177
531 3300005439 Ga0070711_100107198 Ga0070711_1001071983 177
532 3300005440 Ga0070705_100017093 Ga0070705_1000170935 177
533 3300005440 Ga0070705_100408265 Ga0070705_1004082652 177
534 3300005440 Ga0070705_100809940 Ga0070705_1008099401 177
535 3300005441 Ga0070700_100036039 Ga0070700_1000360392 177
536 3300005441 Ga0070700_100038179 Ga0070700_1000381793 177
537 3300005441 Ga0070700_100192473 Ga0070700_1001924732 177
538 3300005441 Ga0070700_100217771 Ga0070700_1002177712 177
539 3300005444 Ga0070694_100111319 Ga0070694_1001113192 177
540 3300005444 Ga0070694_100519600 Ga0070694_1005196001 177
541 3300005444 Ga0070694_100978175 Ga0070694_1009781751 177
542 3300005445 Ga0070708_100555341 Ga0070708_1005553413 177
543 3300005445 Ga0070708_100645117 Ga0070708_1006451172 177
544 3300005455 Ga0070663_100005936 Ga0070663_1000059364 177
545 3300005455 Ga0070663_100178952 Ga0070663_1001789522 177
546 3300005456 Ga0070678_100077056 Ga0070678_1000770562 177
547 3300005456 Ga0070678_100092027 Ga0070678_1000920273 177
548 3300005456 Ga0070678_100215648 Ga0070678_1002156483 177
549 3300005456 Ga0070678_101084109 Ga0070678_1010841091 177
550 3300005457 Ga0070662_100012555 Ga0070662_1000125556 177
551 3300005457 Ga0070662_100050321 Ga0070662_1000503214 177
552 3300005458 Ga0070681_10030447 Ga0070681_100304477 177
553 3300005458 Ga0070681_10128861 Ga0070681_101288615 177
554 3300005458 Ga0070681_10227043 Ga0070681_102270433 177
555 3300005459 Ga0068867_100006857 Ga0068867_1000068579 177
556 3300005459 Ga0068867_100064935 Ga0068867_1000649352 177
557 3300005459 Ga0068867_100140260 Ga0068867_1001402603 177
558 3300005466 Ga0070685_10001772 Ga0070685_1000177219 177
559 3300005466 Ga0070685_10010414 Ga0070685_1001041410 177
560 3300005466 Ga0070685_10033076 Ga0070685_100330765 177
561 3300005466 Ga0070685_10083878 Ga0070685_100838782 177
562 3300005471 Ga0070698_100436141 Ga0070698_1004361412 177
563 3300005530 Ga0070679_100000190 Ga0070679_10000019010 177
564 3300005530 Ga0070679_100232319 Ga0070679_1002323192 177
565 3300005530 Ga0070679_101322433 Ga0070679_1013224331 177
566 3300005535 Ga0070684_100022207 Ga0070684_1000222078 177
567 3300005535 Ga0070684_100024915 Ga0070684_1000249153 177
568 3300005535 Ga0070684_100107233 Ga0070684_1001072333 177
569 3300005535 Ga0070684_100180116 Ga0070684_1001801163 177
570 3300005539 Ga0068853_100011462 Ga0068853_1000114626 177
571 3300005539 Ga0068853_100044541 Ga0068853_1000445416 177
572 3300005539 Ga0068853_100209649 Ga0068853_1002096494 177
573 3300005539 Ga0068853_100217776 Ga0068853_1002177761 177
574 3300005539 Ga0068853_100247124 Ga0068853_1002471243 177
575 3300005539 Ga0068853_100329816 Ga0068853_1003298162 177
576 3300005543 Ga0070672_100336465 Ga0070672_1003364652 177
577 3300005543 Ga0070672_100508960 Ga0070672_1005089601 177
578 3300005544 Ga0070686_100022071 Ga0070686_1000220715 177
579 3300005544 Ga0070686_100539234 Ga0070686_1005392341 177
580 3300005545 Ga0070695_100036224 Ga0070695_1000362243 177
581 3300005547 Ga0070693_100002598 Ga0070693_10000259815 177
582 3300005547 Ga0070693_100005222 Ga0070693_1000052229 177
583 3300005547 Ga0070693_100032488 Ga0070693_1000324885 177
584 3300005547 Ga0070693_100055837 Ga0070693_1000558374 177
585 3300005547 Ga0070693_100386568 Ga0070693_1003865681 177
586 3300005548 Ga0070665_100000022 Ga0070665_100000022391 177
587 3300005548 Ga0070665_100206783 Ga0070665_1002067833 177
588 3300005549 Ga0070704_100108839 Ga0070704_1001088395 177
589 3300005563 Ga0068855_100047827 Ga0068855_1000478272 177
590 3300005563 Ga0068855_100178483 Ga0068855_1001784833 177
591 3300005563 Ga0068855_100279670 Ga0068855_1002796703 177
592 3300005563 Ga0068855_100993881 Ga0068855_1009938811 177
593 3300005564 Ga0070664_100020446 Ga0070664_1000204466 177
594 3300005564 Ga0070664_100347635 Ga0070664_1003476352 177
595 3300005577 Ga0068857_100002203 Ga0068857_1000022034 177
596 3300005577 Ga0068857_100083374 Ga0068857_1000833744 177
597 3300005577 Ga0068857_100180038 Ga0068857_1001800384 177
598 3300005577 Ga0068857_100369462 Ga0068857_1003694623 177
599 3300005578 Ga0068854_100000939 Ga0068854_10000093921 177
600 3300005578 Ga0068854_100005645 Ga0068854_1000056455 177
601 3300005578 Ga0068854_100067138 Ga0068854_1000671384 177
602 3300005578 Ga0068854_100130717 Ga0068854_1001307174 177
603 3300005578 Ga0068854_100275376 Ga0068854_1002753762 177
604 3300005614 Ga0068856_100007857 Ga0068856_10000785714 177
605 3300005614 Ga0068856_100032988 Ga0068856_10003298810 177
606 3300005614 Ga0068856_100058414 Ga0068856_1000584141 177
607 3300005614 Ga0068856_100174813 Ga0068856_1001748131 177
608 3300005614 Ga0068856_100195146 Ga0068856_1001951464 177
609 3300005614 Ga0068856_100437144 Ga0068856_1004371442 177
610 3300005615 Ga0070702_100010103 Ga0070702_1000101039 177
611 3300005615 Ga0070702_100025867 Ga0070702_1000258671 177
612 3300005615 Ga0070702_100097970 Ga0070702_1000979702 177
613 3300005615 Ga0070702_100141916 Ga0070702_1001419163 177
614 3300005616 Ga0068852_100001042 Ga0068852_1000010423 177
615 3300005616 Ga0068852_100008410 Ga0068852_10000841012 177
616 3300005616 Ga0068852_100044592 Ga0068852_1000445925 177
617 3300005617 Ga0068859_100281472 Ga0068859_1002814723 177
618 3300005617 Ga0068859_100284381 Ga0068859_1002843814 177
619 3300005618 Ga0068864_100082274 Ga0068864_1000822747 177
620 3300005618 Ga0068864_100097001 Ga0068864_1000970015 177
621 3300005618 Ga0068864_100178344 Ga0068864_1001783442 177
622 3300005718 Ga0068866_10012947 Ga0068866_100129473 177
623 3300005718 Ga0068866_10042370 Ga0068866_100423703 177
624 3300005718 Ga0068866_10110638 Ga0068866_101106382 177
625 3300005718 Ga0068866_10134589 Ga0068866_101345891 177
626 3300005719 Ga0068861_100213707 Ga0068861_1002137072 177
627 3300005719 Ga0068861_100214600 Ga0068861_1002146002 177
628 3300005719 Ga0068861_100528701 Ga0068861_1005287012 177
629 3300005834 Ga0068851_10017683 Ga0068851_100176834 177
630 3300005834 Ga0068851_10063119 Ga0068851_100631194 177
631 3300005834 Ga0068851_10259012 Ga0068851_102590122 177
632 3300005834 Ga0068851_10537491 Ga0068851_105374911 177
633 3300005840 Ga0068870_10157767 Ga0068870_101577672 177
634 3300005840 Ga0068870_10684856 Ga0068870_106848562 177
635 3300005841 Ga0068863_100022829 Ga0068863_10002282911 177
636 3300005841 Ga0068863_100401959 Ga0068863_1004019592 177
637 3300005842 Ga0068858_100000150 Ga0068858_10000015026 177
638 3300005842 Ga0068858_100000287 Ga0068858_10000028726 177
639 3300005842 Ga0068858_100042254 Ga0068858_1000422549 177
640 3300005842 Ga0068858_100212734 Ga0068858_1002127344 177
641 3300005842 Ga0068858_100284152 Ga0068858_1002841523 177
642 3300005842 Ga0068858_100454298 Ga0068858_1004542982 177
643 3300005843 Ga0068860_100187700 Ga0068860_1001877004 177
644 3300005843 Ga0068860_100230527 Ga0068860_1002305273 177
645 3300005843 Ga0068860_100521315 Ga0068860_1005213152 177
646 3300005843 Ga0068860_100910753 Ga0068860_1009107532 177
647 3300005844 Ga0068862_100001247 Ga0068862_10000124714 177
648 3300005844 Ga0068862_100085173 Ga0068862_1000851734 177
649 3300005844 Ga0068862_100223998 Ga0068862_1002239982 177
650 3300005844 Ga0068862_100366143 Ga0068862_1003661432 177
651 3300005844 Ga0068862_101456934 Ga0068862_1014569341 177
652 3300005937 Ga0081455_10006416 Ga0081455_1000641610 177
653 3300005937 Ga0081455_10012340 Ga0081455_100123406 177
654 3300005937 Ga0081455_10021974 Ga0081455_100219742 177
655 3300005937 Ga0081455_10025075 Ga0081455_100250752 177
656 3300005937 Ga0081455_10073187 Ga0081455_100731876 177
657 3300005937 Ga0081455_10128075 Ga0081455_101280752 177
658 3300005937 Ga0081455_10236680 Ga0081455_102366802 177
659 3300005937 Ga0081455_10307183 Ga0081455_103071831 177
660 3300005937 Ga0081455_10745981 Ga0081455_107459811 177
661 3300005981 Ga0081538_10000208 Ga0081538_1000020850 177
662 3300005981 Ga0081538_10000396 Ga0081538_1000039622 177
663 3300005981 Ga0081538_10017543 Ga0081538_100175434 177
664 3300005981 Ga0081538_10026960 Ga0081538_100269602 177
