F494644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1538 | 463 | 3076 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300038725|Ga0400484_14440|Ga0400484_14440_47_1345 |
| Length | 432 |
| Sequence | MTSRLKEVVIVSGARTPVGSFGGSLKSVPAIDMGALVMKTAIERAGLRPTPSDEMGQLSPDALKDQGTISLEADTAQWDGGAIPVTIDEVVMGHVLTAGLGQNPGRQAMIRAGIPKETPAYTINKVCGSGLKAIALGAASIMTGQADVVMAGGQENMSQVPLALPKARWGHRMELTGVGDIYDLMVYDGLYEIFYGYHMGLTAENIAALYEISREEQDELGVLSHTRARAAITGGEFVEEIVPVTVKGRKGDTIVDTDERPMDTSLEKMGRLRPAFKKDGSVTAGNASGINDGAAAVLLMSAEKALELGLTPLAKIKAFASGGVDPAYMGLGPVPAIRKAVAECGMNLADIDVIELNEAFAAQAIGCLRELKLPNDKPNLVGSGISLGHPIGCTGARQMVTAIHLMKRRQLNTGLISMCIGGGMGMAMLVES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 126 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 127 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 227 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 228 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 229 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 249 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 254 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 255 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 261 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 262 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 263 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 264 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 267 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 268 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 341 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 344 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 349 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 350 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 351 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 352 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 353 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 406 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 407 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 411 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 412 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 414 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 417 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 420 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 421 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 422 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 423 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 424 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 425 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 426 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 427 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 428 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 429 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 430 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 431 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 432 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 433 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 434 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 435 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 436 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 437 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 438 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 439 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 440 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 441 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 442 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 443 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 444 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 445 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 446 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 447 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 448 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 449 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 450 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 451 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 452 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 453 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 454 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 455 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 456 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 457 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 458 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 459 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 460 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 461 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 462 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 463 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.42 |
| Metatranscriptomes | 0.65 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 1.89 |
| Nodule | 1.43 |
| Rhizoplane | 2.6 |
| Rhizosphere | 90.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400484_14440 | 3300038725 | Bacteria | 2322 |
| 2 | JGI24746J21847_1007330 | 3300001977 | Bacteria | 1690 |
| 3 | JGI25406J46586_10000491 | 3300003203 | Bacteria | 18498 |
| 4 | JGI25406J46586_10007753 | 3300003203 | Unclassified | 4884 |
| 5 | Ga0065712_10070058 | 3300005290 | Bacteria | 6368 |
| 6 | Ga0065715_10005050 | 3300005293 | Bacteria | 5549 |
| 7 | Ga0065715_10010633 | 3300005293 | Bacteria | 5347 |
| 8 | Ga0065715_10090876 | 3300005293 | Bacteria | 6342 |
| 9 | Ga0065715_10114814 | 3300005293 | Bacteria | 2437 |
| 10 | Ga0065715_10176740 | 3300005293 | Bacteria | 1506 |
| 11 | Ga0065715_10217235 | 3300005293 | Bacteria | 1287 |
| 12 | Ga0065715_10236973 | 3300005293 | Bacteria | 1213 |
| 13 | Ga0065707_10094919 | 3300005295 | Bacteria | 3437 |
| 14 | Ga0070658_10011373 | 3300005327 | Bacteria | 7136 |
| 15 | Ga0070658_10034910 | 3300005327 | Bacteria | 4047 |
| 16 | Ga0070676_10019288 | 3300005328 | Bacteria | 3793 |
| 17 | Ga0070676_10028453 | 3300005328 | Bacteria | 3174 |
| 18 | Ga0070676_10029120 | 3300005328 | Bacteria | 3139 |
| 19 | Ga0070676_10042623 | 3300005328 | Bacteria | 2636 |
| 20 | Ga0070676_10042666 | 3300005328 | Bacteria | 2635 |
| 21 | Ga0070676_10094738 | 3300005328 | Bacteria | 1835 |
| 22 | Ga0070683_100001126 | 3300005329 | Bacteria | 20202 |
| 23 | Ga0070683_100034468 | 3300005329 | Bacteria | 4625 |
| 24 | Ga0070683_100039007 | 3300005329 | Bacteria | 4357 |
| 25 | Ga0070683_100056802 | 3300005329 | Bacteria | 3635 |
| 26 | Ga0070683_100057431 | 3300005329 | Bacteria | 3615 |
| 27 | Ga0070683_100065420 | 3300005329 | Bacteria | 3385 |
| 28 | Ga0070683_100181721 | 3300005329 | Bacteria | 1997 |
| 29 | Ga0070683_100322244 | 3300005329 | Bacteria | 1471 |
| 30 | Ga0070690_100006740 | 3300005330 | Bacteria | 6527 |
| 31 | Ga0070690_100014748 | 3300005330 | Bacteria | 4642 |
| 32 | Ga0070690_100023771 | 3300005330 | Bacteria | 3762 |
| 33 | Ga0070690_100045248 | 3300005330 | Bacteria | 2795 |
| 34 | Ga0070690_100064366 | 3300005330 | Bacteria | 2368 |
| 35 | Ga0070690_100065474 | 3300005330 | Bacteria | 2350 |
| 36 | Ga0070690_100082341 | 3300005330 | Bacteria | 2107 |
| 37 | Ga0070690_100090851 | 3300005330 | Bacteria | 2011 |
| 38 | Ga0070690_100101546 | 3300005330 | Bacteria | 1908 |
| 39 | Ga0070690_100168379 | 3300005330 | Bacteria | 1506 |
| 40 | Ga0070670_100001936 | 3300005331 | Bacteria | 16947 |
| 41 | Ga0070670_100006348 | 3300005331 | Bacteria | 10006 |
| 42 | Ga0070670_100017827 | 3300005331 | Bacteria | 6093 |
| 43 | Ga0070670_100020760 | 3300005331 | Bacteria | 5647 |
| 44 | Ga0070670_100021146 | 3300005331 | Bacteria | 5597 |
| 45 | Ga0070670_100039172 | 3300005331 | Bacteria | 4075 |
| 46 | Ga0070670_100076642 | 3300005331 | Bacteria | 2873 |
| 47 | Ga0070677_10002564 | 3300005333 | Bacteria | 5811 |
| 48 | Ga0068869_100011370 | 3300005334 | Bacteria | 5835 |
| 49 | Ga0068869_100012331 | 3300005334 | Bacteria | 5646 |
| 50 | Ga0068869_100043658 | 3300005334 | Bacteria | 3221 |
| 51 | Ga0068869_100087287 | 3300005334 | Bacteria | 2340 |
| 52 | Ga0068869_100186645 | 3300005334 | Bacteria | 1628 |
| 53 | Ga0068869_100262555 | 3300005334 | Bacteria | 1383 |
| 54 | Ga0070666_10012366 | 3300005335 | Bacteria | 5381 |
| 55 | Ga0070666_10015831 | 3300005335 | Bacteria | 4817 |
| 56 | Ga0070666_10036583 | 3300005335 | Bacteria | 3260 |
| 57 | Ga0070666_10168285 | 3300005335 | Bacteria | 1534 |
| 58 | Ga0070680_100037488 | 3300005336 | Bacteria | 3917 |
| 59 | Ga0070680_100045533 | 3300005336 | Bacteria | 3567 |
| 60 | Ga0070680_100115030 | 3300005336 | Bacteria | 2241 |
| 61 | Ga0070680_100311552 | 3300005336 | Bacteria | 1335 |
| 62 | Ga0068868_100003641 | 3300005338 | Bacteria | 10752 |
| 63 | Ga0068868_100016841 | 3300005338 | Bacteria | 5437 |
| 64 | Ga0070660_100285795 | 3300005339 | Bacteria | 1350 |
| 65 | Ga0070689_100036732 | 3300005340 | Bacteria | 3746 |
| 66 | Ga0070689_100055068 | 3300005340 | Bacteria | 3080 |
| 67 | Ga0070689_100056731 | 3300005340 | Bacteria | 3038 |
| 68 | Ga0070689_100100516 | 3300005340 | Bacteria | 2288 |
| 69 | Ga0070689_100191728 | 3300005340 | Bacteria | 1664 |
| 70 | Ga0070691_10005290 | 3300005341 | Bacteria | 5863 |
| 71 | Ga0070691_10019803 | 3300005341 | Bacteria | 3106 |
| 72 | Ga0070687_100012601 | 3300005343 | Bacteria | 3739 |
| 73 | Ga0070687_100023806 | 3300005343 | Bacteria | 2914 |
| 74 | Ga0070687_100025783 | 3300005343 | Bacteria | 2825 |
| 75 | Ga0070687_100031349 | 3300005343 | Bacteria | 2608 |
| 76 | Ga0070661_100011194 | 3300005344 | Bacteria | 6250 |
| 77 | Ga0070661_100013643 | 3300005344 | Bacteria | 5706 |
| 78 | Ga0070661_100017754 | 3300005344 | Bacteria | 5050 |
| 79 | Ga0070661_100050849 | 3300005344 | Bacteria | 3032 |
| 80 | Ga0070661_100116655 | 3300005344 | Bacteria | 1997 |
| 81 | Ga0070692_10053279 | 3300005345 | Bacteria | 2109 |
| 82 | Ga0070668_100094882 | 3300005347 | Bacteria | 2356 |
| 83 | Ga0070669_100001000 | 3300005353 | Bacteria | 20586 |
| 84 | Ga0070669_100001192 | 3300005353 | Bacteria | 18941 |
| 85 | Ga0070669_100018183 | 3300005353 | Bacteria | 5021 |
| 86 | Ga0070669_100034609 | 3300005353 | Bacteria | 3657 |
| 87 | Ga0070669_100037580 | 3300005353 | Bacteria | 3512 |
| 88 | Ga0070669_100041230 | 3300005353 | Bacteria | 3357 |
| 89 | Ga0070669_100118136 | 3300005353 | Bacteria | 2019 |
| 90 | Ga0070669_100164049 | 3300005353 | Bacteria | 1728 |
| 91 | Ga0070675_100000202 | 3300005354 | Bacteria | 37748 |
| 92 | Ga0070675_100000206 | 3300005354 | Bacteria | 37528 |
| 93 | Ga0070675_100000408 | 3300005354 | Bacteria | 29253 |
| 94 | Ga0070675_100005006 | 3300005354 | Bacteria | 10118 |
| 95 | Ga0070675_100013178 | 3300005354 | Bacteria | 6496 |
| 96 | Ga0070675_100018751 | 3300005354 | Bacteria | 5508 |
| 97 | Ga0070675_100020786 | 3300005354 | Bacteria | 5238 |
| 98 | Ga0070675_100024217 | 3300005354 | Bacteria | 4861 |
| 99 | Ga0070675_100038952 | 3300005354 | Bacteria | 3876 |
| 100 | Ga0070675_100046972 | 3300005354 | Bacteria | 3537 |
| 101 | Ga0070675_100124788 | 3300005354 | Bacteria | 2190 |
| 102 | Ga0070675_100153219 | 3300005354 | Bacteria | 1977 |
| 103 | Ga0070675_100304999 | 3300005354 | Bacteria | 1404 |
| 104 | Ga0070671_100001717 | 3300005355 | Bacteria | 16637 |
| 105 | Ga0070671_100008027 | 3300005355 | Bacteria | 8448 |
| 106 | Ga0070671_100008756 | 3300005355 | Bacteria | 8119 |
| 107 | Ga0070671_100033204 | 3300005355 | Bacteria | 4267 |
| 108 | Ga0070671_100181883 | 3300005355 | Bacteria | 1780 |
| 109 | Ga0070671_100259913 | 3300005355 | Bacteria | 1475 |
| 110 | Ga0070674_100000192 | 3300005356 | Bacteria | 29259 |
| 111 | Ga0070674_100002496 | 3300005356 | Bacteria | 10188 |
| 112 | Ga0070674_100019077 | 3300005356 | Bacteria | 4351 |
| 113 | Ga0070673_100004944 | 3300005364 | Bacteria | 8491 |
| 114 | Ga0070673_100025833 | 3300005364 | Bacteria | 4329 |
| 115 | Ga0070673_100047112 | 3300005364 | Bacteria | 3352 |
| 116 | Ga0070673_100083282 | 3300005364 | Bacteria | 2598 |
| 117 | Ga0070673_100128423 | 3300005364 | Bacteria | 2124 |
| 118 | Ga0070688_100014162 | 3300005365 | Bacteria | 4515 |
| 119 | Ga0070688_100057032 | 3300005365 | Bacteria | 2453 |
| 120 | Ga0070659_100016221 | 3300005366 | Bacteria | 5590 |
| 121 | Ga0070659_100022661 | 3300005366 | Bacteria | 4796 |
| 122 | Ga0070659_100032944 | 3300005366 | Bacteria | 4023 |
| 123 | Ga0070667_100002413 | 3300005367 | Bacteria | 16341 |
| 124 | Ga0070667_100248121 | 3300005367 | Bacteria | 1591 |
| 125 | Ga0070667_100357696 | 3300005367 | Bacteria | 1323 |
| 126 | Ga0070709_10039305 | 3300005434 | Bacteria | 2902 |
| 127 | Ga0070709_10174061 | 3300005434 | Bacteria | 1506 |
| 128 | Ga0070713_100035741 | 3300005436 | Bacteria | 4003 |
| 129 | Ga0070701_10003212 | 3300005438 | Bacteria | 6436 |
| 130 | Ga0070701_10009769 | 3300005438 | Bacteria | 4215 |
| 131 | Ga0070701_10029499 | 3300005438 | Bacteria | 2707 |
| 132 | Ga0070701_10046400 | 3300005438 | Bacteria | 2233 |
| 133 | Ga0070701_10056666 | 3300005438 | Bacteria | 2051 |
| 134 | Ga0070711_100000038 | 3300005439 | Bacteria | 85684 |
| 135 | Ga0070711_100064470 | 3300005439 | Bacteria | 2560 |
| 136 | Ga0070705_100000023 | 3300005440 | Bacteria | 82331 |
| 137 | Ga0070705_100001554 | 3300005440 | Bacteria | 12031 |
| 138 | Ga0070705_100006748 | 3300005440 | Bacteria | 5646 |
| 139 | Ga0070705_100109541 | 3300005440 | Bacteria | 1761 |
| 140 | Ga0070705_100194391 | 3300005440 | Bacteria | 1386 |
| 141 | Ga0070700_100003012 | 3300005441 | Bacteria | 8640 |
| 142 | Ga0070700_100036343 | 3300005441 | Bacteria | 2987 |
| 143 | Ga0070700_100037695 | 3300005441 | Bacteria | 2942 |
| 144 | Ga0070694_100007236 | 3300005444 | Bacteria | 6759 |
| 145 | Ga0070694_100027390 | 3300005444 | Bacteria | 3701 |
| 146 | Ga0070708_100014503 | 3300005445 | Bacteria | 6488 |
| 147 | Ga0070708_100038377 | 3300005445 | Bacteria | 4185 |
| 148 | Ga0070708_100056011 | 3300005445 | Bacteria | 3506 |
| 149 | Ga0070708_100104251 | 3300005445 | Bacteria | 2601 |
| 150 | Ga0070663_100007672 | 3300005455 | Bacteria | 6585 |
| 151 | Ga0070663_100033219 | 3300005455 | Bacteria | 3563 |
| 152 | Ga0070678_100029082 | 3300005456 | Bacteria | 3780 |
| 153 | Ga0070678_100049631 | 3300005456 | Bacteria | 3030 |
| 154 | Ga0070678_100057239 | 3300005456 | Bacteria | 2855 |
| 155 | Ga0070678_100106840 | 3300005456 | Bacteria | 2182 |
| 156 | Ga0070662_100008307 | 3300005457 | Bacteria | 6764 |
| 157 | Ga0070662_100022624 | 3300005457 | Bacteria | 4306 |
| 158 | Ga0070662_100053625 | 3300005457 | Bacteria | 2919 |
| 159 | Ga0070662_100139429 | 3300005457 | Bacteria | 1878 |
| 160 | Ga0070681_10001704 | 3300005458 | Bacteria | 19679 |
| 161 | Ga0070681_10013545 | 3300005458 | Bacteria | 8109 |
| 162 | Ga0070681_10028189 | 3300005458 | Bacteria | 5646 |
| 163 | Ga0070681_10030588 | 3300005458 | Bacteria | 5403 |
| 164 | Ga0070681_10057901 | 3300005458 | Bacteria | 3855 |
| 165 | Ga0070681_10061568 | 3300005458 | Bacteria | 3726 |
| 166 | Ga0070681_10086994 | 3300005458 | Bacteria | 3078 |
| 167 | Ga0068867_100005997 | 3300005459 | Bacteria | 8616 |
| 168 | Ga0068867_100008016 | 3300005459 | Bacteria | 7464 |
| 169 | Ga0068867_100012021 | 3300005459 | Bacteria | 6113 |
| 170 | Ga0068867_100025755 | 3300005459 | Bacteria | 4221 |
| 171 | Ga0068867_100033375 | 3300005459 | Bacteria | 3727 |
| 172 | Ga0068867_100037901 | 3300005459 | Bacteria | 3506 |
| 173 | Ga0068867_100122508 | 3300005459 | Bacteria | 2011 |
| 174 | Ga0068867_100138363 | 3300005459 | Bacteria | 1901 |
| 175 | Ga0070685_10005680 | 3300005466 | Bacteria | 6335 |
| 176 | Ga0070685_10052836 | 3300005466 | Bacteria | 2352 |
| 177 | Ga0070706_100010022 | 3300005467 | Bacteria | 8799 |
| 178 | Ga0070706_100197323 | 3300005467 | Bacteria | 1880 |
| 179 | Ga0070706_100314277 | 3300005467 | Bacteria | 1461 |
| 180 | Ga0070707_100000212 | 3300005468 | Bacteria | 58073 |
| 181 | Ga0070707_100000431 | 3300005468 | Bacteria | 41512 |
| 182 | Ga0070707_100034000 | 3300005468 | Bacteria | 4863 |
| 183 | Ga0070707_100072471 | 3300005468 | Bacteria | 3320 |
| 184 | Ga0070698_100000385 | 3300005471 | Bacteria | 46316 |
| 185 | Ga0070698_100016037 | 3300005471 | Bacteria | 7912 |
| 186 | Ga0070698_100248411 | 3300005471 | Bacteria | 1712 |
| 187 | Ga0070698_100303010 | 3300005471 | Bacteria | 1529 |
| 188 | Ga0070699_100061274 | 3300005518 | Bacteria | 3261 |
| 189 | Ga0070699_100084611 | 3300005518 | Bacteria | 2768 |
| 190 | Ga0070699_100113220 | 3300005518 | Bacteria | 2383 |
| 191 | Ga0070699_100121194 | 3300005518 | Bacteria | 2300 |
| 192 | Ga0070699_100125417 | 3300005518 | Bacteria | 2260 |
| 193 | Ga0070679_100017481 | 3300005530 | Bacteria | 6942 |
| 194 | Ga0070679_100052278 | 3300005530 | Bacteria | 4070 |
| 195 | Ga0070679_100195639 | 3300005530 | Bacteria | 1989 |
| 196 | Ga0070679_100205341 | 3300005530 | Bacteria | 1935 |
| 197 | Ga0070684_100000068 | 3300005535 | Bacteria | 65538 |
| 198 | Ga0070684_100008077 | 3300005535 | Bacteria | 8216 |
| 199 | Ga0070684_100076425 | 3300005535 | Bacteria | 2956 |
| 200 | Ga0070684_100373888 | 3300005535 | Bacteria | 1312 |
| 201 | Ga0070697_100000531 | 3300005536 | Bacteria | 28705 |
| 202 | Ga0070697_100026023 | 3300005536 | Bacteria | 4668 |
| 203 | Ga0070697_100254576 | 3300005536 | Bacteria | 1502 |
| 204 | Ga0068853_100001165 | 3300005539 | Bacteria | 18691 |
| 205 | Ga0068853_100031112 | 3300005539 | Bacteria | 4513 |
| 206 | Ga0068853_100070822 | 3300005539 | Bacteria | 3035 |
| 207 | Ga0068853_100319535 | 3300005539 | Bacteria | 1439 |
| 208 | Ga0070672_100008106 | 3300005543 | Bacteria | 7178 |
| 209 | Ga0070672_100009511 | 3300005543 | Bacteria | 6706 |
| 210 | Ga0070672_100045467 | 3300005543 | Bacteria | 3396 |
| 211 | Ga0070672_100050492 | 3300005543 | Bacteria | 3240 |
| 212 | Ga0070672_100054107 | 3300005543 | Bacteria | 3141 |
| 213 | Ga0070672_100076644 | 3300005543 | Bacteria | 2671 |
| 214 | Ga0070672_100094364 | 3300005543 | Bacteria | 2419 |
| 215 | Ga0070672_100096073 | 3300005543 | Bacteria | 2397 |
| 216 | Ga0070686_100014154 | 3300005544 | Bacteria | 4590 |
| 217 | Ga0070686_100015831 | 3300005544 | Bacteria | 4377 |
| 218 | Ga0070686_100026116 | 3300005544 | Bacteria | 3521 |
| 219 | Ga0070695_100000155 | 3300005545 | Bacteria | 32258 |
| 220 | Ga0070695_100007901 | 3300005545 | Bacteria | 6297 |
| 221 | Ga0070696_100001294 | 3300005546 | Bacteria | 16298 |
| 222 | Ga0070696_100013489 | 3300005546 | Bacteria | 5483 |
| 223 | Ga0070696_100087670 | 3300005546 | Bacteria | 2211 |
| 224 | Ga0070665_100001535 | 3300005548 | Bacteria | 26671 |
| 225 | Ga0070665_100007098 | 3300005548 | Bacteria | 11381 |
| 226 | Ga0070665_100018061 | 3300005548 | Bacteria | 7079 |
| 227 | Ga0070665_100026106 | 3300005548 | Bacteria | 5881 |
| 228 | Ga0070665_100027580 | 3300005548 | Bacteria | 5720 |
| 229 | Ga0070665_100029554 | 3300005548 | Bacteria | 5516 |
| 230 | Ga0070665_100033893 | 3300005548 | Bacteria | 5136 |
| 231 | Ga0070704_100001112 | 3300005549 | Bacteria | 13983 |
