F494644

General Info

Members Datasets Scaffolds Average Seq Length
1538 463 3076 389

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_14440|Ga0400484_14440_47_1345
Length 432
Sequence MTSRLKEVVIVSGARTPVGSFGGSLKSVPAIDMGALVMKTAIERAGLRPTPSDEMGQLSPDALKDQGTISLEADTAQWDGGAIPVTIDEVVMGHVLTAGLGQNPGRQAMIRAGIPKETPAYTINKVCGSGLKAIALGAASIMTGQADVVMAGGQENMSQVPLALPKARWGHRMELTGVGDIYDLMVYDGLYEIFYGYHMGLTAENIAALYEISREEQDELGVLSHTRARAAITGGEFVEEIVPVTVKGRKGDTIVDTDERPMDTSLEKMGRLRPAFKKDGSVTAGNASGINDGAAAVLLMSAEKALELGLTPLAKIKAFASGGVDPAYMGLGPVPAIRKAVAECGMNLADIDVIELNEAFAAQAIGCLRELKLPNDKPNLVGSGISLGHPIGCTGARQMVTAIHLMKRRQLNTGLISMCIGGGMGMAMLVES

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
126 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
127 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
227 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
228 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
229 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
249 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
254 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
255 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
261 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
262 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
319 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
320 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
321 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
322 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
341 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
342 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
343 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
344 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
349 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
406 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
407 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
410 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
411 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
414 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
417 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
420 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
421 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
422 2643221582 Rhizobium sp. Root651 Isolate Unclassified
423 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
424 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
425 2831426010 Nostoc sp. 106C Isolate Unclassified
426 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
427 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
428 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
429 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
430 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
431 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
432 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
433 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
434 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
435 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
436 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
437 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
438 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
439 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
440 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
441 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
442 2849660919 Nostoc sp. T09 Isolate Unclassified
443 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
444 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
445 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
446 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
447 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
448 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
449 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
450 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
451 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
452 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
453 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
454 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
455 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
456 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
457 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
458 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
459 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
460 8002775197 Frankia nepalensis CN7 Isolate Nodule
461 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
462 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
463 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.65
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 1.89
Nodule 1.43
Rhizoplane 2.6
Rhizosphere 90.12
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_14440 3300038725 Bacteria 2322
2 JGI24746J21847_1007330 3300001977 Bacteria 1690
3 JGI25406J46586_10000491 3300003203 Bacteria 18498
4 JGI25406J46586_10007753 3300003203 Unclassified 4884
5 Ga0065712_10070058 3300005290 Bacteria 6368
6 Ga0065715_10005050 3300005293 Bacteria 5549
7 Ga0065715_10010633 3300005293 Bacteria 5347
8 Ga0065715_10090876 3300005293 Bacteria 6342
9 Ga0065715_10114814 3300005293 Bacteria 2437
10 Ga0065715_10176740 3300005293 Bacteria 1506
11 Ga0065715_10217235 3300005293 Bacteria 1287
12 Ga0065715_10236973 3300005293 Bacteria 1213
13 Ga0065707_10094919 3300005295 Bacteria 3437
14 Ga0070658_10011373 3300005327 Bacteria 7136
15 Ga0070658_10034910 3300005327 Bacteria 4047
16 Ga0070676_10019288 3300005328 Bacteria 3793
17 Ga0070676_10028453 3300005328 Bacteria 3174
18 Ga0070676_10029120 3300005328 Bacteria 3139
19 Ga0070676_10042623 3300005328 Bacteria 2636
20 Ga0070676_10042666 3300005328 Bacteria 2635
21 Ga0070676_10094738 3300005328 Bacteria 1835
22 Ga0070683_100001126 3300005329 Bacteria 20202
23 Ga0070683_100034468 3300005329 Bacteria 4625
24 Ga0070683_100039007 3300005329 Bacteria 4357
25 Ga0070683_100056802 3300005329 Bacteria 3635
26 Ga0070683_100057431 3300005329 Bacteria 3615
27 Ga0070683_100065420 3300005329 Bacteria 3385
28 Ga0070683_100181721 3300005329 Bacteria 1997
29 Ga0070683_100322244 3300005329 Bacteria 1471
30 Ga0070690_100006740 3300005330 Bacteria 6527
31 Ga0070690_100014748 3300005330 Bacteria 4642
32 Ga0070690_100023771 3300005330 Bacteria 3762
33 Ga0070690_100045248 3300005330 Bacteria 2795
34 Ga0070690_100064366 3300005330 Bacteria 2368
35 Ga0070690_100065474 3300005330 Bacteria 2350
36 Ga0070690_100082341 3300005330 Bacteria 2107
37 Ga0070690_100090851 3300005330 Bacteria 2011
38 Ga0070690_100101546 3300005330 Bacteria 1908
39 Ga0070690_100168379 3300005330 Bacteria 1506
40 Ga0070670_100001936 3300005331 Bacteria 16947
41 Ga0070670_100006348 3300005331 Bacteria 10006
42 Ga0070670_100017827 3300005331 Bacteria 6093
43 Ga0070670_100020760 3300005331 Bacteria 5647
44 Ga0070670_100021146 3300005331 Bacteria 5597
45 Ga0070670_100039172 3300005331 Bacteria 4075
46 Ga0070670_100076642 3300005331 Bacteria 2873
47 Ga0070677_10002564 3300005333 Bacteria 5811
48 Ga0068869_100011370 3300005334 Bacteria 5835
49 Ga0068869_100012331 3300005334 Bacteria 5646
50 Ga0068869_100043658 3300005334 Bacteria 3221
51 Ga0068869_100087287 3300005334 Bacteria 2340
52 Ga0068869_100186645 3300005334 Bacteria 1628
53 Ga0068869_100262555 3300005334 Bacteria 1383
54 Ga0070666_10012366 3300005335 Bacteria 5381
55 Ga0070666_10015831 3300005335 Bacteria 4817
56 Ga0070666_10036583 3300005335 Bacteria 3260
57 Ga0070666_10168285 3300005335 Bacteria 1534
58 Ga0070680_100037488 3300005336 Bacteria 3917
59 Ga0070680_100045533 3300005336 Bacteria 3567
60 Ga0070680_100115030 3300005336 Bacteria 2241
61 Ga0070680_100311552 3300005336 Bacteria 1335
62 Ga0068868_100003641 3300005338 Bacteria 10752
63 Ga0068868_100016841 3300005338 Bacteria 5437
64 Ga0070660_100285795 3300005339 Bacteria 1350
65 Ga0070689_100036732 3300005340 Bacteria 3746
66 Ga0070689_100055068 3300005340 Bacteria 3080
67 Ga0070689_100056731 3300005340 Bacteria 3038
68 Ga0070689_100100516 3300005340 Bacteria 2288
69 Ga0070689_100191728 3300005340 Bacteria 1664
70 Ga0070691_10005290 3300005341 Bacteria 5863
71 Ga0070691_10019803 3300005341 Bacteria 3106
72 Ga0070687_100012601 3300005343 Bacteria 3739
73 Ga0070687_100023806 3300005343 Bacteria 2914
74 Ga0070687_100025783 3300005343 Bacteria 2825
75 Ga0070687_100031349 3300005343 Bacteria 2608
76 Ga0070661_100011194 3300005344 Bacteria 6250
77 Ga0070661_100013643 3300005344 Bacteria 5706
78 Ga0070661_100017754 3300005344 Bacteria 5050
79 Ga0070661_100050849 3300005344 Bacteria 3032
80 Ga0070661_100116655 3300005344 Bacteria 1997
81 Ga0070692_10053279 3300005345 Bacteria 2109
82 Ga0070668_100094882 3300005347 Bacteria 2356
83 Ga0070669_100001000 3300005353 Bacteria 20586
84 Ga0070669_100001192 3300005353 Bacteria 18941
85 Ga0070669_100018183 3300005353 Bacteria 5021
86 Ga0070669_100034609 3300005353 Bacteria 3657
87 Ga0070669_100037580 3300005353 Bacteria 3512
88 Ga0070669_100041230 3300005353 Bacteria 3357
89 Ga0070669_100118136 3300005353 Bacteria 2019
90 Ga0070669_100164049 3300005353 Bacteria 1728
91 Ga0070675_100000202 3300005354 Bacteria 37748
92 Ga0070675_100000206 3300005354 Bacteria 37528
93 Ga0070675_100000408 3300005354 Bacteria 29253
94 Ga0070675_100005006 3300005354 Bacteria 10118
95 Ga0070675_100013178 3300005354 Bacteria 6496
96 Ga0070675_100018751 3300005354 Bacteria 5508
97 Ga0070675_100020786 3300005354 Bacteria 5238
98 Ga0070675_100024217 3300005354 Bacteria 4861
99 Ga0070675_100038952 3300005354 Bacteria 3876
100 Ga0070675_100046972 3300005354 Bacteria 3537
101 Ga0070675_100124788 3300005354 Bacteria 2190
102 Ga0070675_100153219 3300005354 Bacteria 1977
103 Ga0070675_100304999 3300005354 Bacteria 1404
104 Ga0070671_100001717 3300005355 Bacteria 16637
105 Ga0070671_100008027 3300005355 Bacteria 8448
106 Ga0070671_100008756 3300005355 Bacteria 8119
107 Ga0070671_100033204 3300005355 Bacteria 4267
108 Ga0070671_100181883 3300005355 Bacteria 1780
109 Ga0070671_100259913 3300005355 Bacteria 1475
110 Ga0070674_100000192 3300005356 Bacteria 29259
111 Ga0070674_100002496 3300005356 Bacteria 10188
112 Ga0070674_100019077 3300005356 Bacteria 4351
113 Ga0070673_100004944 3300005364 Bacteria 8491
114 Ga0070673_100025833 3300005364 Bacteria 4329
115 Ga0070673_100047112 3300005364 Bacteria 3352
116 Ga0070673_100083282 3300005364 Bacteria 2598
117 Ga0070673_100128423 3300005364 Bacteria 2124
118 Ga0070688_100014162 3300005365 Bacteria 4515
119 Ga0070688_100057032 3300005365 Bacteria 2453
120 Ga0070659_100016221 3300005366 Bacteria 5590
121 Ga0070659_100022661 3300005366 Bacteria 4796
122 Ga0070659_100032944 3300005366 Bacteria 4023
123 Ga0070667_100002413 3300005367 Bacteria 16341
124 Ga0070667_100248121 3300005367 Bacteria 1591
125 Ga0070667_100357696 3300005367 Bacteria 1323
126 Ga0070709_10039305 3300005434 Bacteria 2902
127 Ga0070709_10174061 3300005434 Bacteria 1506
128 Ga0070713_100035741 3300005436 Bacteria 4003
129 Ga0070701_10003212 3300005438 Bacteria 6436
130 Ga0070701_10009769 3300005438 Bacteria 4215
131 Ga0070701_10029499 3300005438 Bacteria 2707
132 Ga0070701_10046400 3300005438 Bacteria 2233
133 Ga0070701_10056666 3300005438 Bacteria 2051
134 Ga0070711_100000038 3300005439 Bacteria 85684
135 Ga0070711_100064470 3300005439 Bacteria 2560
136 Ga0070705_100000023 3300005440 Bacteria 82331
137 Ga0070705_100001554 3300005440 Bacteria 12031
138 Ga0070705_100006748 3300005440 Bacteria 5646
139 Ga0070705_100109541 3300005440 Bacteria 1761
140 Ga0070705_100194391 3300005440 Bacteria 1386
141 Ga0070700_100003012 3300005441 Bacteria 8640
142 Ga0070700_100036343 3300005441 Bacteria 2987
143 Ga0070700_100037695 3300005441 Bacteria 2942
144 Ga0070694_100007236 3300005444 Bacteria 6759
145 Ga0070694_100027390 3300005444 Bacteria 3701
146 Ga0070708_100014503 3300005445 Bacteria 6488
147 Ga0070708_100038377 3300005445 Bacteria 4185
148 Ga0070708_100056011 3300005445 Bacteria 3506
149 Ga0070708_100104251 3300005445 Bacteria 2601
150 Ga0070663_100007672 3300005455 Bacteria 6585
151 Ga0070663_100033219 3300005455 Bacteria 3563
152 Ga0070678_100029082 3300005456 Bacteria 3780
153 Ga0070678_100049631 3300005456 Bacteria 3030
154 Ga0070678_100057239 3300005456 Bacteria 2855
155 Ga0070678_100106840 3300005456 Bacteria 2182
156 Ga0070662_100008307 3300005457 Bacteria 6764
157 Ga0070662_100022624 3300005457 Bacteria 4306
158 Ga0070662_100053625 3300005457 Bacteria 2919
159 Ga0070662_100139429 3300005457 Bacteria 1878
160 Ga0070681_10001704 3300005458 Bacteria 19679
161 Ga0070681_10013545 3300005458 Bacteria 8109
162 Ga0070681_10028189 3300005458 Bacteria 5646
163 Ga0070681_10030588 3300005458 Bacteria 5403
164 Ga0070681_10057901 3300005458 Bacteria 3855
165 Ga0070681_10061568 3300005458 Bacteria 3726
166 Ga0070681_10086994 3300005458 Bacteria 3078
167 Ga0068867_100005997 3300005459 Bacteria 8616
168 Ga0068867_100008016 3300005459 Bacteria 7464
169 Ga0068867_100012021 3300005459 Bacteria 6113
170 Ga0068867_100025755 3300005459 Bacteria 4221
171 Ga0068867_100033375 3300005459 Bacteria 3727
172 Ga0068867_100037901 3300005459 Bacteria 3506
173 Ga0068867_100122508 3300005459 Bacteria 2011
174 Ga0068867_100138363 3300005459 Bacteria 1901
175 Ga0070685_10005680 3300005466 Bacteria 6335
176 Ga0070685_10052836 3300005466 Bacteria 2352
177 Ga0070706_100010022 3300005467 Bacteria 8799
178 Ga0070706_100197323 3300005467 Bacteria 1880
179 Ga0070706_100314277 3300005467 Bacteria 1461
180 Ga0070707_100000212 3300005468 Bacteria 58073
181 Ga0070707_100000431 3300005468 Bacteria 41512
182 Ga0070707_100034000 3300005468 Bacteria 4863
183 Ga0070707_100072471 3300005468 Bacteria 3320
184 Ga0070698_100000385 3300005471 Bacteria 46316
185 Ga0070698_100016037 3300005471 Bacteria 7912
186 Ga0070698_100248411 3300005471 Bacteria 1712
187 Ga0070698_100303010 3300005471 Bacteria 1529
188 Ga0070699_100061274 3300005518 Bacteria 3261
189 Ga0070699_100084611 3300005518 Bacteria 2768
190 Ga0070699_100113220 3300005518 Bacteria 2383
191 Ga0070699_100121194 3300005518 Bacteria 2300
192 Ga0070699_100125417 3300005518 Bacteria 2260
193 Ga0070679_100017481 3300005530 Bacteria 6942
194 Ga0070679_100052278 3300005530 Bacteria 4070
195 Ga0070679_100195639 3300005530 Bacteria 1989
196 Ga0070679_100205341 3300005530 Bacteria 1935
197 Ga0070684_100000068 3300005535 Bacteria 65538
198 Ga0070684_100008077 3300005535 Bacteria 8216
199 Ga0070684_100076425 3300005535 Bacteria 2956
200 Ga0070684_100373888 3300005535 Bacteria 1312
201 Ga0070697_100000531 3300005536 Bacteria 28705
202 Ga0070697_100026023 3300005536 Bacteria 4668
203 Ga0070697_100254576 3300005536 Bacteria 1502
204 Ga0068853_100001165 3300005539 Bacteria 18691
205 Ga0068853_100031112 3300005539 Bacteria 4513
206 Ga0068853_100070822 3300005539 Bacteria 3035
207 Ga0068853_100319535 3300005539 Bacteria 1439
208 Ga0070672_100008106 3300005543 Bacteria 7178
209 Ga0070672_100009511 3300005543 Bacteria 6706
210 Ga0070672_100045467 3300005543 Bacteria 3396
211 Ga0070672_100050492 3300005543 Bacteria 3240
212 Ga0070672_100054107 3300005543 Bacteria 3141
213 Ga0070672_100076644 3300005543 Bacteria 2671
214 Ga0070672_100094364 3300005543 Bacteria 2419
215 Ga0070672_100096073 3300005543 Bacteria 2397
216 Ga0070686_100014154 3300005544 Bacteria 4590
217 Ga0070686_100015831 3300005544 Bacteria 4377
218 Ga0070686_100026116 3300005544 Bacteria 3521
219 Ga0070695_100000155 3300005545 Bacteria 32258
220 Ga0070695_100007901 3300005545 Bacteria 6297
221 Ga0070696_100001294 3300005546 Bacteria 16298
222 Ga0070696_100013489 3300005546 Bacteria 5483
223 Ga0070696_100087670 3300005546 Bacteria 2211
224 Ga0070665_100001535 3300005548 Bacteria 26671
225 Ga0070665_100007098 3300005548 Bacteria 11381
226 Ga0070665_100018061 3300005548 Bacteria 7079
227 Ga0070665_100026106 3300005548 Bacteria 5881
228 Ga0070665_100027580 3300005548 Bacteria 5720
229 Ga0070665_100029554 3300005548 Bacteria 5516
230 Ga0070665_100033893 3300005548 Bacteria 5136
231 Ga0070704_100001112 3300005549 Bacteria 13983
232 Ga0070704_100024108 3300005549 Bacteria 3987
233 Ga0070704_100095590 3300005549 Bacteria 2226
234 Ga0070704_100103968 3300005549 Bacteria 2146
235 Ga0070704_100109444 3300005549 Bacteria 2099
236 Ga0068855_100035919 3300005563 Bacteria 5901
237 Ga0068855_100107978 3300005563 Bacteria 3197
238 Ga0068855_100161260 3300005563 Bacteria 2545
239 Ga0068855_100211604 3300005563 Bacteria 2178
240 Ga0070664_100000408 3300005564 Bacteria 32016
241 Ga0070664_100003040 3300005564 Bacteria 13569
242 Ga0070664_100006808 3300005564 Bacteria 9216
243 Ga0070664_100009215 3300005564 Bacteria 8013