665 3300005981 Ga0081538_10031480 Ga0081538_100314803 177
666 3300005981 Ga0081538_10054863 Ga0081538_100548633 177
667 3300005983 Ga0081540_1000281 Ga0081540_100028158 177
668 3300005983 Ga0081540_1000553 Ga0081540_100055330 177
669 3300005983 Ga0081540_1037072 Ga0081540_10370724 177
670 3300005985 Ga0081539_10002195 Ga0081539_1000219527 177
671 3300005985 Ga0081539_10079529 Ga0081539_100795292 177
672 3300006028 Ga0070717_10546230 Ga0070717_105462302 177
673 3300006038 Ga0075365_10048694 Ga0075365_100486943 177
674 3300006048 Ga0075363_100009790 Ga0075363_1000097901 177
675 3300006048 Ga0075363_100089279 Ga0075363_1000892793 177
676 3300006048 Ga0075363_100109474 Ga0075363_1001094742 177
677 3300006051 Ga0075364_10143065 Ga0075364_101430653 177
678 3300006163 Ga0070715_10169092 Ga0070715_101690922 177
679 3300006175 Ga0070712_100088319 Ga0070712_1000883193 177
680 3300006175 Ga0070712_100150232 Ga0070712_1001502322 177
681 3300006175 Ga0070712_100257000 Ga0070712_1002570003 177
682 3300006178 Ga0075367_10154198 Ga0075367_101541983 177
683 3300006178 Ga0075367_10170497 Ga0075367_101704973 177
684 3300006237 Ga0097621_100048344 Ga0097621_1000483446 177
685 3300006237 Ga0097621_100116173 Ga0097621_1001161732 177
686 3300006237 Ga0097621_100225765 Ga0097621_1002257653 177
687 3300006237 Ga0097621_100876354 Ga0097621_1008763542 177
688 3300006358 Ga0068871_100016147 Ga0068871_1000161475 177
689 3300006358 Ga0068871_100063004 Ga0068871_1000630048 177
690 3300006358 Ga0068871_100745261 Ga0068871_1007452612 177
691 3300006844 Ga0075428_100046826 Ga0075428_1000468266 177
692 3300006846 Ga0075430_100049708 Ga0075430_1000497083 177
693 3300006846 Ga0075430_100051923 Ga0075430_1000519233 177
694 3300006847 Ga0075431_100008449 Ga0075431_1000084496 177
695 3300006847 Ga0075431_100119473 Ga0075431_1001194734 177
696 3300006852 Ga0075433_10199216 Ga0075433_101992164 177
697 3300006871 Ga0075434_100007021 Ga0075434_10000702110 177
698 3300006871 Ga0075434_100040672 Ga0075434_1000406723 177
699 3300006871 Ga0075434_100289492 Ga0075434_1002894923 177
700 3300006881 Ga0068865_100000056 Ga0068865_1000000563 177
701 3300006881 Ga0068865_100047901 Ga0068865_1000479013 177
702 3300006881 Ga0068865_100342588 Ga0068865_1003425882 177
703 3300006931 Ga0097620_100281502 Ga0097620_1002815023 177
704 3300006931 Ga0097620_100284382 Ga0097620_1002843824 177
705 3300007076 Ga0075435_100011052 Ga0075435_10001105210 177
706 3300007076 Ga0075435_100064160 Ga0075435_1000641605 177
707 3300009093 Ga0105240_10311681 Ga0105240_103116812 177
708 3300009093 Ga0105240_10758720 Ga0105240_107587202 177
709 3300009094 Ga0111539_10046654 Ga0111539_100466543 177
710 3300009094 Ga0111539_10124228 Ga0111539_101242286 177
711 3300009094 Ga0111539_10502947 Ga0111539_105029473 177
712 3300009094 Ga0111539_10790485 Ga0111539_107904852 177
713 3300009094 Ga0111539_12768004 Ga0111539_127680041 177
714 3300009098 Ga0105245_10000528 Ga0105245_1000052831 177
715 3300009098 Ga0105245_10003202 Ga0105245_1000320220 177
716 3300009098 Ga0105245_10006370 Ga0105245_1000637016 177
717 3300009098 Ga0105245_10011993 Ga0105245_100119932 177
718 3300009098 Ga0105245_10028801 Ga0105245_1002880110 177
719 3300009098 Ga0105245_10051809 Ga0105245_100518094 177
720 3300009098 Ga0105245_10118112 Ga0105245_101181124 177
721 3300009101 Ga0105247_10068106 Ga0105247_100681062 177
722 3300009101 Ga0105247_10079500 Ga0105247_100795002 177
723 3300009101 Ga0105247_10884445 Ga0105247_108844452 177
724 3300009147 Ga0114129_10038141 Ga0114129_100381416 177
725 3300009147 Ga0114129_10055173 Ga0114129_100551736 177
726 3300009147 Ga0114129_10300349 Ga0114129_103003495 177
727 3300009147 Ga0114129_10727935 Ga0114129_107279352 177
728 3300009147 Ga0114129_10791523 Ga0114129_107915233 177
729 3300009148 Ga0105243_10009298 Ga0105243_100092982 177
730 3300009148 Ga0105243_10151802 Ga0105243_101518024 177
731 3300009148 Ga0105243_10356194 Ga0105243_103561942 177
732 3300009174 Ga0105241_10156143 Ga0105241_101561433 177
733 3300009174 Ga0105241_10331739 Ga0105241_103317393 177
734 3300009174 Ga0105241_10380953 Ga0105241_103809533 177
735 3300009174 Ga0105241_11619825 Ga0105241_116198251 177
736 3300009176 Ga0105242_10003277 Ga0105242_100032778 177
737 3300009176 Ga0105242_10015377 Ga0105242_100153779 177
738 3300009176 Ga0105242_10082853 Ga0105242_100828532 177
739 3300009176 Ga0105242_10130118 Ga0105242_101301185 177
740 3300009176 Ga0105242_10228906 Ga0105242_102289063 177
741 3300009177 Ga0105248_10001735 Ga0105248_1000173511 177
742 3300009177 Ga0105248_10065805 Ga0105248_100658058 177
743 3300009177 Ga0105248_10100212 Ga0105248_101002123 177
744 3300009177 Ga0105248_10459819 Ga0105248_104598192 177
745 3300009177 Ga0105248_10558017 Ga0105248_105580173 177
746 3300009545 Ga0105237_10059780 Ga0105237_100597804 177
747 3300009545 Ga0105237_10061198 Ga0105237_100611982 177
748 3300009545 Ga0105237_10216807 Ga0105237_102168071 177
749 3300009551 Ga0105238_10067131 Ga0105238_100671316 177
750 3300009551 Ga0105238_10131331 Ga0105238_101313314 177
751 3300009551 Ga0105238_10153585 Ga0105238_101535853 177
752 3300009551 Ga0105238_10172824 Ga0105238_101728242 177
753 3300009551 Ga0105238_10520702 Ga0105238_105207021 177
754 3300009553 Ga0105249_10000181 Ga0105249_1000018180 177
755 3300009553 Ga0105249_10003640 Ga0105249_1000364019 177
756 3300009553 Ga0105249_10020972 Ga0105249_100209727 177
757 3300009553 Ga0105249_10044378 Ga0105249_100443786 177
758 3300009553 Ga0105249_10304613 Ga0105249_103046134 177
759 3300009553 Ga0105249_10415983 Ga0105249_104159832 177
760 3300009553 Ga0105249_10429359 Ga0105249_104293594 177
761 3300010375 Ga0105239_10024932 Ga0105239_100249323 177
762 3300010375 Ga0105239_10063402 Ga0105239_100634024 177
763 3300010375 Ga0105239_10142086 Ga0105239_101420865 177
764 3300010375 Ga0105239_10161441 Ga0105239_101614412 177
765 3300010375 Ga0105239_10162422 Ga0105239_101624223 177
766 3300010375 Ga0105239_10189923 Ga0105239_101899234 177
767 3300010375 Ga0105239_10225732 Ga0105239_102257324 177
768 3300010375 Ga0105239_10617371 Ga0105239_106173713 177
769 3300010375 Ga0105239_11423915 Ga0105239_114239152 177
770 3300011119 Ga0105246_10023148 Ga0105246_100231489 177
771 3300011119 Ga0105246_10036447 Ga0105246_100364475 177
772 3300013059 Ga0154012_155380 Ga0154012_1553801 177
773 3300013102 Ga0157371_10017630 Ga0157371_100176305 177
774 3300013102 Ga0157371_10100010 Ga0157371_101000102 177
775 3300013102 Ga0157371_10791850 Ga0157371_107918501 177
776 3300013104 Ga0157370_10411144 Ga0157370_104111443 177
777 3300013105 Ga0157369_10000068 Ga0157369_10000068139 177
778 3300013105 Ga0157369_10155965 Ga0157369_101559651 177
779 3300013105 Ga0157369_10223079 Ga0157369_102230795 177
780 3300013105 Ga0157369_10308657 Ga0157369_103086574 177
781 3300013105 Ga0157369_11052111 Ga0157369_110521111 177
782 3300013296 Ga0157374_10049184 Ga0157374_100491843 177
783 3300013296 Ga0157374_10389560 Ga0157374_103895602 177
784 3300013296 Ga0157374_10449298 Ga0157374_104492983 177
785 3300013297 Ga0157378_10036743 Ga0157378_100367433 177
786 3300013306 Ga0163162_10234909 Ga0163162_102349094 177
787 3300013306 Ga0163162_10392910 Ga0163162_103929103 177
788 3300013306 Ga0163162_10726749 Ga0163162_107267493 177
789 3300013306 Ga0163162_10997519 Ga0163162_109975192 177
790 3300013306 Ga0163162_11150743 Ga0163162_111507432 177
791 3300013307 Ga0157372_10000809 Ga0157372_1000080918 177
792 3300013307 Ga0157372_10043850 Ga0157372_1004385010 177
793 3300013307 Ga0157372_10144542 Ga0157372_101445422 177
794 3300013307 Ga0157372_10333254 Ga0157372_103332541 177
795 3300013307 Ga0157372_11605889 Ga0157372_116058892 177
796 3300013308 Ga0157375_10062797 Ga0157375_100627972 177
797 3300013308 Ga0157375_10505993 Ga0157375_105059934 177
798 3300013308 Ga0157375_10586201 Ga0157375_105862011 177
799 3300014325 Ga0163163_10161117 Ga0163163_101611172 177
800 3300014325 Ga0163163_10197945 Ga0163163_101979453 177
801 3300014325 Ga0163163_10930423 Ga0163163_109304232 177
802 3300014325 Ga0163163_11942625 Ga0163163_119426251 177
