F494623

General Info

Members Datasets Scaffolds Average Seq Length
1534 535 1484 326

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10167744|Ga0111539_101677442
Length 383
Sequence MLLVTGGAGFIGSNVVAGLNEAGRADIAVCDELGSGQKWRNLAKRQLADIVPPQALASWLDQRKLDAVIHLGAISDTTATDADLVVETNFRLSLRLLDWCTASRTPFIYASSAATYGAGTDGFGDDWSPDALRRLRPMNLYGWSKHLFDLVLVERQRRGLSLPPQWAGLKFFNVFGPNEYHKGEMMSLVAKRFDDAKAGRPVRLFKSHRAGIGDGEQKRDFIYVDDAVAVVRWLIETPAVSGIFNVGTGAARSFRDLVVAMFRALGQPENIEYIDMPGAIRDQYQYFTQAEIENLRRAGYNAGFTPLEDAVTRYVTQYLNCADRYCFALEATPGESQCPPPHTALISTSQNSPIRRCSASAISCSMSSTTVVSRASLRKPRRR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
9 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
10 2643221651 Afipia sp. Root123D2 Isolate Unclassified
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2791355199
13 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
14 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
15 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
16 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
17 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
18 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
19 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
20 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
21 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
22 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
23 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
24 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
25 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
26 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
27 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
28 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
29 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
30 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
31 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
32 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
33 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
34 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
35 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
36 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
37 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
38 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
39 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
40 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
41 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
42 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
43 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
44 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
78 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
82 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
83 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
84 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
85 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
86 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
101 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
126 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
127 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
149 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
150 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
151 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
172 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
178 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
179 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
260 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
261 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
264 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
265 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
268 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
269 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
270 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