244 Ga0070664_100009579 3300005564 Bacteria 7856
245 Ga0070664_100018914 3300005564 Bacteria 5663
246 Ga0070664_100020599 3300005564 Bacteria 5431
247 Ga0070664_100022888 3300005564 Bacteria 5155
248 Ga0070664_100034123 3300005564 Bacteria 4267
249 Ga0070664_100079530 3300005564 Bacteria 2822
250 Ga0070664_100083244 3300005564 Bacteria 2760
251 Ga0070664_100098220 3300005564 Bacteria 2543
252 Ga0068857_100005029 3300005577 Bacteria 11239
253 Ga0068857_100017945 3300005577 Bacteria 6206
254 Ga0068857_100044957 3300005577 Bacteria 3917
255 Ga0068857_100048598 3300005577 Bacteria 3766
256 Ga0068857_100307235 3300005577 Bacteria 1463
257 Ga0068854_100141939 3300005578 Bacteria 1844
258 Ga0068856_100351940 3300005614 Bacteria 1491
259 Ga0068856_100399033 3300005614 Bacteria 1395
260 Ga0070702_100008655 3300005615 Bacteria 4941
261 Ga0068859_100005622 3300005617 Bacteria 12779
262 Ga0068859_100013051 3300005617 Bacteria 8348
263 Ga0068859_100016091 3300005617 Bacteria 7514
264 Ga0068859_100034153 3300005617 Bacteria 5105
265 Ga0068859_100078549 3300005617 Bacteria 3341
266 Ga0068859_100095218 3300005617 Bacteria 3030
267 Ga0068859_100170825 3300005617 Bacteria 2255
268 Ga0068859_100179049 3300005617 Bacteria 2202
269 Ga0068859_100180719 3300005617 Bacteria 2192
270 Ga0068859_100360208 3300005617 Bacteria 1549
271 Ga0068864_100030720 3300005618 Bacteria 4555
272 Ga0068864_100125410 3300005618 Bacteria 2300
273 Ga0068864_100307422 3300005618 Bacteria 1486
274 Ga0068861_100004593 3300005719 Bacteria 9265
275 Ga0068861_100005603 3300005719 Bacteria 8510
276 Ga0068861_100005906 3300005719 Bacteria 8319
277 Ga0068861_100048764 3300005719 Bacteria 3203
278 Ga0068861_100063982 3300005719 Bacteria 2829
279 Ga0068861_100261353 3300005719 Bacteria 1482
280 Ga0068870_10002305 3300005840 Bacteria 7927
281 Ga0068870_10002884 3300005840 Bacteria 7243
282 Ga0068870_10005642 3300005840 Bacteria 5474
283 Ga0068870_10182307 3300005840 Bacteria 1261
284 Ga0068863_100021750 3300005841 Bacteria 6119
285 Ga0068863_100063750 3300005841 Bacteria 3485
286 Ga0068863_100072609 3300005841 Bacteria 3255
287 Ga0068863_100151036 3300005841 Bacteria 2222
288 Ga0068858_100040590 3300005842 Bacteria 4316
289 Ga0068858_100049335 3300005842 Bacteria 3898
290 Ga0068858_100125856 3300005842 Bacteria 2400
291 Ga0068858_100128307 3300005842 Bacteria 2377
292 Ga0068858_100180231 3300005842 Bacteria 1994
293 Ga0068858_100213540 3300005842 Bacteria 1826
294 Ga0068860_100018392 3300005843 Bacteria 6798
295 Ga0068860_100032227 3300005843 Bacteria 5037
296 Ga0068860_100058145 3300005843 Bacteria 3675
297 Ga0068860_100081629 3300005843 Bacteria 3074
298 Ga0068860_100285269 3300005843 Bacteria 1614
299 Ga0068862_100001571 3300005844 Bacteria 20810
300 Ga0068862_100002276 3300005844 Bacteria 17181
301 Ga0068862_100013045 3300005844 Bacteria 6874
302 Ga0068862_100044380 3300005844 Bacteria 3791
303 Ga0068862_100046669 3300005844 Bacteria 3695
304 Ga0068862_100073499 3300005844 Bacteria 2955
305 Ga0068862_100191372 3300005844 Bacteria 1841
306 Ga0068862_100201759 3300005844 Bacteria 1794
307 Ga0081540_1074489 3300005983 Bacteria 1555
308 Ga0081539_10000093 3300005985 Bacteria 207314
309 Ga0081539_10001136 3300005985 Bacteria 48290
310 Ga0081539_10005341 3300005985 Bacteria 13186
311 Ga0081539_10009311 3300005985 Bacteria 8244
312 Ga0081539_10057781 3300005985 Bacteria 2144
313 Ga0070717_10030097 3300006028 Bacteria 4361
314 Ga0070717_10032785 3300006028 Bacteria 4187
315 Ga0070717_10336150 3300006028 Bacteria 1348
316 Ga0075368_10001899 3300006042 Bacteria 6713
317 Ga0075364_10000845 3300006051 Bacteria 16154
318 Ga0075364_10005410 3300006051 Bacteria 7414
319 Ga0075364_10038968 3300006051 Bacteria 3080
320 Ga0075432_10055550 3300006058 Bacteria 1403
321 Ga0075367_10020967 3300006178 Bacteria 3647
322 Ga0075367_10055547 3300006178 Bacteria 2350
323 Ga0075367_10101443 3300006178 Bacteria 1760
324 Ga0075369_10008604 3300006186 Bacteria 3934
325 Ga0097621_100043570 3300006237 Bacteria 3618
326 Ga0097621_100096262 3300006237 Bacteria 2484
327 Ga0097621_100147311 3300006237 Bacteria 2017
328 Ga0097621_100164616 3300006237 Bacteria 1908
329 Ga0068871_100015620 3300006358 Bacteria 5689
330 Ga0068871_100019830 3300006358 Bacteria 5139
331 Ga0068871_100256782 3300006358 Bacteria 1523
332 Ga0075428_100005558 3300006844 Bacteria 14020
333 Ga0075428_100007739 3300006844 Bacteria 11908
334 Ga0075428_100008259 3300006844 Bacteria 11544
335 Ga0075428_100011749 3300006844 Bacteria 9748
336 Ga0075428_100012298 3300006844 Bacteria 9519
337 Ga0075428_100022458 3300006844 Bacteria 6987
338 Ga0075428_100036930 3300006844 Bacteria 5380
339 Ga0075428_100050593 3300006844 Bacteria 4556
340 Ga0075428_100145289 3300006844 Bacteria 2578
341 Ga0075430_100001572 3300006846 Bacteria 18678
342 Ga0075430_100013858 3300006846 Bacteria 6870
343 Ga0075430_100025892 3300006846 Bacteria 4992
344 Ga0075430_100068808 3300006846 Bacteria 2970
345 Ga0075430_100088985 3300006846 Bacteria 2583
346 Ga0075430_100130023 3300006846 Bacteria 2099
347 Ga0075430_100170800 3300006846 Bacteria 1809
348 Ga0075430_100218642 3300006846 Bacteria 1581
349 Ga0075430_100240510 3300006846 Bacteria 1500
350 Ga0075430_100326639 3300006846 Bacteria 1268
351 Ga0075431_100002075 3300006847 Bacteria 19135
352 Ga0075431_100007891 3300006847 Bacteria 10607
353 Ga0075431_100014890 3300006847 Bacteria 7874
354 Ga0075431_100039560 3300006847 Bacteria 4858
355 Ga0075431_100041811 3300006847 Bacteria 4727
356 Ga0075431_100097958 3300006847 Bacteria 3028
357 Ga0075431_100118566 3300006847 Bacteria 2731
358 Ga0075431_100145261 3300006847 Bacteria 2445
359 Ga0075431_100206996 3300006847 Bacteria 2005
360 Ga0075431_100207846 3300006847 Bacteria 2001
361 Ga0075431_100340241 3300006847 Bacteria 1510
362 Ga0075433_10008088 3300006852 Bacteria 8375
363 Ga0075433_10014399 3300006852 Bacteria 6460
364 Ga0075433_10022099 3300006852 Bacteria 5340
365 Ga0075433_10024458 3300006852 Bacteria 5098
366 Ga0075433_10031125 3300006852 Bacteria 4559
367 Ga0075433_10031541 3300006852 Bacteria 4531
368 Ga0075433_10040375 3300006852 Bacteria 4039
369 Ga0075433_10047106 3300006852 Bacteria 3750
370 Ga0075433_10189420 3300006852 Bacteria 1830
371 Ga0075434_100000553 3300006871 Bacteria 28642
372 Ga0075434_100000585 3300006871 Bacteria 28096
373 Ga0075434_100002096 3300006871 Bacteria 17342
374 Ga0075434_100002820 3300006871 Bacteria 15389
375 Ga0075434_100004979 3300006871 Bacteria 12051
376 Ga0075434_100013018 3300006871 Bacteria 7899
377 Ga0075434_100015822 3300006871 Bacteria 7243
378 Ga0075434_100021087 3300006871 Bacteria 6332
379 Ga0075434_100043606 3300006871 Bacteria 4449
380 Ga0075434_100075410 3300006871 Bacteria 3366
381 Ga0075434_100082612 3300006871 Bacteria 3210
382 Ga0075434_100158591 3300006871 Bacteria 2282
383 Ga0075434_100334843 3300006871 Bacteria 1534
384 Ga0075429_100000181 3300006880 Bacteria 41066
385 Ga0075429_100002380 3300006880 Bacteria 15838
386 Ga0075429_100005278 3300006880 Bacteria 11114
387 Ga0075429_100024452 3300006880 Bacteria 5241
388 Ga0075429_100048639 3300006880 Bacteria 3687
389 Ga0075429_100118964 3300006880 Bacteria 2308
390 Ga0075429_100189523 3300006880 Bacteria 1802
391 Ga0068865_100012596 3300006881 Bacteria 5328
392 Ga0068865_100016005 3300006881 Bacteria 4790
393 Ga0068865_100262524 3300006881 Bacteria 1368
394 Ga0075436_100000199 3300006914 Bacteria 37237
395 Ga0075436_100005822 3300006914 Bacteria 8461
396 Ga0075436_100006076 3300006914 Bacteria 8288
397 Ga0075436_100009367 3300006914 Bacteria 6695
398 Ga0075436_100026590 3300006914 Bacteria 3984
399 Ga0097620_100005622 3300006931 Bacteria 12779
400 Ga0097620_100013051 3300006931 Bacteria 8348
401 Ga0097620_100016090 3300006931 Bacteria 7514
402 Ga0097620_100034155 3300006931 Bacteria 5105
403 Ga0097620_100078547 3300006931 Bacteria 3341
404 Ga0097620_100095218 3300006931 Bacteria 3030
405 Ga0097620_100170820 3300006931 Bacteria 2255
406 Ga0097620_100179047 3300006931 Bacteria 2202
407 Ga0097620_100180721 3300006931 Bacteria 2192
408 Ga0097620_100360230 3300006931 Bacteria 1549
409 Ga0099826_10000468 3300006948 Bacteria 19486
410 Ga0099826_10014757 3300006948 Bacteria 5901
411 Ga0075435_100000052 3300007076 Bacteria 58955
412 Ga0075435_100009595 3300007076 Bacteria 7022
413 Ga0075435_100022726 3300007076 Bacteria 4840
414 Ga0075435_100044354 3300007076 Bacteria 3562
415 Ga0075435_100074365 3300007076 Bacteria 2779
416 Ga0075435_100088232 3300007076 Bacteria 2556
417 Ga0099794_10005403 3300007265 Bacteria 5118
418 Ga0105240_10009442 3300009093 Bacteria 13809
419 Ga0105240_10089919 3300009093 Bacteria 3754
420 Ga0105240_10107198 3300009093 Bacteria 3388
421 Ga0105240_10134551 3300009093 Bacteria 2961
422 Ga0105240_10213176 3300009093 Bacteria 2255
423 Ga0105240_10374214 3300009093 Bacteria 1610
424 Ga0111539_10000324 3300009094 Bacteria 58406
425 Ga0111539_10003328 3300009094 Bacteria 21227
426 Ga0111539_10003636 3300009094 Bacteria 20314
427 Ga0111539_10006989 3300009094 Bacteria 14477
428 Ga0111539_10022595 3300009094 Bacteria 7727
429 Ga0111539_10028372 3300009094 Bacteria 6830
430 Ga0111539_10037755 3300009094 Bacteria 5831
431 Ga0111539_10041079 3300009094 Bacteria 5564
432 Ga0111539_10060627 3300009094 Bacteria 4483
433 Ga0111539_10068797 3300009094 Bacteria 4180
434 Ga0111539_10105503 3300009094 Bacteria 3306
435 Ga0111539_10118098 3300009094 Bacteria 3108
436 Ga0111539_10135625 3300009094 Bacteria 2882
437 Ga0111539_10144567 3300009094 Bacteria 2784
438 Ga0111539_10154542 3300009094 Bacteria 2685
439 Ga0111539_10312479 3300009094 Bacteria 1829
440 Ga0105245_10084662 3300009098 Bacteria 2906
441 Ga0105245_10106002 3300009098 Bacteria 2607
442 Ga0105245_10148397 3300009098 Bacteria 2215
443 Ga0105247_10031422 3300009101 Bacteria 3222
444 Ga0105247_10040785 3300009101 Bacteria 2839
445 Ga0105247_10063593 3300009101 Bacteria 2291
446 Ga0105247_10104426 3300009101 Bacteria 1815
447 Ga0114129_10000307 3300009147 Bacteria 57086
448 Ga0114129_10000588 3300009147 Bacteria 44911
449 Ga0114129_10006012 3300009147 Bacteria 17200
450 Ga0114129_10006290 3300009147 Bacteria 16838
451 Ga0114129_10006879 3300009147 Bacteria 16174
452 Ga0114129_10007407 3300009147 Bacteria 15621
453 Ga0114129_10010731 3300009147 Bacteria 13060
454 Ga0114129_10012882 3300009147 Bacteria 11900
455 Ga0114129_10021924 3300009147 Bacteria 9065
456 Ga0114129_10033704 3300009147 Bacteria 7236
457 Ga0114129_10047465 3300009147 Bacteria 6033
458 Ga0114129_10047748 3300009147 Bacteria 6014
459 Ga0114129_10061111 3300009147 Bacteria 5266
460 Ga0114129_10071975 3300009147 Bacteria 4820
461 Ga0114129_10079382 3300009147 Bacteria 4563
462 Ga0114129_10106093 3300009147 Bacteria 3881
463 Ga0114129_10156558 3300009147 Bacteria 3115
464 Ga0114129_10177608 3300009147 Bacteria 2899
465 Ga0114129_10268119 3300009147 Bacteria 2285
466 Ga0114129_10380637 3300009147 Bacteria 1864
467 Ga0114129_10587841 3300009147 Bacteria 1444
468 Ga0114129_10752778 3300009147 Bacteria 1247
469 Ga0105243_10019426 3300009148 Bacteria 5152
470 Ga0105243_10030455 3300009148 Bacteria 4154
471 Ga0105243_10041278 3300009148 Bacteria 3608
472 Ga0105243_10101663 3300009148 Bacteria 2387
473 Ga0105243_10247838 3300009148 Bacteria 1589
474 Ga0105243_10273776 3300009148 Bacteria 1517
475 Ga0105243_10408312 3300009148 Bacteria 1263
476 Ga0105242_10009410 3300009176 Bacteria 7494
477 Ga0105242_10016448 3300009176 Bacteria 5751
478 Ga0105242_10060137 3300009176 Bacteria 3120
479 Ga0105248_10000664 3300009177 Bacteria 39095
480 Ga0105248_10002959 3300009177 Bacteria 18822
481 Ga0105248_10014897 3300009177 Bacteria 8562
482 Ga0105248_10043880 3300009177 Bacteria 5015
483 Ga0105248_10063176 3300009177 Bacteria 4156
484 Ga0105248_10092522 3300009177 Bacteria 3406
485 Ga0105248_10108361 3300009177 Bacteria 3132
486 Ga0105248_10167554 3300009177 Bacteria 2476
487 Ga0105248_10337990 3300009177 Bacteria 1695
488 Ga0105248_10400700 3300009177 Bacteria 1545
489 Ga0105248_10439837 3300009177 Bacteria 1469
490 Ga0105237_10028798 3300009545 Bacteria 5652
491 Ga0105237_10079291 3300009545 Bacteria 3274
492 Ga0105237_10491492 3300009545 Bacteria 1234
493 Ga0105238_10016494 3300009551 Bacteria 7477
494 Ga0105249_10000733 3300009553 Bacteria 29716
495 Ga0105249_10015979 3300009553 Bacteria 6654
496 Ga0105249_10063199 3300009553 Bacteria 3401
497 Ga0105249_10101884 3300009553 Bacteria 2701
498 Ga0105249_10183723 3300009553 Bacteria 2036
499 Ga0105249_10207017 3300009553 Bacteria 1923
500 Ga0105239_10241031 3300010375 Bacteria 2029
501 Ga0105246_10010820 3300011119 Bacteria 5653
502 Ga0105246_10029966 3300011119 Bacteria 3589
503 Ga0157373_10066988 3300013100 Bacteria 2539
504 Ga0157371_10000071 3300013102 Bacteria 164088
505 Ga0157371_10037856 3300013102 Bacteria 3452
506 Ga0157370_10000469 3300013104 Bacteria 50288
507 Ga0157370_10025074 3300013104 Bacteria 5903
508 Ga0157370_10108404 3300013104 Bacteria 2597
509 Ga0157369_10013530 3300013105 Bacteria 9221
510 Ga0157369_10043197 3300013105 Bacteria 4914
511 Ga0157369_10051341 3300013105 Bacteria 4463
512 Ga0157369_10056570 3300013105 Bacteria 4232
513 Ga0157369_10125898 3300013105 Bacteria 2717
514 Ga0157374_10000448 3300013296 Bacteria 37472
515 Ga0157374_10012030 3300013296 Bacteria 7514
516 Ga0157374_10072301 3300013296 Bacteria 3254
517 Ga0157374_10184870 3300013296 Bacteria 2037
518 Ga0157378_10004264 3300013297 Bacteria 12605
519 Ga0157378_10005712 3300013297 Bacteria 10889
520 Ga0163162_10000786 3300013306 Bacteria 29494
521 Ga0163162_10016252 3300013306 Bacteria 7279
522 Ga0163162_10070083 3300013306 Bacteria 3558
523 Ga0163162_10209555 3300013306 Bacteria 2078
524 Ga0157372_10001231 3300013307 Bacteria 27702
525 Ga0157372_10004537 3300013307 Bacteria 14784
526 Ga0157372_10054256 3300013307 Bacteria 4470
527 Ga0157375_10000071 3300013308 Bacteria 107825
528 Ga0157375_10013991 3300013308 Bacteria 7155
529 Ga0157375_10191624 3300013308 Bacteria 2199
530 Ga0163163_10001107 3300014325 Bacteria 22902
531 Ga0163163_10013130 3300014325 Bacteria 7568
532 Ga0163163_10024898 3300014325 Bacteria 5699
533 Ga0163163_10030622 3300014325 Bacteria 5186
534 Ga0163163_10041518 3300014325 Bacteria 4499
535 Ga0163163_10051444 3300014325 Bacteria 4063
536 Ga0163163_10057531 3300014325 Bacteria 3845
537 Ga0157380_10001766 3300014326 Bacteria 14272
538 Ga0157380_10007787 3300014326 Bacteria 7622
539 Ga0157380_10012368 3300014326 Bacteria 6192
540 Ga0157380_10017341 3300014326 Bacteria 5328
541 Ga0157380_10046144 3300014326 Bacteria 3421
542 Ga0157380_10238364 3300014326 Bacteria 1638
543 Ga0157380_10261166 3300014326 Bacteria 1573
544 Ga0157380_10309771 3300014326 Bacteria 1459
545 Ga0157380_10377125 3300014326 Bacteria 1337
546 Ga0157377_10017766 3300014745 Bacteria 3686
547 Ga0157377_10018790 3300014745 Bacteria 3599
548 Ga0157377_10020665 3300014745 Bacteria 3452
549 Ga0157379_10005094 3300014968 Bacteria 11270
550 Ga0157379_10011426 3300014968 Bacteria 7750
551 Ga0157379_10016218 3300014968 Bacteria 6555
552 Ga0157379_10024070 3300014968 Bacteria 5404
553 Ga0157379_10029043 3300014968 Bacteria 4917
554 Ga0157379_10038695 3300014968 Bacteria 4255
555 Ga0157379_10145854 3300014968 Bacteria 2134
556 Ga0157376_10018769 3300014969 Bacteria 5313
557 Ga0157376_10051739 3300014969 Bacteria 3412
558 Ga0157376_10641973 3300014969 Bacteria 1061
559 Ga0163161_10008043 3300017792 Bacteria 7296
560 Ga0163161_10124937 3300017792 Bacteria 1936
561 Ga0213872_10005421 3300021361 Bacteria 6571
562 Ga0224569_101166 3300022732 Bacteria 2231
563 Ga0224572_1006723 3300024225 Bacteria 2086
564 Ga0224572_1007427 3300024225 Bacteria 2007
565 Ga0228598_1004755 3300024227 Bacteria 2869
566 Ga0209025_1001274 3300025294 Bacteria 34655
567 Ga0207697_10001972 3300025315 Bacteria 10876
568 Ga0207697_10026903 3300025315 Bacteria 2353
569 Ga0207682_10000256 3300025893 Bacteria 23951
570 Ga0207682_10005491 3300025893 Bacteria 5164
571 Ga0207682_10028497 3300025893 Bacteria 2229
572 Ga0207682_10036900 3300025893 Bacteria 1979
573 Ga0207682_10058240 3300025893 Bacteria 1612
574 Ga0207710_10060582 3300025900 Bacteria 1716
575 Ga0207710_10083931 3300025900 Bacteria 1482
576 Ga0207688_10001374 3300025901 Bacteria 12628
577 Ga0207688_10001964 3300025901 Bacteria 11030
578 Ga0207688_10135358 3300025901 Bacteria 1447
579 Ga0207680_10007138 3300025903 Bacteria 5432
580 Ga0207680_10110641 3300025903 Bacteria 1781
581 Ga0207685_10004015 3300025905 Bacteria 3674
582 Ga0207685_10099142 3300025905 Bacteria 1242
583 Ga0207699_10003844 3300025906 Bacteria 7170
584 Ga0207699_10072534 3300025906 Bacteria 2109
585 Ga0207645_10001189 3300025907 Bacteria 21501