803 3300014326 Ga0157380_10000808 Ga0157380_1000080826 177
804 3300014326 Ga0157380_10010840 Ga0157380_100108406 177
805 3300014326 Ga0157380_10354710 Ga0157380_103547102 177
806 3300014745 Ga0157377_10005570 Ga0157377_1000557010 177
807 3300014745 Ga0157377_10055609 Ga0157377_100556094 177
808 3300014968 Ga0157379_10035775 Ga0157379_100357753 177
809 3300014968 Ga0157379_10036674 Ga0157379_100366749 177
810 3300014968 Ga0157379_10151797 Ga0157379_101517974 177
811 3300014968 Ga0157379_10317800 Ga0157379_103178002 177
812 3300014968 Ga0157379_10331925 Ga0157379_103319253 177
813 3300014968 Ga0157379_10453386 Ga0157379_104533863 177
814 3300014969 Ga0157376_10068638 Ga0157376_100686385 177
815 3300014969 Ga0157376_10171187 Ga0157376_101711871 177
816 3300014969 Ga0157376_10190310 Ga0157376_101903103 177
817 3300014969 Ga0157376_10202240 Ga0157376_102022404 177
818 3300017792 Ga0163161_10026094 Ga0163161_100260942 177
819 3300020069 Ga0197907_10374124 Ga0197907_103741242 177
820 3300020069 Ga0197907_10806034 Ga0197907_108060343 177
821 3300020070 Ga0206356_10172704 Ga0206356_101727044 177
822 3300020070 Ga0206356_10263773 Ga0206356_102637732 177
823 3300020075 Ga0206349_1180813 Ga0206349_11808133 177
824 3300020076 Ga0206355_1489689 Ga0206355_14896894 177
825 3300020078 Ga0206352_10514711 Ga0206352_105147114 177
826 3300020080 Ga0206350_10478609 Ga0206350_104786093 177
827 3300020080 Ga0206350_10883997 Ga0206350_108839972 177
828 3300020081 Ga0206354_10637918 Ga0206354_106379184 177
829 3300020082 Ga0206353_10631379 Ga0206353_106313792 177
830 3300020082 Ga0206353_11748998 Ga0206353_117489984 177
831 3300021358 Ga0213873_10000029 Ga0213873_1000002929 177
832 3300021384 Ga0213876_10020166 Ga0213876_100201668 177
833 3300021384 Ga0213876_10040339 Ga0213876_100403392 177
834 3300021388 Ga0213875_10000107 Ga0213875_1000010743 177
835 3300022467 Ga0224712_10001255 Ga0224712_100012554 177
836 3300022467 Ga0224712_10001920 Ga0224712_100019207 177
837 3300022467 Ga0224712_10030109 Ga0224712_100301093 177
838 3300022467 Ga0224712_10203812 Ga0224712_102038122 177
839 3300025315 Ga0207697_10111218 Ga0207697_101112181 177
840 3300025321 Ga0207656_10001578 Ga0207656_100015785 177
841 3300025321 Ga0207656_10015654 Ga0207656_100156544 177
842 3300025899 Ga0207642_10001731 Ga0207642_100017316 177
843 3300025899 Ga0207642_10016604 Ga0207642_100166045 177
844 3300025899 Ga0207642_10278862 Ga0207642_102788622 177
845 3300025900 Ga0207710_10049726 Ga0207710_100497263 177
846 3300025900 Ga0207710_10058926 Ga0207710_100589264 177
847 3300025901 Ga0207688_10003165 Ga0207688_1000316511 177
848 3300025901 Ga0207688_10006351 Ga0207688_100063517 177
849 3300025901 Ga0207688_10013562 Ga0207688_100135622 177
850 3300025903 Ga0207680_10077588 Ga0207680_100775881 177
851 3300025903 Ga0207680_10725882 Ga0207680_107258822 177
852 3300025904 Ga0207647_10072100 Ga0207647_100721002 177
853 3300025904 Ga0207647_10179056 Ga0207647_101790562 177
854 3300025905 Ga0207685_10142126 Ga0207685_101421262 177
855 3300025908 Ga0207643_10090540 Ga0207643_100905403 177
856 3300025908 Ga0207643_10197574 Ga0207643_101975742 177
857 3300025908 Ga0207643_10708799 Ga0207643_107087992 177
858 3300025909 Ga0207705_10073917 Ga0207705_100739174 177
859 3300025909 Ga0207705_10159270 Ga0207705_101592704 177
860 3300025909 Ga0207705_10783522 Ga0207705_107835222 177
861 3300025911 Ga0207654_10018225 Ga0207654_100182253 177
862 3300025911 Ga0207654_10465371 Ga0207654_104653711 177
863 3300025912 Ga0207707_10023272 Ga0207707_100232724 177
864 3300025913 Ga0207695_10053583 Ga0207695_100535834 177
865 3300025913 Ga0207695_10827714 Ga0207695_108277142 177
866 3300025914 Ga0207671_10073969 Ga0207671_100739693 177
867 3300025915 Ga0207693_10012090 Ga0207693_100120907 177
868 3300025915 Ga0207693_10033589 Ga0207693_100335896 177
869 3300025915 Ga0207693_10108337 Ga0207693_101083372 177
870 3300025917 Ga0207660_10175795 Ga0207660_101757952 177
871 3300025917 Ga0207660_10229768 Ga0207660_102297684 177
872 3300025918 Ga0207662_10068507 Ga0207662_100685073 177
873 3300025918 Ga0207662_10295167 Ga0207662_102951672 177
874 3300025919 Ga0207657_10001826 Ga0207657_100018265 177
875 3300025919 Ga0207657_10006521 Ga0207657_1000652118 177
876 3300025919 Ga0207657_10057557 Ga0207657_100575579 177
877 3300025920 Ga0207649_10000166 Ga0207649_100001664 177
878 3300025921 Ga0207652_10000242 Ga0207652_1000024219 177
879 3300025921 Ga0207652_10061664 Ga0207652_100616643 177
880 3300025921 Ga0207652_10580586 Ga0207652_105805861 177
881 3300025924 Ga0207694_10006100 Ga0207694_1000610015 177
882 3300025924 Ga0207694_10092117 Ga0207694_100921173 177
883 3300025924 Ga0207694_10140636 Ga0207694_101406362 177
884 3300025924 Ga0207694_10396218 Ga0207694_103962183 177
885 3300025925 Ga0207650_10151787 Ga0207650_101517872 177
886 3300025925 Ga0207650_10173283 Ga0207650_101732831 177
887 3300025926 Ga0207659_10084754 Ga0207659_100847545 177
888 3300025926 Ga0207659_10162720 Ga0207659_101627201 177
889 3300025926 Ga0207659_11132238 Ga0207659_111322381 177
890 3300025927 Ga0207687_10000025 Ga0207687_1000002525 177
891 3300025927 Ga0207687_10000132 Ga0207687_1000013238 177
892 3300025927 Ga0207687_10000332 Ga0207687_1000033224 177
893 3300025927 Ga0207687_10002690 Ga0207687_1000269012 177
894 3300025927 Ga0207687_10017439 Ga0207687_1001743910 177
895 3300025927 Ga0207687_10713360 Ga0207687_107133602 177
896 3300025927 Ga0207687_11115275 Ga0207687_111152751 177
897 3300025928 Ga0207700_10000019 Ga0207700_10000019181 177
898 3300025929 Ga0207664_10017195 Ga0207664_100171956 177
899 3300025929 Ga0207664_10111635 Ga0207664_101116351 177
900 3300025929 Ga0207664_10203949 Ga0207664_102039493 177
901 3300025931 Ga0207644_10081707 Ga0207644_100817075 177
902 3300025931 Ga0207644_10249849 Ga0207644_102498492 177
903 3300025932 Ga0207690_10012718 Ga0207690_100127186 177
904 3300025932 Ga0207690_10018842 Ga0207690_100188422 177
905 3300025932 Ga0207690_10057954 Ga0207690_100579542 177
906 3300025932 Ga0207690_10064977 Ga0207690_100649774 177
907 3300025933 Ga0207706_10010003 Ga0207706_100100036 177
908 3300025933 Ga0207706_10038324 Ga0207706_100383246 177
909 3300025933 Ga0207706_10061710 Ga0207706_100617101 177
910 3300025933 Ga0207706_11129644 Ga0207706_111296442 177
911 3300025934 Ga0207686_10001614 Ga0207686_1000161417 177
912 3300025934 Ga0207686_10033231 Ga0207686_100332314 177
913 3300025935 Ga0207709_10113945 Ga0207709_101139453 177
914 3300025935 Ga0207709_10145220 Ga0207709_101452202 177
915 3300025935 Ga0207709_10183989 Ga0207709_101839893 177
916 3300025935 Ga0207709_10347456 Ga0207709_103474562 177
917 3300025936 Ga0207670_10344528 Ga0207670_103445283 177
918 3300025936 Ga0207670_10553904 Ga0207670_105539042 177
919 3300025937 Ga0207669_10004557 Ga0207669_100045578 177
920 3300025937 Ga0207669_10269841 Ga0207669_102698411 177
921 3300025937 Ga0207669_10282036 Ga0207669_102820363 177
922 3300025937 Ga0207669_10308753 Ga0207669_103087532 177
923 3300025938 Ga0207704_10000308 Ga0207704_1000030820 177
924 3300025938 Ga0207704_10028005 Ga0207704_100280053 177
925 3300025938 Ga0207704_10032037 Ga0207704_100320372 177
926 3300025938 Ga0207704_10043014 Ga0207704_100430142 177
927 3300025939 Ga0207665_10006238 Ga0207665_100062386 177
928 3300025940 Ga0207691_10051899 Ga0207691_100518992 177
929 3300025940 Ga0207691_10296099 Ga0207691_102960993 177
930 3300025941 Ga0207711_10000011 Ga0207711_1000001138 177
931 3300025941 Ga0207711_10035265 Ga0207711_100352656 177
932 3300025941 Ga0207711_10180575 Ga0207711_101805752 177
933 3300025941 Ga0207711_10708492 Ga0207711_107084921 177
934 3300025941 Ga0207711_10799925 Ga0207711_107999251 177
935 3300025942 Ga0207689_10034455 Ga0207689_100344556 177
936 3300025942 Ga0207689_10212854 Ga0207689_102128544 177
937 3300025942 Ga0207689_10951246 Ga0207689_109512461 177
938 3300025944 Ga0207661_10002864 Ga0207661_1000286419 177
939 3300025944 Ga0207661_10046081 Ga0207661_100460812 177
940 3300025944 Ga0207661_10075445 Ga0207661_100754452 177