| 232 | Ga0070704_100024108 | 3300005549 | Bacteria | 3987 |
| 233 | Ga0070704_100095590 | 3300005549 | Bacteria | 2226 |
| 234 | Ga0070704_100103968 | 3300005549 | Bacteria | 2146 |
| 235 | Ga0070704_100109444 | 3300005549 | Bacteria | 2099 |
| 236 | Ga0068855_100035919 | 3300005563 | Bacteria | 5901 |
| 237 | Ga0068855_100107978 | 3300005563 | Bacteria | 3197 |
| 238 | Ga0068855_100161260 | 3300005563 | Bacteria | 2545 |
| 239 | Ga0068855_100211604 | 3300005563 | Bacteria | 2178 |
| 240 | Ga0070664_100000408 | 3300005564 | Bacteria | 32016 |
| 241 | Ga0070664_100003040 | 3300005564 | Bacteria | 13569 |
| 242 | Ga0070664_100006808 | 3300005564 | Bacteria | 9216 |
| 243 | Ga0070664_100009215 | 3300005564 | Bacteria | 8013 |
| 244 | Ga0070664_100009579 | 3300005564 | Bacteria | 7856 |
| 245 | Ga0070664_100018914 | 3300005564 | Bacteria | 5663 |
| 246 | Ga0070664_100020599 | 3300005564 | Bacteria | 5431 |
| 247 | Ga0070664_100022888 | 3300005564 | Bacteria | 5155 |
| 248 | Ga0070664_100034123 | 3300005564 | Bacteria | 4267 |
| 249 | Ga0070664_100079530 | 3300005564 | Bacteria | 2822 |
| 250 | Ga0070664_100083244 | 3300005564 | Bacteria | 2760 |
| 251 | Ga0070664_100098220 | 3300005564 | Bacteria | 2543 |
| 252 | Ga0068857_100005029 | 3300005577 | Bacteria | 11239 |
| 253 | Ga0068857_100017945 | 3300005577 | Bacteria | 6206 |
| 254 | Ga0068857_100044957 | 3300005577 | Bacteria | 3917 |
| 255 | Ga0068857_100048598 | 3300005577 | Bacteria | 3766 |
| 256 | Ga0068857_100307235 | 3300005577 | Bacteria | 1463 |
| 257 | Ga0068854_100141939 | 3300005578 | Bacteria | 1844 |
| 258 | Ga0068856_100351940 | 3300005614 | Bacteria | 1491 |
| 259 | Ga0068856_100399033 | 3300005614 | Bacteria | 1395 |
| 260 | Ga0070702_100008655 | 3300005615 | Bacteria | 4941 |
| 261 | Ga0068859_100005622 | 3300005617 | Bacteria | 12779 |
| 262 | Ga0068859_100013051 | 3300005617 | Bacteria | 8348 |
| 263 | Ga0068859_100016091 | 3300005617 | Bacteria | 7514 |
| 264 | Ga0068859_100034153 | 3300005617 | Bacteria | 5105 |
| 265 | Ga0068859_100078549 | 3300005617 | Bacteria | 3341 |
| 266 | Ga0068859_100095218 | 3300005617 | Bacteria | 3030 |
| 267 | Ga0068859_100170825 | 3300005617 | Bacteria | 2255 |
| 268 | Ga0068859_100179049 | 3300005617 | Bacteria | 2202 |
| 269 | Ga0068859_100180719 | 3300005617 | Bacteria | 2192 |
| 270 | Ga0068859_100360208 | 3300005617 | Bacteria | 1549 |
| 271 | Ga0068864_100030720 | 3300005618 | Bacteria | 4555 |
| 272 | Ga0068864_100125410 | 3300005618 | Bacteria | 2300 |
| 273 | Ga0068864_100307422 | 3300005618 | Bacteria | 1486 |
| 274 | Ga0068861_100004593 | 3300005719 | Bacteria | 9265 |
| 275 | Ga0068861_100005603 | 3300005719 | Bacteria | 8510 |
| 276 | Ga0068861_100005906 | 3300005719 | Bacteria | 8319 |
| 277 | Ga0068861_100048764 | 3300005719 | Bacteria | 3203 |
| 278 | Ga0068861_100063982 | 3300005719 | Bacteria | 2829 |
| 279 | Ga0068861_100261353 | 3300005719 | Bacteria | 1482 |
| 280 | Ga0068870_10002305 | 3300005840 | Bacteria | 7927 |
| 281 | Ga0068870_10002884 | 3300005840 | Bacteria | 7243 |
| 282 | Ga0068870_10005642 | 3300005840 | Bacteria | 5474 |
| 283 | Ga0068870_10182307 | 3300005840 | Bacteria | 1261 |
| 284 | Ga0068863_100021750 | 3300005841 | Bacteria | 6119 |
| 285 | Ga0068863_100063750 | 3300005841 | Bacteria | 3485 |
| 286 | Ga0068863_100072609 | 3300005841 | Bacteria | 3255 |
| 287 | Ga0068863_100151036 | 3300005841 | Bacteria | 2222 |
| 288 | Ga0068858_100040590 | 3300005842 | Bacteria | 4316 |
| 289 | Ga0068858_100049335 | 3300005842 | Bacteria | 3898 |
| 290 | Ga0068858_100125856 | 3300005842 | Bacteria | 2400 |
| 291 | Ga0068858_100128307 | 3300005842 | Bacteria | 2377 |
| 292 | Ga0068858_100180231 | 3300005842 | Bacteria | 1994 |
| 293 | Ga0068858_100213540 | 3300005842 | Bacteria | 1826 |
| 294 | Ga0068860_100018392 | 3300005843 | Bacteria | 6798 |
| 295 | Ga0068860_100032227 | 3300005843 | Bacteria | 5037 |
| 296 | Ga0068860_100058145 | 3300005843 | Bacteria | 3675 |
| 297 | Ga0068860_100081629 | 3300005843 | Bacteria | 3074 |
| 298 | Ga0068860_100285269 | 3300005843 | Bacteria | 1614 |
| 299 | Ga0068862_100001571 | 3300005844 | Bacteria | 20810 |
| 300 | Ga0068862_100002276 | 3300005844 | Bacteria | 17181 |
| 301 | Ga0068862_100013045 | 3300005844 | Bacteria | 6874 |
| 302 | Ga0068862_100044380 | 3300005844 | Bacteria | 3791 |
| 303 | Ga0068862_100046669 | 3300005844 | Bacteria | 3695 |
| 304 | Ga0068862_100073499 | 3300005844 | Bacteria | 2955 |
| 305 | Ga0068862_100191372 | 3300005844 | Bacteria | 1841 |
| 306 | Ga0068862_100201759 | 3300005844 | Bacteria | 1794 |
| 307 | Ga0081540_1074489 | 3300005983 | Bacteria | 1555 |
| 308 | Ga0081539_10000093 | 3300005985 | Bacteria | 207314 |
| 309 | Ga0081539_10001136 | 3300005985 | Bacteria | 48290 |
| 310 | Ga0081539_10005341 | 3300005985 | Bacteria | 13186 |
| 311 | Ga0081539_10009311 | 3300005985 | Bacteria | 8244 |
| 312 | Ga0081539_10057781 | 3300005985 | Bacteria | 2144 |
| 313 | Ga0070717_10030097 | 3300006028 | Bacteria | 4361 |
| 314 | Ga0070717_10032785 | 3300006028 | Bacteria | 4187 |
| 315 | Ga0070717_10336150 | 3300006028 | Bacteria | 1348 |
| 316 | Ga0075368_10001899 | 3300006042 | Bacteria | 6713 |
| 317 | Ga0075364_10000845 | 3300006051 | Bacteria | 16154 |
| 318 | Ga0075364_10005410 | 3300006051 | Bacteria | 7414 |
| 319 | Ga0075364_10038968 | 3300006051 | Bacteria | 3080 |
| 320 | Ga0075432_10055550 | 3300006058 | Bacteria | 1403 |
| 321 | Ga0075367_10020967 | 3300006178 | Bacteria | 3647 |
| 322 | Ga0075367_10055547 | 3300006178 | Bacteria | 2350 |
| 323 | Ga0075367_10101443 | 3300006178 | Bacteria | 1760 |
| 324 | Ga0075369_10008604 | 3300006186 | Bacteria | 3934 |
| 325 | Ga0097621_100043570 | 3300006237 | Bacteria | 3618 |
| 326 | Ga0097621_100096262 | 3300006237 | Bacteria | 2484 |
| 327 | Ga0097621_100147311 | 3300006237 | Bacteria | 2017 |
| 328 | Ga0097621_100164616 | 3300006237 | Bacteria | 1908 |
| 329 | Ga0068871_100015620 | 3300006358 | Bacteria | 5689 |
| 330 | Ga0068871_100019830 | 3300006358 | Bacteria | 5139 |
| 331 | Ga0068871_100256782 | 3300006358 | Bacteria | 1523 |
| 332 | Ga0075428_100005558 | 3300006844 | Bacteria | 14020 |
| 333 | Ga0075428_100007739 | 3300006844 | Bacteria | 11908 |
| 334 | Ga0075428_100008259 | 3300006844 | Bacteria | 11544 |
| 335 | Ga0075428_100011749 | 3300006844 | Bacteria | 9748 |
| 336 | Ga0075428_100012298 | 3300006844 | Bacteria | 9519 |
| 337 | Ga0075428_100022458 | 3300006844 | Bacteria | 6987 |
| 338 | Ga0075428_100036930 | 3300006844 | Bacteria | 5380 |
| 339 | Ga0075428_100050593 | 3300006844 | Bacteria | 4556 |
| 340 | Ga0075428_100145289 | 3300006844 | Bacteria | 2578 |
| 341 | Ga0075430_100001572 | 3300006846 | Bacteria | 18678 |
| 342 | Ga0075430_100013858 | 3300006846 | Bacteria | 6870 |
| 343 | Ga0075430_100025892 | 3300006846 | Bacteria | 4992 |
| 344 | Ga0075430_100068808 | 3300006846 | Bacteria | 2970 |
| 345 | Ga0075430_100088985 | 3300006846 | Bacteria | 2583 |
| 346 | Ga0075430_100130023 | 3300006846 | Bacteria | 2099 |
| 347 | Ga0075430_100170800 | 3300006846 | Bacteria | 1809 |
| 348 | Ga0075430_100218642 | 3300006846 | Bacteria | 1581 |
| 349 | Ga0075430_100240510 | 3300006846 | Bacteria | 1500 |
| 350 | Ga0075430_100326639 | 3300006846 | Bacteria | 1268 |
| 351 | Ga0075431_100002075 | 3300006847 | Bacteria | 19135 |
| 352 | Ga0075431_100007891 | 3300006847 | Bacteria | 10607 |
| 353 | Ga0075431_100014890 | 3300006847 | Bacteria | 7874 |
| 354 | Ga0075431_100039560 | 3300006847 | Bacteria | 4858 |
| 355 | Ga0075431_100041811 | 3300006847 | Bacteria | 4727 |
| 356 | Ga0075431_100097958 | 3300006847 | Bacteria | 3028 |
| 357 | Ga0075431_100118566 | 3300006847 | Bacteria | 2731 |
| 358 | Ga0075431_100145261 | 3300006847 | Bacteria | 2445 |
| 359 | Ga0075431_100206996 | 3300006847 | Bacteria | 2005 |
| 360 | Ga0075431_100207846 | 3300006847 | Bacteria | 2001 |
| 361 | Ga0075431_100340241 | 3300006847 | Bacteria | 1510 |
| 362 | Ga0075433_10008088 | 3300006852 | Bacteria | 8375 |
| 363 | Ga0075433_10014399 | 3300006852 | Bacteria | 6460 |
| 364 | Ga0075433_10022099 | 3300006852 | Bacteria | 5340 |
| 365 | Ga0075433_10024458 | 3300006852 | Bacteria | 5098 |
| 366 | Ga0075433_10031125 | 3300006852 | Bacteria | 4559 |
| 367 | Ga0075433_10031541 | 3300006852 | Bacteria | 4531 |
| 368 | Ga0075433_10040375 | 3300006852 | Bacteria | 4039 |
| 369 | Ga0075433_10047106 | 3300006852 | Bacteria | 3750 |
| 370 | Ga0075433_10189420 | 3300006852 | Bacteria | 1830 |
| 371 | Ga0075434_100000553 | 3300006871 | Bacteria | 28642 |
| 372 | Ga0075434_100000585 | 3300006871 | Bacteria | 28096 |
| 373 | Ga0075434_100002096 | 3300006871 | Bacteria | 17342 |
| 374 | Ga0075434_100002820 | 3300006871 | Bacteria | 15389 |
| 375 | Ga0075434_100004979 | 3300006871 | Bacteria | 12051 |
| 376 | Ga0075434_100013018 | 3300006871 | Bacteria | 7899 |
| 377 | Ga0075434_100015822 | 3300006871 | Bacteria | 7243 |
| 378 | Ga0075434_100021087 | 3300006871 | Bacteria | 6332 |
| 379 | Ga0075434_100043606 | 3300006871 | Bacteria | 4449 |
| 380 | Ga0075434_100075410 | 3300006871 | Bacteria | 3366 |
| 381 | Ga0075434_100082612 | 3300006871 | Bacteria | 3210 |
| 382 | Ga0075434_100158591 | 3300006871 | Bacteria | 2282 |
| 383 | Ga0075434_100334843 | 3300006871 | Bacteria | 1534 |
| 384 | Ga0075429_100000181 | 3300006880 | Bacteria | 41066 |
| 385 | Ga0075429_100002380 | 3300006880 | Bacteria | 15838 |
| 386 | Ga0075429_100005278 | 3300006880 | Bacteria | 11114 |
| 387 | Ga0075429_100024452 | 3300006880 | Bacteria | 5241 |
| 388 | Ga0075429_100048639 | 3300006880 | Bacteria | 3687 |
| 389 | Ga0075429_100118964 | 3300006880 | Bacteria | 2308 |
| 390 | Ga0075429_100189523 | 3300006880 | Bacteria | 1802 |
| 391 | Ga0068865_100012596 | 3300006881 | Bacteria | 5328 |
| 392 | Ga0068865_100016005 | 3300006881 | Bacteria | 4790 |
| 393 | Ga0068865_100262524 | 3300006881 | Bacteria | 1368 |
| 394 | Ga0075436_100000199 | 3300006914 | Bacteria | 37237 |
| 395 | Ga0075436_100005822 | 3300006914 | Bacteria | 8461 |
| 396 | Ga0075436_100006076 | 3300006914 | Bacteria | 8288 |
| 397 | Ga0075436_100009367 | 3300006914 | Bacteria | 6695 |
| 398 | Ga0075436_100026590 | 3300006914 | Bacteria | 3984 |
| 399 | Ga0097620_100005622 | 3300006931 | Bacteria | 12779 |
| 400 | Ga0097620_100013051 | 3300006931 | Bacteria | 8348 |
| 401 | Ga0097620_100016090 | 3300006931 | Bacteria | 7514 |
| 402 | Ga0097620_100034155 | 3300006931 | Bacteria | 5105 |
| 403 | Ga0097620_100078547 | 3300006931 | Bacteria | 3341 |
| 404 | Ga0097620_100095218 | 3300006931 | Bacteria | 3030 |
| 405 | Ga0097620_100170820 | 3300006931 | Bacteria | 2255 |
| 406 | Ga0097620_100179047 | 3300006931 | Bacteria | 2202 |
| 407 | Ga0097620_100180721 | 3300006931 | Bacteria | 2192 |
| 408 | Ga0097620_100360230 | 3300006931 | Bacteria | 1549 |
| 409 | Ga0099826_10000468 | 3300006948 | Bacteria | 19486 |
| 410 | Ga0099826_10014757 | 3300006948 | Bacteria | 5901 |
| 411 | Ga0075435_100000052 | 3300007076 | Bacteria | 58955 |
| 412 | Ga0075435_100009595 | 3300007076 | Bacteria | 7022 |
| 413 | Ga0075435_100022726 | 3300007076 | Bacteria | 4840 |
| 414 | Ga0075435_100044354 | 3300007076 | Bacteria | 3562 |
| 415 | Ga0075435_100074365 | 3300007076 | Bacteria | 2779 |
| 416 | Ga0075435_100088232 | 3300007076 | Bacteria | 2556 |
| 417 | Ga0099794_10005403 | 3300007265 | Bacteria | 5118 |
| 418 | Ga0105240_10009442 | 3300009093 | Bacteria | 13809 |
| 419 | Ga0105240_10089919 | 3300009093 | Bacteria | 3754 |
| 420 | Ga0105240_10107198 | 3300009093 | Bacteria | 3388 |
| 421 | Ga0105240_10134551 | 3300009093 | Bacteria | 2961 |
| 422 | Ga0105240_10213176 | 3300009093 | Bacteria | 2255 |
| 423 | Ga0105240_10374214 | 3300009093 | Bacteria | 1610 |
| 424 | Ga0111539_10000324 | 3300009094 | Bacteria | 58406 |
| 425 | Ga0111539_10003328 | 3300009094 | Bacteria | 21227 |
| 426 | Ga0111539_10003636 | 3300009094 | Bacteria | 20314 |
| 427 | Ga0111539_10006989 | 3300009094 | Bacteria | 14477 |
| 428 | Ga0111539_10022595 | 3300009094 | Bacteria | 7727 |
| 429 | Ga0111539_10028372 | 3300009094 | Bacteria | 6830 |
| 430 | Ga0111539_10037755 | 3300009094 | Bacteria | 5831 |
| 431 | Ga0111539_10041079 | 3300009094 | Bacteria | 5564 |
| 432 | Ga0111539_10060627 | 3300009094 | Bacteria | 4483 |
| 433 | Ga0111539_10068797 | 3300009094 | Bacteria | 4180 |
| 434 | Ga0111539_10105503 | 3300009094 | Bacteria | 3306 |
| 435 | Ga0111539_10118098 | 3300009094 | Bacteria | 3108 |
| 436 | Ga0111539_10135625 | 3300009094 | Bacteria | 2882 |
| 437 | Ga0111539_10144567 | 3300009094 | Bacteria | 2784 |
| 438 | Ga0111539_10154542 | 3300009094 | Bacteria | 2685 |
| 439 | Ga0111539_10312479 | 3300009094 | Bacteria | 1829 |
| 440 | Ga0105245_10084662 | 3300009098 | Bacteria | 2906 |
| 441 | Ga0105245_10106002 | 3300009098 | Bacteria | 2607 |
| 442 | Ga0105245_10148397 | 3300009098 | Bacteria | 2215 |
| 443 | Ga0105247_10031422 | 3300009101 | Bacteria | 3222 |
| 444 | Ga0105247_10040785 | 3300009101 | Bacteria | 2839 |
| 445 | Ga0105247_10063593 | 3300009101 | Bacteria | 2291 |
| 446 | Ga0105247_10104426 | 3300009101 | Bacteria | 1815 |
| 447 | Ga0114129_10000307 | 3300009147 | Bacteria | 57086 |
| 448 | Ga0114129_10000588 | 3300009147 | Bacteria | 44911 |
| 449 | Ga0114129_10006012 | 3300009147 | Bacteria | 17200 |
| 450 | Ga0114129_10006290 | 3300009147 | Bacteria | 16838 |
| 451 | Ga0114129_10006879 | 3300009147 | Bacteria | 16174 |
| 452 | Ga0114129_10007407 | 3300009147 | Bacteria | 15621 |
| 453 | Ga0114129_10010731 | 3300009147 | Bacteria | 13060 |
| 454 | Ga0114129_10012882 | 3300009147 | Bacteria | 11900 |
| 455 | Ga0114129_10021924 | 3300009147 | Bacteria | 9065 |
| 456 | Ga0114129_10033704 | 3300009147 | Bacteria | 7236 |
| 457 | Ga0114129_10047465 | 3300009147 | Bacteria | 6033 |
| 458 | Ga0114129_10047748 | 3300009147 | Bacteria | 6014 |
| 459 | Ga0114129_10061111 | 3300009147 | Bacteria | 5266 |
| 460 | Ga0114129_10071975 | 3300009147 | Bacteria | 4820 |
| 461 | Ga0114129_10079382 | 3300009147 | Bacteria | 4563 |
| 462 | Ga0114129_10106093 | 3300009147 | Bacteria | 3881 |
| 463 | Ga0114129_10156558 | 3300009147 | Bacteria | 3115 |
| 464 | Ga0114129_10177608 | 3300009147 | Bacteria | 2899 |
| 465 | Ga0114129_10268119 | 3300009147 | Bacteria | 2285 |
| 466 | Ga0114129_10380637 | 3300009147 | Bacteria | 1864 |
| 467 | Ga0114129_10587841 | 3300009147 | Bacteria | 1444 |
| 468 | Ga0114129_10752778 | 3300009147 | Bacteria | 1247 |
| 469 | Ga0105243_10019426 | 3300009148 | Bacteria | 5152 |
| 470 | Ga0105243_10030455 | 3300009148 | Bacteria | 4154 |
| 471 | Ga0105243_10041278 | 3300009148 | Bacteria | 3608 |
| 472 | Ga0105243_10101663 | 3300009148 | Bacteria | 2387 |
| 473 | Ga0105243_10247838 | 3300009148 | Bacteria | 1589 |
| 474 | Ga0105243_10273776 | 3300009148 | Bacteria | 1517 |
| 475 | Ga0105243_10408312 | 3300009148 | Bacteria | 1263 |
| 476 | Ga0105242_10009410 | 3300009176 | Bacteria | 7494 |
| 477 | Ga0105242_10016448 | 3300009176 | Bacteria | 5751 |
| 478 | Ga0105242_10060137 | 3300009176 | Bacteria | 3120 |
| 479 | Ga0105248_10000664 | 3300009177 | Bacteria | 39095 |
| 480 | Ga0105248_10002959 | 3300009177 | Bacteria | 18822 |
| 481 | Ga0105248_10014897 | 3300009177 | Bacteria | 8562 |
| 482 | Ga0105248_10043880 | 3300009177 | Bacteria | 5015 |
| 483 | Ga0105248_10063176 | 3300009177 | Bacteria | 4156 |
| 484 | Ga0105248_10092522 | 3300009177 | Bacteria | 3406 |
| 485 | Ga0105248_10108361 | 3300009177 | Bacteria | 3132 |
| 486 | Ga0105248_10167554 | 3300009177 | Bacteria | 2476 |
| 487 | Ga0105248_10337990 | 3300009177 | Bacteria | 1695 |
| 488 | Ga0105248_10400700 | 3300009177 | Bacteria | 1545 |
| 489 | Ga0105248_10439837 | 3300009177 | Bacteria | 1469 |
| 490 | Ga0105237_10028798 | 3300009545 | Bacteria | 5652 |
| 491 | Ga0105237_10079291 | 3300009545 | Bacteria | 3274 |
| 492 | Ga0105237_10491492 | 3300009545 | Bacteria | 1234 |
| 493 | Ga0105238_10016494 | 3300009551 | Bacteria | 7477 |
| 494 | Ga0105249_10000733 | 3300009553 | Bacteria | 29716 |
| 495 | Ga0105249_10015979 | 3300009553 | Bacteria | 6654 |
| 496 | Ga0105249_10063199 | 3300009553 | Bacteria | 3401 |
| 497 | Ga0105249_10101884 | 3300009553 | Bacteria | 2701 |
| 498 | Ga0105249_10183723 | 3300009553 | Bacteria | 2036 |
| 499 | Ga0105249_10207017 | 3300009553 | Bacteria | 1923 |
| 500 | Ga0105239_10241031 | 3300010375 | Bacteria | 2029 |
| 501 | Ga0105246_10010820 | 3300011119 | Bacteria | 5653 |
| 502 | Ga0105246_10029966 | 3300011119 | Bacteria | 3589 |
| 503 | Ga0157373_10066988 | 3300013100 | Bacteria | 2539 |
| 504 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 505 | Ga0157371_10037856 | 3300013102 | Bacteria | 3452 |
| 506 | Ga0157370_10000469 | 3300013104 | Bacteria | 50288 |
| 507 | Ga0157370_10025074 | 3300013104 | Bacteria | 5903 |
| 508 | Ga0157370_10108404 | 3300013104 | Bacteria | 2597 |
| 509 | Ga0157369_10013530 | 3300013105 | Bacteria | 9221 |
| 510 | Ga0157369_10043197 | 3300013105 | Bacteria | 4914 |
| 511 | Ga0157369_10051341 | 3300013105 | Bacteria | 4463 |
| 512 | Ga0157369_10056570 | 3300013105 | Bacteria | 4232 |
| 513 | Ga0157369_10125898 | 3300013105 | Bacteria | 2717 |
| 514 | Ga0157374_10000448 | 3300013296 | Bacteria | 37472 |
| 515 | Ga0157374_10012030 | 3300013296 | Bacteria | 7514 |
| 516 | Ga0157374_10072301 | 3300013296 | Bacteria | 3254 |
| 517 | Ga0157374_10184870 | 3300013296 | Bacteria | 2037 |
| 518 | Ga0157378_10004264 | 3300013297 | Bacteria | 12605 |
| 519 | Ga0157378_10005712 | 3300013297 | Bacteria | 10889 |
| 520 | Ga0163162_10000786 | 3300013306 | Bacteria | 29494 |
| 521 | Ga0163162_10016252 | 3300013306 | Bacteria | 7279 |
| 522 | Ga0163162_10070083 | 3300013306 | Bacteria | 3558 |
| 523 | Ga0163162_10209555 | 3300013306 | Bacteria | 2078 |
| 524 | Ga0157372_10001231 | 3300013307 | Bacteria | 27702 |
| 525 | Ga0157372_10004537 | 3300013307 | Bacteria | 14784 |
| 526 | Ga0157372_10054256 | 3300013307 | Bacteria | 4470 |
| 527 | Ga0157375_10000071 | 3300013308 | Bacteria | 107825 |
| 528 | Ga0157375_10013991 | 3300013308 | Bacteria | 7155 |
| 529 | Ga0157375_10191624 | 3300013308 | Bacteria | 2199 |
| 530 | Ga0163163_10001107 | 3300014325 | Bacteria | 22902 |
| 531 | Ga0163163_10013130 | 3300014325 | Bacteria | 7568 |
| 532 | Ga0163163_10024898 | 3300014325 | Bacteria | 5699 |
| 533 | Ga0163163_10030622 | 3300014325 | Bacteria | 5186 |
| 534 | Ga0163163_10041518 | 3300014325 | Bacteria | 4499 |
| 535 | Ga0163163_10051444 | 3300014325 | Bacteria | 4063 |
| 536 | Ga0163163_10057531 | 3300014325 | Bacteria | 3845 |
| 537 | Ga0157380_10001766 | 3300014326 | Bacteria | 14272 |
| 538 | Ga0157380_10007787 | 3300014326 | Bacteria | 7622 |
| 539 | Ga0157380_10012368 | 3300014326 | Bacteria | 6192 |
| 540 | Ga0157380_10017341 | 3300014326 | Bacteria | 5328 |
| 541 | Ga0157380_10046144 | 3300014326 | Bacteria | 3421 |
| 542 | Ga0157380_10238364 | 3300014326 | Bacteria | 1638 |
| 543 | Ga0157380_10261166 | 3300014326 | Bacteria | 1573 |
| 544 | Ga0157380_10309771 | 3300014326 | Bacteria | 1459 |
| 545 | Ga0157380_10377125 | 3300014326 | Bacteria | 1337 |