586 Ga0207645_10001887 3300025907 Bacteria 16929
587 Ga0207645_10003038 3300025907 Bacteria 12916
588 Ga0207645_10006720 3300025907 Bacteria 8222
589 Ga0207645_10012432 3300025907 Bacteria 5774
590 Ga0207645_10016102 3300025907 Bacteria 4951
591 Ga0207645_10031135 3300025907 Bacteria 3434
592 Ga0207645_10047028 3300025907 Bacteria 2755
593 Ga0207643_10000976 3300025908 Bacteria 17187
594 Ga0207643_10002349 3300025908 Bacteria 10283
595 Ga0207643_10008592 3300025908 Bacteria 5477
596 Ga0207643_10016621 3300025908 Bacteria 4013
597 Ga0207705_10000463 3300025909 Bacteria 34773
598 Ga0207705_10014605 3300025909 Bacteria 5651
599 Ga0207684_10003705 3300025910 Bacteria 14798
600 Ga0207684_10147145 3300025910 Bacteria 2026
601 Ga0207707_10096218 3300025912 Bacteria 2588
602 Ga0207707_10107009 3300025912 Bacteria 2445
603 Ga0207707_10167535 3300025912 Bacteria 1920
604 Ga0207707_10239421 3300025912 Bacteria 1578
605 Ga0207695_10057888 3300025913 Bacteria 4025
606 Ga0207695_10161907 3300025913 Bacteria 2169
607 Ga0207695_10250619 3300025913 Bacteria 1670
608 Ga0207695_10266080 3300025913 Bacteria 1611
609 Ga0207663_10000017 3300025916 Bacteria 145654
610 Ga0207660_10051507 3300025917 Bacteria 2927
611 Ga0207660_10057403 3300025917 Bacteria 2788
612 Ga0207660_10071756 3300025917 Bacteria 2520
613 Ga0207660_10111115 3300025917 Bacteria 2063
614 Ga0207662_10001582 3300025918 Bacteria 11148
615 Ga0207662_10003401 3300025918 Bacteria 8183
616 Ga0207662_10022645 3300025918 Bacteria 3604
617 Ga0207657_10006664 3300025919 Bacteria 11951
618 Ga0207657_10067071 3300025919 Bacteria 3053
619 Ga0207649_10052175 3300025920 Bacteria 2536
620 Ga0207649_10090297 3300025920 Bacteria 2004
621 Ga0207649_10175712 3300025920 Bacteria 1495
622 Ga0207649_10197291 3300025920 Bacteria 1419
623 Ga0207652_10014267 3300025921 Bacteria 6434
624 Ga0207652_10171519 3300025921 Bacteria 1947
625 Ga0207652_10186904 3300025921 Bacteria 1863
626 Ga0207652_10198088 3300025921 Bacteria 1807
627 Ga0207646_10000400 3300025922 Bacteria 58084
628 Ga0207646_10000801 3300025922 Bacteria 40960
629 Ga0207646_10116073 3300025922 Bacteria 2404
630 Ga0207681_10000315 3300025923 Bacteria 35258
631 Ga0207681_10002837 3300025923 Bacteria 10966
632 Ga0207681_10006093 3300025923 Bacteria 7396
633 Ga0207681_10008989 3300025923 Bacteria 6102
634 Ga0207681_10016410 3300025923 Bacteria 4633
635 Ga0207681_10021025 3300025923 Bacteria 4143
636 Ga0207681_10042735 3300025923 Bacteria 3029
637 Ga0207681_10061138 3300025923 Bacteria 2588
638 Ga0207681_10137941 3300025923 Bacteria 1813
639 Ga0207694_10009664 3300025924 Bacteria 7270
640 Ga0207650_10001649 3300025925 Bacteria 15896
641 Ga0207650_10038085 3300025925 Bacteria 3508
642 Ga0207650_10089593 3300025925 Bacteria 2348
643 Ga0207650_10101156 3300025925 Bacteria 2218
644 Ga0207659_10000076 3300025926 Bacteria 62373
645 Ga0207659_10001426 3300025926 Bacteria 14241
646 Ga0207659_10001726 3300025926 Bacteria 12952
647 Ga0207659_10001830 3300025926 Bacteria 12597
648 Ga0207659_10003364 3300025926 Bacteria 9591
649 Ga0207659_10055289 3300025926 Bacteria 2838
650 Ga0207659_10062162 3300025926 Bacteria 2694
651 Ga0207659_10084529 3300025926 Bacteria 2355
652 Ga0207659_10117700 3300025926 Bacteria 2031
653 Ga0207687_10046812 3300025927 Bacteria 2996
654 Ga0207687_10121323 3300025927 Bacteria 1955
655 Ga0207700_10053462 3300025928 Bacteria 3026
656 Ga0207664_10119175 3300025929 Bacteria 2206
657 Ga0207644_10000485 3300025931 Bacteria 25573
658 Ga0207644_10004067 3300025931 Bacteria 9485
659 Ga0207644_10027107 3300025931 Bacteria 3956
660 Ga0207690_10025745 3300025932 Bacteria 3698
661 Ga0207690_10184452 3300025932 Bacteria 1573
662 Ga0207706_10002610 3300025933 Bacteria 17550
663 Ga0207706_10009806 3300025933 Bacteria 8787
664 Ga0207706_10013693 3300025933 Bacteria 7361
665 Ga0207706_10018234 3300025933 Bacteria 6315
666 Ga0207706_10029383 3300025933 Bacteria 4907
667 Ga0207706_10039016 3300025933 Bacteria 4212
668 Ga0207706_10055474 3300025933 Bacteria 3494
669 Ga0207706_10135755 3300025933 Bacteria 2164
670 Ga0207686_10128298 3300025934 Bacteria 1736
671 Ga0207709_10017122 3300025935 Bacteria 4040
672 Ga0207709_10018785 3300025935 Bacteria 3876
673 Ga0207709_10024069 3300025935 Bacteria 3473
674 Ga0207709_10046837 3300025935 Bacteria 2626
675 Ga0207670_10051802 3300025936 Bacteria 2758
676 Ga0207670_10063216 3300025936 Bacteria 2532
677 Ga0207670_10070850 3300025936 Bacteria 2409
678 Ga0207670_10095177 3300025936 Bacteria 2115
679 Ga0207670_10212999 3300025936 Bacteria 1474
680 Ga0207669_10019434 3300025937 Bacteria 3537
681 Ga0207669_10198810 3300025937 Bacteria 1453
682 Ga0207704_10033108 3300025938 Bacteria 2935
683 Ga0207704_10042299 3300025938 Bacteria 2681
684 Ga0207704_10099216 3300025938 Bacteria 1937
685 Ga0207665_10005573 3300025939 Bacteria 8393
686 Ga0207665_10017374 3300025939 Bacteria 4728
687 Ga0207691_10001612 3300025940 Bacteria 22421
688 Ga0207691_10007302 3300025940 Bacteria 10665
689 Ga0207691_10011138 3300025940 Bacteria 8631
690 Ga0207691_10016959 3300025940 Bacteria 6911
691 Ga0207691_10022003 3300025940 Bacteria 6017
692 Ga0207691_10026485 3300025940 Bacteria 5439
693 Ga0207691_10033850 3300025940 Bacteria 4757
694 Ga0207691_10047127 3300025940 Bacteria 3957
695 Ga0207691_10075799 3300025940 Bacteria 3032
696 Ga0207691_10094511 3300025940 Bacteria 2675
697 Ga0207691_10096844 3300025940 Bacteria 2638
698 Ga0207691_10100147 3300025940 Bacteria 2587
699 Ga0207691_10105868 3300025940 Bacteria 2505
700 Ga0207691_10106389 3300025940 Bacteria 2499
701 Ga0207691_10188302 3300025940 Bacteria 1801
702 Ga0207711_10010963 3300025941 Bacteria 7531
703 Ga0207711_10014618 3300025941 Bacteria 6523
704 Ga0207711_10025788 3300025941 Bacteria 4929
705 Ga0207711_10034774 3300025941 Bacteria 4267
706 Ga0207711_10040252 3300025941 Bacteria 3976
707 Ga0207711_10041583 3300025941 Bacteria 3915
708 Ga0207711_10056886 3300025941 Bacteria 3361
709 Ga0207711_10167324 3300025941 Bacteria 1993
710 Ga0207711_10191118 3300025941 Bacteria 1866
711 Ga0207689_10014461 3300025942 Bacteria 6713
712 Ga0207689_10046922 3300025942 Bacteria 3568
713 Ga0207689_10117260 3300025942 Bacteria 2189
714 Ga0207689_10122307 3300025942 Bacteria 2140
715 Ga0207661_10003131 3300025944 Bacteria 11466
716 Ga0207661_10025526 3300025944 Bacteria 4492
717 Ga0207661_10035737 3300025944 Bacteria 3874
718 Ga0207661_10051968 3300025944 Bacteria 3272
719 Ga0207661_10081352 3300025944 Bacteria 2675
720 Ga0207661_10122362 3300025944 Bacteria 2217
721 Ga0207679_10003204 3300025945 Bacteria 10090
722 Ga0207679_10003415 3300025945 Bacteria 9801
723 Ga0207679_10006342 3300025945 Bacteria 7473
724 Ga0207679_10015783 3300025945 Bacteria 5002
725 Ga0207679_10045134 3300025945 Bacteria 3185
726 Ga0207679_10063272 3300025945 Bacteria 2761
727 Ga0207679_10097456 3300025945 Bacteria 2291
728 Ga0207679_10102068 3300025945 Bacteria 2245
729 Ga0207679_10105661 3300025945 Bacteria 2211
730 Ga0207679_10216683 3300025945 Bacteria 1608
731 Ga0207667_10018041 3300025949 Bacteria 7926
732 Ga0207667_10049057 3300025949 Bacteria 4461
733 Ga0207667_10074332 3300025949 Bacteria 3531
734 Ga0207651_10004772 3300025960 Bacteria 6891
735 Ga0207651_10011179 3300025960 Bacteria 5011
736 Ga0207651_10052108 3300025960 Bacteria 2788
737 Ga0207651_10160726 3300025960 Bacteria 1761
738 Ga0207712_10002949 3300025961 Bacteria 10863
739 Ga0207712_10004752 3300025961 Bacteria 8584
740 Ga0207712_10080863 3300025961 Bacteria 2365
741 Ga0207712_10152887 3300025961 Bacteria 1784
742 Ga0207668_10017130 3300025972 Bacteria 4534
743 Ga0207668_10176784 3300025972 Bacteria 1680
744 Ga0207668_10207885 3300025972 Bacteria 1563
745 Ga0207640_10016650 3300025981 Bacteria 4282
746 Ga0207640_10046083 3300025981 Bacteria 2803
747 Ga0207640_10136389 3300025981 Bacteria 1782
748 Ga0207658_10011211 3300025986 Bacteria 6106
749 Ga0207658_10062486 3300025986 Bacteria 2787
750 Ga0207658_10168498 3300025986 Bacteria 1802
751 Ga0207677_10076952 3300026023 Bacteria 2377
752 Ga0207677_10172310 3300026023 Bacteria 1693
753 Ga0207703_10025435 3300026035 Bacteria 4656
754 Ga0207703_10028156 3300026035 Bacteria 4426
755 Ga0207703_10035383 3300026035 Bacteria 3968
756 Ga0207703_10138710 3300026035 Bacteria 2108
757 Ga0207703_10145358 3300026035 Bacteria 2062
758 Ga0207703_10187697 3300026035 Bacteria 1828
759 Ga0207639_10003395 3300026041 Bacteria 10710
760 Ga0207639_10157608 3300026041 Bacteria 1909
761 Ga0207639_10279369 3300026041 Bacteria 1468
762 Ga0207678_10008895 3300026067 Bacteria 8841
763 Ga0207678_10022903 3300026067 Bacteria 5467
764 Ga0207678_10023382 3300026067 Bacteria 5404
765 Ga0207708_10003536 3300026075 Bacteria 11509
766 Ga0207708_10003617 3300026075 Bacteria 11396
767 Ga0207708_10010005 3300026075 Bacteria 7043
768 Ga0207708_10025892 3300026075 Bacteria 4438
769 Ga0207708_10035282 3300026075 Bacteria 3806
770 Ga0207708_10055002 3300026075 Bacteria 3034
771 Ga0207708_10070903 3300026075 Bacteria 2669
772 Ga0207708_10099773 3300026075 Bacteria 2246
773 Ga0207702_10322766 3300026078 Bacteria 1471
774 Ga0207641_10001113 3300026088 Bacteria 27018
775 Ga0207641_10114243 3300026088 Bacteria 2399
776 Ga0207641_10160020 3300026088 Bacteria 2046
777 Ga0207648_10000280 3300026089 Bacteria 55313
778 Ga0207648_10001579 3300026089 Bacteria 24975
779 Ga0207648_10006656 3300026089 Bacteria 11469
780 Ga0207648_10007517 3300026089 Bacteria 10696
781 Ga0207648_10041218 3300026089 Bacteria 4055
782 Ga0207648_10047619 3300026089 Bacteria 3757
783 Ga0207648_10062065 3300026089 Bacteria 3259
784 Ga0207648_10131360 3300026089 Bacteria 2204
785 Ga0207648_10158532 3300026089 Bacteria 1998
786 Ga0207648_10225875 3300026089 Bacteria 1665
787 Ga0207648_10260806 3300026089 Bacteria 1546
788 Ga0207676_10021525 3300026095 Bacteria 4730
789 Ga0207676_10069611 3300026095 Bacteria 2818
790 Ga0207676_10085050 3300026095 Bacteria 2580
791 Ga0207676_10290579 3300026095 Bacteria 1488
792 Ga0207676_10301347 3300026095 Bacteria 1463
793 Ga0207674_10000975 3300026116 Bacteria 37411
794 Ga0207674_10001029 3300026116 Bacteria 36400
795 Ga0207674_10009475 3300026116 Bacteria 11123
796 Ga0207674_10009866 3300026116 Bacteria 10867
797 Ga0207674_10025524 3300026116 Bacteria 6300
798 Ga0207674_10048267 3300026116 Bacteria 4358
799 Ga0207674_10119857 3300026116 Bacteria 2600
800 Ga0207674_10175598 3300026116 Bacteria 2095
801 Ga0207675_100005112 3300026118 Bacteria 12628
802 Ga0207675_100009300 3300026118 Bacteria 9216
803 Ga0207675_100010828 3300026118 Bacteria 8544
804 Ga0207675_100014801 3300026118 Bacteria 7279
805 Ga0207675_100021208 3300026118 Bacteria 6052
806 Ga0207675_100029674 3300026118 Bacteria 5093
807 Ga0207675_100073355 3300026118 Bacteria 3202
808 Ga0207675_100083061 3300026118 Bacteria 3004
809 Ga0207675_100101515 3300026118 Bacteria 2710
810 Ga0207675_100321976 3300026118 Bacteria 1510
811 Ga0207683_10001056 3300026121 Bacteria 25103
812 Ga0207683_10021790 3300026121 Bacteria 5494
813 Ga0207683_10053680 3300026121 Bacteria 3534
814 Ga0207683_10188916 3300026121 Bacteria 1870
815 Ga0207683_10219553 3300026121 Bacteria 1732
816 Ga0207698_10061373 3300026142 Bacteria 2929
817 Ga0207698_10186040 3300026142 Bacteria 1845
818 Ga0209282_1010364 3300027666 Bacteria 5896
819 Ga0209282_1021345 3300027666 Bacteria 4090
820 Ga0209588_1004742 3300027671 Bacteria 3858
821 Ga0209971_1023508 3300027682 Bacteria 1471
822 Ga0207428_10000481 3300027907 Bacteria 48194
823 Ga0207428_10003460 3300027907 Bacteria 15327
824 Ga0207428_10004078 3300027907 Bacteria 13998
825 Ga0207428_10011888 3300027907 Bacteria 7665
826 Ga0207428_10028879 3300027907 Bacteria 4603
827 Ga0207428_10044629 3300027907 Bacteria 3575
828 Ga0207428_10098452 3300027907 Bacteria 2263
829 Ga0207428_10115910 3300027907 Bacteria 2058
830 Ga0207428_10116968 3300027907 Bacteria 2047
831 Ga0207428_10169805 3300027907 Bacteria 1652
832 Ga0268266_10001913 3300028379 Bacteria 23421
833 Ga0268266_10003647 3300028379 Bacteria 15228
834 Ga0268266_10003719 3300028379 Bacteria 15010
835 Ga0268266_10016423 3300028379 Bacteria 6328
836 Ga0268266_10107527 3300028379 Bacteria 2467
837 Ga0268266_10155753 3300028379 Bacteria 2063
838 Ga0268265_10003942 3300028380 Bacteria 10455
839 Ga0268265_10006108 3300028380 Bacteria 8172
840 Ga0268265_10021735 3300028380 Bacteria 4498
841 Ga0268265_10030986 3300028380 Bacteria 3858
842 Ga0268265_10041011 3300028380 Bacteria 3422
843 Ga0268265_10230255 3300028380 Bacteria 1628
844 Ga0268264_10005498 3300028381 Bacteria 10742
845 Ga0268264_10030911 3300028381 Bacteria 4390
846 Ga0268264_10133223 3300028381 Bacteria 2206
847 Ga0268264_10204038 3300028381 Bacteria 1810
848 Ga0268264_10385130 3300028381 Bacteria 1344
849 Ga0265336_10001220 3300028666 Bacteria 12202
850 Ga0265338_10002329 3300028800 Bacteria 28713
851 Ga0265338_10208561 3300028800 Bacteria 1468
852 Ga0307512_10031809 3300030522 Bacteria 4564
853 Ga0265762_1000437 3300030760 Bacteria 7209
854 Ga0265762_1007655 3300030760 Bacteria 1924
855 Ga0265332_10003975 3300031238 Bacteria 7048
856 Ga0265328_10061315 3300031239 Bacteria 1381
857 Ga0265325_10052379 3300031241 Bacteria 2096
858 Ga0265329_10031629 3300031242 Bacteria 1718
859 Ga0265340_10076292 3300031247 Bacteria 1583
860 Ga0265340_10086162 3300031247 Bacteria 1473
861 Ga0265331_10059940 3300031250 Bacteria 1799
862 Ga0265316_10002852 3300031344 Bacteria 17687
863 Ga0307408_100005731 3300031548 Bacteria 8279
864 Ga0307408_100088843 3300031548 Bacteria 2328
865 Ga0307408_100262374 3300031548 Bacteria 1430
866 Ga0307508_10003585 3300031616 Bacteria 15626
867 Ga0316575_10000078 3300031665 Bacteria 24212
868 Ga0316575_10001173 3300031665 Bacteria 8249
869 Ga0316575_10014940 3300031665 Bacteria 2922
870 Ga0316575_10051213 3300031665 Bacteria 1644
871 Ga0316575_10072183 3300031665 Bacteria 1387
872 Ga0316575_10079148 3300031665 Bacteria 1325
873 Ga0316579_10000340 3300031691 Bacteria 14609
874 Ga0316579_10003231 3300031691 Bacteria 6313
875 Ga0316579_10005032 3300031691 Bacteria 5303
876 Ga0316579_10005489 3300031691 Bacteria 5124
877 Ga0316579_10006783 3300031691 Bacteria 4691
878 Ga0316579_10033573 3300031691 Bacteria 2357
879 Ga0316579_10079800 3300031691 Bacteria 1557
880 Ga0265314_10031752 3300031711 Bacteria 3894
881 Ga0265314_10043744 3300031711 Bacteria 3180
882 Ga0265314_10056375 3300031711 Bacteria 2705
883 Ga0316576_10000061 3300031727 Bacteria 35080
884 Ga0316576_10003527 3300031727 Bacteria 9188
885 Ga0316576_10008317 3300031727 Bacteria 6608
886 Ga0316576_10011247 3300031727 Bacteria 5854
887 Ga0316576_10012299 3300031727 Bacteria 5650
888 Ga0316576_10028153 3300031727 Bacteria 3958
889 Ga0316576_10036520 3300031727 Bacteria 3513
890 Ga0316576_10041041 3300031727 Bacteria 3329
891 Ga0316576_10070111 3300031727 Bacteria 2585
892 Ga0316576_10122277 3300031727 Bacteria 1955
893 Ga0316576_10163406 3300031727 Bacteria 1679
894 Ga0316576_10164384 3300031727 Bacteria 1674
895 Ga0316576_10203708 3300031727 Bacteria 1490
896 Ga0316578_10000292 3300031728 Bacteria 15224
897 Ga0316578_10000778 3300031728 Bacteria 11748
898 Ga0316578_10008143 3300031728 Bacteria 5313
899 Ga0316578_10008169 3300031728 Bacteria 5305
900 Ga0316578_10020051 3300031728 Bacteria 3689
901 Ga0316578_10053385 3300031728 Bacteria 2368
902 Ga0316578_10062956 3300031728 Bacteria 2187
903 Ga0316578_10128903 3300031728 Bacteria 1521
904 Ga0316578_10131423 3300031728 Bacteria 1506
905 Ga0307405_10014290 3300031731 Bacteria 4264
906 Ga0307405_10227356 3300031731 Bacteria 1373
907 Ga0316577_10001299 3300031733 Bacteria 11678
908 Ga0316577_10001513 3300031733 Bacteria 11028
909 Ga0316577_10004481 3300031733 Bacteria 7211
910 Ga0316577_10031830 3300031733 Bacteria 2947
911 Ga0316577_10036514 3300031733 Bacteria 2748
912 Ga0316577_10060081 3300031733 Bacteria 2121
913 Ga0316577_10150845 3300031733 Bacteria 1310
914 Ga0316577_10151652 3300031733 Bacteria 1306
915 Ga0307413_10000731 3300031824 Bacteria 11314
916 Ga0307413_10007133 3300031824 Bacteria 5161
917 Ga0307413_10094788 3300031824 Bacteria 1955
918 Ga0307413_10146291 3300031824 Bacteria 1641
919 Ga0307413_10189666 3300031824 Bacteria 1474
920 Ga0307410_10038888 3300031852 Bacteria 3119
921 Ga0307410_10130009 3300031852 Bacteria 1849
922 Ga0307406_10003599 3300031901 Bacteria 8451
923 Ga0307406_10026366 3300031901 Bacteria 3489
924 Ga0307406_10084724 3300031901 Bacteria 2117
925 Ga0307406_10148358 3300031901 Bacteria 1670
926 Ga0307407_10001825 3300031903 Bacteria 7993
927 Ga0307407_10025974 3300031903 Bacteria 3095
928 Ga0307407_10058651 3300031903 Bacteria 2238
929 Ga0307407_10068791 3300031903 Bacteria 2099
930 Ga0307412_10074102 3300031911 Bacteria 2331