941 3300025944 Ga0207661_10086229 Ga0207661_100862295 177
942 3300025944 Ga0207661_10158506 Ga0207661_101585063 177
943 3300025944 Ga0207661_10406912 Ga0207661_104069122 177
944 3300025944 Ga0207661_10940006 Ga0207661_109400062 177
945 3300025945 Ga0207679_10006381 Ga0207679_100063819 177
946 3300025945 Ga0207679_10438763 Ga0207679_104387632 177
947 3300025945 Ga0207679_10707905 Ga0207679_107079052 177
948 3300025949 Ga0207667_10500452 Ga0207667_105004522 177
949 3300025949 Ga0207667_10578982 Ga0207667_105789821 177
950 3300025949 Ga0207667_10676677 Ga0207667_106766772 177
951 3300025961 Ga0207712_10003459 Ga0207712_100034593 177
952 3300025961 Ga0207712_10176641 Ga0207712_101766414 177
953 3300025961 Ga0207712_10426927 Ga0207712_104269272 177
954 3300025972 Ga0207668_10002563 Ga0207668_1000256316 177
955 3300025972 Ga0207668_10125124 Ga0207668_101251243 177
956 3300025972 Ga0207668_10354899 Ga0207668_103548993 177
957 3300025981 Ga0207640_10000821 Ga0207640_100008216 177
958 3300025981 Ga0207640_10045237 Ga0207640_100452374 177
959 3300025981 Ga0207640_10092534 Ga0207640_100925345 177
960 3300025981 Ga0207640_10130092 Ga0207640_101300923 177
961 3300025986 Ga0207658_10000840 Ga0207658_1000084024 177
962 3300025986 Ga0207658_10075552 Ga0207658_100755522 177
963 3300025986 Ga0207658_10235231 Ga0207658_102352314 177
964 3300025986 Ga0207658_10235938 Ga0207658_102359383 177
965 3300025986 Ga0207658_10367480 Ga0207658_103674803 177
966 3300025986 Ga0207658_10507298 Ga0207658_105072982 177
967 3300026023 Ga0207677_10001476 Ga0207677_1000147610 177
968 3300026023 Ga0207677_10006465 Ga0207677_1000646511 177
969 3300026023 Ga0207677_10089682 Ga0207677_100896822 177
970 3300026023 Ga0207677_10153421 Ga0207677_101534214 177
971 3300026035 Ga0207703_10000122 Ga0207703_1000012285 177
972 3300026035 Ga0207703_10001133 Ga0207703_1000113326 177
973 3300026035 Ga0207703_10038713 Ga0207703_100387136 177
974 3300026035 Ga0207703_10080329 Ga0207703_100803296 177
975 3300026035 Ga0207703_10085920 Ga0207703_100859204 177
976 3300026035 Ga0207703_10387407 Ga0207703_103874072 177
977 3300026041 Ga0207639_10024085 Ga0207639_100240851 177
978 3300026041 Ga0207639_10038539 Ga0207639_100385392 177
979 3300026041 Ga0207639_10220990 Ga0207639_102209903 177
980 3300026041 Ga0207639_10395364 Ga0207639_103953642 177
981 3300026041 Ga0207639_11319629 Ga0207639_113196291 177
982 3300026067 Ga0207678_10013734 Ga0207678_1001373410 177
983 3300026067 Ga0207678_10418263 Ga0207678_104182632 177
984 3300026067 Ga0207678_10844560 Ga0207678_108445601 177
985 3300026075 Ga0207708_10020783 Ga0207708_100207836 177
986 3300026075 Ga0207708_10051542 Ga0207708_100515423 177
987 3300026075 Ga0207708_10062091 Ga0207708_100620914 177
988 3300026075 Ga0207708_10236466 Ga0207708_102364662 177
989 3300026075 Ga0207708_10306002 Ga0207708_103060023 177
990 3300026075 Ga0207708_10592652 Ga0207708_105926522 177
991 3300026078 Ga0207702_10002042 Ga0207702_100020424 177
992 3300026078 Ga0207702_10046943 Ga0207702_100469431 177
993 3300026078 Ga0207702_10055370 Ga0207702_100553704 177
994 3300026078 Ga0207702_10252572 Ga0207702_102525722 177
995 3300026078 Ga0207702_10260642 Ga0207702_102606422 177
996 3300026078 Ga0207702_11693933 Ga0207702_116939331 177
997 3300026088 Ga0207641_10016220 Ga0207641_100162203 177
998 3300026088 Ga0207641_10293407 Ga0207641_102934072 177
999 3300026088 Ga0207641_11405485 Ga0207641_114054851 177
1000 3300026089 Ga0207648_10004057 Ga0207648_100040574 177
1001 3300026089 Ga0207648_10013324 Ga0207648_1001332411 177
1002 3300026089 Ga0207648_10035378 Ga0207648_100353787 177
1003 3300026089 Ga0207648_10113415 Ga0207648_101134152 177
1004 3300026089 Ga0207648_10388551 Ga0207648_103885514 177
1005 3300026095 Ga0207676_10078386 Ga0207676_100783865 177
1006 3300026095 Ga0207676_10185697 Ga0207676_101856971 177
1007 3300026095 Ga0207676_10784883 Ga0207676_107848832 177
1008 3300026116 Ga0207674_10006903 Ga0207674_100069036 177
1009 3300026116 Ga0207674_10033290 Ga0207674_100332908 177
1010 3300026118 Ga0207675_100064910 Ga0207675_1000649104 177
1011 3300026118 Ga0207675_100137578 Ga0207675_1001375784 177
1012 3300026118 Ga0207675_100633580 Ga0207675_1006335802 177
1013 3300026121 Ga0207683_10042517 Ga0207683_100425179 177
1014 3300026121 Ga0207683_10107504 Ga0207683_101075044 177
1015 3300026121 Ga0207683_10123809 Ga0207683_101238092 177
1016 3300026142 Ga0207698_10000014 Ga0207698_1000001456 177
1017 3300026142 Ga0207698_10033531 Ga0207698_100335314 177
1018 3300026142 Ga0207698_10067783 Ga0207698_100677835 177
1019 3300026142 Ga0207698_10145954 Ga0207698_101459542 177
1020 3300026142 Ga0207698_10222758 Ga0207698_102227583 177
1021 3300026142 Ga0207698_10394392 Ga0207698_103943922 177
1022 3300026142 Ga0207698_10719489 Ga0207698_107194892 177
1023 3300027866 Ga0209813_10086401 Ga0209813_100864012 177
1024 3300027907 Ga0207428_10266213 Ga0207428_102662133 177
1025 3300028379 Ga0268266_10000029 Ga0268266_1000002964 177
1026 3300028379 Ga0268266_10001628 Ga0268266_1000162818 177
1027 3300028379 Ga0268266_10027445 Ga0268266_100274458 177
1028 3300028379 Ga0268266_10187682 Ga0268266_101876822 177
1029 3300028379 Ga0268266_10200233 Ga0268266_102002332 177
1030 3300028379 Ga0268266_10260429 Ga0268266_102604294 177
1031 3300028380 Ga0268265_10000667 Ga0268265_1000066733 177
1032 3300028380 Ga0268265_10064910 Ga0268265_100649104 177
1033 3300028381 Ga0268264_10098144 Ga0268264_100981443 177
1034 3300028381 Ga0268264_10111100 Ga0268264_101111006 177
1035 3300028381 Ga0268264_10199127 Ga0268264_101991272 177
1036 3300028381 Ga0268264_10715754 Ga0268264_107157542 177
1037 3300028563 Ga0265319_1000030 Ga0265319_100003049 177
1038 3300028800 Ga0265338_10000156 Ga0265338_1000015649 177
1039 3300028800 Ga0265338_10006510 Ga0265338_1000651019 177
1040 3300030521 Ga0307511_10243532 Ga0307511_102435321 177
1041 3300031241 Ga0265325_10024792 Ga0265325_100247927 177
1042 3300031251 Ga0265327_10006243 Ga0265327_100062435 177
1043 3300031507 Ga0307509_10009247 Ga0307509_100092475 177
1044 3300031691 Ga0316579_10093934 Ga0316579_100939343 177
1045 3300031727 Ga0316576_10623254 Ga0316576_106232541 177
1046 3300031727 Ga0316576_10722834 Ga0316576_107228341 177
1047 3300031728 Ga0316578_10071340 Ga0316578_100713401 177
1048 3300031728 Ga0316578_10347904 Ga0316578_103479042 177
1049 3300031852 Ga0307410_10125302 Ga0307410_101253023 177
1050 3300031901 Ga0307406_10234510 Ga0307406_102345103 177
1051 3300032002 Ga0307416_100399734 Ga0307416_1003997341 177
1052 3300032002 Ga0307416_101299659 Ga0307416_1012996592 177
1053 3300032005 Ga0307411_10229543 Ga0307411_102295432 177
1054 3300032126 Ga0307415_100173979 Ga0307415_1001739791 177
1055 3300032126 Ga0307415_100574418 Ga0307415_1005744183 177
1056 3300032133 Ga0316583_10212997 Ga0316583_102129972 177
1057 3300032137 Ga0316585_10046937 Ga0316585_100469373 177
1058 3300032168 Ga0316593_10000042 Ga0316593_1000004212 177
1059 3300032168 Ga0316593_10000090 Ga0316593_1000009012 177
1060 3300032168 Ga0316593_10014395 Ga0316593_100143953 177
1061 3300032168 Ga0316593_10047889 Ga0316593_100478893 177
1062 3300032168 Ga0316593_10058929 Ga0316593_100589292 177
1063 3300032168 Ga0316593_10078429 Ga0316593_100784291 177
1064 3300032168 Ga0316593_10096505 Ga0316593_100965052 177
1065 3300033524 Ga0316592_1001276 Ga0316592_10012767 177
1066 3300033524 Ga0316592_1073005 Ga0316592_10730052 177
1067 3300033527 Ga0316586_1003876 Ga0316586_10038762 177
1068 3300033541 Ga0316596_1016809 Ga0316596_10168091 177
1069 3300033541 Ga0316596_1068827 Ga0316596_10688272 177
1070 3300035086 Ga0373934_0016127 Ga0373934_0016127_1804_2337 177
1071 3300035089 Ga0373944_0023014 Ga0373944_0023014_730_1263 177
1072 3300035092 Ga0373952_0122477 Ga0373952_0122477_97_630 177
1073 3300035113 Ga0373936_0019812 Ga0373936_0019812_1693_2226 177
1074 3300035117 Ga0373953_0150862 Ga0373953_0150862_302_835 177
1075 3300035118 Ga0373954_0049735 Ga0373954_0049735_126_659 177
1076 3300035119 Ga0373956_0020417 Ga0373956_0020417_1267_1800 177