| 546 | Ga0157377_10017766 | 3300014745 | Bacteria | 3686 |
| 547 | Ga0157377_10018790 | 3300014745 | Bacteria | 3599 |
| 548 | Ga0157377_10020665 | 3300014745 | Bacteria | 3452 |
| 549 | Ga0157379_10005094 | 3300014968 | Bacteria | 11270 |
| 550 | Ga0157379_10011426 | 3300014968 | Bacteria | 7750 |
| 551 | Ga0157379_10016218 | 3300014968 | Bacteria | 6555 |
| 552 | Ga0157379_10024070 | 3300014968 | Bacteria | 5404 |
| 553 | Ga0157379_10029043 | 3300014968 | Bacteria | 4917 |
| 554 | Ga0157379_10038695 | 3300014968 | Bacteria | 4255 |
| 555 | Ga0157379_10145854 | 3300014968 | Bacteria | 2134 |
| 556 | Ga0157376_10018769 | 3300014969 | Bacteria | 5313 |
| 557 | Ga0157376_10051739 | 3300014969 | Bacteria | 3412 |
| 558 | Ga0157376_10641973 | 3300014969 | Bacteria | 1061 |
| 559 | Ga0163161_10008043 | 3300017792 | Bacteria | 7296 |
| 560 | Ga0163161_10124937 | 3300017792 | Bacteria | 1936 |
| 561 | Ga0213872_10005421 | 3300021361 | Bacteria | 6571 |
| 562 | Ga0224569_101166 | 3300022732 | Bacteria | 2231 |
| 563 | Ga0224572_1006723 | 3300024225 | Bacteria | 2086 |
| 564 | Ga0224572_1007427 | 3300024225 | Bacteria | 2007 |
| 565 | Ga0228598_1004755 | 3300024227 | Bacteria | 2869 |
| 566 | Ga0209025_1001274 | 3300025294 | Bacteria | 34655 |
| 567 | Ga0207697_10001972 | 3300025315 | Bacteria | 10876 |
| 568 | Ga0207697_10026903 | 3300025315 | Bacteria | 2353 |
| 569 | Ga0207682_10000256 | 3300025893 | Bacteria | 23951 |
| 570 | Ga0207682_10005491 | 3300025893 | Bacteria | 5164 |
| 571 | Ga0207682_10028497 | 3300025893 | Bacteria | 2229 |
| 572 | Ga0207682_10036900 | 3300025893 | Bacteria | 1979 |
| 573 | Ga0207682_10058240 | 3300025893 | Bacteria | 1612 |
| 574 | Ga0207710_10060582 | 3300025900 | Bacteria | 1716 |
| 575 | Ga0207710_10083931 | 3300025900 | Bacteria | 1482 |
| 576 | Ga0207688_10001374 | 3300025901 | Bacteria | 12628 |
| 577 | Ga0207688_10001964 | 3300025901 | Bacteria | 11030 |
| 578 | Ga0207688_10135358 | 3300025901 | Bacteria | 1447 |
| 579 | Ga0207680_10007138 | 3300025903 | Bacteria | 5432 |
| 580 | Ga0207680_10110641 | 3300025903 | Bacteria | 1781 |
| 581 | Ga0207685_10004015 | 3300025905 | Bacteria | 3674 |
| 582 | Ga0207685_10099142 | 3300025905 | Bacteria | 1242 |
| 583 | Ga0207699_10003844 | 3300025906 | Bacteria | 7170 |
| 584 | Ga0207699_10072534 | 3300025906 | Bacteria | 2109 |
| 585 | Ga0207645_10001189 | 3300025907 | Bacteria | 21501 |
| 586 | Ga0207645_10001887 | 3300025907 | Bacteria | 16929 |
| 587 | Ga0207645_10003038 | 3300025907 | Bacteria | 12916 |
| 588 | Ga0207645_10006720 | 3300025907 | Bacteria | 8222 |
| 589 | Ga0207645_10012432 | 3300025907 | Bacteria | 5774 |
| 590 | Ga0207645_10016102 | 3300025907 | Bacteria | 4951 |
| 591 | Ga0207645_10031135 | 3300025907 | Bacteria | 3434 |
| 592 | Ga0207645_10047028 | 3300025907 | Bacteria | 2755 |
| 593 | Ga0207643_10000976 | 3300025908 | Bacteria | 17187 |
| 594 | Ga0207643_10002349 | 3300025908 | Bacteria | 10283 |
| 595 | Ga0207643_10008592 | 3300025908 | Bacteria | 5477 |
| 596 | Ga0207643_10016621 | 3300025908 | Bacteria | 4013 |
| 597 | Ga0207705_10000463 | 3300025909 | Bacteria | 34773 |
| 598 | Ga0207705_10014605 | 3300025909 | Bacteria | 5651 |
| 599 | Ga0207684_10003705 | 3300025910 | Bacteria | 14798 |
| 600 | Ga0207684_10147145 | 3300025910 | Bacteria | 2026 |
| 601 | Ga0207707_10096218 | 3300025912 | Bacteria | 2588 |
| 602 | Ga0207707_10107009 | 3300025912 | Bacteria | 2445 |
| 603 | Ga0207707_10167535 | 3300025912 | Bacteria | 1920 |
| 604 | Ga0207707_10239421 | 3300025912 | Bacteria | 1578 |
| 605 | Ga0207695_10057888 | 3300025913 | Bacteria | 4025 |
| 606 | Ga0207695_10161907 | 3300025913 | Bacteria | 2169 |
| 607 | Ga0207695_10250619 | 3300025913 | Bacteria | 1670 |
| 608 | Ga0207695_10266080 | 3300025913 | Bacteria | 1611 |
| 609 | Ga0207663_10000017 | 3300025916 | Bacteria | 145654 |
| 610 | Ga0207660_10051507 | 3300025917 | Bacteria | 2927 |
| 611 | Ga0207660_10057403 | 3300025917 | Bacteria | 2788 |
| 612 | Ga0207660_10071756 | 3300025917 | Bacteria | 2520 |
| 613 | Ga0207660_10111115 | 3300025917 | Bacteria | 2063 |
| 614 | Ga0207662_10001582 | 3300025918 | Bacteria | 11148 |
| 615 | Ga0207662_10003401 | 3300025918 | Bacteria | 8183 |
| 616 | Ga0207662_10022645 | 3300025918 | Bacteria | 3604 |
| 617 | Ga0207657_10006664 | 3300025919 | Bacteria | 11951 |
| 618 | Ga0207657_10067071 | 3300025919 | Bacteria | 3053 |
| 619 | Ga0207649_10052175 | 3300025920 | Bacteria | 2536 |
| 620 | Ga0207649_10090297 | 3300025920 | Bacteria | 2004 |
| 621 | Ga0207649_10175712 | 3300025920 | Bacteria | 1495 |
| 622 | Ga0207649_10197291 | 3300025920 | Bacteria | 1419 |
| 623 | Ga0207652_10014267 | 3300025921 | Bacteria | 6434 |
| 624 | Ga0207652_10171519 | 3300025921 | Bacteria | 1947 |
| 625 | Ga0207652_10186904 | 3300025921 | Bacteria | 1863 |
| 626 | Ga0207652_10198088 | 3300025921 | Bacteria | 1807 |
| 627 | Ga0207646_10000400 | 3300025922 | Bacteria | 58084 |
| 628 | Ga0207646_10000801 | 3300025922 | Bacteria | 40960 |
| 629 | Ga0207646_10116073 | 3300025922 | Bacteria | 2404 |
| 630 | Ga0207681_10000315 | 3300025923 | Bacteria | 35258 |
| 631 | Ga0207681_10002837 | 3300025923 | Bacteria | 10966 |
| 632 | Ga0207681_10006093 | 3300025923 | Bacteria | 7396 |
| 633 | Ga0207681_10008989 | 3300025923 | Bacteria | 6102 |
| 634 | Ga0207681_10016410 | 3300025923 | Bacteria | 4633 |
| 635 | Ga0207681_10021025 | 3300025923 | Bacteria | 4143 |
| 636 | Ga0207681_10042735 | 3300025923 | Bacteria | 3029 |
| 637 | Ga0207681_10061138 | 3300025923 | Bacteria | 2588 |
| 638 | Ga0207681_10137941 | 3300025923 | Bacteria | 1813 |
| 639 | Ga0207694_10009664 | 3300025924 | Bacteria | 7270 |
| 640 | Ga0207650_10001649 | 3300025925 | Bacteria | 15896 |
| 641 | Ga0207650_10038085 | 3300025925 | Bacteria | 3508 |
| 642 | Ga0207650_10089593 | 3300025925 | Bacteria | 2348 |
| 643 | Ga0207650_10101156 | 3300025925 | Bacteria | 2218 |
| 644 | Ga0207659_10000076 | 3300025926 | Bacteria | 62373 |
| 645 | Ga0207659_10001426 | 3300025926 | Bacteria | 14241 |
| 646 | Ga0207659_10001726 | 3300025926 | Bacteria | 12952 |
| 647 | Ga0207659_10001830 | 3300025926 | Bacteria | 12597 |
| 648 | Ga0207659_10003364 | 3300025926 | Bacteria | 9591 |
| 649 | Ga0207659_10055289 | 3300025926 | Bacteria | 2838 |
| 650 | Ga0207659_10062162 | 3300025926 | Bacteria | 2694 |
| 651 | Ga0207659_10084529 | 3300025926 | Bacteria | 2355 |
| 652 | Ga0207659_10117700 | 3300025926 | Bacteria | 2031 |
| 653 | Ga0207687_10046812 | 3300025927 | Bacteria | 2996 |
| 654 | Ga0207687_10121323 | 3300025927 | Bacteria | 1955 |
| 655 | Ga0207700_10053462 | 3300025928 | Bacteria | 3026 |
| 656 | Ga0207664_10119175 | 3300025929 | Bacteria | 2206 |
| 657 | Ga0207644_10000485 | 3300025931 | Bacteria | 25573 |
| 658 | Ga0207644_10004067 | 3300025931 | Bacteria | 9485 |
| 659 | Ga0207644_10027107 | 3300025931 | Bacteria | 3956 |
| 660 | Ga0207690_10025745 | 3300025932 | Bacteria | 3698 |
| 661 | Ga0207690_10184452 | 3300025932 | Bacteria | 1573 |
| 662 | Ga0207706_10002610 | 3300025933 | Bacteria | 17550 |
| 663 | Ga0207706_10009806 | 3300025933 | Bacteria | 8787 |
| 664 | Ga0207706_10013693 | 3300025933 | Bacteria | 7361 |
| 665 | Ga0207706_10018234 | 3300025933 | Bacteria | 6315 |
| 666 | Ga0207706_10029383 | 3300025933 | Bacteria | 4907 |
| 667 | Ga0207706_10039016 | 3300025933 | Bacteria | 4212 |
| 668 | Ga0207706_10055474 | 3300025933 | Bacteria | 3494 |
| 669 | Ga0207706_10135755 | 3300025933 | Bacteria | 2164 |
| 670 | Ga0207686_10128298 | 3300025934 | Bacteria | 1736 |
| 671 | Ga0207709_10017122 | 3300025935 | Bacteria | 4040 |
| 672 | Ga0207709_10018785 | 3300025935 | Bacteria | 3876 |
| 673 | Ga0207709_10024069 | 3300025935 | Bacteria | 3473 |
| 674 | Ga0207709_10046837 | 3300025935 | Bacteria | 2626 |
| 675 | Ga0207670_10051802 | 3300025936 | Bacteria | 2758 |
| 676 | Ga0207670_10063216 | 3300025936 | Bacteria | 2532 |
| 677 | Ga0207670_10070850 | 3300025936 | Bacteria | 2409 |
| 678 | Ga0207670_10095177 | 3300025936 | Bacteria | 2115 |
| 679 | Ga0207670_10212999 | 3300025936 | Bacteria | 1474 |
| 680 | Ga0207669_10019434 | 3300025937 | Bacteria | 3537 |
| 681 | Ga0207669_10198810 | 3300025937 | Bacteria | 1453 |
| 682 | Ga0207704_10033108 | 3300025938 | Bacteria | 2935 |
| 683 | Ga0207704_10042299 | 3300025938 | Bacteria | 2681 |
| 684 | Ga0207704_10099216 | 3300025938 | Bacteria | 1937 |
| 685 | Ga0207665_10005573 | 3300025939 | Bacteria | 8393 |
| 686 | Ga0207665_10017374 | 3300025939 | Bacteria | 4728 |
| 687 | Ga0207691_10001612 | 3300025940 | Bacteria | 22421 |
| 688 | Ga0207691_10007302 | 3300025940 | Bacteria | 10665 |
| 689 | Ga0207691_10011138 | 3300025940 | Bacteria | 8631 |
| 690 | Ga0207691_10016959 | 3300025940 | Bacteria | 6911 |
| 691 | Ga0207691_10022003 | 3300025940 | Bacteria | 6017 |
| 692 | Ga0207691_10026485 | 3300025940 | Bacteria | 5439 |
| 693 | Ga0207691_10033850 | 3300025940 | Bacteria | 4757 |
| 694 | Ga0207691_10047127 | 3300025940 | Bacteria | 3957 |
| 695 | Ga0207691_10075799 | 3300025940 | Bacteria | 3032 |
| 696 | Ga0207691_10094511 | 3300025940 | Bacteria | 2675 |
| 697 | Ga0207691_10096844 | 3300025940 | Bacteria | 2638 |
| 698 | Ga0207691_10100147 | 3300025940 | Bacteria | 2587 |
| 699 | Ga0207691_10105868 | 3300025940 | Bacteria | 2505 |
| 700 | Ga0207691_10106389 | 3300025940 | Bacteria | 2499 |
| 701 | Ga0207691_10188302 | 3300025940 | Bacteria | 1801 |
| 702 | Ga0207711_10010963 | 3300025941 | Bacteria | 7531 |
| 703 | Ga0207711_10014618 | 3300025941 | Bacteria | 6523 |
| 704 | Ga0207711_10025788 | 3300025941 | Bacteria | 4929 |
| 705 | Ga0207711_10034774 | 3300025941 | Bacteria | 4267 |
| 706 | Ga0207711_10040252 | 3300025941 | Bacteria | 3976 |
| 707 | Ga0207711_10041583 | 3300025941 | Bacteria | 3915 |
| 708 | Ga0207711_10056886 | 3300025941 | Bacteria | 3361 |
| 709 | Ga0207711_10167324 | 3300025941 | Bacteria | 1993 |
| 710 | Ga0207711_10191118 | 3300025941 | Bacteria | 1866 |
| 711 | Ga0207689_10014461 | 3300025942 | Bacteria | 6713 |
| 712 | Ga0207689_10046922 | 3300025942 | Bacteria | 3568 |
| 713 | Ga0207689_10117260 | 3300025942 | Bacteria | 2189 |
| 714 | Ga0207689_10122307 | 3300025942 | Bacteria | 2140 |
| 715 | Ga0207661_10003131 | 3300025944 | Bacteria | 11466 |
| 716 | Ga0207661_10025526 | 3300025944 | Bacteria | 4492 |
| 717 | Ga0207661_10035737 | 3300025944 | Bacteria | 3874 |
| 718 | Ga0207661_10051968 | 3300025944 | Bacteria | 3272 |
| 719 | Ga0207661_10081352 | 3300025944 | Bacteria | 2675 |
| 720 | Ga0207661_10122362 | 3300025944 | Bacteria | 2217 |
| 721 | Ga0207679_10003204 | 3300025945 | Bacteria | 10090 |
| 722 | Ga0207679_10003415 | 3300025945 | Bacteria | 9801 |
| 723 | Ga0207679_10006342 | 3300025945 | Bacteria | 7473 |
| 724 | Ga0207679_10015783 | 3300025945 | Bacteria | 5002 |
| 725 | Ga0207679_10045134 | 3300025945 | Bacteria | 3185 |
| 726 | Ga0207679_10063272 | 3300025945 | Bacteria | 2761 |
| 727 | Ga0207679_10097456 | 3300025945 | Bacteria | 2291 |
| 728 | Ga0207679_10102068 | 3300025945 | Bacteria | 2245 |
| 729 | Ga0207679_10105661 | 3300025945 | Bacteria | 2211 |
| 730 | Ga0207679_10216683 | 3300025945 | Bacteria | 1608 |
| 731 | Ga0207667_10018041 | 3300025949 | Bacteria | 7926 |
| 732 | Ga0207667_10049057 | 3300025949 | Bacteria | 4461 |
| 733 | Ga0207667_10074332 | 3300025949 | Bacteria | 3531 |
| 734 | Ga0207651_10004772 | 3300025960 | Bacteria | 6891 |
| 735 | Ga0207651_10011179 | 3300025960 | Bacteria | 5011 |
| 736 | Ga0207651_10052108 | 3300025960 | Bacteria | 2788 |
| 737 | Ga0207651_10160726 | 3300025960 | Bacteria | 1761 |
| 738 | Ga0207712_10002949 | 3300025961 | Bacteria | 10863 |
| 739 | Ga0207712_10004752 | 3300025961 | Bacteria | 8584 |
| 740 | Ga0207712_10080863 | 3300025961 | Bacteria | 2365 |
| 741 | Ga0207712_10152887 | 3300025961 | Bacteria | 1784 |
| 742 | Ga0207668_10017130 | 3300025972 | Bacteria | 4534 |
| 743 | Ga0207668_10176784 | 3300025972 | Bacteria | 1680 |
| 744 | Ga0207668_10207885 | 3300025972 | Bacteria | 1563 |
| 745 | Ga0207640_10016650 | 3300025981 | Bacteria | 4282 |
| 746 | Ga0207640_10046083 | 3300025981 | Bacteria | 2803 |
| 747 | Ga0207640_10136389 | 3300025981 | Bacteria | 1782 |
| 748 | Ga0207658_10011211 | 3300025986 | Bacteria | 6106 |
| 749 | Ga0207658_10062486 | 3300025986 | Bacteria | 2787 |
| 750 | Ga0207658_10168498 | 3300025986 | Bacteria | 1802 |
| 751 | Ga0207677_10076952 | 3300026023 | Bacteria | 2377 |
| 752 | Ga0207677_10172310 | 3300026023 | Bacteria | 1693 |
| 753 | Ga0207703_10025435 | 3300026035 | Bacteria | 4656 |
| 754 | Ga0207703_10028156 | 3300026035 | Bacteria | 4426 |
| 755 | Ga0207703_10035383 | 3300026035 | Bacteria | 3968 |
| 756 | Ga0207703_10138710 | 3300026035 | Bacteria | 2108 |
| 757 | Ga0207703_10145358 | 3300026035 | Bacteria | 2062 |
| 758 | Ga0207703_10187697 | 3300026035 | Bacteria | 1828 |
| 759 | Ga0207639_10003395 | 3300026041 | Bacteria | 10710 |
| 760 | Ga0207639_10157608 | 3300026041 | Bacteria | 1909 |
| 761 | Ga0207639_10279369 | 3300026041 | Bacteria | 1468 |
| 762 | Ga0207678_10008895 | 3300026067 | Bacteria | 8841 |
| 763 | Ga0207678_10022903 | 3300026067 | Bacteria | 5467 |
| 764 | Ga0207678_10023382 | 3300026067 | Bacteria | 5404 |
| 765 | Ga0207708_10003536 | 3300026075 | Bacteria | 11509 |
| 766 | Ga0207708_10003617 | 3300026075 | Bacteria | 11396 |
| 767 | Ga0207708_10010005 | 3300026075 | Bacteria | 7043 |
| 768 | Ga0207708_10025892 | 3300026075 | Bacteria | 4438 |
| 769 | Ga0207708_10035282 | 3300026075 | Bacteria | 3806 |
| 770 | Ga0207708_10055002 | 3300026075 | Bacteria | 3034 |
| 771 | Ga0207708_10070903 | 3300026075 | Bacteria | 2669 |
| 772 | Ga0207708_10099773 | 3300026075 | Bacteria | 2246 |
| 773 | Ga0207702_10322766 | 3300026078 | Bacteria | 1471 |
| 774 | Ga0207641_10001113 | 3300026088 | Bacteria | 27018 |
| 775 | Ga0207641_10114243 | 3300026088 | Bacteria | 2399 |
| 776 | Ga0207641_10160020 | 3300026088 | Bacteria | 2046 |
| 777 | Ga0207648_10000280 | 3300026089 | Bacteria | 55313 |
| 778 | Ga0207648_10001579 | 3300026089 | Bacteria | 24975 |
| 779 | Ga0207648_10006656 | 3300026089 | Bacteria | 11469 |
| 780 | Ga0207648_10007517 | 3300026089 | Bacteria | 10696 |
| 781 | Ga0207648_10041218 | 3300026089 | Bacteria | 4055 |
| 782 | Ga0207648_10047619 | 3300026089 | Bacteria | 3757 |
| 783 | Ga0207648_10062065 | 3300026089 | Bacteria | 3259 |
| 784 | Ga0207648_10131360 | 3300026089 | Bacteria | 2204 |
| 785 | Ga0207648_10158532 | 3300026089 | Bacteria | 1998 |
| 786 | Ga0207648_10225875 | 3300026089 | Bacteria | 1665 |
| 787 | Ga0207648_10260806 | 3300026089 | Bacteria | 1546 |
| 788 | Ga0207676_10021525 | 3300026095 | Bacteria | 4730 |
| 789 | Ga0207676_10069611 | 3300026095 | Bacteria | 2818 |
| 790 | Ga0207676_10085050 | 3300026095 | Bacteria | 2580 |
| 791 | Ga0207676_10290579 | 3300026095 | Bacteria | 1488 |
| 792 | Ga0207676_10301347 | 3300026095 | Bacteria | 1463 |
| 793 | Ga0207674_10000975 | 3300026116 | Bacteria | 37411 |
| 794 | Ga0207674_10001029 | 3300026116 | Bacteria | 36400 |
| 795 | Ga0207674_10009475 | 3300026116 | Bacteria | 11123 |
| 796 | Ga0207674_10009866 | 3300026116 | Bacteria | 10867 |
| 797 | Ga0207674_10025524 | 3300026116 | Bacteria | 6300 |
| 798 | Ga0207674_10048267 | 3300026116 | Bacteria | 4358 |
| 799 | Ga0207674_10119857 | 3300026116 | Bacteria | 2600 |
| 800 | Ga0207674_10175598 | 3300026116 | Bacteria | 2095 |
| 801 | Ga0207675_100005112 | 3300026118 | Bacteria | 12628 |
| 802 | Ga0207675_100009300 | 3300026118 | Bacteria | 9216 |
| 803 | Ga0207675_100010828 | 3300026118 | Bacteria | 8544 |
| 804 | Ga0207675_100014801 | 3300026118 | Bacteria | 7279 |
| 805 | Ga0207675_100021208 | 3300026118 | Bacteria | 6052 |
| 806 | Ga0207675_100029674 | 3300026118 | Bacteria | 5093 |
| 807 | Ga0207675_100073355 | 3300026118 | Bacteria | 3202 |
| 808 | Ga0207675_100083061 | 3300026118 | Bacteria | 3004 |
| 809 | Ga0207675_100101515 | 3300026118 | Bacteria | 2710 |
| 810 | Ga0207675_100321976 | 3300026118 | Bacteria | 1510 |
| 811 | Ga0207683_10001056 | 3300026121 | Bacteria | 25103 |
| 812 | Ga0207683_10021790 | 3300026121 | Bacteria | 5494 |
| 813 | Ga0207683_10053680 | 3300026121 | Bacteria | 3534 |
| 814 | Ga0207683_10188916 | 3300026121 | Bacteria | 1870 |
| 815 | Ga0207683_10219553 | 3300026121 | Bacteria | 1732 |
| 816 | Ga0207698_10061373 | 3300026142 | Bacteria | 2929 |
| 817 | Ga0207698_10186040 | 3300026142 | Bacteria | 1845 |
| 818 | Ga0209282_1010364 | 3300027666 | Bacteria | 5896 |
| 819 | Ga0209282_1021345 | 3300027666 | Bacteria | 4090 |
| 820 | Ga0209588_1004742 | 3300027671 | Bacteria | 3858 |
| 821 | Ga0209971_1023508 | 3300027682 | Bacteria | 1471 |
| 822 | Ga0207428_10000481 | 3300027907 | Bacteria | 48194 |
| 823 | Ga0207428_10003460 | 3300027907 | Bacteria | 15327 |
| 824 | Ga0207428_10004078 | 3300027907 | Bacteria | 13998 |
| 825 | Ga0207428_10011888 | 3300027907 | Bacteria | 7665 |
| 826 | Ga0207428_10028879 | 3300027907 | Bacteria | 4603 |
| 827 | Ga0207428_10044629 | 3300027907 | Bacteria | 3575 |
| 828 | Ga0207428_10098452 | 3300027907 | Bacteria | 2263 |
| 829 | Ga0207428_10115910 | 3300027907 | Bacteria | 2058 |
| 830 | Ga0207428_10116968 | 3300027907 | Bacteria | 2047 |
| 831 | Ga0207428_10169805 | 3300027907 | Bacteria | 1652 |
| 832 | Ga0268266_10001913 | 3300028379 | Bacteria | 23421 |
| 833 | Ga0268266_10003647 | 3300028379 | Bacteria | 15228 |
| 834 | Ga0268266_10003719 | 3300028379 | Bacteria | 15010 |
| 835 | Ga0268266_10016423 | 3300028379 | Bacteria | 6328 |
| 836 | Ga0268266_10107527 | 3300028379 | Bacteria | 2467 |
| 837 | Ga0268266_10155753 | 3300028379 | Bacteria | 2063 |
| 838 | Ga0268265_10003942 | 3300028380 | Bacteria | 10455 |
| 839 | Ga0268265_10006108 | 3300028380 | Bacteria | 8172 |
| 840 | Ga0268265_10021735 | 3300028380 | Bacteria | 4498 |
| 841 | Ga0268265_10030986 | 3300028380 | Bacteria | 3858 |
| 842 | Ga0268265_10041011 | 3300028380 | Bacteria | 3422 |
| 843 | Ga0268265_10230255 | 3300028380 | Bacteria | 1628 |
| 844 | Ga0268264_10005498 | 3300028381 | Bacteria | 10742 |
| 845 | Ga0268264_10030911 | 3300028381 | Bacteria | 4390 |
| 846 | Ga0268264_10133223 | 3300028381 | Bacteria | 2206 |
| 847 | Ga0268264_10204038 | 3300028381 | Bacteria | 1810 |
| 848 | Ga0268264_10385130 | 3300028381 | Bacteria | 1344 |
| 849 | Ga0265336_10001220 | 3300028666 | Bacteria | 12202 |
| 850 | Ga0265338_10002329 | 3300028800 | Bacteria | 28713 |
| 851 | Ga0265338_10208561 | 3300028800 | Bacteria | 1468 |
| 852 | Ga0307512_10031809 | 3300030522 | Bacteria | 4564 |
| 853 | Ga0265762_1000437 | 3300030760 | Bacteria | 7209 |
| 854 | Ga0265762_1007655 | 3300030760 | Bacteria | 1924 |
| 855 | Ga0265332_10003975 | 3300031238 | Bacteria | 7048 |
| 856 | Ga0265328_10061315 | 3300031239 | Bacteria | 1381 |
| 857 | Ga0265325_10052379 | 3300031241 | Bacteria | 2096 |
| 858 | Ga0265329_10031629 | 3300031242 | Bacteria | 1718 |
| 859 | Ga0265340_10076292 | 3300031247 | Bacteria | 1583 |
| 860 | Ga0265340_10086162 | 3300031247 | Bacteria | 1473 |
| 861 | Ga0265331_10059940 | 3300031250 | Bacteria | 1799 |