931 Ga0307409_100000298 3300031995 Bacteria 20176
932 Ga0307409_100018484 3300031995 Bacteria 4688
933 Ga0307409_100037951 3300031995 Bacteria 3557
934 Ga0307416_100003790 3300032002 Bacteria 8973
935 Ga0307416_100005453 3300032002 Bacteria 7815
936 Ga0307416_100059749 3300032002 Bacteria 3100
937 Ga0307416_100097779 3300032002 Bacteria 2543
938 Ga0307416_100112146 3300032002 Bacteria 2406
939 Ga0307416_100135170 3300032002 Bacteria 2229
940 Ga0307416_100138140 3300032002 Bacteria 2209
941 Ga0307416_100164693 3300032002 Bacteria 2055
942 Ga0307414_10049440 3300032004 Bacteria 2908
943 Ga0307414_10062914 3300032004 Bacteria 2636
944 Ga0307414_10127806 3300032004 Bacteria 1967
945 Ga0307414_10179906 3300032004 Bacteria 1700
946 Ga0307414_10381188 3300032004 Bacteria 1219
947 Ga0307411_10001022 3300032005 Bacteria 10794
948 Ga0307411_10005511 3300032005 Bacteria 6227
949 Ga0307411_10043083 3300032005 Bacteria 2886
950 Ga0307411_10085688 3300032005 Bacteria 2183
951 Ga0307411_10103351 3300032005 Bacteria 2021
952 Ga0307411_10213397 3300032005 Bacteria 1492
953 Ga0307411_10303241 3300032005 Bacteria 1282
954 Ga0307415_100006479 3300032126 Bacteria 6321
955 Ga0307415_100072204 3300032126 Bacteria 2430
956 Ga0307415_100086415 3300032126 Bacteria 2257
957 Ga0307415_100173563 3300032126 Bacteria 1684
958 Ga0307415_100206719 3300032126 Bacteria 1562
959 Ga0316583_10000460 3300032133 Bacteria 12044
960 Ga0316583_10001203 3300032133 Bacteria 8499
961 Ga0316583_10001572 3300032133 Bacteria 7693
962 Ga0316583_10003648 3300032133 Bacteria 5439
963 Ga0316583_10006388 3300032133 Bacteria 4232
964 Ga0316583_10007565 3300032133 Bacteria 3912
965 Ga0316583_10021861 3300032133 Bacteria 2292
966 Ga0316585_10000766 3300032137 Bacteria 8119
967 Ga0316585_10001080 3300032137 Bacteria 7083
968 Ga0316585_10032763 3300032137 Bacteria 1637
969 Ga0316580_10000032 3300032139 Bacteria 22250
970 Ga0316580_10000340 3300032139 Bacteria 10266
971 Ga0316580_10004339 3300032139 Bacteria 4108
972 Ga0316593_10000188 3300032168 Bacteria 9420
973 Ga0316593_10009664 3300032168 Bacteria 2735
974 Ga0316593_10011908 3300032168 Bacteria 2540
975 Ga0307510_10126809 3300033180 Bacteria 2239
976 Ga0316592_1000517 3300033524 Bacteria 5419
977 Ga0316592_1001809 3300033524 Bacteria 3563
978 Ga0316588_1000700 3300033528 Bacteria 4910
979 Ga0316596_1000885 3300033541 Bacteria 5643
980 Ga0316596_1002003 3300033541 Bacteria 4276
981 Ga0316212_1003380 3300033547 Bacteria 2302
982 Ga0373926_0009080 3300035083 Bacteria 3318
983 Ga0373926_0017251 3300035083 Bacteria 2477
984 Ga0373923_0005050 3300035111 Bacteria 4445
985 Ga0373923_0130913 3300035111 Bacteria 1127
986 Ga0373941_0049264 3300035115 Bacteria 1333
987 Ga0373943_0030823 3300035170 Bacteria 2541
988 Ga0373961_0042102 3300035241 Bacteria 1323
989 Ga0373962_0058409 3300035242 Bacteria 1128
990 Ga0316574_0000054 3300035398 Bacteria 29440
991 Ga0316574_0000651 3300035398 Bacteria 14575
992 Ga0316574_0003136 3300035398 Bacteria 8452
993 Ga0316574_0036435 3300035398 Bacteria 3012
994 Ga0316574_0054359 3300035398 Bacteria 2501
995 Ga0316574_0060347 3300035398 Bacteria 2380
996 Ga0316574_0098667 3300035398 Bacteria 1868
997 Ga0316574_0103393 3300035398 Bacteria 1824
998 Ga0316574_0194220 3300035398 Bacteria 1305
999 Ga0373931_0033246 3300035691 Bacteria 2672
1000 Ga0373935_0007047 3300035692 Bacteria 6711
1001 Ga0373935_0008647 3300035692 Bacteria 6097
1002 Ga0373927_0011017 3300035695 Bacteria 6022
1003 Ga0373933_0089214 3300035724 Bacteria 1900
1004 Ga0373947_0051242 3300035725 Bacteria 2483
1005 Ga0373947_0216750 3300035725 Bacteria 1257
1006 Ga0373937_0002679 3300036401 Bacteria 14848
1007 Ga0373937_0025464 3300036401 Bacteria 5341
1008 Ga0373937_0252653 3300036401 Bacteria 1662
1009 Ga0316582_0000201 3300036647 Bacteria 19076
1010 Ga0316582_0000608 3300036647 Bacteria 13911
1011 Ga0316582_0003179 3300036647 Bacteria 7974
1012 Ga0316582_0005804 3300036647 Bacteria 6410
1013 Ga0316582_0020480 3300036647 Bacteria 3889
1014 Ga0316582_0039799 3300036647 Bacteria 2929
1015 Ga0316582_0059135 3300036647 Bacteria 2453
1016 Ga0316582_0060613 3300036647 Unclassified 2426
1017 Ga0316582_0073934 3300036647 Bacteria 2212
1018 Ga0316582_0192018 3300036647 Bacteria 1391
1019 Ga0316584_0001889 3300036712 Bacteria 13009
1020 Ga0316584_0009581 3300036712 Bacteria 6731
1021 Ga0316584_0019571 3300036712 Bacteria 4895
1022 Ga0316584_0044299 3300036712 Bacteria 3318
1023 Ga0316584_0054994 3300036712 Bacteria 2981
1024 Ga0316584_0069183 3300036712 Bacteria 2646
1025 Ga0316584_0090014 3300036712 Bacteria 2297
1026 Ga0316584_0094890 3300036712 Bacteria 2233
1027 Ga0316584_0209905 3300036712 Bacteria 1433
1028 Ga0316584_0224544 3300036712 Bacteria 1378
1029 Ga0316584_0318816 3300036712 Bacteria 1122
1030 Ga0373925_0004509 3300037068 Bacteria 10522
1031 Ga0373925_0196397 3300037068 Bacteria 1603
1032 Ga0373925_0245972 3300037068 Bacteria 1434
1033 Ga0316581_0001143 3300037588 Bacteria 5792
1034 Ga0316581_0017783 3300037588 Bacteria 2056
1035 Ga0436364_0778749 3300037853 Bacteria 6892
1036 Ga0400484_29778 3300038725 Bacteria 7394
1037 Ga0400490_53112 3300038726 Bacteria 2341
1038 Ga0400485_18502 3300038735 Bacteria 7137
1039 Ga0400488_23036 3300038741 Bacteria 17387
1040 Ga0400483_252454 3300039062 Bacteria 4429
1041 Ga0400483_263366 3300039062 Bacteria 2561
1042 Ga0400483_263582 3300039062 Bacteria 18241
1043 Ga0400489_36202 3300039093 Bacteria 8162
1044 Ga0400489_39387 3300039093 Bacteria 5543
1045 Ga0400489_57552 3300039093 Bacteria 3673
1046 Ga0400489_66845 3300039093 Bacteria 7637
1047 Ga0400489_67086 3300039093 Bacteria 4897
1048 Ga0400489_87056 3300039093 Bacteria 68318
1049 Ga0436360_0776135 3300039438 Bacteria 3668
1050 Ga0436361_0217784 3300039447 Bacteria 23941
1051 Ga0450920_004909 3300042122 Bacteria 2364
1052 Ga0450898_004430 3300042134 Bacteria 2077
1053 Ga0439446_0018003 3300042156 Bacteria 1975
1054 Ga0451577_0000016 3300042876 Bacteria 531002
1055 Ga0451577_0000063 3300042876 Bacteria 264379
1056 Ga0451577_0003032 3300042876 Bacteria 19100
1057 Ga0451577_0007108 3300042876 Bacteria 11036
1058 Ga0451577_0008586 3300042876 Bacteria 9932
1059 Ga0451577_0011583 3300042876 Bacteria 8333
1060 Ga0451577_0011723 3300042876 Bacteria 8275
1061 Ga0451577_0013346 3300042876 Bacteria 7694
1062 Ga0451577_0020077 3300042876 Bacteria 6136
1063 Ga0451577_0023963 3300042876 Bacteria 5558
1064 Ga0451577_0031730 3300042876 Bacteria 4766
1065 Ga0451577_0032839 3300042876 Bacteria 4678
1066 Ga0451577_0154283 3300042876 Bacteria 2066
1067 Ga0451577_0389889 3300042876 Bacteria 1264
1068 Ga0466969_0000017 3300044656 Bacteria 103792
1069 Ga0466969_0005938 3300044656 Bacteria 6495
1070 Ga0453683_0000354 3300044673 Bacteria 55512
1071 Ga0453683_0001401 3300044673 Bacteria 20945
1072 Ga0453683_0002141 3300044673 Bacteria 15739
1073 Ga0453683_0006715 3300044673 Bacteria 7867
1074 Ga0453683_0007197 3300044673 Bacteria 7585
1075 Ga0453683_0008162 3300044673 Bacteria 7044
1076 Ga0453683_0075195 3300044673 Bacteria 2115
1077 Ga0466965_0021284 3300044683 Bacteria 3120
1078 Ga0466965_0124092 3300044683 Bacteria 1335
1079 Ga0466966_0009159 3300044684 Bacteria 6554
1080 Ga0466966_0025665 3300044684 Bacteria 3848
1081 Ga0466966_0104119 3300044684 Bacteria 1753
1082 Ga0466961_0000675 3300044693 Bacteria 21455
1083 Ga0453684_0000198 3300044712 Bacteria 264379
1084 Ga0453684_0001021 3300044712 Bacteria 89961
1085 Ga0453684_0003669 3300044712 Bacteria 34062
1086 Ga0453684_0005793 3300044712 Bacteria 24103
1087 Ga0453684_0005848 3300044712 Bacteria 23915
1088 Ga0453684_0008716 3300044712 Bacteria 18032
1089 Ga0453684_0011440 3300044712 Bacteria 14883
1090 Ga0453684_0016406 3300044712 Bacteria 11582
1091 Ga0453684_0019113 3300044712 Bacteria 10457
1092 Ga0453684_0025076 3300044712 Bacteria 8676
1093 Ga0453684_0028918 3300044712 Bacteria 7889
1094 Ga0453684_0034553 3300044712 Bacteria 7013
1095 Ga0453684_0038822 3300044712 Bacteria 6498
1096 Ga0453684_0047025 3300044712 Bacteria 5728
1097 Ga0453684_0047870 3300044712 Bacteria 5663
1098 Ga0453684_0073014 3300044712 Bacteria 4328
1099 Ga0453684_0093505 3300044712 Bacteria 3703
1100 Ga0453684_0101809 3300044712 Bacteria 3513
1101 Ga0453684_0165800 3300044712 Bacteria 2608
1102 Ga0453684_0225614 3300044712 Bacteria 2166
1103 Ga0453684_0462321 3300044712 Bacteria 1411
1104 Ga0466957_0064618 3300044842 Bacteria 2251
1105 Ga0466959_0000285 3300045049 Bacteria 30873
1106 Ga0451576_0002045 3300045051 Bacteria 31760
1107 Ga0451576_0007793 3300045051 Bacteria 12703
1108 Ga0451576_0017896 3300045051 Bacteria 7781
1109 Ga0451576_0020522 3300045051 Bacteria 7192
1110 Ga0451576_0021366 3300045051 Bacteria 7033
1111 Ga0451576_0037518 3300045051 Bacteria 5132
1112 Ga0451576_0114907 3300045051 Bacteria 2802
1113 Ga0451576_0124785 3300045051 Bacteria 2682
1114 Ga0451576_0178868 3300045051 Bacteria 2215
1115 Ga0451576_0189302 3300045051 Bacteria 2149
1116 Ga0451576_0197660 3300045051 Bacteria 2101
1117 Ga0451576_0433872 3300045051 Bacteria 1379
1118 Ga0451576_0585453 3300045051 Bacteria 1173
1119 Ga0466958_0018991 3300045836 Bacteria 3996
1120 Ga0466967_0083639 3300045976 Bacteria 2886
1121 Ga0495592_0034869 3300046454 Bacteria 3792
1122 Ga0495592_0062440 3300046454 Bacteria 2735
1123 Ga0495592_0084555 3300046454 Bacteria 2289
1124 Ga0495629_0004932 3300046459 Bacteria 10015
1125 Ga0495641_0012535 3300046461 Bacteria 4731
1126 Ga0495651_0000624 3300046462 Bacteria 27410
1127 Ga0495651_0005231 3300046462 Bacteria 9890
1128 Ga0495651_0009328 3300046462 Bacteria 7531
1129 Ga0495651_0025107 3300046462 Bacteria 4637
1130 Ga0495653_0003358 3300046463 Bacteria 12864
1131 Ga0495653_0102126 3300046463 Bacteria 2076
1132 Ga0495650_0000009 3300046471 Bacteria 653845
1133 Ga0495650_0010284 3300046471 Bacteria 5232
1134 Ga0495580_0007760 3300046472 Bacteria 8598
1135 Ga0495580_0010241 3300046472 Bacteria 7312
1136 Ga0495580_0012295 3300046472 Bacteria 6571
1137 Ga0495580_0105779 3300046472 Bacteria 1955
1138 Ga0495580_0136835 3300046472 Bacteria 1698
1139 Ga0495582_0000160 3300046473 Bacteria 36317
1140 Ga0495582_0061652 3300046473 Bacteria 2071
1141 Ga0495582_0075068 3300046473 Bacteria 1872
1142 Ga0495582_0126001 3300046473 Bacteria 1445
1143 Ga0495664_0009041 3300046477 Bacteria 5570
1144 Ga0495664_0029121 3300046477 Bacteria 3227
1145 Ga0495664_0053062 3300046477 Bacteria 2411
1146 Ga0495585_0023681 3300046492 Bacteria 3523
1147 Ga0495594_0001740 3300046499 Bacteria 11269
1148 Ga0495594_0003599 3300046499 Bacteria 7965
1149 Ga0495594_0011490 3300046499 Bacteria 4604
1150 Ga0495594_0040863 3300046499 Bacteria 2539
1151 Ga0495583_0010608 3300046506 Bacteria 5359
1152 Ga0495606_0080712 3300046507 Bacteria 2023
1153 Ga0495608_0005595 3300046511 Bacteria 8974
1154 Ga0495608_0073549 3300046511 Bacteria 2228
1155 Ga0495608_0114666 3300046511 Bacteria 1730
1156 Ga0495628_0000100 3300046516 Bacteria 68834
1157 Ga0495628_0003895 3300046516 Bacteria 13304
1158 Ga0495628_0073629 3300046516 Bacteria 2661
1159 Ga0495628_0189176 3300046516 Bacteria 1555
1160 Ga0495630_0002788 3300046517 Bacteria 12127
1161 Ga0495630_0015574 3300046517 Bacteria 5554
1162 Ga0495643_0000203 3300046522 Bacteria 92549
1163 Ga0495643_0078798 3300046522 Bacteria 1719
1164 Ga0495644_0003693 3300046523 Bacteria 6024
1165 Ga0495648_0072663 3300046524 Bacteria 1990
1166 Ga0495666_0008923 3300046526 Bacteria 5019
1167 Ga0495666_0021255 3300046526 Bacteria 3212
1168 Ga0495642_0017177 3300046528 Bacteria 2826
1169 Ga0495642_0053101 3300046528 Bacteria 1669
1170 Ga0495652_0007450 3300046529 Bacteria 10087
1171 Ga0495652_0027682 3300046529 Bacteria 4993
1172 Ga0495652_0047638 3300046529 Bacteria 3675
1173 Ga0495652_0251206 3300046529 Bacteria 1310
1174 Ga0495665_0011377 3300046531 Bacteria 4816
1175 Ga0495665_0032663 3300046531 Bacteria 2784
1176 Ga0495665_0070927 3300046531 Bacteria 1836
1177 Ga0495586_0002638 3300046535 Bacteria 9700
1178 Ga0495586_0024319 3300046535 Bacteria 3238
1179 Ga0495586_0143004 3300046535 Bacteria 1343
1180 Ga0495587_0004941 3300046536 Bacteria 8740
1181 Ga0495587_0125409 3300046536 Bacteria 1469
1182 Ga0495598_0038413 3300046537 Bacteria 1386
1183 Ga0495621_0003001 3300046539 Bacteria 4601
1184 Ga0495621_0017025 3300046539 Bacteria 2342
1185 Ga0495645_0002684 3300046543 Bacteria 12075
1186 Ga0495645_0005674 3300046543 Bacteria 8591
1187 Ga0495645_0008111 3300046543 Bacteria 7320
1188 Ga0495645_0083449 3300046543 Bacteria 2290
1189 Ga0495633_0016768 3300046558 Bacteria 3766
1190 Ga0495633_0054740 3300046558 Bacteria 1877
1191 Ga0495633_0061375 3300046558 Bacteria 1760
1192 Ga0495633_0080582 3300046558 Bacteria 1515
1193 Ga0495667_0034067 3300046559 Bacteria 3405
1194 Ga0495667_0044908 3300046559 Bacteria 2926
1195 Ga0495667_0132793 3300046559 Bacteria 1606
1196 Ga0495667_0224295 3300046559 Bacteria 1199
1197 Ga0495668_0064299 3300046616 Bacteria 2020
1198 Ga0495634_0001889 3300046642 Bacteria 17989
1199 Ga0495634_0007610 3300046642 Bacteria 8116
1200 Ga0495625_0000174 3300046660 Bacteria 100401
1201 Ga0495625_0070003 3300046660 Bacteria 2464
1202 Ga0495635_0021952 3300046663 Bacteria 4448
1203 Ga0495635_0036139 3300046663 Bacteria 3425
1204 Ga0495588_0003610 3300046674 Bacteria 6763
1205 Ga0495657_0019947 3300046675 Bacteria 4830
1206 Ga0495657_0147579 3300046675 Bacteria 1462
1207 Ga0495599_0004610 3300046678 Bacteria 8172
1208 Ga0495623_0023862 3300046679 Bacteria 3946
1209 Ga0495646_0007910 3300046680 Bacteria 6752
1210 Ga0495658_0016514 3300046683 Bacteria 3800
1211 Ga0495658_0016706 3300046683 Bacteria 3779
1212 Ga0495658_0122720 3300046683 Bacteria 1573
1213 Ga0495669_0001130 3300046684 Bacteria 11047
1214 Ga0495669_0010879 3300046684 Bacteria 3851
1215 Ga0495613_0012126 3300046689 Bacteria 6406
1216 Ga0495613_0024977 3300046689 Bacteria 4453
1217 Ga0495613_0074258 3300046689 Bacteria 2476
1218 Ga0495624_0009364 3300046690 Bacteria 6784
1219 Ga0495649_0029029 3300046694 Bacteria 3064
1220 Ga0495649_0120856 3300046694 Bacteria 1385
1221 Ga0495600_0001186 3300046809 Bacteria 14261
1222 Ga0495600_0058644 3300046809 Bacteria 2514
1223 Ga0495581_0009729 3300047315 Bacteria 5563
1224 Ga0495604_0000537 3300047317 Bacteria 33451
1225 Ga0495604_0002227 3300047317 Bacteria 15528
1226 Ga0495604_0002867 3300047317 Bacteria 13826
1227 Ga0495604_0014776 3300047317 Bacteria 6225
1228 Ga0495604_0016954 3300047317 Bacteria 5825
1229 Ga0495636_0018647 3300047318 Bacteria 2784
1230 Ga0495674_0001372 3300047319 Bacteria 23745
1231 Ga0495674_0016950 3300047319 Bacteria 6791
1232 Ga0495674_0068815 3300047319 Bacteria 3063
1233 Ga0495676_0003364 3300047321 Bacteria 14460
1234 Ga0495676_0017461 3300047321 Bacteria 6344
1235 Ga0495680_0000436 3300047322 Bacteria 46842
1236 Ga0495680_0001290 3300047322 Bacteria 27330
1237 Ga0495680_0009994 3300047322 Bacteria 8492
1238 Ga0495680_0039057 3300047322 Bacteria 3789
1239 Ga0495680_0169968 3300047322 Bacteria 1579
1240 Ga0495675_0000566 3300047444 Bacteria 23905
1241 Ga0495675_0010096 3300047444 Bacteria 5891
1242 Ga0495675_0010601 3300047444 Bacteria 5761
1243 Ga0495675_0046538 3300047444 Bacteria 2761
1244 Ga0495677_0032944 3300047445 Bacteria 1888
1245 Ga0495685_010344 3300047447 Bacteria 3126
1246 Ga0495681_0003767 3300047470 Bacteria 10514
1247 Ga0495684_0002380 3300047471 Bacteria 15034
1248 Ga0495684_0030918 3300047471 Bacteria 4111
1249 Ga0495684_0052887 3300047471 Bacteria 3099
1250 Ga0495593_0057144 3300047673 Bacteria 2049
1251 Ga0495602_0013208 3300048088 Bacteria 8447
1252 Ga0495614_0002691 3300048089 Bacteria 7902
1253 Ga0495614_0023386 3300048089 Bacteria 2666
1254 Ga0496100_0166956 3300048903 Bacteria 1582
1255 Ga0496100_0218333 3300048903 Bacteria 1398
1256 Ga0496101_0130692 3300048904 Bacteria 1907
1257 Ga0496101_0153434 3300048904 Bacteria 1763
1258 Ga0496101_0189405 3300048904 Bacteria 1587
1259 Ga0496102_0001797 3300048905 Bacteria 18579
1260 Ga0496102_0010259 3300048905 Bacteria 8055
1261 Ga0496102_0115018 3300048905 Bacteria 2510
1262 Ga0496104_0003519 3300048907 Bacteria 13506
1263 Ga0496104_0032813 3300048907 Bacteria 4833
1264 Ga0496104_0144865 3300048907 Bacteria 2281
1265 Ga0496104_0149680 3300048907 Bacteria 2241
1266 Ga0496104_0176149 3300048907 Bacteria 2049
1267 Ga0496105_0060874 3300048908 Bacteria 3115
1268 Ga0496106_0056076 3300048909 Bacteria 2979
1269 Ga0496106_0147709 3300048909 Bacteria 1853
1270 Ga0496107_0365092 3300048910 Bacteria 1074
1271 Ga0496108_0003906 3300048911 Bacteria 11971
1272 Ga0496108_0040415 3300048911 Bacteria 3888
1273 Ga0496108_0181674 3300048911 Bacteria 1822
1274 Ga0496109_0014286 3300048912 Bacteria 6909
1275 Ga0496109_0030192 3300048912 Bacteria 4859
1276 Ga0496109_0119903 3300048912 Bacteria 2450