1077 3300035172 Ga0373955_0052220 Ga0373955_0052220_541_1074 177
1078 3300035242 Ga0373962_0039136 Ga0373962_0039136_418_951 177
1079 3300035398 Ga0316574_0033631 Ga0316574_0033631_981_1514 177
1080 3300035398 Ga0316574_0038096 Ga0316574_0038096_1027_1560 177
1081 3300035398 Ga0316574_0115815 Ga0316574_0115815_418_951 177
1082 3300035410 Ga0373924_0015173 Ga0373924_0015173_64_597 177
1083 3300035691 Ga0373931_0818925 Ga0373931_0818925_31_564 177
1084 3300035692 Ga0373935_0045296 Ga0373935_0045296_1064_1597 177
1085 3300035695 Ga0373927_0022164 Ga0373927_0022164_3039_3572 177
1086 3300035724 Ga0373933_0247447 Ga0373933_0247447_349_882 177
1087 3300035725 Ga0373947_0467021 Ga0373947_0467021_64_597 177
1088 3300036401 Ga0373937_0045561 Ga0373937_0045561_2327_2860 177
1089 3300036712 Ga0316584_0028035 Ga0316584_0028035_579_1112 177
1090 3300037068 Ga0373925_0176562 Ga0373925_0176562_65_598 177
1091 3300037068 Ga0373925_0420616 Ga0373925_0420616_242_775 177
1092 3300037418 Ga0395900_0147541 Ga0395900_0147541_836_1369 177
1093 3300037418 Ga0395900_0939664 Ga0395900_0939664_74_607 177
1094 3300037466 Ga0395898_0106644 Ga0395898_0106644_212_745 177
1095 3300037466 Ga0395898_0745670 Ga0395898_0745670_27_560 177
1096 3300037471 Ga0395905_0227819 Ga0395905_0227819_379_912 177
1097 3300037471 Ga0395905_0941978 Ga0395905_0941978_134_667 177
1098 3300037853 Ga0436364_0184253 Ga0436364_0184253_794_1333 177
1099 3300037853 Ga0436364_0588322 Ga0436364_0588322_66033_66572 177
1100 3300038443 Ga0395901_0013538 Ga0395901_0013538_6990_7529 177
1101 3300038443 Ga0395901_0035304 Ga0395901_0035304_2470_3003 177
1102 3300038443 Ga0395901_0107084 Ga0395901_0107084_1831_2364 177
1103 3300038443 Ga0395901_0154202 Ga0395901_0154202_324_857 177
1104 3300038443 Ga0395901_0308540 Ga0395901_0308540_112_651 177
1105 3300038443 Ga0395901_0687863 Ga0395901_0687863_392_925 177
1106 3300038443 Ga0395901_0693074 Ga0395901_0693074_256_789 177
1107 3300039437 Ga0436365_1374876 Ga0436365_1374876_1040_1579 177
1108 3300039437 Ga0436365_1846767 Ga0436365_1846767_2362_2901 177
1109 3300039453 Ga0436362_0041472 Ga0436362_0041472_356_895 177
1110 3300039453 Ga0436362_0396626 Ga0436362_0396626_506_1045 177
1111 3300039453 Ga0436362_1138695 Ga0436362_1138695_18940_19479 177
1112 3300041453 Ga0451797_1224919 Ga0451797_1224919_183_716 177
1113 3300041486 Ga0451807_0891281 Ga0451807_0891281_314_847 177
1114 3300041496 Ga0451839_0924585 Ga0451839_0924585_151_684 177
1115 3300041512 Ga0451853_0263163 Ga0451853_0263163_371_904 177
1116 3300041512 Ga0451853_1575804 Ga0451853_1575804_431_964 177
1117 3300042001 Ga0439441_113641 Ga0439441_113641_50_583 177
1118 3300042437 Ga0439444_0132903 Ga0439444_0132903_30_563 177
1119 3300042876 Ga0451577_0252111 Ga0451577_0252111_595_1131 177
1120 3300044683 Ga0466965_0261174 Ga0466965_0261174_205_738 177
1121 3300044683 Ga0466965_0457111 Ga0466965_0457111_36_569 177
1122 3300044684 Ga0466966_0000383 Ga0466966_0000383_21493_22032 177
1123 3300044693 Ga0466961_0160350 Ga0466961_0160350_675_1214 177
1124 3300044693 Ga0466961_0516845 Ga0466961_0516845_50_589 177
1125 3300044694 Ga0466963_0009016 Ga0466963_0009016_1975_2514 177
1126 3300044694 Ga0466963_0199244 Ga0466963_0199244_542_1075 177
1127 3300044712 Ga0453684_0003980 Ga0453684_0003980_9675_10211 177
1128 3300044765 Ga0466970_0015123 Ga0466970_0015123_561_1100 177
1129 3300044842 Ga0466957_0004792 Ga0466957_0004792_5235_5768 177
1130 3300044842 Ga0466957_0009243 Ga0466957_0009243_2960_3499 177
1131 3300044842 Ga0466957_0146651 Ga0466957_0146651_453_992 177
1132 3300044901 Ga0466960_0069158 Ga0466960_0069158_398_937 177
1133 3300045049 Ga0466959_0017822 Ga0466959_0017822_2945_3484 177
1134 3300045836 Ga0466958_0000206 Ga0466958_0000206_16249_16788 177
1135 3300045836 Ga0466958_0014240 Ga0466958_0014240_2005_2538 177
1136 3300045836 Ga0466958_0113983 Ga0466958_0113983_197_736 177
1137 3300045836 Ga0466958_0369294 Ga0466958_0369294_109_648 177
1138 3300045976 Ga0466967_0000003 Ga0466967_0000003_39252_39785 177
1139 3300045976 Ga0466967_0007938 Ga0466967_0007938_6136_6675 177
1140 3300045976 Ga0466967_0054093 Ga0466967_0054093_444_983 177
1141 3300045976 Ga0466967_0074584 Ga0466967_0074584_1307_1846 177
1142 3300045976 Ga0466967_0678778 Ga0466967_0678778_129_662 177
1143 3300045976 Ga0466967_1332792 Ga0466967_1332792_44_583 177
1144 3300045976 Ga0466967_1439476 Ga0466967_1439476_59_592 177
1145 3300045976 Ga0466967_1579433 Ga0466967_1579433_40_573 177
1146 3300046454 Ga0495592_0204708 Ga0495592_0204708_776_1309 177
1147 3300046454 Ga0495592_0458285 Ga0495592_0458285_202_735 177
1148 3300046455 Ga0495603_0123208 Ga0495603_0123208_493_1026 177
1149 3300046457 Ga0495590_0092337 Ga0495590_0092337_366_899 177
1150 3300046459 Ga0495629_0004371 Ga0495629_0004371_8221_8754 177
1151 3300046459 Ga0495629_0007604 Ga0495629_0007604_2532_3065 177
1152 3300046459 Ga0495629_0047429 Ga0495629_0047429_256_789 177
1153 3300046459 Ga0495629_0106021 Ga0495629_0106021_1168_1701 177
1154 3300046459 Ga0495629_0177074 Ga0495629_0177074_819_1352 177
1155 3300046459 Ga0495629_0312652 Ga0495629_0312652_200_733 177
1156 3300046461 Ga0495641_0000400 Ga0495641_0000400_4926_5459 177
1157 3300046461 Ga0495641_0030173 Ga0495641_0030173_74_607 177
1158 3300046461 Ga0495641_0036780 Ga0495641_0036780_27_560 177
1159 3300046461 Ga0495641_0063245 Ga0495641_0063245_28_561 177
1160 3300046462 Ga0495651_0093678 Ga0495651_0093678_1029_1562 177
1161 3300046463 Ga0495653_0029693 Ga0495653_0029693_1415_1948 177
1162 3300046472 Ga0495580_0022805 Ga0495580_0022805_3852_4385 177
1163 3300046473 Ga0495582_0004746 Ga0495582_0004746_2027_2560 177
1164 3300046475 Ga0495639_0098236 Ga0495639_0098236_338_871 177
1165 3300046475 Ga0495639_0117467 Ga0495639_0117467_360_893 177
1166 3300046476 Ga0495662_0007474 Ga0495662_0007474_4184_4717 177
1167 3300046477 Ga0495664_0084699 Ga0495664_0084699_619_1152 177
1168 3300046491 Ga0495584_0103771 Ga0495584_0103771_636_1169 177
1169 3300046499 Ga0495594_0000001 Ga0495594_0000001_33025_33558 177
1170 3300046499 Ga0495594_0052080 Ga0495594_0052080_765_1298 177
1171 3300046507 Ga0495606_0000283 Ga0495606_0000283_58603_59136 177
1172 3300046511 Ga0495608_0029074 Ga0495608_0029074_2744_3277 177
1173 3300046511 Ga0495608_0043315 Ga0495608_0043315_1241_1774 177
1174 3300046516 Ga0495628_0000864 Ga0495628_0000864_19180_19713 177
1175 3300046516 Ga0495628_0054541 Ga0495628_0054541_149_682 177
1176 3300046516 Ga0495628_0224494 Ga0495628_0224494_418_951 177
1177 3300046516 Ga0495628_0542213 Ga0495628_0542213_14_547 177
1178 3300046517 Ga0495630_0000395 Ga0495630_0000395_25137_25670 177
1179 3300046517 Ga0495630_0058365 Ga0495630_0058365_1163_1696 177
1180 3300046517 Ga0495630_0066542 Ga0495630_0066542_867_1400 177
1181 3300046517 Ga0495630_0119710 Ga0495630_0119710_839_1372 177
1182 3300046517 Ga0495630_0154016 Ga0495630_0154016_192_725 177
1183 3300046517 Ga0495630_0507095 Ga0495630_0507095_261_794 177
1184 3300046523 Ga0495644_0110530 Ga0495644_0110530_341_874 177
1185 3300046523 Ga0495644_0311280 Ga0495644_0311280_57_590 177
1186 3300046526 Ga0495666_0178250 Ga0495666_0178250_65_598 177
1187 3300046529 Ga0495652_0000009 Ga0495652_0000009_227594_228127 177
1188 3300046529 Ga0495652_0023756 Ga0495652_0023756_4006_4539 177
1189 3300046529 Ga0495652_0323834 Ga0495652_0323834_199_732 177
1190 3300046531 Ga0495665_0027804 Ga0495665_0027804_2254_2787 177
1191 3300046533 Ga0495640_0009674 Ga0495640_0009674_2329_2862 177
1192 3300046533 Ga0495640_0024081 Ga0495640_0024081_1489_2022 177
1193 3300046535 Ga0495586_0001318 Ga0495586_0001318_981_1514 177
1194 3300046535 Ga0495586_0472305 Ga0495586_0472305_36_569 177
1195 3300046536 Ga0495587_0004030 Ga0495587_0004030_8625_9158 177
1196 3300046536 Ga0495587_0143372 Ga0495587_0143372_518_1051 177
1197 3300046536 Ga0495587_0277453 Ga0495587_0277453_158_691 177
1198 3300046543 Ga0495645_0015381 Ga0495645_0015381_2422_2955 177
1199 3300046543 Ga0495645_0097775 Ga0495645_0097775_677_1210 177