| 862 | Ga0265316_10002852 | 3300031344 | Bacteria | 17687 |
| 863 | Ga0307408_100005731 | 3300031548 | Bacteria | 8279 |
| 864 | Ga0307408_100088843 | 3300031548 | Bacteria | 2328 |
| 865 | Ga0307408_100262374 | 3300031548 | Bacteria | 1430 |
| 866 | Ga0307508_10003585 | 3300031616 | Bacteria | 15626 |
| 867 | Ga0316575_10000078 | 3300031665 | Bacteria | 24212 |
| 868 | Ga0316575_10001173 | 3300031665 | Bacteria | 8249 |
| 869 | Ga0316575_10014940 | 3300031665 | Bacteria | 2922 |
| 870 | Ga0316575_10051213 | 3300031665 | Bacteria | 1644 |
| 871 | Ga0316575_10072183 | 3300031665 | Bacteria | 1387 |
| 872 | Ga0316575_10079148 | 3300031665 | Bacteria | 1325 |
| 873 | Ga0316579_10000340 | 3300031691 | Bacteria | 14609 |
| 874 | Ga0316579_10003231 | 3300031691 | Bacteria | 6313 |
| 875 | Ga0316579_10005032 | 3300031691 | Bacteria | 5303 |
| 876 | Ga0316579_10005489 | 3300031691 | Bacteria | 5124 |
| 877 | Ga0316579_10006783 | 3300031691 | Bacteria | 4691 |
| 878 | Ga0316579_10033573 | 3300031691 | Bacteria | 2357 |
| 879 | Ga0316579_10079800 | 3300031691 | Bacteria | 1557 |
| 880 | Ga0265314_10031752 | 3300031711 | Bacteria | 3894 |
| 881 | Ga0265314_10043744 | 3300031711 | Bacteria | 3180 |
| 882 | Ga0265314_10056375 | 3300031711 | Bacteria | 2705 |
| 883 | Ga0316576_10000061 | 3300031727 | Bacteria | 35080 |
| 884 | Ga0316576_10003527 | 3300031727 | Bacteria | 9188 |
| 885 | Ga0316576_10008317 | 3300031727 | Bacteria | 6608 |
| 886 | Ga0316576_10011247 | 3300031727 | Bacteria | 5854 |
| 887 | Ga0316576_10012299 | 3300031727 | Bacteria | 5650 |
| 888 | Ga0316576_10028153 | 3300031727 | Bacteria | 3958 |
| 889 | Ga0316576_10036520 | 3300031727 | Bacteria | 3513 |
| 890 | Ga0316576_10041041 | 3300031727 | Bacteria | 3329 |
| 891 | Ga0316576_10070111 | 3300031727 | Bacteria | 2585 |
| 892 | Ga0316576_10122277 | 3300031727 | Bacteria | 1955 |
| 893 | Ga0316576_10163406 | 3300031727 | Bacteria | 1679 |
| 894 | Ga0316576_10164384 | 3300031727 | Bacteria | 1674 |
| 895 | Ga0316576_10203708 | 3300031727 | Bacteria | 1490 |
| 896 | Ga0316578_10000292 | 3300031728 | Bacteria | 15224 |
| 897 | Ga0316578_10000778 | 3300031728 | Bacteria | 11748 |
| 898 | Ga0316578_10008143 | 3300031728 | Bacteria | 5313 |
| 899 | Ga0316578_10008169 | 3300031728 | Bacteria | 5305 |
| 900 | Ga0316578_10020051 | 3300031728 | Bacteria | 3689 |
| 901 | Ga0316578_10053385 | 3300031728 | Bacteria | 2368 |
| 902 | Ga0316578_10062956 | 3300031728 | Bacteria | 2187 |
| 903 | Ga0316578_10128903 | 3300031728 | Bacteria | 1521 |
| 904 | Ga0316578_10131423 | 3300031728 | Bacteria | 1506 |
| 905 | Ga0307405_10014290 | 3300031731 | Bacteria | 4264 |
| 906 | Ga0307405_10227356 | 3300031731 | Bacteria | 1373 |
| 907 | Ga0316577_10001299 | 3300031733 | Bacteria | 11678 |
| 908 | Ga0316577_10001513 | 3300031733 | Bacteria | 11028 |
| 909 | Ga0316577_10004481 | 3300031733 | Bacteria | 7211 |
| 910 | Ga0316577_10031830 | 3300031733 | Bacteria | 2947 |
| 911 | Ga0316577_10036514 | 3300031733 | Bacteria | 2748 |
| 912 | Ga0316577_10060081 | 3300031733 | Bacteria | 2121 |
| 913 | Ga0316577_10150845 | 3300031733 | Bacteria | 1310 |
| 914 | Ga0316577_10151652 | 3300031733 | Bacteria | 1306 |
| 915 | Ga0307413_10000731 | 3300031824 | Bacteria | 11314 |
| 916 | Ga0307413_10007133 | 3300031824 | Bacteria | 5161 |
| 917 | Ga0307413_10094788 | 3300031824 | Bacteria | 1955 |
| 918 | Ga0307413_10146291 | 3300031824 | Bacteria | 1641 |
| 919 | Ga0307413_10189666 | 3300031824 | Bacteria | 1474 |
| 920 | Ga0307410_10038888 | 3300031852 | Bacteria | 3119 |
| 921 | Ga0307410_10130009 | 3300031852 | Bacteria | 1849 |
| 922 | Ga0307406_10003599 | 3300031901 | Bacteria | 8451 |
| 923 | Ga0307406_10026366 | 3300031901 | Bacteria | 3489 |
| 924 | Ga0307406_10084724 | 3300031901 | Bacteria | 2117 |
| 925 | Ga0307406_10148358 | 3300031901 | Bacteria | 1670 |
| 926 | Ga0307407_10001825 | 3300031903 | Bacteria | 7993 |
| 927 | Ga0307407_10025974 | 3300031903 | Bacteria | 3095 |
| 928 | Ga0307407_10058651 | 3300031903 | Bacteria | 2238 |
| 929 | Ga0307407_10068791 | 3300031903 | Bacteria | 2099 |
| 930 | Ga0307412_10074102 | 3300031911 | Bacteria | 2331 |
| 931 | Ga0307409_100000298 | 3300031995 | Bacteria | 20176 |
| 932 | Ga0307409_100018484 | 3300031995 | Bacteria | 4688 |
| 933 | Ga0307409_100037951 | 3300031995 | Bacteria | 3557 |
| 934 | Ga0307416_100003790 | 3300032002 | Bacteria | 8973 |
| 935 | Ga0307416_100005453 | 3300032002 | Bacteria | 7815 |
| 936 | Ga0307416_100059749 | 3300032002 | Bacteria | 3100 |
| 937 | Ga0307416_100097779 | 3300032002 | Bacteria | 2543 |
| 938 | Ga0307416_100112146 | 3300032002 | Bacteria | 2406 |
| 939 | Ga0307416_100135170 | 3300032002 | Bacteria | 2229 |
| 940 | Ga0307416_100138140 | 3300032002 | Bacteria | 2209 |
| 941 | Ga0307416_100164693 | 3300032002 | Bacteria | 2055 |
| 942 | Ga0307414_10049440 | 3300032004 | Bacteria | 2908 |
| 943 | Ga0307414_10062914 | 3300032004 | Bacteria | 2636 |
| 944 | Ga0307414_10127806 | 3300032004 | Bacteria | 1967 |
| 945 | Ga0307414_10179906 | 3300032004 | Bacteria | 1700 |
| 946 | Ga0307414_10381188 | 3300032004 | Bacteria | 1219 |
| 947 | Ga0307411_10001022 | 3300032005 | Bacteria | 10794 |
| 948 | Ga0307411_10005511 | 3300032005 | Bacteria | 6227 |
| 949 | Ga0307411_10043083 | 3300032005 | Bacteria | 2886 |
| 950 | Ga0307411_10085688 | 3300032005 | Bacteria | 2183 |
| 951 | Ga0307411_10103351 | 3300032005 | Bacteria | 2021 |
| 952 | Ga0307411_10213397 | 3300032005 | Bacteria | 1492 |
| 953 | Ga0307411_10303241 | 3300032005 | Bacteria | 1282 |
| 954 | Ga0307415_100006479 | 3300032126 | Bacteria | 6321 |
| 955 | Ga0307415_100072204 | 3300032126 | Bacteria | 2430 |
| 956 | Ga0307415_100086415 | 3300032126 | Bacteria | 2257 |
| 957 | Ga0307415_100173563 | 3300032126 | Bacteria | 1684 |
| 958 | Ga0307415_100206719 | 3300032126 | Bacteria | 1562 |
| 959 | Ga0316583_10000460 | 3300032133 | Bacteria | 12044 |
| 960 | Ga0316583_10001203 | 3300032133 | Bacteria | 8499 |
| 961 | Ga0316583_10001572 | 3300032133 | Bacteria | 7693 |
| 962 | Ga0316583_10003648 | 3300032133 | Bacteria | 5439 |
| 963 | Ga0316583_10006388 | 3300032133 | Bacteria | 4232 |
| 964 | Ga0316583_10007565 | 3300032133 | Bacteria | 3912 |
| 965 | Ga0316583_10021861 | 3300032133 | Bacteria | 2292 |
| 966 | Ga0316585_10000766 | 3300032137 | Bacteria | 8119 |
| 967 | Ga0316585_10001080 | 3300032137 | Bacteria | 7083 |
| 968 | Ga0316585_10032763 | 3300032137 | Bacteria | 1637 |
| 969 | Ga0316580_10000032 | 3300032139 | Bacteria | 22250 |
| 970 | Ga0316580_10000340 | 3300032139 | Bacteria | 10266 |
| 971 | Ga0316580_10004339 | 3300032139 | Bacteria | 4108 |
| 972 | Ga0316593_10000188 | 3300032168 | Bacteria | 9420 |
| 973 | Ga0316593_10009664 | 3300032168 | Bacteria | 2735 |
| 974 | Ga0316593_10011908 | 3300032168 | Bacteria | 2540 |
| 975 | Ga0307510_10126809 | 3300033180 | Bacteria | 2239 |
| 976 | Ga0316592_1000517 | 3300033524 | Bacteria | 5419 |
| 977 | Ga0316592_1001809 | 3300033524 | Bacteria | 3563 |
| 978 | Ga0316588_1000700 | 3300033528 | Bacteria | 4910 |
| 979 | Ga0316596_1000885 | 3300033541 | Bacteria | 5643 |
| 980 | Ga0316596_1002003 | 3300033541 | Bacteria | 4276 |
| 981 | Ga0316212_1003380 | 3300033547 | Bacteria | 2302 |
| 982 | Ga0373926_0009080 | 3300035083 | Bacteria | 3318 |
| 983 | Ga0373926_0017251 | 3300035083 | Bacteria | 2477 |
| 984 | Ga0373923_0005050 | 3300035111 | Bacteria | 4445 |
| 985 | Ga0373923_0130913 | 3300035111 | Bacteria | 1127 |
| 986 | Ga0373941_0049264 | 3300035115 | Bacteria | 1333 |
| 987 | Ga0373943_0030823 | 3300035170 | Bacteria | 2541 |
| 988 | Ga0373961_0042102 | 3300035241 | Bacteria | 1323 |
| 989 | Ga0373962_0058409 | 3300035242 | Bacteria | 1128 |
| 990 | Ga0316574_0000054 | 3300035398 | Bacteria | 29440 |
| 991 | Ga0316574_0000651 | 3300035398 | Bacteria | 14575 |
| 992 | Ga0316574_0003136 | 3300035398 | Bacteria | 8452 |
| 993 | Ga0316574_0036435 | 3300035398 | Bacteria | 3012 |
| 994 | Ga0316574_0054359 | 3300035398 | Bacteria | 2501 |
| 995 | Ga0316574_0060347 | 3300035398 | Bacteria | 2380 |
| 996 | Ga0316574_0098667 | 3300035398 | Bacteria | 1868 |
| 997 | Ga0316574_0103393 | 3300035398 | Bacteria | 1824 |
| 998 | Ga0316574_0194220 | 3300035398 | Bacteria | 1305 |
| 999 | Ga0373931_0033246 | 3300035691 | Bacteria | 2672 |
| 1000 | Ga0373935_0007047 | 3300035692 | Bacteria | 6711 |
| 1001 | Ga0373935_0008647 | 3300035692 | Bacteria | 6097 |
| 1002 | Ga0373927_0011017 | 3300035695 | Bacteria | 6022 |
| 1003 | Ga0373933_0089214 | 3300035724 | Bacteria | 1900 |
| 1004 | Ga0373947_0051242 | 3300035725 | Bacteria | 2483 |
| 1005 | Ga0373947_0216750 | 3300035725 | Bacteria | 1257 |
| 1006 | Ga0373937_0002679 | 3300036401 | Bacteria | 14848 |
| 1007 | Ga0373937_0025464 | 3300036401 | Bacteria | 5341 |
| 1008 | Ga0373937_0252653 | 3300036401 | Bacteria | 1662 |
| 1009 | Ga0316582_0000201 | 3300036647 | Bacteria | 19076 |
| 1010 | Ga0316582_0000608 | 3300036647 | Bacteria | 13911 |
| 1011 | Ga0316582_0003179 | 3300036647 | Bacteria | 7974 |
| 1012 | Ga0316582_0005804 | 3300036647 | Bacteria | 6410 |
| 1013 | Ga0316582_0020480 | 3300036647 | Bacteria | 3889 |
| 1014 | Ga0316582_0039799 | 3300036647 | Bacteria | 2929 |
| 1015 | Ga0316582_0059135 | 3300036647 | Bacteria | 2453 |
| 1016 | Ga0316582_0060613 | 3300036647 | Unclassified | 2426 |
| 1017 | Ga0316582_0073934 | 3300036647 | Bacteria | 2212 |
| 1018 | Ga0316582_0192018 | 3300036647 | Bacteria | 1391 |
| 1019 | Ga0316584_0001889 | 3300036712 | Bacteria | 13009 |
| 1020 | Ga0316584_0009581 | 3300036712 | Bacteria | 6731 |
| 1021 | Ga0316584_0019571 | 3300036712 | Bacteria | 4895 |
| 1022 | Ga0316584_0044299 | 3300036712 | Bacteria | 3318 |
| 1023 | Ga0316584_0054994 | 3300036712 | Bacteria | 2981 |
| 1024 | Ga0316584_0069183 | 3300036712 | Bacteria | 2646 |
| 1025 | Ga0316584_0090014 | 3300036712 | Bacteria | 2297 |
| 1026 | Ga0316584_0094890 | 3300036712 | Bacteria | 2233 |
| 1027 | Ga0316584_0209905 | 3300036712 | Bacteria | 1433 |
| 1028 | Ga0316584_0224544 | 3300036712 | Bacteria | 1378 |
| 1029 | Ga0316584_0318816 | 3300036712 | Bacteria | 1122 |
| 1030 | Ga0373925_0004509 | 3300037068 | Bacteria | 10522 |
| 1031 | Ga0373925_0196397 | 3300037068 | Bacteria | 1603 |
| 1032 | Ga0373925_0245972 | 3300037068 | Bacteria | 1434 |
| 1033 | Ga0316581_0001143 | 3300037588 | Bacteria | 5792 |
| 1034 | Ga0316581_0017783 | 3300037588 | Bacteria | 2056 |
| 1035 | Ga0436364_0778749 | 3300037853 | Bacteria | 6892 |
| 1036 | Ga0400484_29778 | 3300038725 | Bacteria | 7394 |
| 1037 | Ga0400490_53112 | 3300038726 | Bacteria | 2341 |
| 1038 | Ga0400485_18502 | 3300038735 | Bacteria | 7137 |
| 1039 | Ga0400488_23036 | 3300038741 | Bacteria | 17387 |
| 1040 | Ga0400483_252454 | 3300039062 | Bacteria | 4429 |
| 1041 | Ga0400483_263366 | 3300039062 | Bacteria | 2561 |
| 1042 | Ga0400483_263582 | 3300039062 | Bacteria | 18241 |
| 1043 | Ga0400489_36202 | 3300039093 | Bacteria | 8162 |
| 1044 | Ga0400489_39387 | 3300039093 | Bacteria | 5543 |
| 1045 | Ga0400489_57552 | 3300039093 | Bacteria | 3673 |
| 1046 | Ga0400489_66845 | 3300039093 | Bacteria | 7637 |
| 1047 | Ga0400489_67086 | 3300039093 | Bacteria | 4897 |
| 1048 | Ga0400489_87056 | 3300039093 | Bacteria | 68318 |
| 1049 | Ga0436360_0776135 | 3300039438 | Bacteria | 3668 |
| 1050 | Ga0436361_0217784 | 3300039447 | Bacteria | 23941 |
| 1051 | Ga0450920_004909 | 3300042122 | Bacteria | 2364 |
| 1052 | Ga0450898_004430 | 3300042134 | Bacteria | 2077 |
| 1053 | Ga0439446_0018003 | 3300042156 | Bacteria | 1975 |
| 1054 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 1055 | Ga0451577_0000063 | 3300042876 | Bacteria | 264379 |
| 1056 | Ga0451577_0003032 | 3300042876 | Bacteria | 19100 |
| 1057 | Ga0451577_0007108 | 3300042876 | Bacteria | 11036 |
| 1058 | Ga0451577_0008586 | 3300042876 | Bacteria | 9932 |
| 1059 | Ga0451577_0011583 | 3300042876 | Bacteria | 8333 |
| 1060 | Ga0451577_0011723 | 3300042876 | Bacteria | 8275 |
| 1061 | Ga0451577_0013346 | 3300042876 | Bacteria | 7694 |
| 1062 | Ga0451577_0020077 | 3300042876 | Bacteria | 6136 |
| 1063 | Ga0451577_0023963 | 3300042876 | Bacteria | 5558 |
| 1064 | Ga0451577_0031730 | 3300042876 | Bacteria | 4766 |
| 1065 | Ga0451577_0032839 | 3300042876 | Bacteria | 4678 |
| 1066 | Ga0451577_0154283 | 3300042876 | Bacteria | 2066 |
| 1067 | Ga0451577_0389889 | 3300042876 | Bacteria | 1264 |
| 1068 | Ga0466969_0000017 | 3300044656 | Bacteria | 103792 |
| 1069 | Ga0466969_0005938 | 3300044656 | Bacteria | 6495 |
| 1070 | Ga0453683_0000354 | 3300044673 | Bacteria | 55512 |
| 1071 | Ga0453683_0001401 | 3300044673 | Bacteria | 20945 |
| 1072 | Ga0453683_0002141 | 3300044673 | Bacteria | 15739 |
| 1073 | Ga0453683_0006715 | 3300044673 | Bacteria | 7867 |
| 1074 | Ga0453683_0007197 | 3300044673 | Bacteria | 7585 |
| 1075 | Ga0453683_0008162 | 3300044673 | Bacteria | 7044 |
| 1076 | Ga0453683_0075195 | 3300044673 | Bacteria | 2115 |
| 1077 | Ga0466965_0021284 | 3300044683 | Bacteria | 3120 |
| 1078 | Ga0466965_0124092 | 3300044683 | Bacteria | 1335 |
| 1079 | Ga0466966_0009159 | 3300044684 | Bacteria | 6554 |
| 1080 | Ga0466966_0025665 | 3300044684 | Bacteria | 3848 |
| 1081 | Ga0466966_0104119 | 3300044684 | Bacteria | 1753 |
| 1082 | Ga0466961_0000675 | 3300044693 | Bacteria | 21455 |
| 1083 | Ga0453684_0000198 | 3300044712 | Bacteria | 264379 |
| 1084 | Ga0453684_0001021 | 3300044712 | Bacteria | 89961 |
| 1085 | Ga0453684_0003669 | 3300044712 | Bacteria | 34062 |
| 1086 | Ga0453684_0005793 | 3300044712 | Bacteria | 24103 |
| 1087 | Ga0453684_0005848 | 3300044712 | Bacteria | 23915 |
| 1088 | Ga0453684_0008716 | 3300044712 | Bacteria | 18032 |
| 1089 | Ga0453684_0011440 | 3300044712 | Bacteria | 14883 |
| 1090 | Ga0453684_0016406 | 3300044712 | Bacteria | 11582 |
| 1091 | Ga0453684_0019113 | 3300044712 | Bacteria | 10457 |
| 1092 | Ga0453684_0025076 | 3300044712 | Bacteria | 8676 |
| 1093 | Ga0453684_0028918 | 3300044712 | Bacteria | 7889 |
| 1094 | Ga0453684_0034553 | 3300044712 | Bacteria | 7013 |
| 1095 | Ga0453684_0038822 | 3300044712 | Bacteria | 6498 |
| 1096 | Ga0453684_0047025 | 3300044712 | Bacteria | 5728 |
| 1097 | Ga0453684_0047870 | 3300044712 | Bacteria | 5663 |
| 1098 | Ga0453684_0073014 | 3300044712 | Bacteria | 4328 |
| 1099 | Ga0453684_0093505 | 3300044712 | Bacteria | 3703 |
| 1100 | Ga0453684_0101809 | 3300044712 | Bacteria | 3513 |
| 1101 | Ga0453684_0165800 | 3300044712 | Bacteria | 2608 |
| 1102 | Ga0453684_0225614 | 3300044712 | Bacteria | 2166 |
| 1103 | Ga0453684_0462321 | 3300044712 | Bacteria | 1411 |
| 1104 | Ga0466957_0064618 | 3300044842 | Bacteria | 2251 |
| 1105 | Ga0466959_0000285 | 3300045049 | Bacteria | 30873 |
| 1106 | Ga0451576_0002045 | 3300045051 | Bacteria | 31760 |
| 1107 | Ga0451576_0007793 | 3300045051 | Bacteria | 12703 |
| 1108 | Ga0451576_0017896 | 3300045051 | Bacteria | 7781 |
| 1109 | Ga0451576_0020522 | 3300045051 | Bacteria | 7192 |
| 1110 | Ga0451576_0021366 | 3300045051 | Bacteria | 7033 |
| 1111 | Ga0451576_0037518 | 3300045051 | Bacteria | 5132 |
| 1112 | Ga0451576_0114907 | 3300045051 | Bacteria | 2802 |
| 1113 | Ga0451576_0124785 | 3300045051 | Bacteria | 2682 |
| 1114 | Ga0451576_0178868 | 3300045051 | Bacteria | 2215 |
| 1115 | Ga0451576_0189302 | 3300045051 | Bacteria | 2149 |
| 1116 | Ga0451576_0197660 | 3300045051 | Bacteria | 2101 |
| 1117 | Ga0451576_0433872 | 3300045051 | Bacteria | 1379 |
| 1118 | Ga0451576_0585453 | 3300045051 | Bacteria | 1173 |
| 1119 | Ga0466958_0018991 | 3300045836 | Bacteria | 3996 |
| 1120 | Ga0466967_0083639 | 3300045976 | Bacteria | 2886 |
| 1121 | Ga0495592_0034869 | 3300046454 | Bacteria | 3792 |
| 1122 | Ga0495592_0062440 | 3300046454 | Bacteria | 2735 |
| 1123 | Ga0495592_0084555 | 3300046454 | Bacteria | 2289 |
| 1124 | Ga0495629_0004932 | 3300046459 | Bacteria | 10015 |
| 1125 | Ga0495641_0012535 | 3300046461 | Bacteria | 4731 |
| 1126 | Ga0495651_0000624 | 3300046462 | Bacteria | 27410 |
| 1127 | Ga0495651_0005231 | 3300046462 | Bacteria | 9890 |
| 1128 | Ga0495651_0009328 | 3300046462 | Bacteria | 7531 |
| 1129 | Ga0495651_0025107 | 3300046462 | Bacteria | 4637 |
| 1130 | Ga0495653_0003358 | 3300046463 | Bacteria | 12864 |
| 1131 | Ga0495653_0102126 | 3300046463 | Bacteria | 2076 |
| 1132 | Ga0495650_0000009 | 3300046471 | Bacteria | 653845 |
| 1133 | Ga0495650_0010284 | 3300046471 | Bacteria | 5232 |
| 1134 | Ga0495580_0007760 | 3300046472 | Bacteria | 8598 |
| 1135 | Ga0495580_0010241 | 3300046472 | Bacteria | 7312 |
| 1136 | Ga0495580_0012295 | 3300046472 | Bacteria | 6571 |
| 1137 | Ga0495580_0105779 | 3300046472 | Bacteria | 1955 |
| 1138 | Ga0495580_0136835 | 3300046472 | Bacteria | 1698 |
| 1139 | Ga0495582_0000160 | 3300046473 | Bacteria | 36317 |
| 1140 | Ga0495582_0061652 | 3300046473 | Bacteria | 2071 |
| 1141 | Ga0495582_0075068 | 3300046473 | Bacteria | 1872 |
| 1142 | Ga0495582_0126001 | 3300046473 | Bacteria | 1445 |
| 1143 | Ga0495664_0009041 | 3300046477 | Bacteria | 5570 |
| 1144 | Ga0495664_0029121 | 3300046477 | Bacteria | 3227 |
| 1145 | Ga0495664_0053062 | 3300046477 | Bacteria | 2411 |
| 1146 | Ga0495585_0023681 | 3300046492 | Bacteria | 3523 |
| 1147 | Ga0495594_0001740 | 3300046499 | Bacteria | 11269 |
| 1148 | Ga0495594_0003599 | 3300046499 | Bacteria | 7965 |
| 1149 | Ga0495594_0011490 | 3300046499 | Bacteria | 4604 |
| 1150 | Ga0495594_0040863 | 3300046499 | Bacteria | 2539 |
| 1151 | Ga0495583_0010608 | 3300046506 | Bacteria | 5359 |
| 1152 | Ga0495606_0080712 | 3300046507 | Bacteria | 2023 |
| 1153 | Ga0495608_0005595 | 3300046511 | Bacteria | 8974 |
| 1154 | Ga0495608_0073549 | 3300046511 | Bacteria | 2228 |
| 1155 | Ga0495608_0114666 | 3300046511 | Bacteria | 1730 |
| 1156 | Ga0495628_0000100 | 3300046516 | Bacteria | 68834 |
| 1157 | Ga0495628_0003895 | 3300046516 | Bacteria | 13304 |
| 1158 | Ga0495628_0073629 | 3300046516 | Bacteria | 2661 |
| 1159 | Ga0495628_0189176 | 3300046516 | Bacteria | 1555 |
| 1160 | Ga0495630_0002788 | 3300046517 | Bacteria | 12127 |
| 1161 | Ga0495630_0015574 | 3300046517 | Bacteria | 5554 |
| 1162 | Ga0495643_0000203 | 3300046522 | Bacteria | 92549 |
| 1163 | Ga0495643_0078798 | 3300046522 | Bacteria | 1719 |
| 1164 | Ga0495644_0003693 | 3300046523 | Bacteria | 6024 |
| 1165 | Ga0495648_0072663 | 3300046524 | Bacteria | 1990 |
| 1166 | Ga0495666_0008923 | 3300046526 | Bacteria | 5019 |
| 1167 | Ga0495666_0021255 | 3300046526 | Bacteria | 3212 |
| 1168 | Ga0495642_0017177 | 3300046528 | Bacteria | 2826 |
| 1169 | Ga0495642_0053101 | 3300046528 | Bacteria | 1669 |
| 1170 | Ga0495652_0007450 | 3300046529 | Bacteria | 10087 |
| 1171 | Ga0495652_0027682 | 3300046529 | Bacteria | 4993 |
| 1172 | Ga0495652_0047638 | 3300046529 | Bacteria | 3675 |
| 1173 | Ga0495652_0251206 | 3300046529 | Bacteria | 1310 |
| 1174 | Ga0495665_0011377 | 3300046531 | Bacteria | 4816 |
| 1175 | Ga0495665_0032663 | 3300046531 | Bacteria | 2784 |
| 1176 | Ga0495665_0070927 | 3300046531 | Bacteria | 1836 |
| 1177 | Ga0495586_0002638 | 3300046535 | Bacteria | 9700 |
| 1178 | Ga0495586_0024319 | 3300046535 | Bacteria | 3238 |