271 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
272 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
273 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
274 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
275 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
276 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
279 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
280 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
281 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
282 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
283 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
284 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
285 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
288 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
289 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
313 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
319 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
320 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
323 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
324 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
325 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
326 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
327 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
328 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
329 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
330 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
331 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
332 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
335 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
336 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
337 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
338 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
353 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
354 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
369 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
370 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
371 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
377 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
384 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
401 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
402 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
403 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
461 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
470 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
480 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
481 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
482 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
485 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
486 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
487 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
488 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
489 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
490 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
491 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
492 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
493 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
494 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
495 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
496 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
497 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
498 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
499 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
500 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
501 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
502 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
503 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
504 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
505 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
506 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
507 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
510 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
511 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
512 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
516 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
517 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
518 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
519 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
520 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
521 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
522 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
523 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
524 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
525 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
526 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
527 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
528 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
529 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
530 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
531 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
532 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
533 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
534 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
535 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 2.15
Rhizoplane 5.28
Rhizosphere 79.66
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214884083 2209111006 Bacteria 7726
2 ARSoilYngRDRAFT_c00098 3300000042 Bacteria 14978
3 ARcpr5yngRDRAFT_c000086 3300000043 Bacteria 15101
4 ARSoilOldRDRAFT_c000048 3300000044 Bacteria 25523
5 ARCol0yngRDRAFT_1000082 3300000652 Bacteria 17764
6 JGI24737J22298_10004234 3300001990 Bacteria 5016
7 JGI25159J45721_1002373 3300002987 Bacteria 7180
8 JGI25406J46586_10001807 3300003203 Bacteria 10044
9 JGI25153J46596_10000487 3300003215 Bacteria 25456
10 rootL2_10035570 3300003322 Bacteria 11728
11 JGI25160J50197_1008548 3300003354 Bacteria 3892
12 JGI25404J52841_10000331 3300003659 Bacteria 6283
13 Ga0055539_1008792 3300003752 Bacteria 1260
14 Ga0065165_1015151 3300005262 Bacteria 2954
15 Ga0065712_10014527 3300005290 Bacteria 1832
16 Ga0065712_10072242 3300005290 Bacteria 4838
17 Ga0065715_10125584 3300005293 Bacteria 2127
18 Ga0070676_10044069 3300005328 Bacteria 2595
19 Ga0070676_10162263 3300005328 Bacteria 1439
20 Ga0070683_100021496 3300005329 Bacteria 5760
21 Ga0070683_100028246 3300005329 Bacteria 5068
22 Ga0070683_100448137 3300005329 Bacteria 1232
23 Ga0070690_100097844 3300005330 Bacteria 1941
24 Ga0070690_100129280 3300005330 Bacteria 1704
25 Ga0070690_100227422 3300005330 Bacteria 1310
26 Ga0070670_100017111 3300005331 Bacteria 6221
27 Ga0070670_100043084 3300005331 Bacteria 3880
28 Ga0070670_100110755 3300005331 Bacteria 2365
29 Ga0068869_100072512 3300005334 Bacteria 2551
30 Ga0068869_100192242 3300005334 Bacteria 1605
31 Ga0070666_10007621 3300005335 Bacteria 6679
32 Ga0070666_10083456 3300005335 Bacteria 2186
33 Ga0070666_10191800 3300005335 Bacteria 1436
34 Ga0070680_100029644 3300005336 Bacteria 4394
35 Ga0070680_100077189 3300005336 Bacteria 2744
36 Ga0070680_100099444 3300005336 Bacteria 2413
37 Ga0068868_100029584 3300005338 Bacteria 4195
38 Ga0068868_100062206 3300005338 Bacteria 2958
39 Ga0070660_100050510 3300005339 Bacteria 3200
40 Ga0070689_100010962 3300005340 Bacteria 6478
41 Ga0070689_100016023 3300005340 Bacteria 5480
42 Ga0070689_100038918 3300005340 Bacteria 3639
43 Ga0070689_100040581 3300005340 Bacteria 3569
44 Ga0070689_100065050 3300005340 Bacteria 2839
45 Ga0070691_10074836 3300005341 Bacteria 1648
46 Ga0070687_100013740 3300005343 Bacteria 3617
47 Ga0070687_100076060 3300005343 Bacteria 1817