1277 Ga0496110_0000897 3300048913 Bacteria 20981
1278 Ga0496110_0064141 3300048913 Bacteria 3246
1279 Ga0496110_0177063 3300048913 Bacteria 1936
1280 Ga0496111_0006350 3300048914 Bacteria 7668
1281 Ga0496112_0001650 3300048915 Bacteria 17325
1282 Ga0496112_0033130 3300048915 Bacteria 5020
1283 Ga0496112_0036483 3300048915 Bacteria 4796
1284 Ga0496112_0040595 3300048915 Bacteria 4550
1285 Ga0496113_0006167 3300048916 Bacteria 7567
1286 Ga0496113_0023536 3300048916 Bacteria 4367
1287 Ga0496113_0141040 3300048916 Bacteria 1896
1288 Ga0496114_0279364 3300048917 Bacteria 1472
1289 Ga0496115_0046082 3300048918 Bacteria 3483
1290 Ga0496115_0058899 3300048918 Bacteria 3092
1291 Ga0496115_0084681 3300048918 Bacteria 2585
1292 Ga0496116_0000057 3300048919 Bacteria 281652
1293 Ga0496116_0033391 3300048919 Bacteria 3652
1294 Ga0496117_0000031 3300048920 Bacteria 381048
1295 Ga0496117_0000035 3300048920 Bacteria 326449
1296 Ga0496118_0000054 3300048921 Bacteria 233617
1297 Ga0496118_0000208 3300048921 Bacteria 102645
1298 Ga0496118_0021158 3300048921 Bacteria 5736
1299 Ga0496118_0095560 3300048921 Bacteria 2028
1300 Ga0496119_0001742 3300048922 Bacteria 25363
1301 Ga0496120_0001350 3300048923 Bacteria 30183
1302 Ga0496120_0005474 3300048923 Bacteria 10117
1303 Ga0496120_0117392 3300048923 Bacteria 1380
1304 Ga0496121_0004095 3300048924 Bacteria 20003
1305 Ga0496121_0011702 3300048924 Bacteria 9688
1306 Ga0496122_0000023 3300048925 Bacteria 381035
1307 Ga0496122_0004894 3300048925 Bacteria 16255
1308 Ga0496123_0000027 3300048926 Bacteria 306773
1309 Ga0496123_0018182 3300048926 Bacteria 5607
1310 Ga0496125_0001899 3300048928 Bacteria 28609
1311 Ga0496125_0047340 3300048928 Bacteria 3598
1312 Ga0496125_0082673 3300048928 Bacteria 2446
1313 Ga0496126_0001469 3300048929 Bacteria 36677
1314 Ga0496126_0001514 3300048929 Bacteria 35896
1315 Ga0496126_0008444 3300048929 Bacteria 11111
1316 Ga0496126_0154782 3300048929 Bacteria 1962
1317 Ga0495682_0038985 3300049460 Bacteria 1745
1318 Ga0495682_0041426 3300049460 Bacteria 1688
1319 Ga0501031_0183289 3300049568 Bacteria 1367
1320 Ga0501032_0004235 3300049569 Bacteria 10847
1321 Ga0501033_0004380 3300049570 Bacteria 11315
1322 Ga0501033_0005550 3300049570 Bacteria 9975
1323 Ga0501034_0002524 3300049571 Bacteria 21942
1324 Ga0501034_0011934 3300049571 Bacteria 8982
1325 Ga0501034_0012973 3300049571 Bacteria 8590
1326 Ga0501034_0018184 3300049571 Bacteria 7210
1327 Ga0501034_0151613 3300049571 Bacteria 2294
1328 Ga0501036_0000952 3300049572 Bacteria 21786
1329 Ga0501036_0136224 3300049572 Bacteria 2073
1330 Ga0501037_0002978 3300049573 Bacteria 12299
1331 Ga0501038_0000048 3300049574 Bacteria 104260
1332 Ga0501038_0000619 3300049574 Bacteria 31649
1333 Ga0501039_0010233 3300049575 Bacteria 7147
1334 Ga0501039_0036795 3300049575 Bacteria 3777
1335 Ga0501040_0140012 3300049576 Bacteria 1704
1336 Ga0501041_0028234 3300049577 Bacteria 3384
1337 Ga0501042_0115466 3300049578 Bacteria 1933
1338 Ga0501043_0000347 3300049579 Bacteria 42083
1339 Ga0501046_0003161 3300049580 Bacteria 15206
1340 Ga0501047_0000261 3300049581 Bacteria 61793
1341 Ga0501047_0005907 3300049581 Bacteria 11516
1342 Ga0501067_0037067 3300049583 Bacteria 2708
1343 Ga0501067_0049168 3300049583 Bacteria 2337
1344 Ga0501069_0106418 3300049585 Bacteria 1595
1345 Ga0501070_0002167 3300049586 Bacteria 17251
1346 Ga0501071_0058442 3300049587 Bacteria 2789
1347 Ga0501072_0252753 3300049588 Bacteria 1403
1348 Ga0501072_0410288 3300049588 Bacteria 1074
1349 Ga0501074_0006292 3300049590 Bacteria 8574
1350 Ga0501075_0032307 3300049591 Bacteria 3888
1351 Ga0501075_0045154 3300049591 Bacteria 3306
1352 Ga0501075_0242211 3300049591 Bacteria 1375
1353 Ga0501075_0334845 3300049591 Bacteria 1153
1354 Ga0501076_0013524 3300049592 Bacteria 6119
1355 Ga0501076_0106789 3300049592 Bacteria 2260
1356 Ga0501079_0040224 3300049741 Bacteria 3606
1357 Ga0501079_0078780 3300049741 Bacteria 2549
1358 Ga0501080_0024570 3300049742 Bacteria 5587
1359 Ga0501080_0303533 3300049742 Bacteria 1447
1360 Ga0501081_0100733 3300049743 Bacteria 2042
1361 Ga0501035_0003457 3300049822 Bacteria 15115
1362 Ga0501035_0057137 3300049822 Bacteria 3479
1363 Ga0501044_0028927 3300049823 Bacteria 5844
1364 Ga0501044_0222462 3300049823 Bacteria 1838
1365 Ga0501045_0035593 3300049824 Bacteria 3615
1366 Ga0501045_0215627 3300049824 Bacteria 1429
1367 nmdc:mga03n38_32661_c1 3300050490 Bacteria 2208
1368 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
1369 nmdc:mga00v17_25504_c1 3300050491 Bacteria 3437
1370 nmdc:mga00v17_35588_c1 3300050491 Bacteria 2964
1371 nmdc:mga06z11_28285_c1 3300050494 Bacteria 2689
1372 nmdc:mga05p37_107661_c1 3300050507 Bacteria 2735
1373 nmdc:mga05p37_1139_c1 3300050507 Bacteria 30539
1374 nmdc:mga05p37_17501_c1 3300050507 Bacteria 8651
1375 nmdc:mga05p37_190031_c1 3300050507 Bacteria 2494
1376 nmdc:mga05p37_21578_c1 3300050507 Bacteria 7803
1377 nmdc:mga05p37_251652_c1 3300050507 Bacteria 2119
1378 nmdc:mga05p37_30845_c1 3300050507 Bacteria 6543
1379 nmdc:mga05p37_32441_c1 3300050507 Bacteria 6386
1380 nmdc:mga05p37_339387_c1 3300050507 Bacteria 1772
1381 nmdc:mga05p37_366500_c1 3300050507 Bacteria 1692
1382 nmdc:mga05p37_49_c1 3300050507 Bacteria 103776
1383 nmdc:mga05p37_51401_c1 3300050507 Bacteria 5068
1384 nmdc:mga05p37_66571_c1 3300050507 Bacteria 4431
1385 nmdc:mga05p37_69457_c1 3300050507 Bacteria 4333
1386 nmdc:mga05p37_70509_c1 3300050507 Bacteria 4298
1387 nmdc:mga05p37_9401_c1 3300050507 Bacteria 11570
1388 nmdc:mga05p37_94802_c1 3300050507 Bacteria 3677
1389 nmdc:mga09592_20042_c1 3300050508 Bacteria 5495
1390 nmdc:mga09592_2435_c1 3300050508 Bacteria 15016
1391 nmdc:mga09592_2888_c1 3300050508 Bacteria 13923
1392 nmdc:mga09592_29650_c1 3300050508 Bacteria 4549
1393 nmdc:mga09592_55716_c1 3300050508 Bacteria 3341
1394 nmdc:mga09592_6952_c1 3300050508 Bacteria 9200
1395 nmdc:mga09592_98582_c1 3300050508 Bacteria 2502
1396 nmdc:mga0qj67_100449_c1 3300050509 Bacteria 2332
1397 nmdc:mga0qj67_100594_c1 3300050509 Bacteria 2330
1398 nmdc:mga0qj67_119430_c1 3300050509 Bacteria 2132
1399 nmdc:mga0qj67_12577_c1 3300050509 Bacteria 6379
1400 nmdc:mga0qj67_16204_c1 3300050509 Bacteria 5648
1401 nmdc:mga0qj67_17549_c1 3300050509 Bacteria 5443
1402 nmdc:mga0qj67_290316_c1 3300050509 Bacteria 1325
1403 nmdc:mga0qj67_364633_c1 3300050509 Bacteria 1167
1404 nmdc:mga0qj67_5724_c1 3300050509 Bacteria 9094
1405 nmdc:mga06r32_144929_c1 3300050510 Bacteria 2352
1406 nmdc:mga06r32_15361_c1 3300050510 Bacteria 6954
1407 nmdc:mga06r32_165272_c1 3300050510 Bacteria 2196
1408 nmdc:mga06r32_17242_c1 3300050510 Bacteria 6591
1409 nmdc:mga06r32_247802_c1 3300050510 Bacteria 1769
1410 nmdc:mga06r32_31766_c1 3300050510 Bacteria 4962
1411 nmdc:mga06r32_329327_c1 3300050510 Bacteria 1512
1412 nmdc:mga06r32_37338_c1 3300050510 Bacteria 4596
1413 nmdc:mga06r32_3800_c2 3300050510 Bacteria 9293
1414 nmdc:mga06r32_67414_c1 3300050510 Bacteria 3455
1415 nmdc:mga06r32_86053_c1 3300050510 Bacteria 3066
1416 nmdc:mga08y16_11854_c1 3300050511 Bacteria 9158
1417 nmdc:mga08y16_122744_c1 3300050511 Bacteria 2703
1418 nmdc:mga08y16_128252_c1 3300050511 Bacteria 2639
1419 nmdc:mga08y16_17132_c1 3300050511 Bacteria 7628
1420 nmdc:mga08y16_180840_c1 3300050511 Bacteria 2190
1421 nmdc:mga08y16_22046_c1 3300050511 Bacteria 6726
1422 nmdc:mga08y16_293641_c1 3300050511 Bacteria 1676
1423 nmdc:mga08y16_32274_c1 3300050511 Bacteria 5507
1424 nmdc:mga08y16_32278_c1 3300050511 Bacteria 5506
1425 nmdc:mga08y16_48167_c1 3300050511 Bacteria 4460
1426 nmdc:mga08y16_50488_c1 3300050511 Bacteria 4353
1427 nmdc:mga08y16_60740_c1 3300050511 Bacteria 3947
1428 nmdc:mga08y16_67595_c1 3300050511 Bacteria 3727
1429 nmdc:mga08y16_9318_c1 3300050511 Bacteria 10297
1430 nmdc:mga0n895_1022_c1 3300050512 Bacteria 20347
1431 nmdc:mga0n895_11825_c1 3300050512 Bacteria 7805
1432 nmdc:mga0n895_121269_c1 3300050512 Bacteria 2636
1433 nmdc:mga0n895_13179_c1 3300050512 Bacteria 7447
1434 nmdc:mga0n895_138408_c1 3300050512 Bacteria 2462
1435 nmdc:mga0n895_14065_c1 3300050512 Bacteria 7253
1436 nmdc:mga0n895_208456_c1 3300050512 Bacteria 1985
1437 nmdc:mga0n895_39050_c1 3300050512 Bacteria 4603
1438 nmdc:mga0n895_436004_c1 3300050512 Bacteria 1324
1439 nmdc:mga0n895_6911_c1 3300050512 Bacteria 9695
1440 nmdc:mga0n895_81867_c1 3300050512 Bacteria 3217
1441 nmdc:mga0n895_844_c1 3300050512 Bacteria 21996
1442 nmdc:mga0rr50_11399_c1 3300050513 Bacteria 5690
1443 nmdc:mga0rr50_12325_c1 3300050513 Bacteria 5521
1444 nmdc:mga0rr50_16343_c1 3300050513 Bacteria 4926
1445 nmdc:mga0rr50_198028_c1 3300050513 Bacteria 1650
1446 nmdc:mga0rr50_2107_c1 3300050513 Bacteria 11118
1447 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
1448 nmdc:mga0rr50_266194_c1 3300050513 Bacteria 1427
1449 nmdc:mga0rr50_29045_c1 3300050513 Bacteria 3894
1450 nmdc:mga0rr50_356_c1 3300050513 Bacteria 24892
1451 nmdc:mga08x19_103868_c1 3300050514 Bacteria 1888
1452 nmdc:mga08x19_131950_c1 3300050514 Bacteria 1681
1453 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
1454 nmdc:mga08x19_25_c1 3300050514 Bacteria 222966
1455 nmdc:mga08x19_4977_c1 3300050514 Bacteria 7856
1456 nmdc:mga08x19_577_c1 3300050514 Bacteria 7744
1457 nmdc:mga08x19_5806_c1 3300050514 Bacteria 7298
1458 nmdc:mga08x19_646_c1 3300050514 Bacteria 22496
1459 nmdc:mga0a205_137723_c1 3300050515 Bacteria 2341
1460 nmdc:mga0a205_16866_c1 3300050515 Bacteria 6836
1461 nmdc:mga0a205_180796_c1 3300050515 Bacteria 2003
1462 nmdc:mga0a205_25453_c1 3300050515 Bacteria 5639
1463 nmdc:mga0a205_27501_c1 3300050515 Bacteria 5431
1464 nmdc:mga0a205_323_c1 3300050515 Bacteria 35802
1465 nmdc:mga0a205_351822_c1 3300050515 Bacteria 1340
1466 nmdc:mga0a205_39867_c1 3300050515 Bacteria 4521
1467 nmdc:mga0a205_6239_c1 3300050515 Bacteria 10760
1468 nmdc:mga0a205_6436_c1 3300050515 Bacteria 10615
1469 nmdc:mga0a205_7354_c1 3300050515 Bacteria 9973
1470 nmdc:mga0a205_76706_c1 3300050515 Bacteria 3230
1471 nmdc:mga0sz30_62680_c1 3300050516 Bacteria 1591
1472 Ga0495601_0007830 3300053077 Bacteria 6286
1473 Ga0495612_0025414 3300053078 Bacteria 2377
1474 Ga0495595_0026163 3300053084 Bacteria 2591
1475 Ga0495619_0020393 3300053085 Bacteria 4220
1476 Ga0500643_015722 3300053087 Bacteria 2586
1477 Ga0500560_002917 3300053107 Bacteria 3366
1478 Ga0500560_003744 3300053107 Bacteria 3122
1479 Ga0500572_004591 3300053111 Bacteria 3132
1480 Ga0500595_000121 3300053119 Bacteria 51239
1481 Ga0500595_009623 3300053119 Bacteria 3894
1482 Ga0500597_008056 3300053120 Bacteria 3619
1483 Ga0500628_000737 3300053129 Bacteria 5832
1484 Ga0500577_0005877 3300053142 Bacteria 3340
1485 Ga0500616_0005395 3300053153 Bacteria 8682
1486 Ga0500624_000393 3300053157 Bacteria 13789
1487 Ga0500636_0000025 3300053177 Bacteria 86697
1488 Ga0500636_0004427 3300053177 Bacteria 7949
1489 Ga0501084_0028505 3300054114 Bacteria 4668
1490 Ga0501084_0204766 3300054114 Bacteria 1665
1491 Ga0500661_002485 3300055283 Bacteria 3477
1492 Ga0590071_000285 3300059421 Bacteria 14753
1493 Ga0501082_0056401 3300060353 Bacteria 3384
1494 2537873611 2537561587 Bacteria 5425293
1495 2601610906 2600255279 Bacteria 5605316
1496 2601747680 2600255308 Bacteria 5611129
1497 2643921542 2643221582 Bacteria 5804683
1498 2740994242 2740891818 Bacteria 6711283
1499 2808988156 2808606387 Bacteria 5697198
1500 2831428567 2831426010 Bacteria 8662725
1501 2838678603 2838675328 Bacteria 4909118
1502 2838718309 2838714209 Bacteria 5525906
1503 2838722899 2838719591 Bacteria 5523910
1504 2838728375 2838724970 Bacteria 4908691
1505 2841850455 2841846520 Bacteria 5345850
1506 2841863292 2841859092 Bacteria 5436171
1507 2842129035 2842124991 Bacteria 5346824
1508 2842133496 2842130223 Bacteria 4909145
1509 2842155593 2842152218 Bacteria 4908957
1510 2842174449 2842170452 Bacteria 5525737
1511 2842179110 2842175837 Bacteria 4908771
1512 2842190733 2842187318 Bacteria 5524014
1513 2842214943 2842211629 Bacteria 5523832
1514 2842227664 2842224351 Bacteria 5524473
1515 2842519971 2842515876 Bacteria 5436280
1516 2848699582 2848694841 Bacteria 9205737
1517 2849663763 2849660919 Bacteria 8251853
1518 2884217039 2884215851 Bacteria 4554841
1519 2899795389 2899792073 Bacteria 4926588
1520 2899849368 2899845264 Bacteria 5672268
1521 2919118434 2919114240 Bacteria 5700270
1522 2926754963 2926754445 Bacteria 5964435
1523 2933010559 2933006813 Bacteria 4912075
1524 2933015769 2933011516 Bacteria 5439334
1525 2933597493 2933594066 Bacteria 5594265
1526 2935392915 2935390628 Bacteria 7043367
1527 2979092603 2979089926 Bacteria 5670289
1528 2979100006 2979095461 Bacteria 5669583
1529 2984513628 2984509177 Bacteria 5274802
1530 2984522791 2984518228 Bacteria 5277463
1531 2984542098 2984537506 Bacteria 5277481
1532 2984601528 2984601300 Bacteria 5455244
1533 2995464776 2995463766 Bacteria 8577691
1534 3006486689 3006486233 Bacteria 8157040
1535 8002779563 8002775197 Bacteria 10728764
1536 8003573705 8003570095 Bacteria 5747666
1537 8025481942 8025478263 Bacteria 8209203
1538 8054463744 8054460903 Bacteria 4872905
1539 Ga0400484_14440
1540 JGI24746J21847_1007330
1541 JGI25406J46586_10000491
1542 JGI25406J46586_10007753
1543 Ga0065712_10070058
1544 Ga0065715_10005050
1545 Ga0065715_10010633
1546 Ga0065715_10090876
1547 Ga0065715_10114814
1548 Ga0065715_10176740
1549 Ga0065715_10217235
1550 Ga0065715_10236973
1551 Ga0065707_10094919
1552 Ga0070658_10011373
1553 Ga0070658_10034910
1554 Ga0070676_10019288
1555 Ga0070676_10028453
1556 Ga0070676_10029120
1557 Ga0070676_10042623
1558 Ga0070676_10042666
1559 Ga0070676_10094738
1560 Ga0070683_100001126
1561 Ga0070683_100034468
1562 Ga0070683_100039007
1563 Ga0070683_100056802
1564 Ga0070683_100057431
1565 Ga0070683_100065420
1566 Ga0070683_100181721
1567 Ga0070683_100322244
1568 Ga0070690_100006740
1569 Ga0070690_100014748
1570 Ga0070690_100023771
1571 Ga0070690_100045248
1572 Ga0070690_100064366
1573 Ga0070690_100065474
1574 Ga0070690_100082341
1575 Ga0070690_100090851
1576 Ga0070690_100101546
1577 Ga0070690_100168379
1578 Ga0070670_100001936
1579 Ga0070670_100006348
1580 Ga0070670_100017827
1581 Ga0070670_100020760
1582 Ga0070670_100021146
1583 Ga0070670_100039172
1584 Ga0070670_100076642
1585 Ga0070677_10002564
1586 Ga0068869_100011370
1587 Ga0068869_100012331
1588 Ga0068869_100043658
1589 Ga0068869_100087287
1590 Ga0068869_100186645
1591 Ga0068869_100262555
1592 Ga0070666_10012366
1593 Ga0070666_10015831
1594 Ga0070666_10036583
1595 Ga0070666_10168285
1596 Ga0070680_100037488
1597 Ga0070680_100045533
1598 Ga0070680_100115030
1599 Ga0070680_100311552
1600 Ga0068868_100003641
1601 Ga0068868_100016841
1602 Ga0070660_100285795
1603 Ga0070689_100036732
1604 Ga0070689_100055068
1605 Ga0070689_100056731
1606 Ga0070689_100100516
1607 Ga0070689_100191728
1608 Ga0070691_10005290
1609 Ga0070691_10019803
1610 Ga0070687_100012601
1611 Ga0070687_100023806
1612 Ga0070687_100025783
1613 Ga0070687_100031349
1614 Ga0070661_100011194
1615 Ga0070661_100013643
1616 Ga0070661_100017754
1617 Ga0070661_100050849
1618 Ga0070661_100116655
1619 Ga0070692_10053279
1620 Ga0070668_100094882
1621 Ga0070669_100001000
1622 Ga0070669_100001192
1623 Ga0070669_100018183
1624 Ga0070669_100034609
1625 Ga0070669_100037580
1626 Ga0070669_100041230
1627 Ga0070669_100118136
1628 Ga0070669_100164049
1629 Ga0070675_100000202
1630 Ga0070675_100000206
1631 Ga0070675_100000408
1632 Ga0070675_100005006
1633 Ga0070675_100013178
1634 Ga0070675_100018751
1635 Ga0070675_100020786
1636 Ga0070675_100024217
1637 Ga0070675_100038952
1638 Ga0070675_100046972
1639 Ga0070675_100124788
1640 Ga0070675_100153219
1641 Ga0070675_100304999
1642 Ga0070671_100001717
1643 Ga0070671_100008027
1644 Ga0070671_100008756
1645 Ga0070671_100033204
1646 Ga0070671_100181883
1647 Ga0070671_100259913
1648 Ga0070674_100000192
1649 Ga0070674_100002496
1650 Ga0070674_100019077
1651 Ga0070673_100004944
1652 Ga0070673_100025833
1653 Ga0070673_100047112
1654 Ga0070673_100083282
1655 Ga0070673_100128423
1656 Ga0070688_100014162
1657 Ga0070688_100057032
1658 Ga0070659_100016221
1659 Ga0070659_100022661
1660 Ga0070659_100032944
1661 Ga0070667_100002413
1662 Ga0070667_100248121
1663 Ga0070667_100357696
1664 Ga0070709_10039305
1665 Ga0070709_10174061
1666 Ga0070713_100035741
1667 Ga0070701_10003212
1668 Ga0070701_10009769
1669 Ga0070701_10029499
1670 Ga0070701_10046400
1671 Ga0070701_10056666
1672 Ga0070711_100000038
1673 Ga0070711_100064470
1674 Ga0070705_100000023
1675 Ga0070705_100001554
1676 Ga0070705_100006748
1677 Ga0070705_100109541
1678 Ga0070705_100194391
1679 Ga0070700_100003012
1680 Ga0070700_100036343
1681 Ga0070700_100037695
1682 Ga0070694_100007236
1683 Ga0070694_100027390
1684 Ga0070708_100014503