| 1179 | Ga0495586_0143004 | 3300046535 | Bacteria | 1343 |
| 1180 | Ga0495587_0004941 | 3300046536 | Bacteria | 8740 |
| 1181 | Ga0495587_0125409 | 3300046536 | Bacteria | 1469 |
| 1182 | Ga0495598_0038413 | 3300046537 | Bacteria | 1386 |
| 1183 | Ga0495621_0003001 | 3300046539 | Bacteria | 4601 |
| 1184 | Ga0495621_0017025 | 3300046539 | Bacteria | 2342 |
| 1185 | Ga0495645_0002684 | 3300046543 | Bacteria | 12075 |
| 1186 | Ga0495645_0005674 | 3300046543 | Bacteria | 8591 |
| 1187 | Ga0495645_0008111 | 3300046543 | Bacteria | 7320 |
| 1188 | Ga0495645_0083449 | 3300046543 | Bacteria | 2290 |
| 1189 | Ga0495633_0016768 | 3300046558 | Bacteria | 3766 |
| 1190 | Ga0495633_0054740 | 3300046558 | Bacteria | 1877 |
| 1191 | Ga0495633_0061375 | 3300046558 | Bacteria | 1760 |
| 1192 | Ga0495633_0080582 | 3300046558 | Bacteria | 1515 |
| 1193 | Ga0495667_0034067 | 3300046559 | Bacteria | 3405 |
| 1194 | Ga0495667_0044908 | 3300046559 | Bacteria | 2926 |
| 1195 | Ga0495667_0132793 | 3300046559 | Bacteria | 1606 |
| 1196 | Ga0495667_0224295 | 3300046559 | Bacteria | 1199 |
| 1197 | Ga0495668_0064299 | 3300046616 | Bacteria | 2020 |
| 1198 | Ga0495634_0001889 | 3300046642 | Bacteria | 17989 |
| 1199 | Ga0495634_0007610 | 3300046642 | Bacteria | 8116 |
| 1200 | Ga0495625_0000174 | 3300046660 | Bacteria | 100401 |
| 1201 | Ga0495625_0070003 | 3300046660 | Bacteria | 2464 |
| 1202 | Ga0495635_0021952 | 3300046663 | Bacteria | 4448 |
| 1203 | Ga0495635_0036139 | 3300046663 | Bacteria | 3425 |
| 1204 | Ga0495588_0003610 | 3300046674 | Bacteria | 6763 |
| 1205 | Ga0495657_0019947 | 3300046675 | Bacteria | 4830 |
| 1206 | Ga0495657_0147579 | 3300046675 | Bacteria | 1462 |
| 1207 | Ga0495599_0004610 | 3300046678 | Bacteria | 8172 |
| 1208 | Ga0495623_0023862 | 3300046679 | Bacteria | 3946 |
| 1209 | Ga0495646_0007910 | 3300046680 | Bacteria | 6752 |
| 1210 | Ga0495658_0016514 | 3300046683 | Bacteria | 3800 |
| 1211 | Ga0495658_0016706 | 3300046683 | Bacteria | 3779 |
| 1212 | Ga0495658_0122720 | 3300046683 | Bacteria | 1573 |
| 1213 | Ga0495669_0001130 | 3300046684 | Bacteria | 11047 |
| 1214 | Ga0495669_0010879 | 3300046684 | Bacteria | 3851 |
| 1215 | Ga0495613_0012126 | 3300046689 | Bacteria | 6406 |
| 1216 | Ga0495613_0024977 | 3300046689 | Bacteria | 4453 |
| 1217 | Ga0495613_0074258 | 3300046689 | Bacteria | 2476 |
| 1218 | Ga0495624_0009364 | 3300046690 | Bacteria | 6784 |
| 1219 | Ga0495649_0029029 | 3300046694 | Bacteria | 3064 |
| 1220 | Ga0495649_0120856 | 3300046694 | Bacteria | 1385 |
| 1221 | Ga0495600_0001186 | 3300046809 | Bacteria | 14261 |
| 1222 | Ga0495600_0058644 | 3300046809 | Bacteria | 2514 |
| 1223 | Ga0495581_0009729 | 3300047315 | Bacteria | 5563 |
| 1224 | Ga0495604_0000537 | 3300047317 | Bacteria | 33451 |
| 1225 | Ga0495604_0002227 | 3300047317 | Bacteria | 15528 |
| 1226 | Ga0495604_0002867 | 3300047317 | Bacteria | 13826 |
| 1227 | Ga0495604_0014776 | 3300047317 | Bacteria | 6225 |
| 1228 | Ga0495604_0016954 | 3300047317 | Bacteria | 5825 |
| 1229 | Ga0495636_0018647 | 3300047318 | Bacteria | 2784 |
| 1230 | Ga0495674_0001372 | 3300047319 | Bacteria | 23745 |
| 1231 | Ga0495674_0016950 | 3300047319 | Bacteria | 6791 |
| 1232 | Ga0495674_0068815 | 3300047319 | Bacteria | 3063 |
| 1233 | Ga0495676_0003364 | 3300047321 | Bacteria | 14460 |
| 1234 | Ga0495676_0017461 | 3300047321 | Bacteria | 6344 |
| 1235 | Ga0495680_0000436 | 3300047322 | Bacteria | 46842 |
| 1236 | Ga0495680_0001290 | 3300047322 | Bacteria | 27330 |
| 1237 | Ga0495680_0009994 | 3300047322 | Bacteria | 8492 |
| 1238 | Ga0495680_0039057 | 3300047322 | Bacteria | 3789 |
| 1239 | Ga0495680_0169968 | 3300047322 | Bacteria | 1579 |
| 1240 | Ga0495675_0000566 | 3300047444 | Bacteria | 23905 |
| 1241 | Ga0495675_0010096 | 3300047444 | Bacteria | 5891 |
| 1242 | Ga0495675_0010601 | 3300047444 | Bacteria | 5761 |
| 1243 | Ga0495675_0046538 | 3300047444 | Bacteria | 2761 |
| 1244 | Ga0495677_0032944 | 3300047445 | Bacteria | 1888 |
| 1245 | Ga0495685_010344 | 3300047447 | Bacteria | 3126 |
| 1246 | Ga0495681_0003767 | 3300047470 | Bacteria | 10514 |
| 1247 | Ga0495684_0002380 | 3300047471 | Bacteria | 15034 |
| 1248 | Ga0495684_0030918 | 3300047471 | Bacteria | 4111 |
| 1249 | Ga0495684_0052887 | 3300047471 | Bacteria | 3099 |
| 1250 | Ga0495593_0057144 | 3300047673 | Bacteria | 2049 |
| 1251 | Ga0495602_0013208 | 3300048088 | Bacteria | 8447 |
| 1252 | Ga0495614_0002691 | 3300048089 | Bacteria | 7902 |
| 1253 | Ga0495614_0023386 | 3300048089 | Bacteria | 2666 |
| 1254 | Ga0496100_0166956 | 3300048903 | Bacteria | 1582 |
| 1255 | Ga0496100_0218333 | 3300048903 | Bacteria | 1398 |
| 1256 | Ga0496101_0130692 | 3300048904 | Bacteria | 1907 |
| 1257 | Ga0496101_0153434 | 3300048904 | Bacteria | 1763 |
| 1258 | Ga0496101_0189405 | 3300048904 | Bacteria | 1587 |
| 1259 | Ga0496102_0001797 | 3300048905 | Bacteria | 18579 |
| 1260 | Ga0496102_0010259 | 3300048905 | Bacteria | 8055 |
| 1261 | Ga0496102_0115018 | 3300048905 | Bacteria | 2510 |
| 1262 | Ga0496104_0003519 | 3300048907 | Bacteria | 13506 |
| 1263 | Ga0496104_0032813 | 3300048907 | Bacteria | 4833 |
| 1264 | Ga0496104_0144865 | 3300048907 | Bacteria | 2281 |
| 1265 | Ga0496104_0149680 | 3300048907 | Bacteria | 2241 |
| 1266 | Ga0496104_0176149 | 3300048907 | Bacteria | 2049 |
| 1267 | Ga0496105_0060874 | 3300048908 | Bacteria | 3115 |
| 1268 | Ga0496106_0056076 | 3300048909 | Bacteria | 2979 |
| 1269 | Ga0496106_0147709 | 3300048909 | Bacteria | 1853 |
| 1270 | Ga0496107_0365092 | 3300048910 | Bacteria | 1074 |
| 1271 | Ga0496108_0003906 | 3300048911 | Bacteria | 11971 |
| 1272 | Ga0496108_0040415 | 3300048911 | Bacteria | 3888 |
| 1273 | Ga0496108_0181674 | 3300048911 | Bacteria | 1822 |
| 1274 | Ga0496109_0014286 | 3300048912 | Bacteria | 6909 |
| 1275 | Ga0496109_0030192 | 3300048912 | Bacteria | 4859 |
| 1276 | Ga0496109_0119903 | 3300048912 | Bacteria | 2450 |
| 1277 | Ga0496110_0000897 | 3300048913 | Bacteria | 20981 |
| 1278 | Ga0496110_0064141 | 3300048913 | Bacteria | 3246 |
| 1279 | Ga0496110_0177063 | 3300048913 | Bacteria | 1936 |
| 1280 | Ga0496111_0006350 | 3300048914 | Bacteria | 7668 |
| 1281 | Ga0496112_0001650 | 3300048915 | Bacteria | 17325 |
| 1282 | Ga0496112_0033130 | 3300048915 | Bacteria | 5020 |
| 1283 | Ga0496112_0036483 | 3300048915 | Bacteria | 4796 |
| 1284 | Ga0496112_0040595 | 3300048915 | Bacteria | 4550 |
| 1285 | Ga0496113_0006167 | 3300048916 | Bacteria | 7567 |
| 1286 | Ga0496113_0023536 | 3300048916 | Bacteria | 4367 |
| 1287 | Ga0496113_0141040 | 3300048916 | Bacteria | 1896 |
| 1288 | Ga0496114_0279364 | 3300048917 | Bacteria | 1472 |
| 1289 | Ga0496115_0046082 | 3300048918 | Bacteria | 3483 |
| 1290 | Ga0496115_0058899 | 3300048918 | Bacteria | 3092 |
| 1291 | Ga0496115_0084681 | 3300048918 | Bacteria | 2585 |
| 1292 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 1293 | Ga0496116_0033391 | 3300048919 | Bacteria | 3652 |
| 1294 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 1295 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 1296 | Ga0496118_0000054 | 3300048921 | Bacteria | 233617 |
| 1297 | Ga0496118_0000208 | 3300048921 | Bacteria | 102645 |
| 1298 | Ga0496118_0021158 | 3300048921 | Bacteria | 5736 |
| 1299 | Ga0496118_0095560 | 3300048921 | Bacteria | 2028 |
| 1300 | Ga0496119_0001742 | 3300048922 | Bacteria | 25363 |
| 1301 | Ga0496120_0001350 | 3300048923 | Bacteria | 30183 |
| 1302 | Ga0496120_0005474 | 3300048923 | Bacteria | 10117 |
| 1303 | Ga0496120_0117392 | 3300048923 | Bacteria | 1380 |
| 1304 | Ga0496121_0004095 | 3300048924 | Bacteria | 20003 |
| 1305 | Ga0496121_0011702 | 3300048924 | Bacteria | 9688 |
| 1306 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 1307 | Ga0496122_0004894 | 3300048925 | Bacteria | 16255 |
| 1308 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 1309 | Ga0496123_0018182 | 3300048926 | Bacteria | 5607 |
| 1310 | Ga0496125_0001899 | 3300048928 | Bacteria | 28609 |
| 1311 | Ga0496125_0047340 | 3300048928 | Bacteria | 3598 |
| 1312 | Ga0496125_0082673 | 3300048928 | Bacteria | 2446 |
| 1313 | Ga0496126_0001469 | 3300048929 | Bacteria | 36677 |
| 1314 | Ga0496126_0001514 | 3300048929 | Bacteria | 35896 |
| 1315 | Ga0496126_0008444 | 3300048929 | Bacteria | 11111 |
| 1316 | Ga0496126_0154782 | 3300048929 | Bacteria | 1962 |
| 1317 | Ga0495682_0038985 | 3300049460 | Bacteria | 1745 |
| 1318 | Ga0495682_0041426 | 3300049460 | Bacteria | 1688 |
| 1319 | Ga0501031_0183289 | 3300049568 | Bacteria | 1367 |
| 1320 | Ga0501032_0004235 | 3300049569 | Bacteria | 10847 |
| 1321 | Ga0501033_0004380 | 3300049570 | Bacteria | 11315 |
| 1322 | Ga0501033_0005550 | 3300049570 | Bacteria | 9975 |
| 1323 | Ga0501034_0002524 | 3300049571 | Bacteria | 21942 |
| 1324 | Ga0501034_0011934 | 3300049571 | Bacteria | 8982 |
| 1325 | Ga0501034_0012973 | 3300049571 | Bacteria | 8590 |
| 1326 | Ga0501034_0018184 | 3300049571 | Bacteria | 7210 |
| 1327 | Ga0501034_0151613 | 3300049571 | Bacteria | 2294 |
| 1328 | Ga0501036_0000952 | 3300049572 | Bacteria | 21786 |
| 1329 | Ga0501036_0136224 | 3300049572 | Bacteria | 2073 |
| 1330 | Ga0501037_0002978 | 3300049573 | Bacteria | 12299 |
| 1331 | Ga0501038_0000048 | 3300049574 | Bacteria | 104260 |
| 1332 | Ga0501038_0000619 | 3300049574 | Bacteria | 31649 |
| 1333 | Ga0501039_0010233 | 3300049575 | Bacteria | 7147 |
| 1334 | Ga0501039_0036795 | 3300049575 | Bacteria | 3777 |
| 1335 | Ga0501040_0140012 | 3300049576 | Bacteria | 1704 |
| 1336 | Ga0501041_0028234 | 3300049577 | Bacteria | 3384 |
| 1337 | Ga0501042_0115466 | 3300049578 | Bacteria | 1933 |
| 1338 | Ga0501043_0000347 | 3300049579 | Bacteria | 42083 |
| 1339 | Ga0501046_0003161 | 3300049580 | Bacteria | 15206 |
| 1340 | Ga0501047_0000261 | 3300049581 | Bacteria | 61793 |
| 1341 | Ga0501047_0005907 | 3300049581 | Bacteria | 11516 |
| 1342 | Ga0501067_0037067 | 3300049583 | Bacteria | 2708 |
| 1343 | Ga0501067_0049168 | 3300049583 | Bacteria | 2337 |
| 1344 | Ga0501069_0106418 | 3300049585 | Bacteria | 1595 |
| 1345 | Ga0501070_0002167 | 3300049586 | Bacteria | 17251 |
| 1346 | Ga0501071_0058442 | 3300049587 | Bacteria | 2789 |
| 1347 | Ga0501072_0252753 | 3300049588 | Bacteria | 1403 |
| 1348 | Ga0501072_0410288 | 3300049588 | Bacteria | 1074 |
| 1349 | Ga0501074_0006292 | 3300049590 | Bacteria | 8574 |
| 1350 | Ga0501075_0032307 | 3300049591 | Bacteria | 3888 |
| 1351 | Ga0501075_0045154 | 3300049591 | Bacteria | 3306 |
| 1352 | Ga0501075_0242211 | 3300049591 | Bacteria | 1375 |
| 1353 | Ga0501075_0334845 | 3300049591 | Bacteria | 1153 |
| 1354 | Ga0501076_0013524 | 3300049592 | Bacteria | 6119 |
| 1355 | Ga0501076_0106789 | 3300049592 | Bacteria | 2260 |
| 1356 | Ga0501079_0040224 | 3300049741 | Bacteria | 3606 |
| 1357 | Ga0501079_0078780 | 3300049741 | Bacteria | 2549 |
| 1358 | Ga0501080_0024570 | 3300049742 | Bacteria | 5587 |
| 1359 | Ga0501080_0303533 | 3300049742 | Bacteria | 1447 |
| 1360 | Ga0501081_0100733 | 3300049743 | Bacteria | 2042 |
| 1361 | Ga0501035_0003457 | 3300049822 | Bacteria | 15115 |
| 1362 | Ga0501035_0057137 | 3300049822 | Bacteria | 3479 |
| 1363 | Ga0501044_0028927 | 3300049823 | Bacteria | 5844 |
| 1364 | Ga0501044_0222462 | 3300049823 | Bacteria | 1838 |
| 1365 | Ga0501045_0035593 | 3300049824 | Bacteria | 3615 |
| 1366 | Ga0501045_0215627 | 3300049824 | Bacteria | 1429 |
| 1367 | nmdc:mga03n38_32661_c1 | 3300050490 | Bacteria | 2208 |
| 1368 | nmdc:mga00v17_15_c1 | 3300050491 | Bacteria | 126234 |
| 1369 | nmdc:mga00v17_25504_c1 | 3300050491 | Bacteria | 3437 |
| 1370 | nmdc:mga00v17_35588_c1 | 3300050491 | Bacteria | 2964 |
| 1371 | nmdc:mga06z11_28285_c1 | 3300050494 | Bacteria | 2689 |
| 1372 | nmdc:mga05p37_107661_c1 | 3300050507 | Bacteria | 2735 |
| 1373 | nmdc:mga05p37_1139_c1 | 3300050507 | Bacteria | 30539 |
| 1374 | nmdc:mga05p37_17501_c1 | 3300050507 | Bacteria | 8651 |
| 1375 | nmdc:mga05p37_190031_c1 | 3300050507 | Bacteria | 2494 |
| 1376 | nmdc:mga05p37_21578_c1 | 3300050507 | Bacteria | 7803 |
| 1377 | nmdc:mga05p37_251652_c1 | 3300050507 | Bacteria | 2119 |
| 1378 | nmdc:mga05p37_30845_c1 | 3300050507 | Bacteria | 6543 |
| 1379 | nmdc:mga05p37_32441_c1 | 3300050507 | Bacteria | 6386 |
| 1380 | nmdc:mga05p37_339387_c1 | 3300050507 | Bacteria | 1772 |
| 1381 | nmdc:mga05p37_366500_c1 | 3300050507 | Bacteria | 1692 |
| 1382 | nmdc:mga05p37_49_c1 | 3300050507 | Bacteria | 103776 |
| 1383 | nmdc:mga05p37_51401_c1 | 3300050507 | Bacteria | 5068 |
| 1384 | nmdc:mga05p37_66571_c1 | 3300050507 | Bacteria | 4431 |
| 1385 | nmdc:mga05p37_69457_c1 | 3300050507 | Bacteria | 4333 |
| 1386 | nmdc:mga05p37_70509_c1 | 3300050507 | Bacteria | 4298 |
| 1387 | nmdc:mga05p37_9401_c1 | 3300050507 | Bacteria | 11570 |
| 1388 | nmdc:mga05p37_94802_c1 | 3300050507 | Bacteria | 3677 |
| 1389 | nmdc:mga09592_20042_c1 | 3300050508 | Bacteria | 5495 |
| 1390 | nmdc:mga09592_2435_c1 | 3300050508 | Bacteria | 15016 |
| 1391 | nmdc:mga09592_2888_c1 | 3300050508 | Bacteria | 13923 |
| 1392 | nmdc:mga09592_29650_c1 | 3300050508 | Bacteria | 4549 |
| 1393 | nmdc:mga09592_55716_c1 | 3300050508 | Bacteria | 3341 |
| 1394 | nmdc:mga09592_6952_c1 | 3300050508 | Bacteria | 9200 |
| 1395 | nmdc:mga09592_98582_c1 | 3300050508 | Bacteria | 2502 |
| 1396 | nmdc:mga0qj67_100449_c1 | 3300050509 | Bacteria | 2332 |
| 1397 | nmdc:mga0qj67_100594_c1 | 3300050509 | Bacteria | 2330 |
| 1398 | nmdc:mga0qj67_119430_c1 | 3300050509 | Bacteria | 2132 |
| 1399 | nmdc:mga0qj67_12577_c1 | 3300050509 | Bacteria | 6379 |
| 1400 | nmdc:mga0qj67_16204_c1 | 3300050509 | Bacteria | 5648 |
| 1401 | nmdc:mga0qj67_17549_c1 | 3300050509 | Bacteria | 5443 |
| 1402 | nmdc:mga0qj67_290316_c1 | 3300050509 | Bacteria | 1325 |
| 1403 | nmdc:mga0qj67_364633_c1 | 3300050509 | Bacteria | 1167 |
| 1404 | nmdc:mga0qj67_5724_c1 | 3300050509 | Bacteria | 9094 |
| 1405 | nmdc:mga06r32_144929_c1 | 3300050510 | Bacteria | 2352 |
| 1406 | nmdc:mga06r32_15361_c1 | 3300050510 | Bacteria | 6954 |
| 1407 | nmdc:mga06r32_165272_c1 | 3300050510 | Bacteria | 2196 |
| 1408 | nmdc:mga06r32_17242_c1 | 3300050510 | Bacteria | 6591 |
| 1409 | nmdc:mga06r32_247802_c1 | 3300050510 | Bacteria | 1769 |
| 1410 | nmdc:mga06r32_31766_c1 | 3300050510 | Bacteria | 4962 |
| 1411 | nmdc:mga06r32_329327_c1 | 3300050510 | Bacteria | 1512 |
| 1412 | nmdc:mga06r32_37338_c1 | 3300050510 | Bacteria | 4596 |
| 1413 | nmdc:mga06r32_3800_c2 | 3300050510 | Bacteria | 9293 |
| 1414 | nmdc:mga06r32_67414_c1 | 3300050510 | Bacteria | 3455 |
| 1415 | nmdc:mga06r32_86053_c1 | 3300050510 | Bacteria | 3066 |
| 1416 | nmdc:mga08y16_11854_c1 | 3300050511 | Bacteria | 9158 |
| 1417 | nmdc:mga08y16_122744_c1 | 3300050511 | Bacteria | 2703 |
| 1418 | nmdc:mga08y16_128252_c1 | 3300050511 | Bacteria | 2639 |
| 1419 | nmdc:mga08y16_17132_c1 | 3300050511 | Bacteria | 7628 |
| 1420 | nmdc:mga08y16_180840_c1 | 3300050511 | Bacteria | 2190 |
| 1421 | nmdc:mga08y16_22046_c1 | 3300050511 | Bacteria | 6726 |
| 1422 | nmdc:mga08y16_293641_c1 | 3300050511 | Bacteria | 1676 |
| 1423 | nmdc:mga08y16_32274_c1 | 3300050511 | Bacteria | 5507 |
| 1424 | nmdc:mga08y16_32278_c1 | 3300050511 | Bacteria | 5506 |
| 1425 | nmdc:mga08y16_48167_c1 | 3300050511 | Bacteria | 4460 |
| 1426 | nmdc:mga08y16_50488_c1 | 3300050511 | Bacteria | 4353 |
| 1427 | nmdc:mga08y16_60740_c1 | 3300050511 | Bacteria | 3947 |
| 1428 | nmdc:mga08y16_67595_c1 | 3300050511 | Bacteria | 3727 |
| 1429 | nmdc:mga08y16_9318_c1 | 3300050511 | Bacteria | 10297 |
| 1430 | nmdc:mga0n895_1022_c1 | 3300050512 | Bacteria | 20347 |
| 1431 | nmdc:mga0n895_11825_c1 | 3300050512 | Bacteria | 7805 |
| 1432 | nmdc:mga0n895_121269_c1 | 3300050512 | Bacteria | 2636 |
| 1433 | nmdc:mga0n895_13179_c1 | 3300050512 | Bacteria | 7447 |
| 1434 | nmdc:mga0n895_138408_c1 | 3300050512 | Bacteria | 2462 |
| 1435 | nmdc:mga0n895_14065_c1 | 3300050512 | Bacteria | 7253 |
| 1436 | nmdc:mga0n895_208456_c1 | 3300050512 | Bacteria | 1985 |
| 1437 | nmdc:mga0n895_39050_c1 | 3300050512 | Bacteria | 4603 |
| 1438 | nmdc:mga0n895_436004_c1 | 3300050512 | Bacteria | 1324 |
| 1439 | nmdc:mga0n895_6911_c1 | 3300050512 | Bacteria | 9695 |
| 1440 | nmdc:mga0n895_81867_c1 | 3300050512 | Bacteria | 3217 |
| 1441 | nmdc:mga0n895_844_c1 | 3300050512 | Bacteria | 21996 |
| 1442 | nmdc:mga0rr50_11399_c1 | 3300050513 | Bacteria | 5690 |
| 1443 | nmdc:mga0rr50_12325_c1 | 3300050513 | Bacteria | 5521 |
| 1444 | nmdc:mga0rr50_16343_c1 | 3300050513 | Bacteria | 4926 |
| 1445 | nmdc:mga0rr50_198028_c1 | 3300050513 | Bacteria | 1650 |
| 1446 | nmdc:mga0rr50_2107_c1 | 3300050513 | Bacteria | 11118 |
| 1447 | nmdc:mga0rr50_23_c1 | 3300050513 | Bacteria | 116800 |
| 1448 | nmdc:mga0rr50_266194_c1 | 3300050513 | Bacteria | 1427 |
| 1449 | nmdc:mga0rr50_29045_c1 | 3300050513 | Bacteria | 3894 |
| 1450 | nmdc:mga0rr50_356_c1 | 3300050513 | Bacteria | 24892 |
| 1451 | nmdc:mga08x19_103868_c1 | 3300050514 | Bacteria | 1888 |
| 1452 | nmdc:mga08x19_131950_c1 | 3300050514 | Bacteria | 1681 |
| 1453 | nmdc:mga08x19_165_c1 | 3300050514 | Bacteria | 54991 |
| 1454 | nmdc:mga08x19_25_c1 | 3300050514 | Bacteria | 222966 |
| 1455 | nmdc:mga08x19_4977_c1 | 3300050514 | Bacteria | 7856 |
| 1456 | nmdc:mga08x19_577_c1 | 3300050514 | Bacteria | 7744 |
| 1457 | nmdc:mga08x19_5806_c1 | 3300050514 | Bacteria | 7298 |
| 1458 | nmdc:mga08x19_646_c1 | 3300050514 | Bacteria | 22496 |
| 1459 | nmdc:mga0a205_137723_c1 | 3300050515 | Bacteria | 2341 |
| 1460 | nmdc:mga0a205_16866_c1 | 3300050515 | Bacteria | 6836 |
| 1461 | nmdc:mga0a205_180796_c1 | 3300050515 | Bacteria | 2003 |
| 1462 | nmdc:mga0a205_25453_c1 | 3300050515 | Bacteria | 5639 |
| 1463 | nmdc:mga0a205_27501_c1 | 3300050515 | Bacteria | 5431 |
| 1464 | nmdc:mga0a205_323_c1 | 3300050515 | Bacteria | 35802 |
| 1465 | nmdc:mga0a205_351822_c1 | 3300050515 | Bacteria | 1340 |
| 1466 | nmdc:mga0a205_39867_c1 | 3300050515 | Bacteria | 4521 |
| 1467 | nmdc:mga0a205_6239_c1 | 3300050515 | Bacteria | 10760 |
| 1468 | nmdc:mga0a205_6436_c1 | 3300050515 | Bacteria | 10615 |
| 1469 | nmdc:mga0a205_7354_c1 | 3300050515 | Bacteria | 9973 |
| 1470 | nmdc:mga0a205_76706_c1 | 3300050515 | Bacteria | 3230 |
| 1471 | nmdc:mga0sz30_62680_c1 | 3300050516 | Bacteria | 1591 |
| 1472 | Ga0495601_0007830 | 3300053077 | Bacteria | 6286 |
| 1473 | Ga0495612_0025414 | 3300053078 | Bacteria | 2377 |
| 1474 | Ga0495595_0026163 | 3300053084 | Bacteria | 2591 |
| 1475 | Ga0495619_0020393 | 3300053085 | Bacteria | 4220 |
| 1476 | Ga0500643_015722 | 3300053087 | Bacteria | 2586 |
| 1477 | Ga0500560_002917 | 3300053107 | Bacteria | 3366 |
| 1478 | Ga0500560_003744 | 3300053107 | Bacteria | 3122 |
| 1479 | Ga0500572_004591 | 3300053111 | Bacteria | 3132 |
| 1480 | Ga0500595_000121 | 3300053119 | Bacteria | 51239 |
| 1481 | Ga0500595_009623 | 3300053119 | Bacteria | 3894 |
| 1482 | Ga0500597_008056 | 3300053120 | Bacteria | 3619 |
| 1483 | Ga0500628_000737 | 3300053129 | Bacteria | 5832 |
| 1484 | Ga0500577_0005877 | 3300053142 | Bacteria | 3340 |
| 1485 | Ga0500616_0005395 | 3300053153 | Bacteria | 8682 |