48 Ga0070661_100025301 3300005344 Bacteria 4264
49 Ga0070668_100025278 3300005347 Bacteria 4501
50 Ga0070668_100102669 3300005347 Bacteria 2267
51 Ga0070668_100139262 3300005347 Bacteria 1954
52 Ga0070668_100144764 3300005347 Bacteria 1917
53 Ga0070668_100219007 3300005347 Bacteria 1569
54 Ga0070669_100054343 3300005353 Bacteria 2933
55 Ga0070675_100029836 3300005354 Bacteria 4399
56 Ga0070675_100064011 3300005354 Bacteria 3040
57 Ga0070671_100003119 3300005355 Bacteria 12909
58 Ga0070671_100021146 3300005355 Bacteria 5312
59 Ga0070671_100045329 3300005355 Bacteria 3655
60 Ga0070674_100002557 3300005356 Bacteria 10071
61 Ga0070674_100090856 3300005356 Bacteria 2203
62 Ga0070673_100020397 3300005364 Bacteria 4781
63 Ga0070673_100475891 3300005364 Bacteria 1127
64 Ga0070688_100003579 3300005365 Bacteria 8013
65 Ga0070688_100181163 3300005365 Bacteria 1461
66 Ga0070659_100033865 3300005366 Bacteria 3971
67 Ga0070667_100420976 3300005367 Bacteria 1217
68 Ga0070703_10037630 3300005406 Bacteria 1492
69 Ga0070709_10000509 3300005434 Bacteria 22971
70 Ga0070709_10002226 3300005434 Bacteria 10506
71 Ga0070709_10011378 3300005434 Bacteria 4958
72 Ga0070709_10050661 3300005434 Bacteria 2602
73 Ga0070709_10081358 3300005434 Bacteria 2114
74 Ga0070709_10098674 3300005434 Bacteria 1942
75 Ga0070709_10273150 3300005434 Bacteria 1225
76 Ga0070714_100003312 3300005435 Bacteria 12013
77 Ga0070714_100022109 3300005435 Bacteria 5211
78 Ga0070714_100070998 3300005435 Bacteria 3011
79 Ga0070714_100203947 3300005435 Bacteria 1810
80 Ga0070714_100236571 3300005435 Bacteria 1684
81 Ga0070714_100331926 3300005435 Bacteria 1424
82 Ga0070714_100336179 3300005435 Bacteria 1415
83 Ga0070713_100000538 3300005436 Bacteria 24007
84 Ga0070713_100001696 3300005436 Bacteria 14162
85 Ga0070713_100027160 3300005436 Bacteria 4503
86 Ga0070713_100041422 3300005436 Bacteria 3752
87 Ga0070713_100042540 3300005436 Bacteria 3709
88 Ga0070713_100064977 3300005436 Bacteria 3063
89 Ga0070713_100227739 3300005436 Bacteria 1693
90 Ga0070713_100293520 3300005436 Bacteria 1495
91 Ga0070713_100296596 3300005436 Bacteria 1487
92 Ga0070713_100362381 3300005436 Bacteria 1347
93 Ga0070710_10001354 3300005437 Bacteria 11558
94 Ga0070710_10012316 3300005437 Bacteria 4243
95 Ga0070710_10020598 3300005437 Bacteria 3424
96 Ga0070710_10032801 3300005437 Bacteria 2816
97 Ga0070710_10068681 3300005437 Bacteria 2037
98 Ga0070701_10072260 3300005438 Bacteria 1847
99 Ga0070701_10117689 3300005438 Bacteria 1493
100 Ga0070711_100003821 3300005439 Bacteria 8844
101 Ga0070711_100011119 3300005439 Bacteria 5584
102 Ga0070711_100025633 3300005439 Bacteria 3860
103 Ga0070711_100026452 3300005439 Bacteria 3803
104 Ga0070711_100045359 3300005439 Bacteria 2990
105 Ga0070711_100152549 3300005439 Bacteria 1744
106 Ga0070711_100156735 3300005439 Bacteria 1722
107 Ga0070705_100039403 3300005440 Bacteria 2680
108 Ga0070705_100100330 3300005440 Bacteria 1826
109 Ga0070705_100108050 3300005440 Bacteria 1771
110 Ga0070700_100007014 3300005441 Bacteria 6050
111 Ga0070700_100053234 3300005441 Bacteria 2525
112 Ga0070708_100006143 3300005445 Bacteria 9556
113 Ga0070708_100024183 3300005445 Bacteria 5176
114 Ga0070708_100154601 3300005445 Bacteria 2135
115 Ga0070663_100006797 3300005455 Bacteria 6912
116 Ga0070663_100043820 3300005455 Bacteria 3150
117 Ga0070663_100062956 3300005455 Bacteria 2676
118 Ga0070663_100162438 3300005455 Bacteria 1720
119 Ga0070663_100301490 3300005455 Bacteria 1283
120 Ga0070678_100022783 3300005456 Bacteria 4159
121 Ga0070678_100055373 3300005456 Bacteria 2895
122 Ga0070678_100337228 3300005456 Bacteria 1292
123 Ga0070662_100011242 3300005457 Bacteria 5900
124 Ga0070662_100223923 3300005457 Bacteria 1502
125 Ga0070681_10039483 3300005458 Bacteria 4731
126 Ga0070681_10047909 3300005458 Bacteria 4271
127 Ga0070681_10051123 3300005458 Bacteria 4122
128 Ga0070681_10110680 3300005458 Bacteria 2686