1685 Ga0070708_100038377
1686 Ga0070708_100056011
1687 Ga0070708_100104251
1688 Ga0070663_100007672
1689 Ga0070663_100033219
1690 Ga0070678_100029082
1691 Ga0070678_100049631
1692 Ga0070678_100057239
1693 Ga0070678_100106840
1694 Ga0070662_100008307
1695 Ga0070662_100022624
1696 Ga0070662_100053625
1697 Ga0070662_100139429
1698 Ga0070681_10001704
1699 Ga0070681_10013545
1700 Ga0070681_10028189
1701 Ga0070681_10030588
1702 Ga0070681_10057901
1703 Ga0070681_10061568
1704 Ga0070681_10086994
1705 Ga0068867_100005997
1706 Ga0068867_100008016
1707 Ga0068867_100012021
1708 Ga0068867_100025755
1709 Ga0068867_100033375
1710 Ga0068867_100037901
1711 Ga0068867_100122508
1712 Ga0068867_100138363
1713 Ga0070685_10005680
1714 Ga0070685_10052836
1715 Ga0070706_100010022
1716 Ga0070706_100197323
1717 Ga0070706_100314277
1718 Ga0070707_100000212
1719 Ga0070707_100000431
1720 Ga0070707_100034000
1721 Ga0070707_100072471
1722 Ga0070698_100000385
1723 Ga0070698_100016037
1724 Ga0070698_100248411
1725 Ga0070698_100303010
1726 Ga0070699_100061274
1727 Ga0070699_100084611
1728 Ga0070699_100113220
1729 Ga0070699_100121194
1730 Ga0070699_100125417
1731 Ga0070679_100017481
1732 Ga0070679_100052278
1733 Ga0070679_100195639
1734 Ga0070679_100205341
1735 Ga0070684_100000068
1736 Ga0070684_100008077
1737 Ga0070684_100076425
1738 Ga0070684_100373888
1739 Ga0070697_100000531
1740 Ga0070697_100026023
1741 Ga0070697_100254576
1742 Ga0068853_100001165
1743 Ga0068853_100031112
1744 Ga0068853_100070822
1745 Ga0068853_100319535
1746 Ga0070672_100008106
1747 Ga0070672_100009511
1748 Ga0070672_100045467
1749 Ga0070672_100050492
1750 Ga0070672_100054107
1751 Ga0070672_100076644
1752 Ga0070672_100094364
1753 Ga0070672_100096073
1754 Ga0070686_100014154
1755 Ga0070686_100015831
1756 Ga0070686_100026116
1757 Ga0070695_100000155
1758 Ga0070695_100007901
1759 Ga0070696_100001294
1760 Ga0070696_100013489
1761 Ga0070696_100087670
1762 Ga0070665_100001535
1763 Ga0070665_100007098
1764 Ga0070665_100018061
1765 Ga0070665_100026106
1766 Ga0070665_100027580
1767 Ga0070665_100029554
1768 Ga0070665_100033893
1769 Ga0070704_100001112
1770 Ga0070704_100024108
1771 Ga0070704_100095590
1772 Ga0070704_100103968
1773 Ga0070704_100109444
1774 Ga0068855_100035919
1775 Ga0068855_100107978
1776 Ga0068855_100161260
1777 Ga0068855_100211604
1778 Ga0070664_100000408
1779 Ga0070664_100003040
1780 Ga0070664_100006808
1781 Ga0070664_100009215
1782 Ga0070664_100009579
1783 Ga0070664_100018914
1784 Ga0070664_100020599
1785 Ga0070664_100022888
1786 Ga0070664_100034123
1787 Ga0070664_100079530
1788 Ga0070664_100083244
1789 Ga0070664_100098220
1790 Ga0068857_100005029
1791 Ga0068857_100017945
1792 Ga0068857_100044957
1793 Ga0068857_100048598
1794 Ga0068857_100307235
1795 Ga0068854_100141939
1796 Ga0068856_100351940
1797 Ga0068856_100399033
1798 Ga0070702_100008655
1799 Ga0068859_100005622
1800 Ga0068859_100013051
1801 Ga0068859_100016091
1802 Ga0068859_100034153
1803 Ga0068859_100078549
1804 Ga0068859_100095218
1805 Ga0068859_100170825
1806 Ga0068859_100179049
1807 Ga0068859_100180719
1808 Ga0068859_100360208
1809 Ga0068864_100030720
1810 Ga0068864_100125410
1811 Ga0068864_100307422
1812 Ga0068861_100004593
1813 Ga0068861_100005603
1814 Ga0068861_100005906
1815 Ga0068861_100048764
1816 Ga0068861_100063982
1817 Ga0068861_100261353
1818 Ga0068870_10002305
1819 Ga0068870_10002884
1820 Ga0068870_10005642
1821 Ga0068870_10182307
1822 Ga0068863_100021750
1823 Ga0068863_100063750
1824 Ga0068863_100072609
1825 Ga0068863_100151036
1826 Ga0068858_100040590
1827 Ga0068858_100049335
1828 Ga0068858_100125856
1829 Ga0068858_100128307
1830 Ga0068858_100180231
1831 Ga0068858_100213540
1832 Ga0068860_100018392
1833 Ga0068860_100032227
1834 Ga0068860_100058145
1835 Ga0068860_100081629
1836 Ga0068860_100285269
1837 Ga0068862_100001571
1838 Ga0068862_100002276
1839 Ga0068862_100013045
1840 Ga0068862_100044380
1841 Ga0068862_100046669
1842 Ga0068862_100073499
1843 Ga0068862_100191372
1844 Ga0068862_100201759
1845 Ga0081540_1074489
1846 Ga0081539_10000093
1847 Ga0081539_10001136
1848 Ga0081539_10005341
1849 Ga0081539_10009311
1850 Ga0081539_10057781
1851 Ga0070717_10030097
1852 Ga0070717_10032785
1853 Ga0070717_10336150
1854 Ga0075368_10001899
1855 Ga0075364_10000845
1856 Ga0075364_10005410
1857 Ga0075364_10038968
1858 Ga0075432_10055550
1859 Ga0075367_10020967
1860 Ga0075367_10055547
1861 Ga0075367_10101443
1862 Ga0075369_10008604
1863 Ga0097621_100043570
1864 Ga0097621_100096262
1865 Ga0097621_100147311
1866 Ga0097621_100164616
1867 Ga0068871_100015620
1868 Ga0068871_100019830
1869 Ga0068871_100256782
1870 Ga0075428_100005558
1871 Ga0075428_100007739
1872 Ga0075428_100008259
1873 Ga0075428_100011749
1874 Ga0075428_100012298
1875 Ga0075428_100022458
1876 Ga0075428_100036930
1877 Ga0075428_100050593
1878 Ga0075428_100145289
1879 Ga0075430_100001572
1880 Ga0075430_100013858
1881 Ga0075430_100025892
1882 Ga0075430_100068808
1883 Ga0075430_100088985
1884 Ga0075430_100130023
1885 Ga0075430_100170800
1886 Ga0075430_100218642
1887 Ga0075430_100240510
1888 Ga0075430_100326639
1889 Ga0075431_100002075
1890 Ga0075431_100007891
1891 Ga0075431_100014890
1892 Ga0075431_100039560
1893 Ga0075431_100041811
1894 Ga0075431_100097958
1895 Ga0075431_100118566
1896 Ga0075431_100145261
1897 Ga0075431_100206996
1898 Ga0075431_100207846
1899 Ga0075431_100340241
1900 Ga0075433_10008088
1901 Ga0075433_10014399
1902 Ga0075433_10022099
1903 Ga0075433_10024458
1904 Ga0075433_10031125
1905 Ga0075433_10031541
1906 Ga0075433_10040375
1907 Ga0075433_10047106
1908 Ga0075433_10189420
1909 Ga0075434_100000553
1910 Ga0075434_100000585
1911 Ga0075434_100002096
1912 Ga0075434_100002820
1913 Ga0075434_100004979
1914 Ga0075434_100013018
1915 Ga0075434_100015822
1916 Ga0075434_100021087
1917 Ga0075434_100043606
1918 Ga0075434_100075410
1919 Ga0075434_100082612
1920 Ga0075434_100158591
1921 Ga0075434_100334843
1922 Ga0075429_100000181
1923 Ga0075429_100002380
1924 Ga0075429_100005278
1925 Ga0075429_100024452
1926 Ga0075429_100048639
1927 Ga0075429_100118964
1928 Ga0075429_100189523
1929 Ga0068865_100012596
1930 Ga0068865_100016005
1931 Ga0068865_100262524
1932 Ga0075436_100000199
1933 Ga0075436_100005822
1934 Ga0075436_100006076
1935 Ga0075436_100009367
1936 Ga0075436_100026590
1937 Ga0097620_100005622
1938 Ga0097620_100013051
1939 Ga0097620_100016090
1940 Ga0097620_100034155
1941 Ga0097620_100078547
1942 Ga0097620_100095218
1943 Ga0097620_100170820
1944 Ga0097620_100179047
1945 Ga0097620_100180721
1946 Ga0097620_100360230
1947 Ga0099826_10000468
1948 Ga0099826_10014757
1949 Ga0075435_100000052
1950 Ga0075435_100009595
1951 Ga0075435_100022726
1952 Ga0075435_100044354
1953 Ga0075435_100074365
1954 Ga0075435_100088232
1955 Ga0099794_10005403
1956 Ga0105240_10009442
1957 Ga0105240_10089919
1958 Ga0105240_10107198
1959 Ga0105240_10134551
1960 Ga0105240_10213176
1961 Ga0105240_10374214
1962 Ga0111539_10000324
1963 Ga0111539_10003328
1964 Ga0111539_10003636
1965 Ga0111539_10006989
1966 Ga0111539_10022595
1967 Ga0111539_10028372
1968 Ga0111539_10037755
1969 Ga0111539_10041079
1970 Ga0111539_10060627
1971 Ga0111539_10068797
1972 Ga0111539_10105503
1973 Ga0111539_10118098
1974 Ga0111539_10135625
1975 Ga0111539_10144567
1976 Ga0111539_10154542
1977 Ga0111539_10312479
1978 Ga0105245_10084662
1979 Ga0105245_10106002
1980 Ga0105245_10148397
1981 Ga0105247_10031422
1982 Ga0105247_10040785
1983 Ga0105247_10063593
1984 Ga0105247_10104426
1985 Ga0114129_10000307
1986 Ga0114129_10000588
1987 Ga0114129_10006012
1988 Ga0114129_10006290
1989 Ga0114129_10006879
1990 Ga0114129_10007407
1991 Ga0114129_10010731
1992 Ga0114129_10012882
1993 Ga0114129_10021924
1994 Ga0114129_10033704
1995 Ga0114129_10047465
1996 Ga0114129_10047748
1997 Ga0114129_10061111
1998 Ga0114129_10071975
1999 Ga0114129_10079382
2000 Ga0114129_10106093
2001 Ga0114129_10156558
2002 Ga0114129_10177608
2003 Ga0114129_10268119
2004 Ga0114129_10380637
2005 Ga0114129_10587841
2006 Ga0114129_10752778
2007 Ga0105243_10019426
2008 Ga0105243_10030455
2009 Ga0105243_10041278
2010 Ga0105243_10101663
2011 Ga0105243_10247838
2012 Ga0105243_10273776
2013 Ga0105243_10408312
2014 Ga0105242_10009410
2015 Ga0105242_10016448
2016 Ga0105242_10060137
2017 Ga0105248_10000664
2018 Ga0105248_10002959
2019 Ga0105248_10014897
2020 Ga0105248_10043880
2021 Ga0105248_10063176
2022 Ga0105248_10092522
2023 Ga0105248_10108361
2024 Ga0105248_10167554
2025 Ga0105248_10337990
2026 Ga0105248_10400700
2027 Ga0105248_10439837
2028 Ga0105237_10028798
2029 Ga0105237_10079291
2030 Ga0105237_10491492
2031 Ga0105238_10016494
2032 Ga0105249_10000733
2033 Ga0105249_10015979
2034 Ga0105249_10063199
2035 Ga0105249_10101884
2036 Ga0105249_10183723
2037 Ga0105249_10207017
2038 Ga0105239_10241031
2039 Ga0105246_10010820
2040 Ga0105246_10029966
2041 Ga0157373_10066988
2042 Ga0157371_10000071
2043 Ga0157371_10037856
2044 Ga0157370_10000469
2045 Ga0157370_10025074
2046 Ga0157370_10108404
2047 Ga0157369_10013530
2048 Ga0157369_10043197
2049 Ga0157369_10051341
2050 Ga0157369_10056570
2051 Ga0157369_10125898
2052 Ga0157374_10000448
2053 Ga0157374_10012030
2054 Ga0157374_10072301
2055 Ga0157374_10184870
2056 Ga0157378_10004264
2057 Ga0157378_10005712
2058 Ga0163162_10000786
2059 Ga0163162_10016252
2060 Ga0163162_10070083
2061 Ga0163162_10209555
2062 Ga0157372_10001231
2063 Ga0157372_10004537
2064 Ga0157372_10054256
2065 Ga0157375_10000071
2066 Ga0157375_10013991
2067 Ga0157375_10191624
2068 Ga0163163_10001107
2069 Ga0163163_10013130
2070 Ga0163163_10024898
2071 Ga0163163_10030622
2072 Ga0163163_10041518
2073 Ga0163163_10051444
2074 Ga0163163_10057531
2075 Ga0157380_10001766
2076 Ga0157380_10007787
2077 Ga0157380_10012368
2078 Ga0157380_10017341
2079 Ga0157380_10046144
2080 Ga0157380_10238364
2081 Ga0157380_10261166
2082 Ga0157380_10309771
2083 Ga0157380_10377125
2084 Ga0157377_10017766
2085 Ga0157377_10018790
2086 Ga0157377_10020665
2087 Ga0157379_10005094
2088 Ga0157379_10011426
2089 Ga0157379_10016218
2090 Ga0157379_10024070
2091 Ga0157379_10029043
2092 Ga0157379_10038695
2093 Ga0157379_10145854
2094 Ga0157376_10018769
2095 Ga0157376_10051739
2096 Ga0157376_10641973
2097 Ga0163161_10008043
2098 Ga0163161_10124937
2099 Ga0213872_10005421
2100 Ga0224569_101166
2101 Ga0224572_1006723
2102 Ga0224572_1007427
2103 Ga0228598_1004755
2104 Ga0209025_1001274
2105 Ga0207697_10001972
2106 Ga0207697_10026903
2107 Ga0207682_10000256
2108 Ga0207682_10005491
2109 Ga0207682_10028497
2110 Ga0207682_10036900
2111 Ga0207682_10058240
2112 Ga0207710_10060582
2113 Ga0207710_10083931
2114 Ga0207688_10001374
2115 Ga0207688_10001964
2116 Ga0207688_10135358
2117 Ga0207680_10007138
2118 Ga0207680_10110641
2119 Ga0207685_10004015
2120 Ga0207685_10099142
2121 Ga0207699_10003844
2122 Ga0207699_10072534
2123 Ga0207645_10001189
2124 Ga0207645_10001887
2125 Ga0207645_10003038
2126 Ga0207645_10006720
2127 Ga0207645_10012432
2128 Ga0207645_10016102
2129 Ga0207645_10031135
2130 Ga0207645_10047028
2131 Ga0207643_10000976
2132 Ga0207643_10002349
2133 Ga0207643_10008592
2134 Ga0207643_10016621
2135 Ga0207705_10000463
2136 Ga0207705_10014605
2137 Ga0207684_10003705
2138 Ga0207684_10147145
2139 Ga0207707_10096218
2140 Ga0207707_10107009
2141 Ga0207707_10167535
2142 Ga0207707_10239421
2143 Ga0207695_10057888
2144 Ga0207695_10161907
2145 Ga0207695_10250619
2146 Ga0207695_10266080
2147 Ga0207663_10000017
2148 Ga0207660_10051507
2149 Ga0207660_10057403
2150 Ga0207660_10071756
2151 Ga0207660_10111115
2152 Ga0207662_10001582
2153 Ga0207662_10003401
2154 Ga0207662_10022645
2155 Ga0207657_10006664
2156 Ga0207657_10067071
2157 Ga0207649_10052175
2158 Ga0207649_10090297
2159 Ga0207649_10175712
2160 Ga0207649_10197291
2161 Ga0207652_10014267
2162 Ga0207652_10171519
2163 Ga0207652_10186904
2164 Ga0207652_10198088
2165 Ga0207646_10000400
2166 Ga0207646_10000801
2167 Ga0207646_10116073
2168 Ga0207681_10000315
2169 Ga0207681_10002837
2170 Ga0207681_10006093
2171 Ga0207681_10008989
2172 Ga0207681_10016410
2173 Ga0207681_10021025
2174 Ga0207681_10042735
2175 Ga0207681_10061138
2176 Ga0207681_10137941
2177 Ga0207694_10009664
2178 Ga0207650_10001649
2179 Ga0207650_10038085
2180 Ga0207650_10089593
2181 Ga0207650_10101156
2182 Ga0207659_10000076
2183 Ga0207659_10001426
2184 Ga0207659_10001726
2185 Ga0207659_10001830
2186 Ga0207659_10003364
2187 Ga0207659_10055289
2188 Ga0207659_10062162
2189 Ga0207659_10084529
2190 Ga0207659_10117700
2191 Ga0207687_10046812
2192 Ga0207687_10121323
2193 Ga0207700_10053462
2194 Ga0207664_10119175
2195 Ga0207644_10000485
2196 Ga0207644_10004067
2197 Ga0207644_10027107
2198 Ga0207690_10025745
2199 Ga0207690_10184452
2200 Ga0207706_10002610
2201 Ga0207706_10009806
2202 Ga0207706_10013693
2203 Ga0207706_10018234
2204 Ga0207706_10029383
2205 Ga0207706_10039016
2206 Ga0207706_10055474
2207 Ga0207706_10135755
2208 Ga0207686_10128298
2209 Ga0207709_10017122
2210 Ga0207709_10018785
2211 Ga0207709_10024069
2212 Ga0207709_10046837
2213 Ga0207670_10051802
2214 Ga0207670_10063216
2215 Ga0207670_10070850
2216 Ga0207670_10095177
2217 Ga0207670_10212999
2218 Ga0207669_10019434
2219 Ga0207669_10198810
2220 Ga0207704_10033108
2221 Ga0207704_10042299
2222 Ga0207704_10099216
2223 Ga0207665_10005573
2224 Ga0207665_10017374
2225 Ga0207691_10001612
2226 Ga0207691_10007302
2227 Ga0207691_10011138
2228 Ga0207691_10016959
2229 Ga0207691_10022003
2230 Ga0207691_10026485
2231 Ga0207691_10033850
2232 Ga0207691_10047127
2233 Ga0207691_10075799
2234 Ga0207691_10094511
2235 Ga0207691_10096844
2236 Ga0207691_10100147
2237 Ga0207691_10105868
2238 Ga0207691_10106389
2239 Ga0207691_10188302
2240 Ga0207711_10010963
2241 Ga0207711_10014618
2242 Ga0207711_10025788
2243 Ga0207711_10034774
2244 Ga0207711_10040252
2245 Ga0207711_10041583
2246 Ga0207711_10056886
2247 Ga0207711_10167324
2248 Ga0207711_10191118
2249 Ga0207689_10014461
2250 Ga0207689_10046922
2251 Ga0207689_10117260
2252 Ga0207689_10122307
2253 Ga0207661_10003131
2254 Ga0207661_10025526
2255 Ga0207661_10035737
2256 Ga0207661_10051968
2257 Ga0207661_10081352
2258 Ga0207661_10122362
2259 Ga0207679_10003204
2260 Ga0207679_10003415
2261 Ga0207679_10006342
2262 Ga0207679_10015783
2263 Ga0207679_10045134
2264 Ga0207679_10063272
2265 Ga0207679_10097456
2266 Ga0207679_10102068
2267 Ga0207679_10105661
2268 Ga0207679_10216683
2269 Ga0207667_10018041
2270 Ga0207667_10049057
2271 Ga0207667_10074332
2272 Ga0207651_10004772
2273 Ga0207651_10011179
2274 Ga0207651_10052108
2275 Ga0207651_10160726
2276 Ga0207712_10002949
2277 Ga0207712_10004752
2278 Ga0207712_10080863
2279 Ga0207712_10152887
2280 Ga0207668_10017130
2281 Ga0207668_10176784
2282 Ga0207668_10207885
2283 Ga0207640_10016650
2284 Ga0207640_10046083
2285 Ga0207640_10136389
2286 Ga0207658_10011211
2287 Ga0207658_10062486
2288 Ga0207658_10168498
2289 Ga0207677_10076952
2290 Ga0207677_10172310
2291 Ga0207703_10025435
2292 Ga0207703_10028156
2293 Ga0207703_10035383
2294 Ga0207703_10138710
2295 Ga0207703_10145358
2296 Ga0207703_10187697
2297 Ga0207639_10003395
2298 Ga0207639_10157608
2299 Ga0207639_10279369
2300 Ga0207678_10008895
2301 Ga0207678_10022903
2302 Ga0207678_10023382
2303 Ga0207708_10003536
2304 Ga0207708_10003617
2305 Ga0207708_10010005
2306 Ga0207708_10025892
2307 Ga0207708_10035282
2308 Ga0207708_10055002
2309 Ga0207708_10070903
2310 Ga0207708_10099773
2311 Ga0207702_10322766
2312 Ga0207641_10001113
2313 Ga0207641_10114243
2314 Ga0207641_10160020
2315 Ga0207648_10000280
2316 Ga0207648_10001579
2317 Ga0207648_10006656
2318 Ga0207648_10007517
2319 Ga0207648_10041218
2320 Ga0207648_10047619
2321 Ga0207648_10062065
2322 Ga0207648_10131360
2323 Ga0207648_10158532
2324 Ga0207648_10225875
2325 Ga0207648_10260806
2326 Ga0207676_10021525
2327 Ga0207676_10069611
2328 Ga0207676_10085050
2329 Ga0207676_10290579
2330 Ga0207676_10301347
2331 Ga0207674_10000975
2332 Ga0207674_10001029
2333 Ga0207674_10009475
2334 Ga0207674_10009866
2335 Ga0207674_10025524
2336 Ga0207674_10048267
2337 Ga0207674_10119857
2338 Ga0207674_10175598
2339 Ga0207675_100005112
2340 Ga0207675_100009300
2341 Ga0207675_100010828
2342 Ga0207675_100014801
2343 Ga0207675_100021208
2344 Ga0207675_100029674
2345 Ga0207675_100073355
2346 Ga0207675_100083061
2347 Ga0207675_100101515
2348 Ga0207675_100321976
2349 Ga0207683_10001056
2350 Ga0207683_10021790
2351 Ga0207683_10053680
2352 Ga0207683_10188916
2353 Ga0207683_10219553
2354 Ga0207698_10061373
2355 Ga0207698_10186040
2356 Ga0209282_1010364
2357 Ga0209282_1021345
2358 Ga0209588_1004742
2359 Ga0209971_1023508
2360 Ga0207428_10000481
2361 Ga0207428_10003460
2362 Ga0207428_10004078
2363 Ga0207428_10011888
2364 Ga0207428_10028879
2365 Ga0207428_10044629
2366 Ga0207428_10098452
2367 Ga0207428_10115910