| 1486 | Ga0500624_000393 | 3300053157 | Bacteria | 13789 |
| 1487 | Ga0500636_0000025 | 3300053177 | Bacteria | 86697 |
| 1488 | Ga0500636_0004427 | 3300053177 | Bacteria | 7949 |
| 1489 | Ga0501084_0028505 | 3300054114 | Bacteria | 4668 |
| 1490 | Ga0501084_0204766 | 3300054114 | Bacteria | 1665 |
| 1491 | Ga0500661_002485 | 3300055283 | Bacteria | 3477 |
| 1492 | Ga0590071_000285 | 3300059421 | Bacteria | 14753 |
| 1493 | Ga0501082_0056401 | 3300060353 | Bacteria | 3384 |
| 1494 | 2537873611 | 2537561587 | Bacteria | 5425293 |
| 1495 | 2601610906 | 2600255279 | Bacteria | 5605316 |
| 1496 | 2601747680 | 2600255308 | Bacteria | 5611129 |
| 1497 | 2643921542 | 2643221582 | Bacteria | 5804683 |
| 1498 | 2740994242 | 2740891818 | Bacteria | 6711283 |
| 1499 | 2808988156 | 2808606387 | Bacteria | 5697198 |
| 1500 | 2831428567 | 2831426010 | Bacteria | 8662725 |
| 1501 | 2838678603 | 2838675328 | Bacteria | 4909118 |
| 1502 | 2838718309 | 2838714209 | Bacteria | 5525906 |
| 1503 | 2838722899 | 2838719591 | Bacteria | 5523910 |
| 1504 | 2838728375 | 2838724970 | Bacteria | 4908691 |
| 1505 | 2841850455 | 2841846520 | Bacteria | 5345850 |
| 1506 | 2841863292 | 2841859092 | Bacteria | 5436171 |
| 1507 | 2842129035 | 2842124991 | Bacteria | 5346824 |
| 1508 | 2842133496 | 2842130223 | Bacteria | 4909145 |
| 1509 | 2842155593 | 2842152218 | Bacteria | 4908957 |
| 1510 | 2842174449 | 2842170452 | Bacteria | 5525737 |
| 1511 | 2842179110 | 2842175837 | Bacteria | 4908771 |
| 1512 | 2842190733 | 2842187318 | Bacteria | 5524014 |
| 1513 | 2842214943 | 2842211629 | Bacteria | 5523832 |
| 1514 | 2842227664 | 2842224351 | Bacteria | 5524473 |
| 1515 | 2842519971 | 2842515876 | Bacteria | 5436280 |
| 1516 | 2848699582 | 2848694841 | Bacteria | 9205737 |
| 1517 | 2849663763 | 2849660919 | Bacteria | 8251853 |
| 1518 | 2884217039 | 2884215851 | Bacteria | 4554841 |
| 1519 | 2899795389 | 2899792073 | Bacteria | 4926588 |
| 1520 | 2899849368 | 2899845264 | Bacteria | 5672268 |
| 1521 | 2919118434 | 2919114240 | Bacteria | 5700270 |
| 1522 | 2926754963 | 2926754445 | Bacteria | 5964435 |
| 1523 | 2933010559 | 2933006813 | Bacteria | 4912075 |
| 1524 | 2933015769 | 2933011516 | Bacteria | 5439334 |
| 1525 | 2933597493 | 2933594066 | Bacteria | 5594265 |
| 1526 | 2935392915 | 2935390628 | Bacteria | 7043367 |
| 1527 | 2979092603 | 2979089926 | Bacteria | 5670289 |
| 1528 | 2979100006 | 2979095461 | Bacteria | 5669583 |
| 1529 | 2984513628 | 2984509177 | Bacteria | 5274802 |
| 1530 | 2984522791 | 2984518228 | Bacteria | 5277463 |
| 1531 | 2984542098 | 2984537506 | Bacteria | 5277481 |
| 1532 | 2984601528 | 2984601300 | Bacteria | 5455244 |
| 1533 | 2995464776 | 2995463766 | Bacteria | 8577691 |
| 1534 | 3006486689 | 3006486233 | Bacteria | 8157040 |
| 1535 | 8002779563 | 8002775197 | Bacteria | 10728764 |
| 1536 | 8003573705 | 8003570095 | Bacteria | 5747666 |
| 1537 | 8025481942 | 8025478263 | Bacteria | 8209203 |
| 1538 | 8054463744 | 8054460903 | Bacteria | 4872905 |
| 1539 | Ga0400484_14440 | |||
| 1540 | JGI24746J21847_1007330 | |||
| 1541 | JGI25406J46586_10000491 | |||
| 1542 | JGI25406J46586_10007753 | |||
| 1543 | Ga0065712_10070058 | |||
| 1544 | Ga0065715_10005050 | |||
| 1545 | Ga0065715_10010633 | |||
| 1546 | Ga0065715_10090876 | |||
| 1547 | Ga0065715_10114814 | |||
| 1548 | Ga0065715_10176740 | |||
| 1549 | Ga0065715_10217235 | |||
| 1550 | Ga0065715_10236973 | |||
| 1551 | Ga0065707_10094919 | |||
| 1552 | Ga0070658_10011373 | |||
| 1553 | Ga0070658_10034910 | |||
| 1554 | Ga0070676_10019288 | |||
| 1555 | Ga0070676_10028453 | |||
| 1556 | Ga0070676_10029120 | |||
| 1557 | Ga0070676_10042623 | |||
| 1558 | Ga0070676_10042666 | |||
| 1559 | Ga0070676_10094738 | |||
| 1560 | Ga0070683_100001126 | |||
| 1561 | Ga0070683_100034468 | |||
| 1562 | Ga0070683_100039007 | |||
| 1563 | Ga0070683_100056802 | |||
| 1564 | Ga0070683_100057431 | |||
| 1565 | Ga0070683_100065420 | |||
| 1566 | Ga0070683_100181721 | |||
| 1567 | Ga0070683_100322244 | |||
| 1568 | Ga0070690_100006740 | |||
| 1569 | Ga0070690_100014748 | |||
| 1570 | Ga0070690_100023771 | |||
| 1571 | Ga0070690_100045248 | |||
| 1572 | Ga0070690_100064366 | |||
| 1573 | Ga0070690_100065474 | |||
| 1574 | Ga0070690_100082341 | |||
| 1575 | Ga0070690_100090851 | |||
| 1576 | Ga0070690_100101546 | |||
| 1577 | Ga0070690_100168379 | |||
| 1578 | Ga0070670_100001936 | |||
| 1579 | Ga0070670_100006348 | |||
| 1580 | Ga0070670_100017827 | |||
| 1581 | Ga0070670_100020760 | |||
| 1582 | Ga0070670_100021146 | |||
| 1583 | Ga0070670_100039172 | |||
| 1584 | Ga0070670_100076642 | |||
| 1585 | Ga0070677_10002564 | |||
| 1586 | Ga0068869_100011370 | |||
| 1587 | Ga0068869_100012331 | |||
| 1588 | Ga0068869_100043658 | |||
| 1589 | Ga0068869_100087287 | |||
| 1590 | Ga0068869_100186645 | |||
| 1591 | Ga0068869_100262555 | |||
| 1592 | Ga0070666_10012366 | |||
| 1593 | Ga0070666_10015831 | |||
| 1594 | Ga0070666_10036583 | |||
| 1595 | Ga0070666_10168285 | |||
| 1596 | Ga0070680_100037488 | |||
| 1597 | Ga0070680_100045533 | |||
| 1598 | Ga0070680_100115030 | |||
| 1599 | Ga0070680_100311552 | |||
| 1600 | Ga0068868_100003641 | |||
| 1601 | Ga0068868_100016841 | |||
| 1602 | Ga0070660_100285795 | |||
| 1603 | Ga0070689_100036732 | |||
| 1604 | Ga0070689_100055068 | |||
| 1605 | Ga0070689_100056731 | |||
| 1606 | Ga0070689_100100516 | |||
| 1607 | Ga0070689_100191728 | |||
| 1608 | Ga0070691_10005290 | |||
| 1609 | Ga0070691_10019803 | |||
| 1610 | Ga0070687_100012601 | |||
| 1611 | Ga0070687_100023806 | |||
| 1612 | Ga0070687_100025783 | |||
| 1613 | Ga0070687_100031349 | |||
| 1614 | Ga0070661_100011194 | |||
| 1615 | Ga0070661_100013643 | |||
| 1616 | Ga0070661_100017754 | |||
| 1617 | Ga0070661_100050849 | |||
| 1618 | Ga0070661_100116655 | |||
| 1619 | Ga0070692_10053279 | |||
| 1620 | Ga0070668_100094882 | |||
| 1621 | Ga0070669_100001000 | |||
| 1622 | Ga0070669_100001192 | |||
| 1623 | Ga0070669_100018183 | |||
| 1624 | Ga0070669_100034609 | |||
| 1625 | Ga0070669_100037580 | |||
| 1626 | Ga0070669_100041230 | |||
| 1627 | Ga0070669_100118136 | |||
| 1628 | Ga0070669_100164049 | |||
| 1629 | Ga0070675_100000202 | |||
| 1630 | Ga0070675_100000206 | |||
| 1631 | Ga0070675_100000408 | |||
| 1632 | Ga0070675_100005006 | |||
| 1633 | Ga0070675_100013178 | |||
| 1634 | Ga0070675_100018751 | |||
| 1635 | Ga0070675_100020786 | |||
| 1636 | Ga0070675_100024217 | |||
| 1637 | Ga0070675_100038952 | |||
| 1638 | Ga0070675_100046972 | |||
| 1639 | Ga0070675_100124788 | |||
| 1640 | Ga0070675_100153219 | |||
| 1641 | Ga0070675_100304999 | |||
| 1642 | Ga0070671_100001717 | |||
| 1643 | Ga0070671_100008027 | |||
| 1644 | Ga0070671_100008756 | |||
| 1645 | Ga0070671_100033204 | |||
| 1646 | Ga0070671_100181883 | |||
| 1647 | Ga0070671_100259913 | |||
| 1648 | Ga0070674_100000192 | |||
| 1649 | Ga0070674_100002496 | |||
| 1650 | Ga0070674_100019077 | |||
| 1651 | Ga0070673_100004944 | |||
| 1652 | Ga0070673_100025833 | |||
| 1653 | Ga0070673_100047112 | |||
| 1654 | Ga0070673_100083282 | |||
| 1655 | Ga0070673_100128423 | |||
| 1656 | Ga0070688_100014162 | |||
| 1657 | Ga0070688_100057032 | |||
| 1658 | Ga0070659_100016221 | |||
| 1659 | Ga0070659_100022661 | |||
| 1660 | Ga0070659_100032944 | |||
| 1661 | Ga0070667_100002413 | |||
| 1662 | Ga0070667_100248121 | |||
| 1663 | Ga0070667_100357696 | |||
| 1664 | Ga0070709_10039305 | |||
| 1665 | Ga0070709_10174061 | |||
| 1666 | Ga0070713_100035741 | |||
| 1667 | Ga0070701_10003212 | |||
| 1668 | Ga0070701_10009769 | |||
| 1669 | Ga0070701_10029499 | |||
| 1670 | Ga0070701_10046400 | |||
| 1671 | Ga0070701_10056666 | |||
| 1672 | Ga0070711_100000038 | |||
| 1673 | Ga0070711_100064470 | |||
| 1674 | Ga0070705_100000023 | |||
| 1675 | Ga0070705_100001554 | |||
| 1676 | Ga0070705_100006748 | |||
| 1677 | Ga0070705_100109541 | |||
| 1678 | Ga0070705_100194391 | |||
| 1679 | Ga0070700_100003012 | |||
| 1680 | Ga0070700_100036343 | |||
| 1681 | Ga0070700_100037695 | |||
| 1682 | Ga0070694_100007236 | |||
| 1683 | Ga0070694_100027390 | |||
| 1684 | Ga0070708_100014503 | |||
| 1685 | Ga0070708_100038377 | |||
| 1686 | Ga0070708_100056011 | |||
| 1687 | Ga0070708_100104251 | |||
| 1688 | Ga0070663_100007672 | |||
| 1689 | Ga0070663_100033219 | |||
| 1690 | Ga0070678_100029082 | |||
| 1691 | Ga0070678_100049631 | |||
| 1692 | Ga0070678_100057239 | |||
| 1693 | Ga0070678_100106840 | |||
| 1694 | Ga0070662_100008307 | |||
| 1695 | Ga0070662_100022624 | |||
| 1696 | Ga0070662_100053625 | |||
| 1697 | Ga0070662_100139429 | |||
| 1698 | Ga0070681_10001704 | |||
| 1699 | Ga0070681_10013545 | |||
| 1700 | Ga0070681_10028189 | |||
| 1701 | Ga0070681_10030588 | |||
| 1702 | Ga0070681_10057901 | |||
| 1703 | Ga0070681_10061568 | |||
| 1704 | Ga0070681_10086994 | |||
| 1705 | Ga0068867_100005997 | |||
| 1706 | Ga0068867_100008016 | |||
| 1707 | Ga0068867_100012021 | |||
| 1708 | Ga0068867_100025755 | |||
| 1709 | Ga0068867_100033375 | |||
| 1710 | Ga0068867_100037901 | |||
| 1711 | Ga0068867_100122508 | |||
| 1712 | Ga0068867_100138363 | |||
| 1713 | Ga0070685_10005680 | |||
| 1714 | Ga0070685_10052836 | |||
| 1715 | Ga0070706_100010022 | |||
| 1716 | Ga0070706_100197323 | |||
| 1717 | Ga0070706_100314277 | |||
| 1718 | Ga0070707_100000212 | |||
| 1719 | Ga0070707_100000431 | |||
| 1720 | Ga0070707_100034000 | |||
| 1721 | Ga0070707_100072471 | |||
| 1722 | Ga0070698_100000385 | |||
| 1723 | Ga0070698_100016037 | |||
| 1724 | Ga0070698_100248411 | |||
| 1725 | Ga0070698_100303010 | |||
| 1726 | Ga0070699_100061274 | |||
| 1727 | Ga0070699_100084611 | |||
| 1728 | Ga0070699_100113220 | |||
| 1729 | Ga0070699_100121194 | |||
| 1730 | Ga0070699_100125417 | |||
| 1731 | Ga0070679_100017481 | |||
| 1732 | Ga0070679_100052278 | |||
| 1733 | Ga0070679_100195639 | |||
| 1734 | Ga0070679_100205341 | |||
| 1735 | Ga0070684_100000068 | |||
| 1736 | Ga0070684_100008077 | |||
| 1737 | Ga0070684_100076425 | |||
| 1738 | Ga0070684_100373888 | |||
| 1739 | Ga0070697_100000531 | |||
| 1740 | Ga0070697_100026023 | |||
| 1741 | Ga0070697_100254576 | |||
| 1742 | Ga0068853_100001165 | |||
| 1743 | Ga0068853_100031112 | |||
| 1744 | Ga0068853_100070822 | |||
| 1745 | Ga0068853_100319535 | |||
| 1746 | Ga0070672_100008106 | |||
| 1747 | Ga0070672_100009511 | |||
| 1748 | Ga0070672_100045467 | |||
| 1749 | Ga0070672_100050492 | |||
| 1750 | Ga0070672_100054107 | |||
| 1751 | Ga0070672_100076644 | |||
| 1752 | Ga0070672_100094364 | |||
| 1753 | Ga0070672_100096073 | |||
| 1754 | Ga0070686_100014154 | |||
| 1755 | Ga0070686_100015831 | |||
| 1756 | Ga0070686_100026116 | |||
| 1757 | Ga0070695_100000155 | |||
| 1758 | Ga0070695_100007901 | |||
| 1759 | Ga0070696_100001294 | |||
| 1760 | Ga0070696_100013489 | |||
| 1761 | Ga0070696_100087670 | |||
| 1762 | Ga0070665_100001535 | |||
| 1763 | Ga0070665_100007098 | |||
| 1764 | Ga0070665_100018061 | |||
| 1765 | Ga0070665_100026106 | |||
| 1766 | Ga0070665_100027580 | |||
| 1767 | Ga0070665_100029554 | |||
| 1768 | Ga0070665_100033893 | |||
| 1769 | Ga0070704_100001112 | |||
| 1770 | Ga0070704_100024108 | |||
| 1771 | Ga0070704_100095590 | |||
| 1772 | Ga0070704_100103968 | |||
| 1773 | Ga0070704_100109444 | |||
| 1774 | Ga0068855_100035919 | |||
| 1775 | Ga0068855_100107978 | |||
| 1776 | Ga0068855_100161260 | |||
| 1777 | Ga0068855_100211604 | |||
| 1778 | Ga0070664_100000408 | |||
| 1779 | Ga0070664_100003040 | |||
| 1780 | Ga0070664_100006808 | |||
| 1781 | Ga0070664_100009215 | |||
| 1782 | Ga0070664_100009579 | |||
| 1783 | Ga0070664_100018914 | |||
| 1784 | Ga0070664_100020599 | |||
| 1785 | Ga0070664_100022888 | |||
| 1786 | Ga0070664_100034123 | |||
| 1787 | Ga0070664_100079530 | |||
| 1788 | Ga0070664_100083244 | |||
| 1789 | Ga0070664_100098220 | |||
| 1790 | Ga0068857_100005029 | |||
| 1791 | Ga0068857_100017945 | |||
| 1792 | Ga0068857_100044957 | |||
| 1793 | Ga0068857_100048598 | |||
| 1794 | Ga0068857_100307235 | |||
| 1795 | Ga0068854_100141939 | |||
| 1796 | Ga0068856_100351940 | |||
| 1797 | Ga0068856_100399033 | |||
| 1798 | Ga0070702_100008655 | |||
| 1799 | Ga0068859_100005622 | |||
| 1800 | Ga0068859_100013051 | |||
| 1801 | Ga0068859_100016091 | |||
| 1802 | Ga0068859_100034153 | |||
| 1803 | Ga0068859_100078549 | |||
| 1804 | Ga0068859_100095218 | |||
| 1805 | Ga0068859_100170825 | |||
| 1806 | Ga0068859_100179049 | |||
| 1807 | Ga0068859_100180719 | |||
| 1808 | Ga0068859_100360208 | |||
| 1809 | Ga0068864_100030720 | |||
| 1810 | Ga0068864_100125410 | |||
| 1811 | Ga0068864_100307422 | |||
| 1812 | Ga0068861_100004593 | |||
| 1813 | Ga0068861_100005603 | |||
| 1814 | Ga0068861_100005906 | |||
| 1815 | Ga0068861_100048764 | |||
| 1816 | Ga0068861_100063982 | |||
| 1817 | Ga0068861_100261353 | |||
| 1818 | Ga0068870_10002305 | |||
| 1819 | Ga0068870_10002884 | |||
| 1820 | Ga0068870_10005642 | |||
| 1821 | Ga0068870_10182307 | |||
| 1822 | Ga0068863_100021750 | |||
| 1823 | Ga0068863_100063750 | |||
| 1824 | Ga0068863_100072609 | |||
| 1825 | Ga0068863_100151036 | |||
| 1826 | Ga0068858_100040590 | |||
| 1827 | Ga0068858_100049335 | |||
| 1828 | Ga0068858_100125856 | |||
| 1829 | Ga0068858_100128307 | |||
| 1830 | Ga0068858_100180231 | |||
| 1831 | Ga0068858_100213540 | |||
| 1832 | Ga0068860_100018392 | |||
| 1833 | Ga0068860_100032227 | |||
| 1834 | Ga0068860_100058145 | |||
| 1835 | Ga0068860_100081629 | |||
| 1836 | Ga0068860_100285269 | |||
| 1837 | Ga0068862_100001571 | |||
| 1838 | Ga0068862_100002276 | |||
| 1839 | Ga0068862_100013045 | |||
| 1840 | Ga0068862_100044380 | |||
| 1841 | Ga0068862_100046669 | |||
| 1842 | Ga0068862_100073499 | |||
| 1843 | Ga0068862_100191372 | |||
| 1844 | Ga0068862_100201759 | |||
| 1845 | Ga0081540_1074489 | |||
| 1846 | Ga0081539_10000093 | |||
| 1847 | Ga0081539_10001136 | |||
| 1848 | Ga0081539_10005341 | |||
| 1849 | Ga0081539_10009311 | |||
| 1850 | Ga0081539_10057781 | |||
| 1851 | Ga0070717_10030097 | |||
| 1852 | Ga0070717_10032785 | |||
| 1853 | Ga0070717_10336150 | |||
| 1854 | Ga0075368_10001899 | |||
| 1855 | Ga0075364_10000845 | |||
| 1856 | Ga0075364_10005410 | |||
| 1857 | Ga0075364_10038968 | |||
| 1858 | Ga0075432_10055550 | |||
| 1859 | Ga0075367_10020967 | |||
| 1860 | Ga0075367_10055547 | |||
| 1861 | Ga0075367_10101443 | |||
| 1862 | Ga0075369_10008604 | |||
| 1863 | Ga0097621_100043570 | |||
| 1864 | Ga0097621_100096262 | |||
| 1865 | Ga0097621_100147311 | |||
| 1866 | Ga0097621_100164616 | |||
| 1867 | Ga0068871_100015620 | |||
| 1868 | Ga0068871_100019830 | |||
| 1869 | Ga0068871_100256782 | |||
| 1870 | Ga0075428_100005558 | |||
| 1871 | Ga0075428_100007739 | |||
| 1872 | Ga0075428_100008259 | |||
| 1873 | Ga0075428_100011749 | |||
| 1874 | Ga0075428_100012298 | |||
| 1875 | Ga0075428_100022458 | |||
| 1876 | Ga0075428_100036930 | |||
| 1877 | Ga0075428_100050593 | |||
| 1878 | Ga0075428_100145289 | |||
| 1879 | Ga0075430_100001572 | |||
| 1880 | Ga0075430_100013858 | |||
| 1881 | Ga0075430_100025892 | |||
| 1882 | Ga0075430_100068808 | |||
| 1883 | Ga0075430_100088985 | |||
| 1884 | Ga0075430_100130023 | |||
| 1885 | Ga0075430_100170800 | |||
| 1886 | Ga0075430_100218642 | |||
| 1887 | Ga0075430_100240510 | |||
| 1888 | Ga0075430_100326639 | |||
| 1889 | Ga0075431_100002075 | |||
| 1890 | Ga0075431_100007891 | |||
| 1891 | Ga0075431_100014890 | |||
| 1892 | Ga0075431_100039560 | |||
| 1893 | Ga0075431_100041811 | |||
| 1894 | Ga0075431_100097958 | |||
| 1895 | Ga0075431_100118566 | |||
| 1896 | Ga0075431_100145261 | |||
| 1897 | Ga0075431_100206996 | |||
| 1898 | Ga0075431_100207846 | |||
| 1899 | Ga0075431_100340241 | |||
| 1900 | Ga0075433_10008088 | |||
| 1901 | Ga0075433_10014399 | |||
| 1902 | Ga0075433_10022099 | |||
| 1903 | Ga0075433_10024458 | |||
| 1904 | Ga0075433_10031125 | |||
| 1905 | Ga0075433_10031541 | |||
| 1906 | Ga0075433_10040375 | |||
| 1907 | Ga0075433_10047106 | |||
| 1908 | Ga0075433_10189420 | |||
| 1909 | Ga0075434_100000553 | |||
| 1910 | Ga0075434_100000585 | |||
| 1911 | Ga0075434_100002096 | |||
| 1912 | Ga0075434_100002820 | |||
| 1913 | Ga0075434_100004979 | |||
| 1914 | Ga0075434_100013018 | |||
| 1915 | Ga0075434_100015822 | |||
| 1916 | Ga0075434_100021087 | |||
| 1917 | Ga0075434_100043606 | |||
| 1918 | Ga0075434_100075410 | |||
| 1919 | Ga0075434_100082612 | |||
| 1920 | Ga0075434_100158591 | |||
| 1921 | Ga0075434_100334843 | |||
| 1922 | Ga0075429_100000181 | |||
| 1923 | Ga0075429_100002380 | |||
| 1924 | Ga0075429_100005278 | |||
| 1925 | Ga0075429_100024452 | |||
| 1926 | Ga0075429_100048639 | |||
| 1927 | Ga0075429_100118964 | |||
| 1928 | Ga0075429_100189523 | |||
| 1929 | Ga0068865_100012596 | |||
| 1930 | Ga0068865_100016005 | |||
| 1931 | Ga0068865_100262524 | |||
| 1932 | Ga0075436_100000199 | |||
| 1933 | Ga0075436_100005822 | |||
| 1934 | Ga0075436_100006076 | |||
| 1935 | Ga0075436_100009367 | |||
| 1936 | Ga0075436_100026590 | |||
| 1937 | Ga0097620_100005622 | |||
| 1938 | Ga0097620_100013051 | |||
| 1939 | Ga0097620_100016090 | |||
| 1940 | Ga0097620_100034155 | |||
| 1941 | Ga0097620_100078547 | |||
| 1942 | Ga0097620_100095218 | |||
| 1943 | Ga0097620_100170820 | |||
| 1944 | Ga0097620_100179047 | |||
| 1945 | Ga0097620_100180721 | |||
| 1946 | Ga0097620_100360230 | |||
| 1947 | Ga0099826_10000468 | |||
| 1948 | Ga0099826_10014757 | |||
| 1949 | Ga0075435_100000052 | |||
| 1950 | Ga0075435_100009595 | |||
| 1951 | Ga0075435_100022726 | |||
| 1952 | Ga0075435_100044354 | |||
| 1953 | Ga0075435_100074365 | |||
| 1954 | Ga0075435_100088232 | |||
| 1955 | Ga0099794_10005403 | |||
| 1956 | Ga0105240_10009442 | |||
| 1957 | Ga0105240_10089919 | |||
| 1958 | Ga0105240_10107198 | |||
| 1959 | Ga0105240_10134551 | |||
| 1960 | Ga0105240_10213176 | |||
| 1961 | Ga0105240_10374214 | |||
| 1962 | Ga0111539_10000324 | |||
| 1963 | Ga0111539_10003328 | |||
| 1964 | Ga0111539_10003636 | |||
| 1965 | Ga0111539_10006989 | |||
| 1966 | Ga0111539_10022595 | |||
| 1967 | Ga0111539_10028372 | |||
| 1968 | Ga0111539_10037755 | |||
| 1969 | Ga0111539_10041079 | |||
| 1970 | Ga0111539_10060627 | |||
| 1971 | Ga0111539_10068797 | |||
| 1972 | Ga0111539_10105503 | |||
| 1973 | Ga0111539_10118098 | |||
| 1974 | Ga0111539_10135625 | |||
| 1975 | Ga0111539_10144567 | |||
| 1976 | Ga0111539_10154542 | |||
| 1977 | Ga0111539_10312479 | |||
| 1978 | Ga0105245_10084662 | |||
| 1979 | Ga0105245_10106002 | |||
| 1980 | Ga0105245_10148397 | |||
| 1981 | Ga0105247_10031422 | |||
| 1982 | Ga0105247_10040785 | |||
| 1983 | Ga0105247_10063593 | |||
| 1984 | Ga0105247_10104426 | |||
| 1985 | Ga0114129_10000307 | |||
| 1986 | Ga0114129_10000588 | |||
| 1987 | Ga0114129_10006012 | |||
| 1988 | Ga0114129_10006290 | |||
| 1989 | Ga0114129_10006879 | |||
| 1990 | Ga0114129_10007407 | |||
| 1991 | Ga0114129_10010731 | |||
| 1992 | Ga0114129_10012882 | |||
| 1993 | Ga0114129_10021924 | |||
| 1994 | Ga0114129_10033704 | |||
| 1995 | Ga0114129_10047465 | |||
| 1996 | Ga0114129_10047748 | |||
| 1997 | Ga0114129_10061111 | |||
| 1998 | Ga0114129_10071975 | |||
| 1999 | Ga0114129_10079382 | |||