1200 3300046543 Ga0495645_0540396 Ga0495645_0540396_64_597 177
1201 3300046557 Ga0495622_0000069 Ga0495622_0000069_37477_38010 177
1202 3300046559 Ga0495667_0039119 Ga0495667_0039119_2549_3082 177
1203 3300046615 Ga0495656_0000412 Ga0495656_0000412_12557_13090 177
1204 3300046642 Ga0495634_0022437 Ga0495634_0022437_3635_4174 177
1205 3300046642 Ga0495634_0028786 Ga0495634_0028786_2024_2557 177
1206 3300046642 Ga0495634_0031228 Ga0495634_0031228_1017_1550 177
1207 3300046648 Ga0495611_0171638 Ga0495611_0171638_35_568 177
1208 3300046660 Ga0495625_0000109 Ga0495625_0000109_81743_82276 177
1209 3300046663 Ga0495635_0000922 Ga0495635_0000922_14684_15223 177
1210 3300046663 Ga0495635_0112146 Ga0495635_0112146_463_996 177
1211 3300046674 Ga0495588_0000175 Ga0495588_0000175_41058_41591 177
1212 3300046675 Ga0495657_0003110 Ga0495657_0003110_10211_10744 177
1213 3300046678 Ga0495599_0025046 Ga0495599_0025046_2695_3234 177
1214 3300046678 Ga0495599_0047469 Ga0495599_0047469_1207_1740 177
1215 3300046680 Ga0495646_0311010 Ga0495646_0311010_139_672 177
1216 3300046680 Ga0495646_0331730 Ga0495646_0331730_112_645 177
1217 3300046681 Ga0495647_0003117 Ga0495647_0003117_2182_2715 177
1218 3300046683 Ga0495658_0001182 Ga0495658_0001182_11942_12475 177
1219 3300046683 Ga0495658_0009022 Ga0495658_0009022_3324_3857 177
1220 3300046683 Ga0495658_0158495 Ga0495658_0158495_145_678 177
1221 3300046689 Ga0495613_0000087 Ga0495613_0000087_79466_79999 177
1222 3300046689 Ga0495613_0028786 Ga0495613_0028786_819_1352 177
1223 3300046689 Ga0495613_0043476 Ga0495613_0043476_74_607 177
1224 3300046690 Ga0495624_0100809 Ga0495624_0100809_951_1484 177
1225 3300046690 Ga0495624_0184452 Ga0495624_0184452_245_778 177
1226 3300046691 Ga0495670_0063306 Ga0495670_0063306_871_1404 177
1227 3300046694 Ga0495649_0004973 Ga0495649_0004973_3258_3791 177
1228 3300046809 Ga0495600_0006577 Ga0495600_0006577_5550_6083 177
1229 3300046809 Ga0495600_0042492 Ga0495600_0042492_1259_1798 177
1230 3300046809 Ga0495600_0056406 Ga0495600_0056406_1347_1880 177
1231 3300046809 Ga0495600_0180531 Ga0495600_0180531_697_1230 177
1232 3300047315 Ga0495581_0038851 Ga0495581_0038851_418_951 177
1233 3300047317 Ga0495604_0000322 Ga0495604_0000322_20399_20932 177
1234 3300047317 Ga0495604_0047307 Ga0495604_0047307_2102_2635 177
1235 3300047317 Ga0495604_0078464 Ga0495604_0078464_1715_2248 177
1236 3300047317 Ga0495604_0429270 Ga0495604_0429270_63_596 177
1237 3300047319 Ga0495674_0000141 Ga0495674_0000141_14145_14678 177
1238 3300047319 Ga0495674_0076908 Ga0495674_0076908_810_1343 177
1239 3300047320 Ga0495672_0036499 Ga0495672_0036499_1725_2258 177
1240 3300047321 Ga0495676_0012216 Ga0495676_0012216_615_1148 177
1241 3300047321 Ga0495676_0040217 Ga0495676_0040217_2462_2995 177
1242 3300047321 Ga0495676_0113010 Ga0495676_0113010_1283_1816 177
1243 3300047322 Ga0495680_0001951 Ga0495680_0001951_4723_5256 177
1244 3300047322 Ga0495680_0029124 Ga0495680_0029124_3304_3837 177
1245 3300047444 Ga0495675_0014758 Ga0495675_0014758_1652_2185 177
1246 3300047471 Ga0495684_0200003 Ga0495684_0200003_74_607 177
1247 3300047471 Ga0495684_0381076 Ga0495684_0381076_379_912 177
1248 3300047472 Ga0495686_0032955 Ga0495686_0032955_1223_1756 177
1249 3300047673 Ga0495593_0016327 Ga0495593_0016327_3194_3727 177
1250 3300048088 Ga0495602_0000038 Ga0495602_0000038_20759_21292 177
1251 3300048088 Ga0495602_0003702 Ga0495602_0003702_7163_7696 177
1252 3300048088 Ga0495602_0140799 Ga0495602_0140799_701_1234 177
1253 3300048088 Ga0495602_0234245 Ga0495602_0234245_813_1346 177
1254 3300048088 Ga0495602_0450293 Ga0495602_0450293_354_887 177
1255 3300048089 Ga0495614_0024070 Ga0495614_0024070_659_1192 177
1256 3300048903 Ga0496100_0019069 Ga0496100_0019069_3041_3574 177
1257 3300048903 Ga0496100_0031021 Ga0496100_0031021_529_1062 177
1258 3300048903 Ga0496100_0167304 Ga0496100_0167304_103_636 177
1259 3300048903 Ga0496100_0364770 Ga0496100_0364770_259_792 177
1260 3300048903 Ga0496100_1096061 Ga0496100_1096061_72_605 177
1261 3300048904 Ga0496101_0002912 Ga0496101_0002912_2785_3318 177
1262 3300048904 Ga0496101_0013023 Ga0496101_0013023_1029_1562 177
1263 3300048904 Ga0496101_0252038 Ga0496101_0252038_210_743 177
1264 3300048904 Ga0496101_0375508 Ga0496101_0375508_58_591 177
1265 3300048905 Ga0496102_0000021 Ga0496102_0000021_174241_174774 177
1266 3300048905 Ga0496102_0010286 Ga0496102_0010286_7132_7665 177
1267 3300048905 Ga0496102_0032988 Ga0496102_0032988_2301_2834 177
1268 3300048905 Ga0496102_0130356 Ga0496102_0130356_501_1034 177
1269 3300048905 Ga0496102_0175588 Ga0496102_0175588_1456_1989 177
1270 3300048905 Ga0496102_0321373 Ga0496102_0321373_823_1356 177
1271 3300048905 Ga0496102_0482685 Ga0496102_0482685_251_790 177
1272 3300048905 Ga0496102_0952872 Ga0496102_0952872_169_702 177
1273 3300048906 Ga0496103_0000001 Ga0496103_0000001_421133_421666 177
1274 3300048906 Ga0496103_0037187 Ga0496103_0037187_915_1448 177
1275 3300048906 Ga0496103_0434164 Ga0496103_0434164_10_543 177
1276 3300048907 Ga0496104_0000029 Ga0496104_0000029_187154_187687 177
1277 3300048907 Ga0496104_0057144 Ga0496104_0057144_56_589 177
1278 3300048907 Ga0496104_0143937 Ga0496104_0143937_1537_2070 177
1279 3300048907 Ga0496104_0729275 Ga0496104_0729275_230_763 177
1280 3300048908 Ga0496105_0000002 Ga0496105_0000002_187154_187687 177
1281 3300048908 Ga0496105_0073103 Ga0496105_0073103_672_1205 177
1282 3300048908 Ga0496105_1031186 Ga0496105_1031186_41_574 177
1283 3300048909 Ga0496106_0000838 Ga0496106_0000838_12179_12712 177
1284 3300048909 Ga0496106_0007743 Ga0496106_0007743_2964_3497 177
1285 3300048909 Ga0496106_0015086 Ga0496106_0015086_2291_2824 177
1286 3300048909 Ga0496106_0030477 Ga0496106_0030477_518_1051 177
1287 3300048909 Ga0496106_0050277 Ga0496106_0050277_2009_2542 177
1288 3300048909 Ga0496106_0374678 Ga0496106_0374678_291_824 177
1289 3300048910 Ga0496107_0000371 Ga0496107_0000371_16491_17024 177
1290 3300048910 Ga0496107_0017709 Ga0496107_0017709_427_960 177
1291 3300048910 Ga0496107_0037346 Ga0496107_0037346_2007_2540 177
1292 3300048910 Ga0496107_0058400 Ga0496107_0058400_373_906 177
1293 3300048910 Ga0496107_0232167 Ga0496107_0232167_500_1033 177
1294 3300048911 Ga0496108_0000042 Ga0496108_0000042_119460_119993 177
1295 3300048911 Ga0496108_0021329 Ga0496108_0021329_2090_2623 177
1296 3300048911 Ga0496108_0074397 Ga0496108_0074397_2141_2674 177
1297 3300048911 Ga0496108_0132946 Ga0496108_0132946_1214_1747 177
1298 3300048911 Ga0496108_0339633 Ga0496108_0339633_636_1169 177
1299 3300048911 Ga0496108_0635271 Ga0496108_0635271_149_688 177
1300 3300048912 Ga0496109_0000034 Ga0496109_0000034_152099_152632 177
1301 3300048912 Ga0496109_0003257 Ga0496109_0003257_5429_5962 177
1302 3300048912 Ga0496109_0008015 Ga0496109_0008015_6580_7113 177
1303 3300048912 Ga0496109_0038802 Ga0496109_0038802_3368_3901 177
1304 3300048912 Ga0496109_0077735 Ga0496109_0077735_1141_1674 177
1305 3300048912 Ga0496109_0119801 Ga0496109_0119801_1601_2134 177
1306 3300048912 Ga0496109_0327544 Ga0496109_0327544_64_597 177
1307 3300048912 Ga0496109_0484619 Ga0496109_0484619_285_818 177
1308 3300048912 Ga0496109_0729771 Ga0496109_0729771_376_909 177
1309 3300048913 Ga0496110_0000325 Ga0496110_0000325_19715_20248 177
1310 3300048913 Ga0496110_0003959 Ga0496110_0003959_7523_8056 177
1311 3300048913 Ga0496110_0018233 Ga0496110_0018233_2771_3304 177
1312 3300048913 Ga0496110_0022729 Ga0496110_0022729_3223_3756 177
1313 3300048913 Ga0496110_0035533 Ga0496110_0035533_2141_2674 177
1314 3300048913 Ga0496110_0041415 Ga0496110_0041415_741_1274 177
1315 3300048913 Ga0496110_0120715 Ga0496110_0120715_1027_1560 177
1316 3300048913 Ga0496110_0203004 Ga0496110_0203004_636_1169 177
1317 3300048914 Ga0496111_0000171 Ga0496111_0000171_9359_9892 177
1318 3300048914 Ga0496111_0005234 Ga0496111_0005234_2366_2899 177
1319 3300048914 Ga0496111_0011147 Ga0496111_0011147_3148_3681 177
1320 3300048914 Ga0496111_0062842 Ga0496111_0062842_386_919 177
1321 3300048914 Ga0496111_0093413 Ga0496111_0093413_804_1337 177