2368 Ga0207428_10116968
2369 Ga0207428_10169805
2370 Ga0268266_10001913
2371 Ga0268266_10003647
2372 Ga0268266_10003719
2373 Ga0268266_10016423
2374 Ga0268266_10107527
2375 Ga0268266_10155753
2376 Ga0268265_10003942
2377 Ga0268265_10006108
2378 Ga0268265_10021735
2379 Ga0268265_10030986
2380 Ga0268265_10041011
2381 Ga0268265_10230255
2382 Ga0268264_10005498
2383 Ga0268264_10030911
2384 Ga0268264_10133223
2385 Ga0268264_10204038
2386 Ga0268264_10385130
2387 Ga0265336_10001220
2388 Ga0265338_10002329
2389 Ga0265338_10208561
2390 Ga0307512_10031809
2391 Ga0265762_1000437
2392 Ga0265762_1007655
2393 Ga0265332_10003975
2394 Ga0265328_10061315
2395 Ga0265325_10052379
2396 Ga0265329_10031629
2397 Ga0265340_10076292
2398 Ga0265340_10086162
2399 Ga0265331_10059940
2400 Ga0265316_10002852
2401 Ga0307408_100005731
2402 Ga0307408_100088843
2403 Ga0307408_100262374
2404 Ga0307508_10003585
2405 Ga0316575_10000078
2406 Ga0316575_10001173
2407 Ga0316575_10014940
2408 Ga0316575_10051213
2409 Ga0316575_10072183
2410 Ga0316575_10079148
2411 Ga0316579_10000340
2412 Ga0316579_10003231
2413 Ga0316579_10005032
2414 Ga0316579_10005489
2415 Ga0316579_10006783
2416 Ga0316579_10033573
2417 Ga0316579_10079800
2418 Ga0265314_10031752
2419 Ga0265314_10043744
2420 Ga0265314_10056375
2421 Ga0316576_10000061
2422 Ga0316576_10003527
2423 Ga0316576_10008317
2424 Ga0316576_10011247
2425 Ga0316576_10012299
2426 Ga0316576_10028153
2427 Ga0316576_10036520
2428 Ga0316576_10041041
2429 Ga0316576_10070111
2430 Ga0316576_10122277
2431 Ga0316576_10163406
2432 Ga0316576_10164384
2433 Ga0316576_10203708
2434 Ga0316578_10000292
2435 Ga0316578_10000778
2436 Ga0316578_10008143
2437 Ga0316578_10008169
2438 Ga0316578_10020051
2439 Ga0316578_10053385
2440 Ga0316578_10062956
2441 Ga0316578_10128903
2442 Ga0316578_10131423
2443 Ga0307405_10014290
2444 Ga0307405_10227356
2445 Ga0316577_10001299
2446 Ga0316577_10001513
2447 Ga0316577_10004481
2448 Ga0316577_10031830
2449 Ga0316577_10036514
2450 Ga0316577_10060081
2451 Ga0316577_10150845
2452 Ga0316577_10151652
2453 Ga0307413_10000731
2454 Ga0307413_10007133
2455 Ga0307413_10094788
2456 Ga0307413_10146291
2457 Ga0307413_10189666
2458 Ga0307410_10038888
2459 Ga0307410_10130009
2460 Ga0307406_10003599
2461 Ga0307406_10026366
2462 Ga0307406_10084724
2463 Ga0307406_10148358
2464 Ga0307407_10001825
2465 Ga0307407_10025974
2466 Ga0307407_10058651
2467 Ga0307407_10068791
2468 Ga0307412_10074102
2469 Ga0307409_100000298
2470 Ga0307409_100018484
2471 Ga0307409_100037951
2472 Ga0307416_100003790
2473 Ga0307416_100005453
2474 Ga0307416_100059749
2475 Ga0307416_100097779
2476 Ga0307416_100112146
2477 Ga0307416_100135170
2478 Ga0307416_100138140
2479 Ga0307416_100164693
2480 Ga0307414_10049440
2481 Ga0307414_10062914
2482 Ga0307414_10127806
2483 Ga0307414_10179906
2484 Ga0307414_10381188
2485 Ga0307411_10001022
2486 Ga0307411_10005511
2487 Ga0307411_10043083
2488 Ga0307411_10085688
2489 Ga0307411_10103351
2490 Ga0307411_10213397
2491 Ga0307411_10303241
2492 Ga0307415_100006479
2493 Ga0307415_100072204
2494 Ga0307415_100086415
2495 Ga0307415_100173563
2496 Ga0307415_100206719
2497 Ga0316583_10000460
2498 Ga0316583_10001203
2499 Ga0316583_10001572
2500 Ga0316583_10003648
2501 Ga0316583_10006388
2502 Ga0316583_10007565
2503 Ga0316583_10021861
2504 Ga0316585_10000766
2505 Ga0316585_10001080
2506 Ga0316585_10032763
2507 Ga0316580_10000032
2508 Ga0316580_10000340
2509 Ga0316580_10004339
2510 Ga0316593_10000188
2511 Ga0316593_10009664
2512 Ga0316593_10011908
2513 Ga0307510_10126809
2514 Ga0316592_1000517
2515 Ga0316592_1001809
2516 Ga0316588_1000700
2517 Ga0316596_1000885
2518 Ga0316596_1002003
2519 Ga0316212_1003380
2520 Ga0373926_0009080
2521 Ga0373926_0017251
2522 Ga0373923_0005050
2523 Ga0373923_0130913
2524 Ga0373941_0049264
2525 Ga0373943_0030823
2526 Ga0373961_0042102
2527 Ga0373962_0058409
2528 Ga0316574_0000054
2529 Ga0316574_0000651
2530 Ga0316574_0003136
2531 Ga0316574_0036435
2532 Ga0316574_0054359
2533 Ga0316574_0060347
2534 Ga0316574_0098667
2535 Ga0316574_0103393
2536 Ga0316574_0194220
2537 Ga0373931_0033246
2538 Ga0373935_0007047
2539 Ga0373935_0008647
2540 Ga0373927_0011017
2541 Ga0373933_0089214
2542 Ga0373947_0051242
2543 Ga0373947_0216750
2544 Ga0373937_0002679
2545 Ga0373937_0025464
2546 Ga0373937_0252653
2547 Ga0316582_0000201
2548 Ga0316582_0000608
2549 Ga0316582_0003179
2550 Ga0316582_0005804
2551 Ga0316582_0020480
2552 Ga0316582_0039799
2553 Ga0316582_0059135
2554 Ga0316582_0060613
2555 Ga0316582_0073934
2556 Ga0316582_0192018
2557 Ga0316584_0001889
2558 Ga0316584_0009581
2559 Ga0316584_0019571
2560 Ga0316584_0044299
2561 Ga0316584_0054994
2562 Ga0316584_0069183
2563 Ga0316584_0090014
2564 Ga0316584_0094890
2565 Ga0316584_0209905
2566 Ga0316584_0224544
2567 Ga0316584_0318816
2568 Ga0373925_0004509
2569 Ga0373925_0196397
2570 Ga0373925_0245972
2571 Ga0316581_0001143
2572 Ga0316581_0017783
2573 Ga0436364_0778749
2574 Ga0400484_29778
2575 Ga0400490_53112
2576 Ga0400485_18502
2577 Ga0400488_23036
2578 Ga0400483_252454
2579 Ga0400483_263366
2580 Ga0400483_263582
2581 Ga0400489_36202
2582 Ga0400489_39387
2583 Ga0400489_57552
2584 Ga0400489_66845
2585 Ga0400489_67086
2586 Ga0400489_87056
2587 Ga0436360_0776135
2588 Ga0436361_0217784
2589 Ga0450920_004909
2590 Ga0450898_004430
2591 Ga0439446_0018003
2592 Ga0451577_0000016
2593 Ga0451577_0000063
2594 Ga0451577_0003032
2595 Ga0451577_0007108
2596 Ga0451577_0008586
2597 Ga0451577_0011583
2598 Ga0451577_0011723
2599 Ga0451577_0013346
2600 Ga0451577_0020077
2601 Ga0451577_0023963
2602 Ga0451577_0031730
2603 Ga0451577_0032839
2604 Ga0451577_0154283
2605 Ga0451577_0389889
2606 Ga0466969_0000017
2607 Ga0466969_0005938
2608 Ga0453683_0000354
2609 Ga0453683_0001401
2610 Ga0453683_0002141
2611 Ga0453683_0006715
2612 Ga0453683_0007197
2613 Ga0453683_0008162
2614 Ga0453683_0075195
2615 Ga0466965_0021284
2616 Ga0466965_0124092
2617 Ga0466966_0009159
2618 Ga0466966_0025665
2619 Ga0466966_0104119
2620 Ga0466961_0000675
2621 Ga0453684_0000198
2622 Ga0453684_0001021
2623 Ga0453684_0003669
2624 Ga0453684_0005793
2625 Ga0453684_0005848
2626 Ga0453684_0008716
2627 Ga0453684_0011440
2628 Ga0453684_0016406
2629 Ga0453684_0019113
2630 Ga0453684_0025076
2631 Ga0453684_0028918
2632 Ga0453684_0034553
2633 Ga0453684_0038822
2634 Ga0453684_0047025
2635 Ga0453684_0047870
2636 Ga0453684_0073014
2637 Ga0453684_0093505
2638 Ga0453684_0101809
2639 Ga0453684_0165800
2640 Ga0453684_0225614
2641 Ga0453684_0462321
2642 Ga0466957_0064618
2643 Ga0466959_0000285
2644 Ga0451576_0002045
2645 Ga0451576_0007793
2646 Ga0451576_0017896
2647 Ga0451576_0020522
2648 Ga0451576_0021366
2649 Ga0451576_0037518
2650 Ga0451576_0114907
2651 Ga0451576_0124785
2652 Ga0451576_0178868
2653 Ga0451576_0189302
2654 Ga0451576_0197660
2655 Ga0451576_0433872
2656 Ga0451576_0585453
2657 Ga0466958_0018991
2658 Ga0466967_0083639
2659 Ga0495592_0034869
2660 Ga0495592_0062440
2661 Ga0495592_0084555
2662 Ga0495629_0004932
2663 Ga0495641_0012535
2664 Ga0495651_0000624
2665 Ga0495651_0005231
2666 Ga0495651_0009328
2667 Ga0495651_0025107
2668 Ga0495653_0003358
2669 Ga0495653_0102126
2670 Ga0495650_0000009
2671 Ga0495650_0010284
2672 Ga0495580_0007760
2673 Ga0495580_0010241
2674 Ga0495580_0012295
2675 Ga0495580_0105779
2676 Ga0495580_0136835
2677 Ga0495582_0000160
2678 Ga0495582_0061652
2679 Ga0495582_0075068
2680 Ga0495582_0126001
2681 Ga0495664_0009041
2682 Ga0495664_0029121
2683 Ga0495664_0053062
2684 Ga0495585_0023681
2685 Ga0495594_0001740
2686 Ga0495594_0003599
2687 Ga0495594_0011490
2688 Ga0495594_0040863
2689 Ga0495583_0010608
2690 Ga0495606_0080712
2691 Ga0495608_0005595
2692 Ga0495608_0073549
2693 Ga0495608_0114666
2694 Ga0495628_0000100
2695 Ga0495628_0003895
2696 Ga0495628_0073629
2697 Ga0495628_0189176
2698 Ga0495630_0002788
2699 Ga0495630_0015574
2700 Ga0495643_0000203
2701 Ga0495643_0078798
2702 Ga0495644_0003693
2703 Ga0495648_0072663
2704 Ga0495666_0008923
2705 Ga0495666_0021255
2706 Ga0495642_0017177
2707 Ga0495642_0053101
2708 Ga0495652_0007450
2709 Ga0495652_0027682
2710 Ga0495652_0047638
2711 Ga0495652_0251206
2712 Ga0495665_0011377
2713 Ga0495665_0032663
2714 Ga0495665_0070927
2715 Ga0495586_0002638
2716 Ga0495586_0024319
2717 Ga0495586_0143004
2718 Ga0495587_0004941
2719 Ga0495587_0125409
2720 Ga0495598_0038413
2721 Ga0495621_0003001
2722 Ga0495621_0017025
2723 Ga0495645_0002684
2724 Ga0495645_0005674
2725 Ga0495645_0008111
2726 Ga0495645_0083449
2727 Ga0495633_0016768
2728 Ga0495633_0054740
2729 Ga0495633_0061375
2730 Ga0495633_0080582
2731 Ga0495667_0034067
2732 Ga0495667_0044908
2733 Ga0495667_0132793
2734 Ga0495667_0224295
2735 Ga0495668_0064299
2736 Ga0495634_0001889
2737 Ga0495634_0007610
2738 Ga0495625_0000174
2739 Ga0495625_0070003
2740 Ga0495635_0021952
2741 Ga0495635_0036139
2742 Ga0495588_0003610
2743 Ga0495657_0019947
2744 Ga0495657_0147579
2745 Ga0495599_0004610
2746 Ga0495623_0023862
2747 Ga0495646_0007910
2748 Ga0495658_0016514
2749 Ga0495658_0016706
2750 Ga0495658_0122720
2751 Ga0495669_0001130
2752 Ga0495669_0010879
2753 Ga0495613_0012126
2754 Ga0495613_0024977
2755 Ga0495613_0074258
2756 Ga0495624_0009364
2757 Ga0495649_0029029
2758 Ga0495649_0120856
2759 Ga0495600_0001186
2760 Ga0495600_0058644
2761 Ga0495581_0009729
2762 Ga0495604_0000537
2763 Ga0495604_0002227
2764 Ga0495604_0002867
2765 Ga0495604_0014776
2766 Ga0495604_0016954
2767 Ga0495636_0018647
2768 Ga0495674_0001372
2769 Ga0495674_0016950
2770 Ga0495674_0068815
2771 Ga0495676_0003364
2772 Ga0495676_0017461
2773 Ga0495680_0000436
2774 Ga0495680_0001290
2775 Ga0495680_0009994
2776 Ga0495680_0039057
2777 Ga0495680_0169968
2778 Ga0495675_0000566
2779 Ga0495675_0010096
2780 Ga0495675_0010601
2781 Ga0495675_0046538
2782 Ga0495677_0032944
2783 Ga0495685_010344
2784 Ga0495681_0003767
2785 Ga0495684_0002380
2786 Ga0495684_0030918
2787 Ga0495684_0052887
2788 Ga0495593_0057144
2789 Ga0495602_0013208
2790 Ga0495614_0002691
2791 Ga0495614_0023386
2792 Ga0496100_0166956
2793 Ga0496100_0218333
2794 Ga0496101_0130692
2795 Ga0496101_0153434
2796 Ga0496101_0189405
2797 Ga0496102_0001797
2798 Ga0496102_0010259
2799 Ga0496102_0115018
2800 Ga0496104_0003519
2801 Ga0496104_0032813
2802 Ga0496104_0144865
2803 Ga0496104_0149680
2804 Ga0496104_0176149
2805 Ga0496105_0060874
2806 Ga0496106_0056076
2807 Ga0496106_0147709
2808 Ga0496107_0365092
2809 Ga0496108_0003906
2810 Ga0496108_0040415
2811 Ga0496108_0181674
2812 Ga0496109_0014286
2813 Ga0496109_0030192
2814 Ga0496109_0119903
2815 Ga0496110_0000897
2816 Ga0496110_0064141
2817 Ga0496110_0177063
2818 Ga0496111_0006350
2819 Ga0496112_0001650
2820 Ga0496112_0033130
2821 Ga0496112_0036483
2822 Ga0496112_0040595
2823 Ga0496113_0006167
2824 Ga0496113_0023536
2825 Ga0496113_0141040
2826 Ga0496114_0279364
2827 Ga0496115_0046082
2828 Ga0496115_0058899
2829 Ga0496115_0084681
2830 Ga0496116_0000057
2831 Ga0496116_0033391
2832 Ga0496117_0000031
2833 Ga0496117_0000035
2834 Ga0496118_0000054
2835 Ga0496118_0000208
2836 Ga0496118_0021158
2837 Ga0496118_0095560
2838 Ga0496119_0001742
2839 Ga0496120_0001350
2840 Ga0496120_0005474
2841 Ga0496120_0117392
2842 Ga0496121_0004095
2843 Ga0496121_0011702
2844 Ga0496122_0000023
2845 Ga0496122_0004894
2846 Ga0496123_0000027
2847 Ga0496123_0018182
2848 Ga0496125_0001899
2849 Ga0496125_0047340
2850 Ga0496125_0082673
2851 Ga0496126_0001469
2852 Ga0496126_0001514
2853 Ga0496126_0008444
2854 Ga0496126_0154782
2855 Ga0495682_0038985
2856 Ga0495682_0041426
2857 Ga0501031_0183289
2858 Ga0501032_0004235
2859 Ga0501033_0004380
2860 Ga0501033_0005550
2861 Ga0501034_0002524
2862 Ga0501034_0011934
2863 Ga0501034_0012973
2864 Ga0501034_0018184
2865 Ga0501034_0151613
2866 Ga0501036_0000952
2867 Ga0501036_0136224
2868 Ga0501037_0002978
2869 Ga0501038_0000048
2870 Ga0501038_0000619
2871 Ga0501039_0010233
2872 Ga0501039_0036795
2873 Ga0501040_0140012
2874 Ga0501041_0028234
2875 Ga0501042_0115466
2876 Ga0501043_0000347
2877 Ga0501046_0003161
2878 Ga0501047_0000261
2879 Ga0501047_0005907
2880 Ga0501067_0037067
2881 Ga0501067_0049168
2882 Ga0501069_0106418
2883 Ga0501070_0002167
2884 Ga0501071_0058442
2885 Ga0501072_0252753
2886 Ga0501072_0410288
2887 Ga0501074_0006292
2888 Ga0501075_0032307
2889 Ga0501075_0045154
2890 Ga0501075_0242211
2891 Ga0501075_0334845
2892 Ga0501076_0013524
2893 Ga0501076_0106789
2894 Ga0501079_0040224
2895 Ga0501079_0078780
2896 Ga0501080_0024570
2897 Ga0501080_0303533
2898 Ga0501081_0100733
2899 Ga0501035_0003457
2900 Ga0501035_0057137
2901 Ga0501044_0028927
2902 Ga0501044_0222462
2903 Ga0501045_0035593
2904 Ga0501045_0215627
2905 nmdc:mga03n38_32661_c1
2906 nmdc:mga00v17_15_c1
2907 nmdc:mga00v17_25504_c1
2908 nmdc:mga00v17_35588_c1
2909 nmdc:mga06z11_28285_c1
2910 nmdc:mga05p37_107661_c1
2911 nmdc:mga05p37_1139_c1
2912 nmdc:mga05p37_17501_c1
2913 nmdc:mga05p37_190031_c1
2914 nmdc:mga05p37_21578_c1
2915 nmdc:mga05p37_251652_c1
2916 nmdc:mga05p37_30845_c1
2917 nmdc:mga05p37_32441_c1
2918 nmdc:mga05p37_339387_c1
2919 nmdc:mga05p37_366500_c1
2920 nmdc:mga05p37_49_c1
2921 nmdc:mga05p37_51401_c1
2922 nmdc:mga05p37_66571_c1
2923 nmdc:mga05p37_69457_c1
2924 nmdc:mga05p37_70509_c1
2925 nmdc:mga05p37_9401_c1
2926 nmdc:mga05p37_94802_c1
2927 nmdc:mga09592_20042_c1
2928 nmdc:mga09592_2435_c1
2929 nmdc:mga09592_2888_c1
2930 nmdc:mga09592_29650_c1
2931 nmdc:mga09592_55716_c1
2932 nmdc:mga09592_6952_c1
2933 nmdc:mga09592_98582_c1
2934 nmdc:mga0qj67_100449_c1
2935 nmdc:mga0qj67_100594_c1
2936 nmdc:mga0qj67_119430_c1
2937 nmdc:mga0qj67_12577_c1
2938 nmdc:mga0qj67_16204_c1
2939 nmdc:mga0qj67_17549_c1
2940 nmdc:mga0qj67_290316_c1
2941 nmdc:mga0qj67_364633_c1
2942 nmdc:mga0qj67_5724_c1
2943 nmdc:mga06r32_144929_c1
2944 nmdc:mga06r32_15361_c1
2945 nmdc:mga06r32_165272_c1
2946 nmdc:mga06r32_17242_c1
2947 nmdc:mga06r32_247802_c1
2948 nmdc:mga06r32_31766_c1
2949 nmdc:mga06r32_329327_c1
2950 nmdc:mga06r32_37338_c1
2951 nmdc:mga06r32_3800_c2
2952 nmdc:mga06r32_67414_c1
2953 nmdc:mga06r32_86053_c1
2954 nmdc:mga08y16_11854_c1
2955 nmdc:mga08y16_122744_c1
2956 nmdc:mga08y16_128252_c1
2957 nmdc:mga08y16_17132_c1
2958 nmdc:mga08y16_180840_c1
2959 nmdc:mga08y16_22046_c1
2960 nmdc:mga08y16_293641_c1
2961 nmdc:mga08y16_32274_c1
2962 nmdc:mga08y16_32278_c1
2963 nmdc:mga08y16_48167_c1
2964 nmdc:mga08y16_50488_c1
2965 nmdc:mga08y16_60740_c1
2966 nmdc:mga08y16_67595_c1
2967 nmdc:mga08y16_9318_c1
2968 nmdc:mga0n895_1022_c1
2969 nmdc:mga0n895_11825_c1
2970 nmdc:mga0n895_121269_c1
2971 nmdc:mga0n895_13179_c1
2972 nmdc:mga0n895_138408_c1
2973 nmdc:mga0n895_14065_c1
2974 nmdc:mga0n895_208456_c1
2975 nmdc:mga0n895_39050_c1
2976 nmdc:mga0n895_436004_c1
2977 nmdc:mga0n895_6911_c1
2978 nmdc:mga0n895_81867_c1
2979 nmdc:mga0n895_844_c1
2980 nmdc:mga0rr50_11399_c1
2981 nmdc:mga0rr50_12325_c1
2982 nmdc:mga0rr50_16343_c1
2983 nmdc:mga0rr50_198028_c1
2984 nmdc:mga0rr50_2107_c1
2985 nmdc:mga0rr50_23_c1
2986 nmdc:mga0rr50_266194_c1
2987 nmdc:mga0rr50_29045_c1
2988 nmdc:mga0rr50_356_c1
2989 nmdc:mga08x19_103868_c1
2990 nmdc:mga08x19_131950_c1
2991 nmdc:mga08x19_165_c1
2992 nmdc:mga08x19_25_c1
2993 nmdc:mga08x19_4977_c1
2994 nmdc:mga08x19_577_c1
2995 nmdc:mga08x19_5806_c1
2996 nmdc:mga08x19_646_c1
2997 nmdc:mga0a205_137723_c1
2998 nmdc:mga0a205_16866_c1
2999 nmdc:mga0a205_180796_c1
3000 nmdc:mga0a205_25453_c1
3001 nmdc:mga0a205_27501_c1
3002 nmdc:mga0a205_323_c1
3003 nmdc:mga0a205_351822_c1
3004 nmdc:mga0a205_39867_c1
3005 nmdc:mga0a205_6239_c1
3006 nmdc:mga0a205_6436_c1
3007 nmdc:mga0a205_7354_c1
3008 nmdc:mga0a205_76706_c1
3009 nmdc:mga0sz30_62680_c1
3010 Ga0495601_0007830
3011 Ga0495612_0025414
3012 Ga0495595_0026163
3013 Ga0495619_0020393
3014 Ga0500643_015722
3015 Ga0500560_002917
3016 Ga0500560_003744
3017 Ga0500572_004591
3018 Ga0500595_000121
3019 Ga0500595_009623
3020 Ga0500597_008056
3021 Ga0500628_000737
3022 Ga0500577_0005877
3023 Ga0500616_0005395
3024 Ga0500624_000393
3025 Ga0500636_0000025
3026 Ga0500636_0004427
3027 Ga0501084_0028505
3028 Ga0501084_0204766
3029 Ga0500661_002485
3030 Ga0590071_000285
3031 Ga0501082_0056401
3032 2537873611
3033 2601610906
3034 2601747680
3035 2643921542
3036 2740994242
3037 2808988156
3038 2831428567
3039 2838678603
3040 2838718309
3041 2838722899
3042 2838728375
3043 2841850455
3044 2841863292
3045 2842129035
3046 2842133496
3047 2842155593
3048 2842174449
3049 2842179110
3050 2842190733
3051 2842214943
3052 2842227664
3053 2842519971
3054 2848699582
3055 2849663763
3056 2884217039
3057 2899795389
3058 2899849368
3059 2919118434
3060 2926754963
3061 2933010559
3062 2933015769
3063 2933597493
3064 2935392915
3065 2979092603
3066 2979100006
3067 2984513628
3068 2984522791
3069 2984542098
3070 2984601528
3071 2995464776
3072 3006486689
3073 8002779563
3074 8003573705
3075 8025481942
3076 8054463744