129 Ga0068867_100033723 3300005459 Bacteria 3709
130 Ga0070685_10036133 3300005466 Bacteria 2791
131 Ga0070685_10145315 3300005466 Bacteria 1497
132 Ga0070685_10183209 3300005466 Bacteria 1350
133 Ga0070706_100040304 3300005467 Bacteria 4311
134 Ga0070707_100049530 3300005468 Bacteria 4027
135 Ga0070698_100056017 3300005471 Bacteria 3996
136 Ga0070698_100107280 3300005471 Bacteria 2760
137 Ga0070699_100000676 3300005518 Bacteria 31923
138 Ga0070699_100311481 3300005518 Bacteria 1413
139 Ga0070679_100038866 3300005530 Bacteria 4731
140 Ga0070679_100085711 3300005530 Bacteria 3137
141 Ga0070679_100107171 3300005530 Bacteria 2780
142 Ga0070679_100109721 3300005530 Bacteria 2745
143 Ga0070679_100148576 3300005530 Bacteria 2320
144 Ga0070684_100004031 3300005535 Bacteria 11116
145 Ga0070684_100021333 3300005535 Bacteria 5388
146 Ga0070684_100129024 3300005535 Bacteria 2280
147 Ga0070684_100199619 3300005535 Bacteria 1822
148 Ga0070684_100205607 3300005535 Bacteria 1794
149 Ga0070684_100270120 3300005535 Bacteria 1556
150 Ga0070684_100373045 3300005535 Bacteria 1314
151 Ga0068853_100004863 3300005539 Bacteria 10442
152 Ga0068853_100021935 3300005539 Bacteria 5327
153 Ga0068853_100036973 3300005539 Bacteria 4153
154 Ga0068853_100069653 3300005539 Bacteria 3060
155 Ga0070672_100045947 3300005543 Bacteria 3381
156 Ga0070672_100095742 3300005543 Bacteria 2401
157 Ga0070672_100246221 3300005543 Bacteria 1505
158 Ga0070672_100258535 3300005543 Bacteria 1468
159 Ga0070686_100005455 3300005544 Bacteria 7043
160 Ga0070686_100010968 3300005544 Bacteria 5130
161 Ga0070696_100104723 3300005546 Bacteria 2032
162 Ga0070693_100061469 3300005547 Bacteria 2184
163 Ga0070665_100079561 3300005548 Bacteria 3283
164 Ga0070665_100089345 3300005548 Bacteria 3087
165 Ga0070665_100442794 3300005548 Bacteria 1308
166 Ga0070704_100008183 3300005549 Bacteria 6257
167 Ga0070704_100138024 3300005549 Bacteria 1899
168 Ga0068855_100013119 3300005563 Bacteria 9993
169 Ga0068855_100110088 3300005563 Bacteria 3162
170 Ga0068855_100152379 3300005563 Bacteria 2628
171 Ga0068855_100290290 3300005563 Bacteria 1813
172 Ga0070664_100080565 3300005564 Bacteria 2805
173 Ga0070664_100124211 3300005564 Bacteria 2262
174 Ga0070664_100296469 3300005564 Bacteria 1460
175 Ga0070664_100330346 3300005564 Bacteria 1383
176 Ga0070664_100395748 3300005564 Bacteria 1263
177 Ga0070664_100421072 3300005564 Unclassified 1223
178 Ga0068857_100002370 3300005577 Bacteria 15359
179 Ga0068857_100009393 3300005577 Bacteria 8489
180 Ga0068857_100071902 3300005577 Bacteria 3083
181 Ga0068857_100320026 3300005577 Bacteria 1432
182 Ga0068854_100028344 3300005578 Bacteria 3868
183 Ga0068854_100035005 3300005578 Bacteria 3513
184 Ga0068854_100404105 3300005578 Bacteria 1131
185 Ga0068856_100000780 3300005614 Bacteria 34542
186 Ga0068856_100021983 3300005614 Bacteria 6201
187 Ga0068856_100029786 3300005614 Bacteria 5333
188 Ga0068856_100081399 3300005614 Bacteria 3212
189 Ga0068856_100174091 3300005614 Bacteria 2165
190 Ga0068856_100216509 3300005614 Bacteria 1930
191 Ga0068856_100319407 3300005614 Bacteria 1570
192 Ga0070702_100018944 3300005615 Bacteria 3578
193 Ga0068852_100107680 3300005616 Bacteria 2529
194 Ga0068859_100032401 3300005617 Bacteria 5250
195 Ga0068861_100028109 3300005719 Bacteria 4102
196 Ga0068851_10013595 3300005834 Bacteria 3853
197 Ga0068870_10130626 3300005840 Bacteria 1458
198 Ga0068863_100099967 3300005841 Bacteria 2757
199 Ga0068863_100246949 3300005841 Bacteria 1723
200 Ga0068863_100513802 3300005841 Bacteria 1180
201 Ga0068858_100067981 3300005842 Bacteria 3301
202 Ga0068858_100244723 3300005842 Bacteria 1702
203 Ga0068858_100532490 3300005842 Bacteria 1137
204 Ga0068860_100075857 3300005843 Bacteria 3197
205 Ga0068860_100275375 3300005843 Bacteria 1643
206 Ga0068862_100016209 3300005844 Bacteria 6199
207 Ga0068862_100501227 3300005844 Bacteria 1152