1322 3300048914 Ga0496111_0125452 Ga0496111_0125452_620_1153 177
1323 3300048914 Ga0496111_0273435 Ga0496111_0273435_705_1238 177
1324 3300048914 Ga0496111_0294876 Ga0496111_0294876_606_1139 177
1325 3300048914 Ga0496111_0323216 Ga0496111_0323216_94_627 177
1326 3300048914 Ga0496111_0356409 Ga0496111_0356409_286_819 177
1327 3300048914 Ga0496111_0522343 Ga0496111_0522343_153_686 177
1328 3300048914 Ga0496111_0598258 Ga0496111_0598258_25_558 177
1329 3300048915 Ga0496112_0007934 Ga0496112_0007934_8104_8637 177
1330 3300048915 Ga0496112_0008451 Ga0496112_0008451_3169_3702 177
1331 3300048915 Ga0496112_0038994 Ga0496112_0038994_3015_3548 177
1332 3300048915 Ga0496112_0086863 Ga0496112_0086863_25_558 177
1333 3300048915 Ga0496112_0118975 Ga0496112_0118975_716_1255 177
1334 3300048915 Ga0496112_0136580 Ga0496112_0136580_1402_1935 177
1335 3300048915 Ga0496112_0311169 Ga0496112_0311169_751_1284 177
1336 3300048916 Ga0496113_0000002 Ga0496113_0000002_19376_19909 177
1337 3300048916 Ga0496113_0023067 Ga0496113_0023067_2787_3320 177
1338 3300048916 Ga0496113_0097854 Ga0496113_0097854_1060_1593 177
1339 3300048916 Ga0496113_0234778 Ga0496113_0234778_557_1090 177
1340 3300048916 Ga0496113_0675684 Ga0496113_0675684_116_649 177
1341 3300048917 Ga0496114_0000097 Ga0496114_0000097_30109_30642 177
1342 3300048917 Ga0496114_0006753 Ga0496114_0006753_1816_2349 177
1343 3300048917 Ga0496114_0030424 Ga0496114_0030424_3438_3971 177
1344 3300048917 Ga0496114_0064791 Ga0496114_0064791_1390_1923 177
1345 3300048917 Ga0496114_0130282 Ga0496114_0130282_238_771 177
1346 3300048917 Ga0496114_0131568 Ga0496114_0131568_357_890 177
1347 3300048917 Ga0496114_0219100 Ga0496114_0219100_434_967 177
1348 3300048917 Ga0496114_0356045 Ga0496114_0356045_555_1091 177
1349 3300048917 Ga0496114_0847176 Ga0496114_0847176_251_784 177
1350 3300048918 Ga0496115_0000005 Ga0496115_0000005_128508_129041 177
1351 3300048918 Ga0496115_0000151 Ga0496115_0000151_31211_31744 177
1352 3300048918 Ga0496115_0052058 Ga0496115_0052058_2639_3172 177
1353 3300048918 Ga0496115_0264013 Ga0496115_0264013_515_1048 177
1354 3300048920 Ga0496117_0030866 Ga0496117_0030866_3044_3577 177
1355 3300048921 Ga0496118_0006751 Ga0496118_0006751_2052_2585 177
1356 3300048921 Ga0496118_0247675 Ga0496118_0247675_138_671 177
1357 3300048922 Ga0496119_0015281 Ga0496119_0015281_1897_2430 177
1358 3300048923 Ga0496120_0003833 Ga0496120_0003833_8327_8860 177
1359 3300048927 Ga0496124_0173053 Ga0496124_0173053_76_609 177
1360 3300048927 Ga0496124_0732844 Ga0496124_0732844_67_600 177
1361 3300048929 Ga0496126_0089445 Ga0496126_0089445_442_975 177
1362 3300049568 Ga0501031_0026171 Ga0501031_0026171_2927_3460 177
1363 3300049568 Ga0501031_0176449 Ga0501031_0176449_443_976 177
1364 3300049569 Ga0501032_0099533 Ga0501032_0099533_382_915 177
1365 3300049569 Ga0501032_0255132 Ga0501032_0255132_373_912 177
1366 3300049569 Ga0501032_0421393 Ga0501032_0421393_121_654 177
1367 3300049570 Ga0501033_0044482 Ga0501033_0044482_110_643 177
1368 3300049570 Ga0501033_0064058 Ga0501033_0064058_861_1394 177
1369 3300049571 Ga0501034_0069447 Ga0501034_0069447_2064_2597 177
1370 3300049571 Ga0501034_0711972 Ga0501034_0711972_358_891 177
1371 3300049572 Ga0501036_0018306 Ga0501036_0018306_62_595 177
1372 3300049572 Ga0501036_0051280 Ga0501036_0051280_2102_2635 177
1373 3300049572 Ga0501036_0056541 Ga0501036_0056541_977_1516 177
1374 3300049572 Ga0501036_0336763 Ga0501036_0336763_195_728 177
1375 3300049573 Ga0501037_0006661 Ga0501037_0006661_5908_6447 177
1376 3300049573 Ga0501037_0811918 Ga0501037_0811918_44_577 177
1377 3300049574 Ga0501038_0102284 Ga0501038_0102284_858_1391 177
1378 3300049574 Ga0501038_0194975 Ga0501038_0194975_959_1498 177
1379 3300049575 Ga0501039_0028940 Ga0501039_0028940_3401_3940 177
1380 3300049575 Ga0501039_0099545 Ga0501039_0099545_1534_2067 177
1381 3300049575 Ga0501039_0245664 Ga0501039_0245664_849_1382 177
1382 3300049576 Ga0501040_0018448 Ga0501040_0018448_1334_1867 177
1383 3300049576 Ga0501040_0070528 Ga0501040_0070528_1648_2181 177
1384 3300049576 Ga0501040_0392566 Ga0501040_0392566_367_900 177
1385 3300049576 Ga0501040_0469972 Ga0501040_0469972_347_886 177
1386 3300049577 Ga0501041_0013799 Ga0501041_0013799_1319_1852 177
1387 3300049577 Ga0501041_0043948 Ga0501041_0043948_797_1336 177
1388 3300049577 Ga0501041_0054276 Ga0501041_0054276_1184_1717 177
1389 3300049577 Ga0501041_0068821 Ga0501041_0068821_370_909 177
1390 3300049577 Ga0501041_0756420 Ga0501041_0756420_31_564 177
1391 3300049578 Ga0501042_0005622 Ga0501042_0005622_167_706 177
1392 3300049578 Ga0501042_0030096 Ga0501042_0030096_1650_2183 177
1393 3300049578 Ga0501042_0056952 Ga0501042_0056952_854_1387 177
1394 3300049578 Ga0501042_0533184 Ga0501042_0533184_307_840 177
1395 3300049578 Ga0501042_0740475 Ga0501042_0740475_164_697 177
1396 3300049578 Ga0501042_0907641 Ga0501042_0907641_10_549 177
1397 3300049579 Ga0501043_0032912 Ga0501043_0032912_2078_2611 177
1398 3300049580 Ga0501046_0433475 Ga0501046_0433475_280_819 177
1399 3300049582 Ga0501048_0012062 Ga0501048_0012062_3591_4130 177
1400 3300049582 Ga0501048_0040441 Ga0501048_0040441_144_677 177
1401 3300049582 Ga0501048_0083634 Ga0501048_0083634_799_1332 177
1402 3300049582 Ga0501048_0738095 Ga0501048_0738095_22_555 177
1403 3300049583 Ga0501067_0002332 Ga0501067_0002332_3155_3688 177
1404 3300049583 Ga0501067_0025723 Ga0501067_0025723_1237_1770 177
1405 3300049583 Ga0501067_0028629 Ga0501067_0028629_762_1295 177
1406 3300049583 Ga0501067_0032866 Ga0501067_0032866_55_588 177
1407 3300049584 Ga0501068_0003192 Ga0501068_0003192_1356_1889 177
1408 3300049584 Ga0501068_0006756 Ga0501068_0006756_372_911 177
1409 3300049584 Ga0501068_0024472 Ga0501068_0024472_799_1332 177
1410 3300049584 Ga0501068_0035937 Ga0501068_0035937_617_1150 177
1411 3300049584 Ga0501068_0055462 Ga0501068_0055462_118_651 177
1412 3300049584 Ga0501068_0087008 Ga0501068_0087008_287_820 177
1413 3300049584 Ga0501068_0294829 Ga0501068_0294829_324_857 177
1414 3300049584 Ga0501068_0540563 Ga0501068_0540563_64_597 177
1415 3300049585 Ga0501069_0000453 Ga0501069_0000453_7774_8307 177
1416 3300049585 Ga0501069_0036099 Ga0501069_0036099_596_1129 177
1417 3300049586 Ga0501070_0075131 Ga0501070_0075131_115_648 177
1418 3300049586 Ga0501070_0090385 Ga0501070_0090385_1599_2138 177
1419 3300049586 Ga0501070_0149937 Ga0501070_0149937_245_778 177
1420 3300049586 Ga0501070_0376306 Ga0501070_0376306_560_1093 177
1421 3300049586 Ga0501070_1056823 Ga0501070_1056823_30_569 177
1422 3300049587 Ga0501071_0004097 Ga0501071_0004097_7330_7869 177
1423 3300049587 Ga0501071_0020990 Ga0501071_0020990_406_939 177
1424 3300049587 Ga0501071_0208123 Ga0501071_0208123_644_1183 177
1425 3300049587 Ga0501071_0261028 Ga0501071_0261028_192_725 177
1426 3300049587 Ga0501071_0328198 Ga0501071_0328198_62_595 177
1427 3300049587 Ga0501071_0413681 Ga0501071_0413681_252_785 177
1428 3300049588 Ga0501072_0010784 Ga0501072_0010784_92_631 177
1429 3300049588 Ga0501072_0019597 Ga0501072_0019597_925_1458 177
1430 3300049588 Ga0501072_0084645 Ga0501072_0084645_648_1181 177
1431 3300049588 Ga0501072_0108676 Ga0501072_0108676_216_749 177
1432 3300049588 Ga0501072_0226216 Ga0501072_0226216_571_1104 177
1433 3300049588 Ga0501072_0267290 Ga0501072_0267290_704_1237 177
1434 3300049588 Ga0501072_0325955 Ga0501072_0325955_553_1086 177
1435 3300049589 Ga0501073_0047488 Ga0501073_0047488_94_627 177
1436 3300049590 Ga0501074_0015990 Ga0501074_0015990_2190_2723 177
1437 3300049590 Ga0501074_0019513 Ga0501074_0019513_139_672 177
1438 3300049590 Ga0501074_0047115 Ga0501074_0047115_1720_2253 177
1439 3300049590 Ga0501074_0109316 Ga0501074_0109316_743_1276 177
1440 3300049590 Ga0501074_0805338 Ga0501074_0805338_11_544 177
1441 3300049591 Ga0501075_0012379 Ga0501075_0012379_797_1336 177
1442 3300049591 Ga0501075_0013808 Ga0501075_0013808_1040_1573 177
1443 3300049591 Ga0501075_0022192 Ga0501075_0022192_2007_2540 177
1444 3300049592 Ga0501076_0000421 Ga0501076_0000421_22612_23145 177
1445 3300049592 Ga0501076_0012859 Ga0501076_0012859_1001_1534 177