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

310

432

0.99

PF00108

Thiolase_N

Thiolase, N-terminal domain

70

303

0.96

PF00108

Thiolase_N

Thiolase, N-terminal domain

8

59

0.93

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

25

164

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wua-assembly1.cif.gz_A structure of the peroxisomal 3-ketoacyl-coa thiolase from sunflower 0.9577 1 391
2wu9-assembly1.cif.gz_B crystal structure of peroxisomal kat2 from arabidopsis thaliana 0.9562 2 391
4e1l-assembly1.cif.gz_D crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile 0.9546 1 391
2iik-assembly1.cif.gz_B crystal structure of human peroxisomal acetyl-coa acyl transferase 1 (acaa1) 0.9535 2 392
4ubt-assembly3.cif.gz_D structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with a steroid and coa. 0.953 1 392
ID Description Score Start End Superfamily
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9866 276 386 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9863 265 392 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9833 276 386 3.40.47.10
af_Q2G1D0_1_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9796 1 392 3.40.47.10
af_Q2G1D0_1_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9771 1 392 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7V4PRG6-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9913 271 392 GO:0003988
GO:0006635
GO:0010124
AF-X1NTI0-F1-model_v4 Electron transfer flavoprotein alpha/beta-subunit N-terminal domain-containing protein 0.9899 269 392 GO:0016747
AF-A0A1F7L7J7-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9898 281 390 GO:0003988
GO:0006635
GO:0010124
AF-A0A3M1N5H7-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9879 44 392 GO:0003988
GO:0006635
GO:0010124
AF-A0A7X6WFA2-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 0.9875 282 391 GO:0003985
GO:0006635
GO:0010124

Map