| 2000 | Ga0114129_10106093 | |||
| 2001 | Ga0114129_10156558 | |||
| 2002 | Ga0114129_10177608 | |||
| 2003 | Ga0114129_10268119 | |||
| 2004 | Ga0114129_10380637 | |||
| 2005 | Ga0114129_10587841 | |||
| 2006 | Ga0114129_10752778 | |||
| 2007 | Ga0105243_10019426 | |||
| 2008 | Ga0105243_10030455 | |||
| 2009 | Ga0105243_10041278 | |||
| 2010 | Ga0105243_10101663 | |||
| 2011 | Ga0105243_10247838 | |||
| 2012 | Ga0105243_10273776 | |||
| 2013 | Ga0105243_10408312 | |||
| 2014 | Ga0105242_10009410 | |||
| 2015 | Ga0105242_10016448 | |||
| 2016 | Ga0105242_10060137 | |||
| 2017 | Ga0105248_10000664 | |||
| 2018 | Ga0105248_10002959 | |||
| 2019 | Ga0105248_10014897 | |||
| 2020 | Ga0105248_10043880 | |||
| 2021 | Ga0105248_10063176 | |||
| 2022 | Ga0105248_10092522 | |||
| 2023 | Ga0105248_10108361 | |||
| 2024 | Ga0105248_10167554 | |||
| 2025 | Ga0105248_10337990 | |||
| 2026 | Ga0105248_10400700 | |||
| 2027 | Ga0105248_10439837 | |||
| 2028 | Ga0105237_10028798 | |||
| 2029 | Ga0105237_10079291 | |||
| 2030 | Ga0105237_10491492 | |||
| 2031 | Ga0105238_10016494 | |||
| 2032 | Ga0105249_10000733 | |||
| 2033 | Ga0105249_10015979 | |||
| 2034 | Ga0105249_10063199 | |||
| 2035 | Ga0105249_10101884 | |||
| 2036 | Ga0105249_10183723 | |||
| 2037 | Ga0105249_10207017 | |||
| 2038 | Ga0105239_10241031 | |||
| 2039 | Ga0105246_10010820 | |||
| 2040 | Ga0105246_10029966 | |||
| 2041 | Ga0157373_10066988 | |||
| 2042 | Ga0157371_10000071 | |||
| 2043 | Ga0157371_10037856 | |||
| 2044 | Ga0157370_10000469 | |||
| 2045 | Ga0157370_10025074 | |||
| 2046 | Ga0157370_10108404 | |||
| 2047 | Ga0157369_10013530 | |||
| 2048 | Ga0157369_10043197 | |||
| 2049 | Ga0157369_10051341 | |||
| 2050 | Ga0157369_10056570 | |||
| 2051 | Ga0157369_10125898 | |||
| 2052 | Ga0157374_10000448 | |||
| 2053 | Ga0157374_10012030 | |||
| 2054 | Ga0157374_10072301 | |||
| 2055 | Ga0157374_10184870 | |||
| 2056 | Ga0157378_10004264 | |||
| 2057 | Ga0157378_10005712 | |||
| 2058 | Ga0163162_10000786 | |||
| 2059 | Ga0163162_10016252 | |||
| 2060 | Ga0163162_10070083 | |||
| 2061 | Ga0163162_10209555 | |||
| 2062 | Ga0157372_10001231 | |||
| 2063 | Ga0157372_10004537 | |||
| 2064 | Ga0157372_10054256 | |||
| 2065 | Ga0157375_10000071 | |||
| 2066 | Ga0157375_10013991 | |||
| 2067 | Ga0157375_10191624 | |||
| 2068 | Ga0163163_10001107 | |||
| 2069 | Ga0163163_10013130 | |||
| 2070 | Ga0163163_10024898 | |||
| 2071 | Ga0163163_10030622 | |||
| 2072 | Ga0163163_10041518 | |||
| 2073 | Ga0163163_10051444 | |||
| 2074 | Ga0163163_10057531 | |||
| 2075 | Ga0157380_10001766 | |||
| 2076 | Ga0157380_10007787 | |||
| 2077 | Ga0157380_10012368 | |||
| 2078 | Ga0157380_10017341 | |||
| 2079 | Ga0157380_10046144 | |||
| 2080 | Ga0157380_10238364 | |||
| 2081 | Ga0157380_10261166 | |||
| 2082 | Ga0157380_10309771 | |||
| 2083 | Ga0157380_10377125 | |||
| 2084 | Ga0157377_10017766 | |||
| 2085 | Ga0157377_10018790 | |||
| 2086 | Ga0157377_10020665 | |||
| 2087 | Ga0157379_10005094 | |||
| 2088 | Ga0157379_10011426 | |||
| 2089 | Ga0157379_10016218 | |||
| 2090 | Ga0157379_10024070 | |||
| 2091 | Ga0157379_10029043 | |||
| 2092 | Ga0157379_10038695 | |||
| 2093 | Ga0157379_10145854 | |||
| 2094 | Ga0157376_10018769 | |||
| 2095 | Ga0157376_10051739 | |||
| 2096 | Ga0157376_10641973 | |||
| 2097 | Ga0163161_10008043 | |||
| 2098 | Ga0163161_10124937 | |||
| 2099 | Ga0213872_10005421 | |||
| 2100 | Ga0224569_101166 | |||
| 2101 | Ga0224572_1006723 | |||
| 2102 | Ga0224572_1007427 | |||
| 2103 | Ga0228598_1004755 | |||
| 2104 | Ga0209025_1001274 | |||
| 2105 | Ga0207697_10001972 | |||
| 2106 | Ga0207697_10026903 | |||
| 2107 | Ga0207682_10000256 | |||
| 2108 | Ga0207682_10005491 | |||
| 2109 | Ga0207682_10028497 | |||
| 2110 | Ga0207682_10036900 | |||
| 2111 | Ga0207682_10058240 | |||
| 2112 | Ga0207710_10060582 | |||
| 2113 | Ga0207710_10083931 | |||
| 2114 | Ga0207688_10001374 | |||
| 2115 | Ga0207688_10001964 | |||
| 2116 | Ga0207688_10135358 | |||
| 2117 | Ga0207680_10007138 | |||
| 2118 | Ga0207680_10110641 | |||
| 2119 | Ga0207685_10004015 | |||
| 2120 | Ga0207685_10099142 | |||
| 2121 | Ga0207699_10003844 | |||
| 2122 | Ga0207699_10072534 | |||
| 2123 | Ga0207645_10001189 | |||
| 2124 | Ga0207645_10001887 | |||
| 2125 | Ga0207645_10003038 | |||
| 2126 | Ga0207645_10006720 | |||
| 2127 | Ga0207645_10012432 | |||
| 2128 | Ga0207645_10016102 | |||
| 2129 | Ga0207645_10031135 | |||
| 2130 | Ga0207645_10047028 | |||
| 2131 | Ga0207643_10000976 | |||
| 2132 | Ga0207643_10002349 | |||
| 2133 | Ga0207643_10008592 | |||
| 2134 | Ga0207643_10016621 | |||
| 2135 | Ga0207705_10000463 | |||
| 2136 | Ga0207705_10014605 | |||
| 2137 | Ga0207684_10003705 | |||
| 2138 | Ga0207684_10147145 | |||
| 2139 | Ga0207707_10096218 | |||
| 2140 | Ga0207707_10107009 | |||
| 2141 | Ga0207707_10167535 | |||
| 2142 | Ga0207707_10239421 | |||
| 2143 | Ga0207695_10057888 | |||
| 2144 | Ga0207695_10161907 | |||
| 2145 | Ga0207695_10250619 | |||
| 2146 | Ga0207695_10266080 | |||
| 2147 | Ga0207663_10000017 | |||
| 2148 | Ga0207660_10051507 | |||
| 2149 | Ga0207660_10057403 | |||
| 2150 | Ga0207660_10071756 | |||
| 2151 | Ga0207660_10111115 | |||
| 2152 | Ga0207662_10001582 | |||
| 2153 | Ga0207662_10003401 | |||
| 2154 | Ga0207662_10022645 | |||
| 2155 | Ga0207657_10006664 | |||
| 2156 | Ga0207657_10067071 | |||
| 2157 | Ga0207649_10052175 | |||
| 2158 | Ga0207649_10090297 | |||
| 2159 | Ga0207649_10175712 | |||
| 2160 | Ga0207649_10197291 | |||
| 2161 | Ga0207652_10014267 | |||
| 2162 | Ga0207652_10171519 | |||
| 2163 | Ga0207652_10186904 | |||
| 2164 | Ga0207652_10198088 | |||
| 2165 | Ga0207646_10000400 | |||
| 2166 | Ga0207646_10000801 | |||
| 2167 | Ga0207646_10116073 | |||
| 2168 | Ga0207681_10000315 | |||
| 2169 | Ga0207681_10002837 | |||
| 2170 | Ga0207681_10006093 | |||
| 2171 | Ga0207681_10008989 | |||
| 2172 | Ga0207681_10016410 | |||
| 2173 | Ga0207681_10021025 | |||
| 2174 | Ga0207681_10042735 | |||
| 2175 | Ga0207681_10061138 | |||
| 2176 | Ga0207681_10137941 | |||
| 2177 | Ga0207694_10009664 | |||
| 2178 | Ga0207650_10001649 | |||
| 2179 | Ga0207650_10038085 | |||
| 2180 | Ga0207650_10089593 | |||
| 2181 | Ga0207650_10101156 | |||
| 2182 | Ga0207659_10000076 | |||
| 2183 | Ga0207659_10001426 | |||
| 2184 | Ga0207659_10001726 | |||
| 2185 | Ga0207659_10001830 | |||
| 2186 | Ga0207659_10003364 | |||
| 2187 | Ga0207659_10055289 | |||
| 2188 | Ga0207659_10062162 | |||
| 2189 | Ga0207659_10084529 | |||
| 2190 | Ga0207659_10117700 | |||
| 2191 | Ga0207687_10046812 | |||
| 2192 | Ga0207687_10121323 | |||
| 2193 | Ga0207700_10053462 | |||
| 2194 | Ga0207664_10119175 | |||
| 2195 | Ga0207644_10000485 | |||
| 2196 | Ga0207644_10004067 | |||
| 2197 | Ga0207644_10027107 | |||
| 2198 | Ga0207690_10025745 | |||
| 2199 | Ga0207690_10184452 | |||
| 2200 | Ga0207706_10002610 | |||
| 2201 | Ga0207706_10009806 | |||
| 2202 | Ga0207706_10013693 | |||
| 2203 | Ga0207706_10018234 | |||
| 2204 | Ga0207706_10029383 | |||
| 2205 | Ga0207706_10039016 | |||
| 2206 | Ga0207706_10055474 | |||
| 2207 | Ga0207706_10135755 | |||
| 2208 | Ga0207686_10128298 | |||
| 2209 | Ga0207709_10017122 | |||
| 2210 | Ga0207709_10018785 | |||
| 2211 | Ga0207709_10024069 | |||
| 2212 | Ga0207709_10046837 | |||
| 2213 | Ga0207670_10051802 | |||
| 2214 | Ga0207670_10063216 | |||
| 2215 | Ga0207670_10070850 | |||
| 2216 | Ga0207670_10095177 | |||
| 2217 | Ga0207670_10212999 | |||
| 2218 | Ga0207669_10019434 | |||
| 2219 | Ga0207669_10198810 | |||
| 2220 | Ga0207704_10033108 | |||
| 2221 | Ga0207704_10042299 | |||
| 2222 | Ga0207704_10099216 | |||
| 2223 | Ga0207665_10005573 | |||
| 2224 | Ga0207665_10017374 | |||
| 2225 | Ga0207691_10001612 | |||
| 2226 | Ga0207691_10007302 | |||
| 2227 | Ga0207691_10011138 | |||
| 2228 | Ga0207691_10016959 | |||
| 2229 | Ga0207691_10022003 | |||
| 2230 | Ga0207691_10026485 | |||
| 2231 | Ga0207691_10033850 | |||
| 2232 | Ga0207691_10047127 | |||
| 2233 | Ga0207691_10075799 | |||
| 2234 | Ga0207691_10094511 | |||
| 2235 | Ga0207691_10096844 | |||
| 2236 | Ga0207691_10100147 | |||
| 2237 | Ga0207691_10105868 | |||
| 2238 | Ga0207691_10106389 | |||
| 2239 | Ga0207691_10188302 | |||
| 2240 | Ga0207711_10010963 | |||
| 2241 | Ga0207711_10014618 | |||
| 2242 | Ga0207711_10025788 | |||
| 2243 | Ga0207711_10034774 | |||
| 2244 | Ga0207711_10040252 | |||
| 2245 | Ga0207711_10041583 | |||
| 2246 | Ga0207711_10056886 | |||
| 2247 | Ga0207711_10167324 | |||
| 2248 | Ga0207711_10191118 | |||
| 2249 | Ga0207689_10014461 | |||
| 2250 | Ga0207689_10046922 | |||
| 2251 | Ga0207689_10117260 | |||
| 2252 | Ga0207689_10122307 | |||
| 2253 | Ga0207661_10003131 | |||
| 2254 | Ga0207661_10025526 | |||
| 2255 | Ga0207661_10035737 | |||
| 2256 | Ga0207661_10051968 | |||
| 2257 | Ga0207661_10081352 | |||
| 2258 | Ga0207661_10122362 | |||
| 2259 | Ga0207679_10003204 | |||
| 2260 | Ga0207679_10003415 | |||
| 2261 | Ga0207679_10006342 | |||
| 2262 | Ga0207679_10015783 | |||
| 2263 | Ga0207679_10045134 | |||
| 2264 | Ga0207679_10063272 | |||
| 2265 | Ga0207679_10097456 | |||
| 2266 | Ga0207679_10102068 | |||
| 2267 | Ga0207679_10105661 | |||
| 2268 | Ga0207679_10216683 | |||
| 2269 | Ga0207667_10018041 | |||
| 2270 | Ga0207667_10049057 | |||
| 2271 | Ga0207667_10074332 | |||
| 2272 | Ga0207651_10004772 | |||
| 2273 | Ga0207651_10011179 | |||
| 2274 | Ga0207651_10052108 | |||
| 2275 | Ga0207651_10160726 | |||
| 2276 | Ga0207712_10002949 | |||
| 2277 | Ga0207712_10004752 | |||
| 2278 | Ga0207712_10080863 | |||
| 2279 | Ga0207712_10152887 | |||
| 2280 | Ga0207668_10017130 | |||
| 2281 | Ga0207668_10176784 | |||
| 2282 | Ga0207668_10207885 | |||
| 2283 | Ga0207640_10016650 | |||
| 2284 | Ga0207640_10046083 | |||
| 2285 | Ga0207640_10136389 | |||
| 2286 | Ga0207658_10011211 | |||
| 2287 | Ga0207658_10062486 | |||
| 2288 | Ga0207658_10168498 | |||
| 2289 | Ga0207677_10076952 | |||
| 2290 | Ga0207677_10172310 | |||
| 2291 | Ga0207703_10025435 | |||
| 2292 | Ga0207703_10028156 | |||
| 2293 | Ga0207703_10035383 | |||
| 2294 | Ga0207703_10138710 | |||
| 2295 | Ga0207703_10145358 | |||
| 2296 | Ga0207703_10187697 | |||
| 2297 | Ga0207639_10003395 | |||
| 2298 | Ga0207639_10157608 | |||
| 2299 | Ga0207639_10279369 | |||
| 2300 | Ga0207678_10008895 | |||
| 2301 | Ga0207678_10022903 | |||
| 2302 | Ga0207678_10023382 | |||
| 2303 | Ga0207708_10003536 | |||
| 2304 | Ga0207708_10003617 | |||
| 2305 | Ga0207708_10010005 | |||
| 2306 | Ga0207708_10025892 | |||
| 2307 | Ga0207708_10035282 | |||
| 2308 | Ga0207708_10055002 | |||
| 2309 | Ga0207708_10070903 | |||
| 2310 | Ga0207708_10099773 | |||
| 2311 | Ga0207702_10322766 | |||
| 2312 | Ga0207641_10001113 | |||
| 2313 | Ga0207641_10114243 | |||
| 2314 | Ga0207641_10160020 | |||
| 2315 | Ga0207648_10000280 | |||
| 2316 | Ga0207648_10001579 | |||
| 2317 | Ga0207648_10006656 | |||
| 2318 | Ga0207648_10007517 | |||
| 2319 | Ga0207648_10041218 | |||
| 2320 | Ga0207648_10047619 | |||
| 2321 | Ga0207648_10062065 | |||
| 2322 | Ga0207648_10131360 | |||
| 2323 | Ga0207648_10158532 | |||
| 2324 | Ga0207648_10225875 | |||
| 2325 | Ga0207648_10260806 | |||
| 2326 | Ga0207676_10021525 | |||
| 2327 | Ga0207676_10069611 | |||
| 2328 | Ga0207676_10085050 | |||
| 2329 | Ga0207676_10290579 | |||
| 2330 | Ga0207676_10301347 | |||
| 2331 | Ga0207674_10000975 | |||
| 2332 | Ga0207674_10001029 | |||
| 2333 | Ga0207674_10009475 | |||
| 2334 | Ga0207674_10009866 | |||
| 2335 | Ga0207674_10025524 | |||
| 2336 | Ga0207674_10048267 | |||
| 2337 | Ga0207674_10119857 | |||
| 2338 | Ga0207674_10175598 | |||
| 2339 | Ga0207675_100005112 | |||
| 2340 | Ga0207675_100009300 | |||
| 2341 | Ga0207675_100010828 | |||
| 2342 | Ga0207675_100014801 | |||
| 2343 | Ga0207675_100021208 | |||
| 2344 | Ga0207675_100029674 | |||
| 2345 | Ga0207675_100073355 | |||
| 2346 | Ga0207675_100083061 | |||
| 2347 | Ga0207675_100101515 | |||
| 2348 | Ga0207675_100321976 | |||
| 2349 | Ga0207683_10001056 | |||
| 2350 | Ga0207683_10021790 | |||
| 2351 | Ga0207683_10053680 | |||
| 2352 | Ga0207683_10188916 | |||
| 2353 | Ga0207683_10219553 | |||
| 2354 | Ga0207698_10061373 | |||
| 2355 | Ga0207698_10186040 | |||
| 2356 | Ga0209282_1010364 | |||
| 2357 | Ga0209282_1021345 | |||
| 2358 | Ga0209588_1004742 | |||
| 2359 | Ga0209971_1023508 | |||
| 2360 | Ga0207428_10000481 | |||
| 2361 | Ga0207428_10003460 | |||
| 2362 | Ga0207428_10004078 | |||
| 2363 | Ga0207428_10011888 | |||
| 2364 | Ga0207428_10028879 | |||
| 2365 | Ga0207428_10044629 | |||
| 2366 | Ga0207428_10098452 | |||
| 2367 | Ga0207428_10115910 | |||
| 2368 | Ga0207428_10116968 | |||
| 2369 | Ga0207428_10169805 | |||
| 2370 | Ga0268266_10001913 | |||
| 2371 | Ga0268266_10003647 | |||
| 2372 | Ga0268266_10003719 | |||
| 2373 | Ga0268266_10016423 | |||
| 2374 | Ga0268266_10107527 | |||
| 2375 | Ga0268266_10155753 | |||
| 2376 | Ga0268265_10003942 | |||
| 2377 | Ga0268265_10006108 | |||
| 2378 | Ga0268265_10021735 | |||
| 2379 | Ga0268265_10030986 | |||
| 2380 | Ga0268265_10041011 | |||
| 2381 | Ga0268265_10230255 | |||
| 2382 | Ga0268264_10005498 | |||
| 2383 | Ga0268264_10030911 | |||
| 2384 | Ga0268264_10133223 | |||
| 2385 | Ga0268264_10204038 | |||
| 2386 | Ga0268264_10385130 | |||
| 2387 | Ga0265336_10001220 | |||
| 2388 | Ga0265338_10002329 | |||
| 2389 | Ga0265338_10208561 | |||
| 2390 | Ga0307512_10031809 | |||
| 2391 | Ga0265762_1000437 | |||
| 2392 | Ga0265762_1007655 | |||
| 2393 | Ga0265332_10003975 | |||
| 2394 | Ga0265328_10061315 | |||
| 2395 | Ga0265325_10052379 | |||
| 2396 | Ga0265329_10031629 | |||
| 2397 | Ga0265340_10076292 | |||
| 2398 | Ga0265340_10086162 | |||
| 2399 | Ga0265331_10059940 | |||
| 2400 | Ga0265316_10002852 | |||
| 2401 | Ga0307408_100005731 | |||
| 2402 | Ga0307408_100088843 | |||
| 2403 | Ga0307408_100262374 | |||
| 2404 | Ga0307508_10003585 | |||
| 2405 | Ga0316575_10000078 | |||
| 2406 | Ga0316575_10001173 | |||
| 2407 | Ga0316575_10014940 | |||
| 2408 | Ga0316575_10051213 | |||
| 2409 | Ga0316575_10072183 | |||
| 2410 | Ga0316575_10079148 | |||
| 2411 | Ga0316579_10000340 | |||
| 2412 | Ga0316579_10003231 | |||
| 2413 | Ga0316579_10005032 | |||
| 2414 | Ga0316579_10005489 | |||
| 2415 | Ga0316579_10006783 | |||
| 2416 | Ga0316579_10033573 | |||
| 2417 | Ga0316579_10079800 | |||
| 2418 | Ga0265314_10031752 | |||
| 2419 | Ga0265314_10043744 | |||
| 2420 | Ga0265314_10056375 | |||
| 2421 | Ga0316576_10000061 | |||
| 2422 | Ga0316576_10003527 | |||
| 2423 | Ga0316576_10008317 | |||
| 2424 | Ga0316576_10011247 | |||
| 2425 | Ga0316576_10012299 | |||
| 2426 | Ga0316576_10028153 | |||
| 2427 | Ga0316576_10036520 | |||
| 2428 | Ga0316576_10041041 | |||
| 2429 | Ga0316576_10070111 | |||
| 2430 | Ga0316576_10122277 | |||
| 2431 | Ga0316576_10163406 | |||
| 2432 | Ga0316576_10164384 | |||
| 2433 | Ga0316576_10203708 | |||
| 2434 | Ga0316578_10000292 | |||
| 2435 | Ga0316578_10000778 | |||
| 2436 | Ga0316578_10008143 | |||
| 2437 | Ga0316578_10008169 | |||
| 2438 | Ga0316578_10020051 | |||
| 2439 | Ga0316578_10053385 | |||
| 2440 | Ga0316578_10062956 | |||
| 2441 | Ga0316578_10128903 | |||
| 2442 | Ga0316578_10131423 | |||
| 2443 | Ga0307405_10014290 | |||
| 2444 | Ga0307405_10227356 | |||
| 2445 | Ga0316577_10001299 | |||
| 2446 | Ga0316577_10001513 | |||
| 2447 | Ga0316577_10004481 | |||
| 2448 | Ga0316577_10031830 | |||
| 2449 | Ga0316577_10036514 | |||
| 2450 | Ga0316577_10060081 | |||
| 2451 | Ga0316577_10150845 | |||
| 2452 | Ga0316577_10151652 | |||
| 2453 | Ga0307413_10000731 | |||
| 2454 | Ga0307413_10007133 | |||
| 2455 | Ga0307413_10094788 | |||
| 2456 | Ga0307413_10146291 | |||
| 2457 | Ga0307413_10189666 | |||
| 2458 | Ga0307410_10038888 | |||
| 2459 | Ga0307410_10130009 | |||
| 2460 | Ga0307406_10003599 | |||
| 2461 | Ga0307406_10026366 | |||
| 2462 | Ga0307406_10084724 | |||
| 2463 | Ga0307406_10148358 | |||
| 2464 | Ga0307407_10001825 | |||
| 2465 | Ga0307407_10025974 | |||
| 2466 | Ga0307407_10058651 | |||
| 2467 | Ga0307407_10068791 | |||
| 2468 | Ga0307412_10074102 | |||
| 2469 | Ga0307409_100000298 | |||
| 2470 | Ga0307409_100018484 | |||
| 2471 | Ga0307409_100037951 | |||
| 2472 | Ga0307416_100003790 | |||
| 2473 | Ga0307416_100005453 | |||
| 2474 | Ga0307416_100059749 | |||
| 2475 | Ga0307416_100097779 | |||
| 2476 | Ga0307416_100112146 | |||
| 2477 | Ga0307416_100135170 | |||
| 2478 | Ga0307416_100138140 | |||
| 2479 | Ga0307416_100164693 | |||
| 2480 | Ga0307414_10049440 | |||
| 2481 | Ga0307414_10062914 | |||
| 2482 | Ga0307414_10127806 | |||
| 2483 | Ga0307414_10179906 | |||
| 2484 | Ga0307414_10381188 | |||
| 2485 | Ga0307411_10001022 | |||
| 2486 | Ga0307411_10005511 | |||
| 2487 | Ga0307411_10043083 | |||
| 2488 | Ga0307411_10085688 | |||
| 2489 | Ga0307411_10103351 | |||
| 2490 | Ga0307411_10213397 | |||
| 2491 | Ga0307411_10303241 | |||
| 2492 | Ga0307415_100006479 | |||
| 2493 | Ga0307415_100072204 | |||
| 2494 | Ga0307415_100086415 | |||
| 2495 | Ga0307415_100173563 | |||
| 2496 | Ga0307415_100206719 | |||
| 2497 | Ga0316583_10000460 | |||
| 2498 | Ga0316583_10001203 | |||
| 2499 | Ga0316583_10001572 | |||
| 2500 | Ga0316583_10003648 | |||
| 2501 | Ga0316583_10006388 | |||
| 2502 | Ga0316583_10007565 | |||
| 2503 | Ga0316583_10021861 | |||
| 2504 | Ga0316585_10000766 | |||
| 2505 | Ga0316585_10001080 | |||
| 2506 | Ga0316585_10032763 | |||
| 2507 | Ga0316580_10000032 | |||
| 2508 | Ga0316580_10000340 | |||
| 2509 | Ga0316580_10004339 | |||
| 2510 | Ga0316593_10000188 | |||
| 2511 | Ga0316593_10009664 | |||
| 2512 | Ga0316593_10011908 | |||
| 2513 | Ga0307510_10126809 | |||
| 2514 | Ga0316592_1000517 | |||
| 2515 | Ga0316592_1001809 | |||
| 2516 | Ga0316588_1000700 | |||
| 2517 | Ga0316596_1000885 | |||
| 2518 | Ga0316596_1002003 | |||
| 2519 | Ga0316212_1003380 | |||
| 2520 | Ga0373926_0009080 | |||
| 2521 | Ga0373926_0017251 | |||
| 2522 | Ga0373923_0005050 | |||
| 2523 | Ga0373923_0130913 | |||
| 2524 | Ga0373941_0049264 | |||
| 2525 | Ga0373943_0030823 | |||
| 2526 | Ga0373961_0042102 | |||
| 2527 | Ga0373962_0058409 | |||
| 2528 | Ga0316574_0000054 | |||
| 2529 | Ga0316574_0000651 | |||
| 2530 | Ga0316574_0003136 | |||
| 2531 | Ga0316574_0036435 | |||
| 2532 | Ga0316574_0054359 | |||
| 2533 | Ga0316574_0060347 | |||
| 2534 | Ga0316574_0098667 | |||
| 2535 | Ga0316574_0103393 | |||
| 2536 | Ga0316574_0194220 | |||
| 2537 | Ga0373931_0033246 | |||
| 2538 | Ga0373935_0007047 | |||
| 2539 | Ga0373935_0008647 | |||
| 2540 | Ga0373927_0011017 | |||
| 2541 | Ga0373933_0089214 | |||
| 2542 | Ga0373947_0051242 | |||
| 2543 | Ga0373947_0216750 | |||
| 2544 | Ga0373937_0002679 | |||
| 2545 | Ga0373937_0025464 | |||
| 2546 | Ga0373937_0252653 | |||
| 2547 | Ga0316582_0000201 | |||
| 2548 | Ga0316582_0000608 | |||
| 2549 | Ga0316582_0003179 | |||
| 2550 | Ga0316582_0005804 | |||
| 2551 | Ga0316582_0020480 | |||
| 2552 | Ga0316582_0039799 | |||
| 2553 | Ga0316582_0059135 | |||
| 2554 | Ga0316582_0060613 | |||
| 2555 | Ga0316582_0073934 | |||
| 2556 | Ga0316582_0192018 | |||
| 2557 | Ga0316584_0001889 | |||
| 2558 | Ga0316584_0009581 | |||
| 2559 | Ga0316584_0019571 | |||