208 Ga0081455_10000659 3300005937 Bacteria 44728
209 Ga0081455_10002315 3300005937 Bacteria 22718
210 Ga0081455_10002747 3300005937 Bacteria 20769
211 Ga0081455_10003763 3300005937 Bacteria 17325
212 Ga0081455_10017750 3300005937 Bacteria 6807
213 Ga0081455_10038127 3300005937 Bacteria 4257
214 Ga0081455_10238741 3300005937 Bacteria 1337
215 Ga0081540_1000003 3300005983 Bacteria 233942
216 Ga0081540_1003893 3300005983 Bacteria 11631
217 Ga0081540_1004729 3300005983 Bacteria 10295
218 Ga0081540_1014288 3300005983 Bacteria 5097
219 Ga0081540_1015004 3300005983 Bacteria 4923
220 Ga0081540_1015322 3300005983 Bacteria 4858
221 Ga0081540_1023367 3300005983 Bacteria 3618
222 Ga0081540_1024105 3300005983 Bacteria 3539
223 Ga0081540_1038349 3300005983 Bacteria 2526
224 Ga0081540_1057966 3300005983 Bacteria 1869
225 Ga0081540_1071051 3300005983 Bacteria 1610
226 Ga0081539_10000008 3300005985 Bacteria 525071
227 Ga0081539_10006916 3300005985 Bacteria 10566
228 Ga0081539_10010135 3300005985 Bacteria 7725
229 Ga0081539_10016204 3300005985 Bacteria 5344
230 Ga0081539_10078586 3300005985 Bacteria 1741
231 Ga0070717_10000815 3300006028 Bacteria 20535
232 Ga0070717_10021096 3300006028 Bacteria 5132
233 Ga0070717_10065763 3300006028 Bacteria 3014
234 Ga0070717_10098689 3300006028 Bacteria 2476
235 Ga0070717_10287224 3300006028 Bacteria 1460
236 Ga0075365_10000242 3300006038 Bacteria 18677
237 Ga0075365_10029260 3300006038 Bacteria 3519
238 Ga0075368_10027568 3300006042 Bacteria 2192
239 Ga0075363_100024654 3300006048 Bacteria 3060
240 Ga0075363_100059080 3300006048 Bacteria 2061
241 Ga0075364_10048549 3300006051 Bacteria 2766
242 Ga0075364_10158271 3300006051 Bacteria 1528
243 Ga0070715_10000234 3300006163 Bacteria 13251
244 Ga0070716_100001371 3300006173 Bacteria 10813
245 Ga0070716_100093009 3300006173 Bacteria 1829
246 Ga0070712_100002949 3300006175 Bacteria 10539
247 Ga0070712_100005993 3300006175 Bacteria 7520
248 Ga0070712_100017387 3300006175 Bacteria 4656
249 Ga0070712_100043102 3300006175 Bacteria 3105
250 Ga0070712_100050528 3300006175 Bacteria 2893
251 Ga0070712_100221855 3300006175 Bacteria 1497
252 Ga0070712_100379631 3300006175 Bacteria 1163
253 Ga0075362_10001713 3300006177 Bacteria 7110
254 Ga0075362_10051567 3300006177 Bacteria 1842
255 Ga0075367_10057343 3300006178 Bacteria 2316
256 Ga0075367_10084632 3300006178 Bacteria 1923
257 Ga0075367_10141784 3300006178 Bacteria 1489
258 Ga0075367_10194180 3300006178 Bacteria 1267
259 Ga0075366_10015635 3300006195 Bacteria 4354
260 Ga0097621_100096666 3300006237 Bacteria 2478
261 Ga0097621_100129398 3300006237 Bacteria 2147
262 Ga0097621_100416881 3300006237 Bacteria 1205
263 Ga0075370_10030883 3300006353 Bacteria 2990
264 Ga0068871_100010107 3300006358 Bacteria 6866
265 Ga0068871_100042409 3300006358 Bacteria 3652
266 Ga0068871_100134519 3300006358 Bacteria 2099
267 Ga0075428_100011670 3300006844 Bacteria 9778
268 Ga0075428_100432883 3300006844 Bacteria 1409
269 Ga0075430_100000001 3300006846 Bacteria 185803
270 Ga0075430_100004445 3300006846 Bacteria 11828
271 Ga0075430_100022548 3300006846 Bacteria 5359
272 Ga0075430_100066797 3300006846 Bacteria 3020
273 Ga0075431_100001191 3300006847 Bacteria 23471
274 Ga0075431_100010046 3300006847 Bacteria 9508
275 Ga0075431_100021984 3300006847 Bacteria 6522
276 Ga0075431_100340666 3300006847 Bacteria 1509
277 Ga0075431_100352663 3300006847 Bacteria 1479
278 Ga0075433_10003020 3300006852 Bacteria 12926
279 Ga0075434_100007759 3300006871 Bacteria 9938
280 Ga0075434_100044201 3300006871 Bacteria 4420
281 Ga0075429_100003393 3300006880 Bacteria 13578
282 Ga0075429_100064925 3300006880 Bacteria 3178
283 Ga0068865_100097443 3300006881 Bacteria 2146
284 Ga0068865_100224404 3300006881 Bacteria 1470
285 Ga0075436_100002402 3300006914 Bacteria 12912
286 Ga0075436_100060762 3300006914 Bacteria 2610
287 Ga0075436_100065205 3300006914 Bacteria 2518