1446 3300049592 Ga0501076_0214851 Ga0501076_0214851_644_1183 177
1447 3300049593 Ga0501077_0100644 Ga0501077_0100644_68_607 177
1448 3300049593 Ga0501077_0101576 Ga0501077_0101576_352_885 177
1449 3300049593 Ga0501077_0497431 Ga0501077_0497431_136_669 177
1450 3300049741 Ga0501079_0082759 Ga0501079_0082759_1334_1867 177
1451 3300049741 Ga0501079_0133261 Ga0501079_0133261_510_1049 177
1452 3300049741 Ga0501079_0218330 Ga0501079_0218330_784_1317 177
1453 3300049741 Ga0501079_0252153 Ga0501079_0252153_160_693 177
1454 3300049741 Ga0501079_0602260 Ga0501079_0602260_49_588 177
1455 3300049742 Ga0501080_0003052 Ga0501080_0003052_3969_4502 177
1456 3300049742 Ga0501080_0034921 Ga0501080_0034921_3201_3740 177
1457 3300049742 Ga0501080_0050692 Ga0501080_0050692_2863_3396 177
1458 3300049742 Ga0501080_0339968 Ga0501080_0339968_324_857 177
1459 3300049742 Ga0501080_1482591 Ga0501080_1482591_13_546 177
1460 3300049743 Ga0501081_0009235 Ga0501081_0009235_4240_4773 177
1461 3300049744 Ga0501083_0022386 Ga0501083_0022386_812_1345 177
1462 3300049744 Ga0501083_0024382 Ga0501083_0024382_811_1350 177
1463 3300049744 Ga0501083_0177744 Ga0501083_0177744_509_1042 177
1464 3300049744 Ga0501083_0195334 Ga0501083_0195334_503_1036 177
1465 3300049744 Ga0501083_0541365 Ga0501083_0541365_45_578 177
1466 3300049822 Ga0501035_0021108 Ga0501035_0021108_4935_5474 177
1467 3300049822 Ga0501035_0050399 Ga0501035_0050399_2009_2542 177
1468 3300049822 Ga0501035_0057867 Ga0501035_0057867_1196_1729 177
1469 3300049823 Ga0501044_0123906 Ga0501044_0123906_1981_2514 177
1470 3300049823 Ga0501044_0207263 Ga0501044_0207263_605_1138 177
1471 3300049824 Ga0501045_0008167 Ga0501045_0008167_525_1064 177
1472 3300049824 Ga0501045_0047269 Ga0501045_0047269_1607_2140 177
1473 3300049824 Ga0501045_0212834 Ga0501045_0212834_837_1370 177
1474 3300049824 Ga0501045_0299619 Ga0501045_0299619_47_586 177
1475 3300050490 nmdc:mga03n38_192086_c1 nmdc:mga03n38_192086_c1_338_871 177
1476 3300050490 nmdc:mga03n38_4164_c1 nmdc:mga03n38_4164_c1_287_820 177
1477 3300050491 nmdc:mga00v17_166784_c1 nmdc:mga00v17_166784_c1_648_1181 177
1478 3300050492 nmdc:mga0yw44_10371_c1 nmdc:mga0yw44_10371_c1_898_1431 177
1479 3300050492 nmdc:mga0yw44_279059_c1 nmdc:mga0yw44_279059_c1_546_1079 177
1480 3300050492 nmdc:mga0yw44_495256_c1 nmdc:mga0yw44_495256_c1_116_649 177
1481 3300050492 nmdc:mga0yw44_63138_c1 nmdc:mga0yw44_63138_c1_124_657 177
1482 3300050494 nmdc:mga06z11_363418_c1 nmdc:mga06z11_363418_c1_132_665 177
1483 3300050494 nmdc:mga06z11_382806_c1 nmdc:mga06z11_382806_c1_10_543 177
1484 3300050507 nmdc:mga05p37_43303_c1 nmdc:mga05p37_43303_c1_2727_3260 177
1485 3300050507 nmdc:mga05p37_759979_c1 nmdc:mga05p37_759979_c1_512_1045 177
1486 3300050507 nmdc:mga05p37_796258_c1 nmdc:mga05p37_796258_c1_50_583 177
1487 3300050509 nmdc:mga0qj67_50568_c1 nmdc:mga0qj67_50568_c1_531_1064 177
1488 3300050509 nmdc:mga0qj67_91623_c1 nmdc:mga0qj67_91623_c1_1117_1668 177
1489 3300050510 nmdc:mga06r32_196750_c1 nmdc:mga06r32_196750_c1_945_1478 177
1490 3300050510 nmdc:mga06r32_32833_c1 nmdc:mga06r32_32833_c1_588_1121 177
1491 3300050510 nmdc:mga06r32_950158_c1 nmdc:mga06r32_950158_c1_29_580 177
1492 3300050511 nmdc:mga08y16_67946_c1 nmdc:mga08y16_67946_c1_2319_2852 177
1493 3300050511 nmdc:mga08y16_800124_c1 nmdc:mga08y16_800124_c1_146_679 177
1494 3300050512 nmdc:mga0n895_25936_c1 nmdc:mga0n895_25936_c1_1896_2429 177
1495 3300050512 nmdc:mga0n895_346336_c1 nmdc:mga0n895_346336_c1_380_913 177
1496 3300050512 nmdc:mga0n895_910855_c1 nmdc:mga0n895_910855_c1_229_762 177
1497 3300050513 nmdc:mga0rr50_1038818_c1 nmdc:mga0rr50_1038818_c1_31_564 177
1498 3300050513 nmdc:mga0rr50_20072_c1 nmdc:mga0rr50_20072_c1_2164_2697 177
1499 3300050514 nmdc:mga08x19_332382_c1 nmdc:mga08x19_332382_c1_347_880 177
1500 3300050514 nmdc:mga08x19_478247_c1 nmdc:mga08x19_478247_c1_249_782 177
1501 3300053077 Ga0495601_0000065 Ga0495601_0000065_986_1519 177
1502 3300053077 Ga0495601_0003864 Ga0495601_0003864_4694_5227 177
1503 3300053077 Ga0495601_0023616 Ga0495601_0023616_3226_3759 177
1504 3300053077 Ga0495601_0099960 Ga0495601_0099960_831_1364 177
1505 3300053077 Ga0495601_0170302 Ga0495601_0170302_415_948 177
1506 3300053077 Ga0495601_0199663 Ga0495601_0199663_691_1224 177
1507 3300053078 Ga0495612_0006879 Ga0495612_0006879_3159_3692 177
1508 3300053078 Ga0495612_0063947 Ga0495612_0063947_464_997 177
1509 3300053078 Ga0495612_0069600 Ga0495612_0069600_84_617 177
1510 3300053078 Ga0495612_0170306 Ga0495612_0170306_117_650 177
1511 3300053083 Ga0495655_0007117 Ga0495655_0007117_1380_1913 177
1512 3300053084 Ga0495595_0010466 Ga0495595_0010466_2789_3322 177
1513 3300053084 Ga0495595_0079108 Ga0495595_0079108_344_877 177
1514 3300053085 Ga0495619_0000069 Ga0495619_0000069_65550_66083 177
1515 3300053085 Ga0495619_0005994 Ga0495619_0005994_4825_5358 177
1516 3300053085 Ga0495619_0038703 Ga0495619_0038703_1283_1816 177
1517 3300053085 Ga0495619_0139945 Ga0495619_0139945_988_1521 177
1518 3300053094 Ga0500566_0001523 Ga0500566_0001523_3147_3680 177
1519 3300053096 Ga0500641_0001013 Ga0500641_0001013_758_1291 177
1520 3300053102 Ga0500554_079816 Ga0500554_079816_124_657 177
1521 3300053119 Ga0500595_095378 Ga0500595_095378_105_638 177
1522 3300054114 Ga0501084_0022899 Ga0501084_0022899_4039_4572 177
1523 3300054114 Ga0501084_0077198 Ga0501084_0077198_1404_1937 177
1524 3300054114 Ga0501084_0732562 Ga0501084_0732562_109_642 177
1525 3300059490 Ga0587066_093256 Ga0587066_093256_49_582 177
1526 3300059492 Ga0587073_0081770 Ga0587073_0081770_245_778 177
1527 3300060353 Ga0501082_0015085 Ga0501082_0015085_4609_5142 177
1528 3300060353 Ga0501082_0109073 Ga0501082_0109073_1091_1624 177
1529 3300060353 Ga0501082_0116933 Ga0501082_0116933_328_867 177
1530 3300060353 Ga0501082_0164879 Ga0501082_0164879_799_1332 177
1531 3300060353 Ga0501082_0635045 Ga0501082_0635045_207_740 177
1532 3300060353 Ga0501082_1278133 Ga0501082_1278133_55_588 177
1533 3300061719 Ga0466962_0003094 Ga0466962_0003094_2286_2825 177
1534 3300061719 Ga0466962_0153789 Ga0466962_0153789_471_1010 177
1535 3300061734 Ga0530510_0006251 Ga0530510_0006251_5508_6041 177
1536 3300061734 Ga0530510_0022325 Ga0530510_0022325_2003_2542 177
1537 3300061734 Ga0530510_0076649 Ga0530510_0076649_906_1439 177
1538 3300061734 Ga0530510_0078777 Ga0530510_0078777_800_1333 177
1539 3300061734 Ga0530510_0240380 Ga0530510_0240380_688_1221 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

101

176

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

22

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6boh-assembly2.cif.gz_NB antibiotic blasticidin s and e. coli release factor 1 (containing deletion 302-304) bound to the 70s ribosome 0.976 2 172
5dm7-assembly1.cif.gz_E crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.9718 8 172
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9681 9 168
7nhn-assembly1.cif.gz_K vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9652 9 170
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9632 2 172
ID Description Score Start End Superfamily
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9784 1 79 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9736 80 170 3.90.930.12
3knmH02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9606 80 165 3.90.930.12
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9598 80 172 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9586 83 174 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A4Q7CIM0-F1-model_v4 50S ribosomal protein L6 1.002 82 158 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A357CQG9-F1-model_v4 50S ribosomal protein L6 0.9974 48 158 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A6G3V3R5-F1-model_v4 deleted 0.9892 1 139
AF-A0A661JDN3-F1-model_v4 50S ribosomal protein L6 0.9861 53 172 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A511VB55-F1-model_v4 Large ribosomal subunit protein uL6 0.9854 1 172 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
91.14 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map