| 2560 | Ga0316584_0044299 | |||
| 2561 | Ga0316584_0054994 | |||
| 2562 | Ga0316584_0069183 | |||
| 2563 | Ga0316584_0090014 | |||
| 2564 | Ga0316584_0094890 | |||
| 2565 | Ga0316584_0209905 | |||
| 2566 | Ga0316584_0224544 | |||
| 2567 | Ga0316584_0318816 | |||
| 2568 | Ga0373925_0004509 | |||
| 2569 | Ga0373925_0196397 | |||
| 2570 | Ga0373925_0245972 | |||
| 2571 | Ga0316581_0001143 | |||
| 2572 | Ga0316581_0017783 | |||
| 2573 | Ga0436364_0778749 | |||
| 2574 | Ga0400484_29778 | |||
| 2575 | Ga0400490_53112 | |||
| 2576 | Ga0400485_18502 | |||
| 2577 | Ga0400488_23036 | |||
| 2578 | Ga0400483_252454 | |||
| 2579 | Ga0400483_263366 | |||
| 2580 | Ga0400483_263582 | |||
| 2581 | Ga0400489_36202 | |||
| 2582 | Ga0400489_39387 | |||
| 2583 | Ga0400489_57552 | |||
| 2584 | Ga0400489_66845 | |||
| 2585 | Ga0400489_67086 | |||
| 2586 | Ga0400489_87056 | |||
| 2587 | Ga0436360_0776135 | |||
| 2588 | Ga0436361_0217784 | |||
| 2589 | Ga0450920_004909 | |||
| 2590 | Ga0450898_004430 | |||
| 2591 | Ga0439446_0018003 | |||
| 2592 | Ga0451577_0000016 | |||
| 2593 | Ga0451577_0000063 | |||
| 2594 | Ga0451577_0003032 | |||
| 2595 | Ga0451577_0007108 | |||
| 2596 | Ga0451577_0008586 | |||
| 2597 | Ga0451577_0011583 | |||
| 2598 | Ga0451577_0011723 | |||
| 2599 | Ga0451577_0013346 | |||
| 2600 | Ga0451577_0020077 | |||
| 2601 | Ga0451577_0023963 | |||
| 2602 | Ga0451577_0031730 | |||
| 2603 | Ga0451577_0032839 | |||
| 2604 | Ga0451577_0154283 | |||
| 2605 | Ga0451577_0389889 | |||
| 2606 | Ga0466969_0000017 | |||
| 2607 | Ga0466969_0005938 | |||
| 2608 | Ga0453683_0000354 | |||
| 2609 | Ga0453683_0001401 | |||
| 2610 | Ga0453683_0002141 | |||
| 2611 | Ga0453683_0006715 | |||
| 2612 | Ga0453683_0007197 | |||
| 2613 | Ga0453683_0008162 | |||
| 2614 | Ga0453683_0075195 | |||
| 2615 | Ga0466965_0021284 | |||
| 2616 | Ga0466965_0124092 | |||
| 2617 | Ga0466966_0009159 | |||
| 2618 | Ga0466966_0025665 | |||
| 2619 | Ga0466966_0104119 | |||
| 2620 | Ga0466961_0000675 | |||
| 2621 | Ga0453684_0000198 | |||
| 2622 | Ga0453684_0001021 | |||
| 2623 | Ga0453684_0003669 | |||
| 2624 | Ga0453684_0005793 | |||
| 2625 | Ga0453684_0005848 | |||
| 2626 | Ga0453684_0008716 | |||
| 2627 | Ga0453684_0011440 | |||
| 2628 | Ga0453684_0016406 | |||
| 2629 | Ga0453684_0019113 | |||
| 2630 | Ga0453684_0025076 | |||
| 2631 | Ga0453684_0028918 | |||
| 2632 | Ga0453684_0034553 | |||
| 2633 | Ga0453684_0038822 | |||
| 2634 | Ga0453684_0047025 | |||
| 2635 | Ga0453684_0047870 | |||
| 2636 | Ga0453684_0073014 | |||
| 2637 | Ga0453684_0093505 | |||
| 2638 | Ga0453684_0101809 | |||
| 2639 | Ga0453684_0165800 | |||
| 2640 | Ga0453684_0225614 | |||
| 2641 | Ga0453684_0462321 | |||
| 2642 | Ga0466957_0064618 | |||
| 2643 | Ga0466959_0000285 | |||
| 2644 | Ga0451576_0002045 | |||
| 2645 | Ga0451576_0007793 | |||
| 2646 | Ga0451576_0017896 | |||
| 2647 | Ga0451576_0020522 | |||
| 2648 | Ga0451576_0021366 | |||
| 2649 | Ga0451576_0037518 | |||
| 2650 | Ga0451576_0114907 | |||
| 2651 | Ga0451576_0124785 | |||
| 2652 | Ga0451576_0178868 | |||
| 2653 | Ga0451576_0189302 | |||
| 2654 | Ga0451576_0197660 | |||
| 2655 | Ga0451576_0433872 | |||
| 2656 | Ga0451576_0585453 | |||
| 2657 | Ga0466958_0018991 | |||
| 2658 | Ga0466967_0083639 | |||
| 2659 | Ga0495592_0034869 | |||
| 2660 | Ga0495592_0062440 | |||
| 2661 | Ga0495592_0084555 | |||
| 2662 | Ga0495629_0004932 | |||
| 2663 | Ga0495641_0012535 | |||
| 2664 | Ga0495651_0000624 | |||
| 2665 | Ga0495651_0005231 | |||
| 2666 | Ga0495651_0009328 | |||
| 2667 | Ga0495651_0025107 | |||
| 2668 | Ga0495653_0003358 | |||
| 2669 | Ga0495653_0102126 | |||
| 2670 | Ga0495650_0000009 | |||
| 2671 | Ga0495650_0010284 | |||
| 2672 | Ga0495580_0007760 | |||
| 2673 | Ga0495580_0010241 | |||
| 2674 | Ga0495580_0012295 | |||
| 2675 | Ga0495580_0105779 | |||
| 2676 | Ga0495580_0136835 | |||
| 2677 | Ga0495582_0000160 | |||
| 2678 | Ga0495582_0061652 | |||
| 2679 | Ga0495582_0075068 | |||
| 2680 | Ga0495582_0126001 | |||
| 2681 | Ga0495664_0009041 | |||
| 2682 | Ga0495664_0029121 | |||
| 2683 | Ga0495664_0053062 | |||
| 2684 | Ga0495585_0023681 | |||
| 2685 | Ga0495594_0001740 | |||
| 2686 | Ga0495594_0003599 | |||
| 2687 | Ga0495594_0011490 | |||
| 2688 | Ga0495594_0040863 | |||
| 2689 | Ga0495583_0010608 | |||
| 2690 | Ga0495606_0080712 | |||
| 2691 | Ga0495608_0005595 | |||
| 2692 | Ga0495608_0073549 | |||
| 2693 | Ga0495608_0114666 | |||
| 2694 | Ga0495628_0000100 | |||
| 2695 | Ga0495628_0003895 | |||
| 2696 | Ga0495628_0073629 | |||
| 2697 | Ga0495628_0189176 | |||
| 2698 | Ga0495630_0002788 | |||
| 2699 | Ga0495630_0015574 | |||
| 2700 | Ga0495643_0000203 | |||
| 2701 | Ga0495643_0078798 | |||
| 2702 | Ga0495644_0003693 | |||
| 2703 | Ga0495648_0072663 | |||
| 2704 | Ga0495666_0008923 | |||
| 2705 | Ga0495666_0021255 | |||
| 2706 | Ga0495642_0017177 | |||
| 2707 | Ga0495642_0053101 | |||
| 2708 | Ga0495652_0007450 | |||
| 2709 | Ga0495652_0027682 | |||
| 2710 | Ga0495652_0047638 | |||
| 2711 | Ga0495652_0251206 | |||
| 2712 | Ga0495665_0011377 | |||
| 2713 | Ga0495665_0032663 | |||
| 2714 | Ga0495665_0070927 | |||
| 2715 | Ga0495586_0002638 | |||
| 2716 | Ga0495586_0024319 | |||
| 2717 | Ga0495586_0143004 | |||
| 2718 | Ga0495587_0004941 | |||
| 2719 | Ga0495587_0125409 | |||
| 2720 | Ga0495598_0038413 | |||
| 2721 | Ga0495621_0003001 | |||
| 2722 | Ga0495621_0017025 | |||
| 2723 | Ga0495645_0002684 | |||
| 2724 | Ga0495645_0005674 | |||
| 2725 | Ga0495645_0008111 | |||
| 2726 | Ga0495645_0083449 | |||
| 2727 | Ga0495633_0016768 | |||
| 2728 | Ga0495633_0054740 | |||
| 2729 | Ga0495633_0061375 | |||
| 2730 | Ga0495633_0080582 | |||
| 2731 | Ga0495667_0034067 | |||
| 2732 | Ga0495667_0044908 | |||
| 2733 | Ga0495667_0132793 | |||
| 2734 | Ga0495667_0224295 | |||
| 2735 | Ga0495668_0064299 | |||
| 2736 | Ga0495634_0001889 | |||
| 2737 | Ga0495634_0007610 | |||
| 2738 | Ga0495625_0000174 | |||
| 2739 | Ga0495625_0070003 | |||
| 2740 | Ga0495635_0021952 | |||
| 2741 | Ga0495635_0036139 | |||
| 2742 | Ga0495588_0003610 | |||
| 2743 | Ga0495657_0019947 | |||
| 2744 | Ga0495657_0147579 | |||
| 2745 | Ga0495599_0004610 | |||
| 2746 | Ga0495623_0023862 | |||
| 2747 | Ga0495646_0007910 | |||
| 2748 | Ga0495658_0016514 | |||
| 2749 | Ga0495658_0016706 | |||
| 2750 | Ga0495658_0122720 | |||
| 2751 | Ga0495669_0001130 | |||
| 2752 | Ga0495669_0010879 | |||
| 2753 | Ga0495613_0012126 | |||
| 2754 | Ga0495613_0024977 | |||
| 2755 | Ga0495613_0074258 | |||
| 2756 | Ga0495624_0009364 | |||
| 2757 | Ga0495649_0029029 | |||
| 2758 | Ga0495649_0120856 | |||
| 2759 | Ga0495600_0001186 | |||
| 2760 | Ga0495600_0058644 | |||
| 2761 | Ga0495581_0009729 | |||
| 2762 | Ga0495604_0000537 | |||
| 2763 | Ga0495604_0002227 | |||
| 2764 | Ga0495604_0002867 | |||
| 2765 | Ga0495604_0014776 | |||
| 2766 | Ga0495604_0016954 | |||
| 2767 | Ga0495636_0018647 | |||
| 2768 | Ga0495674_0001372 | |||
| 2769 | Ga0495674_0016950 | |||
| 2770 | Ga0495674_0068815 | |||
| 2771 | Ga0495676_0003364 | |||
| 2772 | Ga0495676_0017461 | |||
| 2773 | Ga0495680_0000436 | |||
| 2774 | Ga0495680_0001290 | |||
| 2775 | Ga0495680_0009994 | |||
| 2776 | Ga0495680_0039057 | |||
| 2777 | Ga0495680_0169968 | |||
| 2778 | Ga0495675_0000566 | |||
| 2779 | Ga0495675_0010096 | |||
| 2780 | Ga0495675_0010601 | |||
| 2781 | Ga0495675_0046538 | |||
| 2782 | Ga0495677_0032944 | |||
| 2783 | Ga0495685_010344 | |||
| 2784 | Ga0495681_0003767 | |||
| 2785 | Ga0495684_0002380 | |||
| 2786 | Ga0495684_0030918 | |||
| 2787 | Ga0495684_0052887 | |||
| 2788 | Ga0495593_0057144 | |||
| 2789 | Ga0495602_0013208 | |||
| 2790 | Ga0495614_0002691 | |||
| 2791 | Ga0495614_0023386 | |||
| 2792 | Ga0496100_0166956 | |||
| 2793 | Ga0496100_0218333 | |||
| 2794 | Ga0496101_0130692 | |||
| 2795 | Ga0496101_0153434 | |||
| 2796 | Ga0496101_0189405 | |||
| 2797 | Ga0496102_0001797 | |||
| 2798 | Ga0496102_0010259 | |||
| 2799 | Ga0496102_0115018 | |||
| 2800 | Ga0496104_0003519 | |||
| 2801 | Ga0496104_0032813 | |||
| 2802 | Ga0496104_0144865 | |||
| 2803 | Ga0496104_0149680 | |||
| 2804 | Ga0496104_0176149 | |||
| 2805 | Ga0496105_0060874 | |||
| 2806 | Ga0496106_0056076 | |||
| 2807 | Ga0496106_0147709 | |||
| 2808 | Ga0496107_0365092 | |||
| 2809 | Ga0496108_0003906 | |||
| 2810 | Ga0496108_0040415 | |||
| 2811 | Ga0496108_0181674 | |||
| 2812 | Ga0496109_0014286 | |||
| 2813 | Ga0496109_0030192 | |||
| 2814 | Ga0496109_0119903 | |||
| 2815 | Ga0496110_0000897 | |||
| 2816 | Ga0496110_0064141 | |||
| 2817 | Ga0496110_0177063 | |||
| 2818 | Ga0496111_0006350 | |||
| 2819 | Ga0496112_0001650 | |||
| 2820 | Ga0496112_0033130 | |||
| 2821 | Ga0496112_0036483 | |||
| 2822 | Ga0496112_0040595 | |||
| 2823 | Ga0496113_0006167 | |||
| 2824 | Ga0496113_0023536 | |||
| 2825 | Ga0496113_0141040 | |||
| 2826 | Ga0496114_0279364 | |||
| 2827 | Ga0496115_0046082 | |||
| 2828 | Ga0496115_0058899 | |||
| 2829 | Ga0496115_0084681 | |||
| 2830 | Ga0496116_0000057 | |||
| 2831 | Ga0496116_0033391 | |||
| 2832 | Ga0496117_0000031 | |||
| 2833 | Ga0496117_0000035 | |||
| 2834 | Ga0496118_0000054 | |||
| 2835 | Ga0496118_0000208 | |||
| 2836 | Ga0496118_0021158 | |||
| 2837 | Ga0496118_0095560 | |||
| 2838 | Ga0496119_0001742 | |||
| 2839 | Ga0496120_0001350 | |||
| 2840 | Ga0496120_0005474 | |||
| 2841 | Ga0496120_0117392 | |||
| 2842 | Ga0496121_0004095 | |||
| 2843 | Ga0496121_0011702 | |||
| 2844 | Ga0496122_0000023 | |||
| 2845 | Ga0496122_0004894 | |||
| 2846 | Ga0496123_0000027 | |||
| 2847 | Ga0496123_0018182 | |||
| 2848 | Ga0496125_0001899 | |||
| 2849 | Ga0496125_0047340 | |||
| 2850 | Ga0496125_0082673 | |||
| 2851 | Ga0496126_0001469 | |||
| 2852 | Ga0496126_0001514 | |||
| 2853 | Ga0496126_0008444 | |||
| 2854 | Ga0496126_0154782 | |||
| 2855 | Ga0495682_0038985 | |||
| 2856 | Ga0495682_0041426 | |||
| 2857 | Ga0501031_0183289 | |||
| 2858 | Ga0501032_0004235 | |||
| 2859 | Ga0501033_0004380 | |||
| 2860 | Ga0501033_0005550 | |||
| 2861 | Ga0501034_0002524 | |||
| 2862 | Ga0501034_0011934 | |||
| 2863 | Ga0501034_0012973 | |||
| 2864 | Ga0501034_0018184 | |||
| 2865 | Ga0501034_0151613 | |||
| 2866 | Ga0501036_0000952 | |||
| 2867 | Ga0501036_0136224 | |||
| 2868 | Ga0501037_0002978 | |||
| 2869 | Ga0501038_0000048 | |||
| 2870 | Ga0501038_0000619 | |||
| 2871 | Ga0501039_0010233 | |||
| 2872 | Ga0501039_0036795 | |||
| 2873 | Ga0501040_0140012 | |||
| 2874 | Ga0501041_0028234 | |||
| 2875 | Ga0501042_0115466 | |||
| 2876 | Ga0501043_0000347 | |||
| 2877 | Ga0501046_0003161 | |||
| 2878 | Ga0501047_0000261 | |||
| 2879 | Ga0501047_0005907 | |||
| 2880 | Ga0501067_0037067 | |||
| 2881 | Ga0501067_0049168 | |||
| 2882 | Ga0501069_0106418 | |||
| 2883 | Ga0501070_0002167 | |||
| 2884 | Ga0501071_0058442 | |||
| 2885 | Ga0501072_0252753 | |||
| 2886 | Ga0501072_0410288 | |||
| 2887 | Ga0501074_0006292 | |||
| 2888 | Ga0501075_0032307 | |||
| 2889 | Ga0501075_0045154 | |||
| 2890 | Ga0501075_0242211 | |||
| 2891 | Ga0501075_0334845 | |||
| 2892 | Ga0501076_0013524 | |||
| 2893 | Ga0501076_0106789 | |||
| 2894 | Ga0501079_0040224 | |||
| 2895 | Ga0501079_0078780 | |||
| 2896 | Ga0501080_0024570 | |||
| 2897 | Ga0501080_0303533 | |||
| 2898 | Ga0501081_0100733 | |||
| 2899 | Ga0501035_0003457 | |||
| 2900 | Ga0501035_0057137 | |||
| 2901 | Ga0501044_0028927 | |||
| 2902 | Ga0501044_0222462 | |||
| 2903 | Ga0501045_0035593 | |||
| 2904 | Ga0501045_0215627 | |||
| 2905 | nmdc:mga03n38_32661_c1 | |||
| 2906 | nmdc:mga00v17_15_c1 | |||
| 2907 | nmdc:mga00v17_25504_c1 | |||
| 2908 | nmdc:mga00v17_35588_c1 | |||
| 2909 | nmdc:mga06z11_28285_c1 | |||
| 2910 | nmdc:mga05p37_107661_c1 | |||
| 2911 | nmdc:mga05p37_1139_c1 | |||
| 2912 | nmdc:mga05p37_17501_c1 | |||
| 2913 | nmdc:mga05p37_190031_c1 | |||
| 2914 | nmdc:mga05p37_21578_c1 | |||
| 2915 | nmdc:mga05p37_251652_c1 | |||
| 2916 | nmdc:mga05p37_30845_c1 | |||
| 2917 | nmdc:mga05p37_32441_c1 | |||
| 2918 | nmdc:mga05p37_339387_c1 | |||
| 2919 | nmdc:mga05p37_366500_c1 | |||
| 2920 | nmdc:mga05p37_49_c1 | |||
| 2921 | nmdc:mga05p37_51401_c1 | |||
| 2922 | nmdc:mga05p37_66571_c1 | |||
| 2923 | nmdc:mga05p37_69457_c1 | |||
| 2924 | nmdc:mga05p37_70509_c1 | |||
| 2925 | nmdc:mga05p37_9401_c1 | |||
| 2926 | nmdc:mga05p37_94802_c1 | |||
| 2927 | nmdc:mga09592_20042_c1 | |||
| 2928 | nmdc:mga09592_2435_c1 | |||
| 2929 | nmdc:mga09592_2888_c1 | |||
| 2930 | nmdc:mga09592_29650_c1 | |||
| 2931 | nmdc:mga09592_55716_c1 | |||
| 2932 | nmdc:mga09592_6952_c1 | |||
| 2933 | nmdc:mga09592_98582_c1 | |||
| 2934 | nmdc:mga0qj67_100449_c1 | |||
| 2935 | nmdc:mga0qj67_100594_c1 | |||
| 2936 | nmdc:mga0qj67_119430_c1 | |||
| 2937 | nmdc:mga0qj67_12577_c1 | |||
| 2938 | nmdc:mga0qj67_16204_c1 | |||
| 2939 | nmdc:mga0qj67_17549_c1 | |||
| 2940 | nmdc:mga0qj67_290316_c1 | |||
| 2941 | nmdc:mga0qj67_364633_c1 | |||
| 2942 | nmdc:mga0qj67_5724_c1 | |||
| 2943 | nmdc:mga06r32_144929_c1 | |||
| 2944 | nmdc:mga06r32_15361_c1 | |||
| 2945 | nmdc:mga06r32_165272_c1 | |||
| 2946 | nmdc:mga06r32_17242_c1 | |||
| 2947 | nmdc:mga06r32_247802_c1 | |||
| 2948 | nmdc:mga06r32_31766_c1 | |||
| 2949 | nmdc:mga06r32_329327_c1 | |||
| 2950 | nmdc:mga06r32_37338_c1 | |||
| 2951 | nmdc:mga06r32_3800_c2 | |||
| 2952 | nmdc:mga06r32_67414_c1 | |||
| 2953 | nmdc:mga06r32_86053_c1 | |||
| 2954 | nmdc:mga08y16_11854_c1 | |||
| 2955 | nmdc:mga08y16_122744_c1 | |||
| 2956 | nmdc:mga08y16_128252_c1 | |||
| 2957 | nmdc:mga08y16_17132_c1 | |||
| 2958 | nmdc:mga08y16_180840_c1 | |||
| 2959 | nmdc:mga08y16_22046_c1 | |||
| 2960 | nmdc:mga08y16_293641_c1 | |||
| 2961 | nmdc:mga08y16_32274_c1 | |||
| 2962 | nmdc:mga08y16_32278_c1 | |||
| 2963 | nmdc:mga08y16_48167_c1 | |||
| 2964 | nmdc:mga08y16_50488_c1 | |||
| 2965 | nmdc:mga08y16_60740_c1 | |||
| 2966 | nmdc:mga08y16_67595_c1 | |||
| 2967 | nmdc:mga08y16_9318_c1 | |||
| 2968 | nmdc:mga0n895_1022_c1 | |||
| 2969 | nmdc:mga0n895_11825_c1 | |||
| 2970 | nmdc:mga0n895_121269_c1 | |||
| 2971 | nmdc:mga0n895_13179_c1 | |||
| 2972 | nmdc:mga0n895_138408_c1 | |||
| 2973 | nmdc:mga0n895_14065_c1 | |||
| 2974 | nmdc:mga0n895_208456_c1 | |||
| 2975 | nmdc:mga0n895_39050_c1 | |||
| 2976 | nmdc:mga0n895_436004_c1 | |||
| 2977 | nmdc:mga0n895_6911_c1 | |||
| 2978 | nmdc:mga0n895_81867_c1 | |||
| 2979 | nmdc:mga0n895_844_c1 | |||
| 2980 | nmdc:mga0rr50_11399_c1 | |||
| 2981 | nmdc:mga0rr50_12325_c1 | |||
| 2982 | nmdc:mga0rr50_16343_c1 | |||
| 2983 | nmdc:mga0rr50_198028_c1 | |||
| 2984 | nmdc:mga0rr50_2107_c1 | |||
| 2985 | nmdc:mga0rr50_23_c1 | |||
| 2986 | nmdc:mga0rr50_266194_c1 | |||
| 2987 | nmdc:mga0rr50_29045_c1 | |||
| 2988 | nmdc:mga0rr50_356_c1 | |||
| 2989 | nmdc:mga08x19_103868_c1 | |||
| 2990 | nmdc:mga08x19_131950_c1 | |||
| 2991 | nmdc:mga08x19_165_c1 | |||
| 2992 | nmdc:mga08x19_25_c1 | |||
| 2993 | nmdc:mga08x19_4977_c1 | |||
| 2994 | nmdc:mga08x19_577_c1 | |||
| 2995 | nmdc:mga08x19_5806_c1 | |||
| 2996 | nmdc:mga08x19_646_c1 | |||
| 2997 | nmdc:mga0a205_137723_c1 | |||
| 2998 | nmdc:mga0a205_16866_c1 | |||
| 2999 | nmdc:mga0a205_180796_c1 | |||
| 3000 | nmdc:mga0a205_25453_c1 | |||
| 3001 | nmdc:mga0a205_27501_c1 | |||
| 3002 | nmdc:mga0a205_323_c1 | |||
| 3003 | nmdc:mga0a205_351822_c1 | |||
| 3004 | nmdc:mga0a205_39867_c1 | |||
| 3005 | nmdc:mga0a205_6239_c1 | |||
| 3006 | nmdc:mga0a205_6436_c1 | |||
| 3007 | nmdc:mga0a205_7354_c1 | |||
| 3008 | nmdc:mga0a205_76706_c1 | |||
| 3009 | nmdc:mga0sz30_62680_c1 | |||
| 3010 | Ga0495601_0007830 | |||
| 3011 | Ga0495612_0025414 | |||
| 3012 | Ga0495595_0026163 | |||
| 3013 | Ga0495619_0020393 | |||
| 3014 | Ga0500643_015722 | |||
| 3015 | Ga0500560_002917 | |||
| 3016 | Ga0500560_003744 | |||
| 3017 | Ga0500572_004591 | |||
| 3018 | Ga0500595_000121 | |||
| 3019 | Ga0500595_009623 | |||
| 3020 | Ga0500597_008056 | |||
| 3021 | Ga0500628_000737 | |||
| 3022 | Ga0500577_0005877 | |||
| 3023 | Ga0500616_0005395 | |||
| 3024 | Ga0500624_000393 | |||
| 3025 | Ga0500636_0000025 | |||
| 3026 | Ga0500636_0004427 | |||
| 3027 | Ga0501084_0028505 | |||
| 3028 | Ga0501084_0204766 | |||
| 3029 | Ga0500661_002485 | |||
| 3030 | Ga0590071_000285 | |||
| 3031 | Ga0501082_0056401 | |||
| 3032 | 2537873611 | |||
| 3033 | 2601610906 | |||
| 3034 | 2601747680 | |||
| 3035 | 2643921542 | |||
| 3036 | 2740994242 | |||
| 3037 | 2808988156 | |||
| 3038 | 2831428567 | |||
| 3039 | 2838678603 | |||
| 3040 | 2838718309 | |||
| 3041 | 2838722899 | |||
| 3042 | 2838728375 | |||
| 3043 | 2841850455 | |||
| 3044 | 2841863292 | |||
| 3045 | 2842129035 | |||
| 3046 | 2842133496 | |||
| 3047 | 2842155593 | |||
| 3048 | 2842174449 | |||
| 3049 | 2842179110 | |||
| 3050 | 2842190733 | |||
| 3051 | 2842214943 | |||
| 3052 | 2842227664 | |||
| 3053 | 2842519971 | |||
| 3054 | 2848699582 | |||
| 3055 | 2849663763 | |||
| 3056 | 2884217039 | |||
| 3057 | 2899795389 | |||
| 3058 | 2899849368 | |||
| 3059 | 2919118434 | |||
| 3060 | 2926754963 | |||
| 3061 | 2933010559 | |||
| 3062 | 2933015769 | |||
| 3063 | 2933597493 | |||
| 3064 | 2935392915 | |||
| 3065 | 2979092603 | |||
| 3066 | 2979100006 | |||
| 3067 | 2984513628 | |||
| 3068 | 2984522791 | |||
| 3069 | 2984542098 | |||
| 3070 | 2984601528 | |||
| 3071 | 2995464776 | |||
| 3072 | 3006486689 | |||
| 3073 | 8002779563 | |||
| 3074 | 8003573705 | |||
| 3075 | 8025481942 | |||
| 3076 | 8054463744 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wua-assembly1.cif.gz_A | structure of the peroxisomal 3-ketoacyl-coa thiolase from sunflower | 0.9577 | 1 | 391 |
| 2wu9-assembly1.cif.gz_B | crystal structure of peroxisomal kat2 from arabidopsis thaliana | 0.9562 | 2 | 391 |
| 4e1l-assembly1.cif.gz_D | crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile | 0.9546 | 1 | 391 |
| 2iik-assembly1.cif.gz_B | crystal structure of human peroxisomal acetyl-coa acyl transferase 1 (acaa1) | 0.9535 | 2 | 392 |
| 4ubt-assembly3.cif.gz_D | structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with a steroid and coa. | 0.953 | 1 | 392 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9866 | 276 | 386 | 3.40.47.10 |
| af_P76461_265_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9863 | 265 | 392 | 3.40.47.10 |
| af_O53871_287_399_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9833 | 276 | 386 | 3.40.47.10 |
| af_Q2G1D0_1_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9796 | 1 | 392 | 3.40.47.10 |
| af_Q2G1D0_1_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9771 | 1 | 392 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4PRG6-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9913 | 271 | 392 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-X1NTI0-F1-model_v4 | Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein | 0.9899 | 269 | 392 |
GO:0016747
|
| AF-A0A1F7L7J7-F1-model_v4 | Thiolase C-terminal domain-containing protein | 0.9898 | 281 | 390 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A3M1N5H7-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9879 | 44 | 392 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A7X6WFA2-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.9) | 0.9875 | 282 | 391 |
GO:0003985
GO:0006635 GO:0010124 |