288 Ga0075436_100265563 3300006914 Bacteria 1224
289 Ga0097620_100032402 3300006931 Bacteria 5250
290 Ga0075435_100317555 3300007076 Bacteria 1333
291 Ga0075435_100403504 3300007076 Bacteria 1176
292 Ga0099794_10022019 3300007265 Bacteria 2901
293 Ga0099795_10009678 3300007788 Bacteria 2807
294 Ga0099795_10017418 3300007788 Bacteria 2290
295 Ga0099795_10020009 3300007788 Bacteria 2174
296 Ga0099795_10037739 3300007788 Bacteria 1702
297 Ga0105240_10014285 3300009093 Bacteria 10844
298 Ga0105240_10020795 3300009093 Bacteria 8741
299 Ga0105240_10066581 3300009093 Bacteria 4468
300 Ga0105240_10133416 3300009093 Bacteria 2976
301 Ga0105240_10417260 3300009093 Bacteria 1509
302 Ga0111539_10001617 3300009094 Bacteria 30090
303 Ga0111539_10004446 3300009094 Bacteria 18317
304 Ga0111539_10062850 3300009094 Bacteria 4394
305 Ga0111539_10088673 3300009094 Bacteria 3635
306 Ga0111539_10102681 3300009094 Bacteria 3356
307 Ga0111539_10167744 3300009094 Bacteria 2566
308 Ga0111539_10208128 3300009094 Bacteria 2280
309 Ga0111539_10282285 3300009094 Bacteria 1932
310 Ga0111539_10346264 3300009094 Bacteria 1730
311 Ga0105245_10116736 3300009098 Bacteria 2489
312 Ga0105245_10124352 3300009098 Bacteria 2413
313 Ga0105245_10131448 3300009098 Bacteria 2348
314 Ga0105245_10149612 3300009098 Bacteria 2206
315 Ga0105245_10229147 3300009098 Bacteria 1796
316 Ga0105247_10033382 3300009101 Bacteria 3130
317 Ga0105247_10079870 3300009101 Bacteria 2059
318 Ga0105247_10206924 3300009101 Bacteria 1321
319 Ga0114129_10000067 3300009147 Bacteria 93755
320 Ga0114129_10000707 3300009147 Bacteria 42108
321 Ga0114129_10013399 3300009147 Bacteria 11685
322 Ga0114129_10040152 3300009147 Bacteria 6597
323 Ga0105243_10012416 3300009148 Bacteria 6439
324 Ga0105243_10039792 3300009148 Bacteria 3668
325 Ga0105241_10003647 3300009174 Bacteria 11434
326 Ga0105241_10281687 3300009174 Bacteria 1420
327 Ga0105242_10008510 3300009176 Bacteria 7878
328 Ga0105248_10013566 3300009177 Bacteria 8972
329 Ga0105248_10064455 3300009177 Bacteria 4114
330 Ga0105248_10608941 3300009177 Bacteria 1232
331 Ga0105237_10027598 3300009545 Bacteria 5792
332 Ga0105237_10051061 3300009545 Bacteria 4156
333 Ga0105237_10063062 3300009545 Bacteria 3704
334 Ga0105237_10085442 3300009545 Bacteria 3145
335 Ga0105237_10118799 3300009545 Bacteria 2638
336 Ga0105237_10179347 3300009545 Bacteria 2118
337 Ga0105237_10294344 3300009545 Bacteria 1626
338 Ga0105238_10019168 3300009551 Bacteria 6969
339 Ga0105238_10031479 3300009551 Bacteria 5401
340 Ga0105238_10066692 3300009551 Bacteria 3600
341 Ga0105238_10069141 3300009551 Bacteria 3532
342 Ga0105238_10073402 3300009551 Bacteria 3416
343 Ga0105238_10086803 3300009551 Bacteria 3116
344 Ga0105249_10027543 3300009553 Bacteria 5127
345 Ga0105249_10047216 3300009553 Bacteria 3923
346 Ga0105249_10301794 3300009553 Bacteria 1606
347 Ga0105249_10356404 3300009553 Bacteria 1483
348 Ga0105249_10374243 3300009553 Bacteria 1449
349 Ga0099796_10000883 3300010159 Bacteria 5561
350 Ga0099796_10007449 3300010159 Bacteria 2862
351 Ga0099796_10019458 3300010159 Bacteria 2058
352 Ga0099796_10079182 3300010159 Bacteria 1201
353 Ga0105239_10010188 3300010375 Bacteria 10530
354 Ga0105239_10026875 3300010375 Bacteria 6334
355 Ga0105239_10264808 3300010375 Bacteria 1932
356 Ga0105239_10381254 3300010375 Bacteria 1594
357 Ga0157373_10018231 3300013100 Bacteria 5112
358 Ga0157373_10082428 3300013100 Bacteria 2267
359 Ga0157370_10068122 3300013104 Bacteria 3364
360 Ga0157370_10072039 3300013104 Bacteria 3260
361 Ga0157369_10004285 3300013105 Bacteria 16864
362 Ga0157369_10023392 3300013105 Bacteria 6881
363 Ga0157369_10156980 3300013105 Bacteria 2403
364 Ga0157374_10157143 3300013296 Bacteria 2214
365 Ga0157374_10560657 3300013296 Bacteria 1150
366 Ga0157378_10008253 3300013297 Bacteria 9081
367 Ga0157378_10042454 3300013297 Bacteria 4037
368 Ga0157378_10131499 3300013297 Bacteria 2317
369 Ga0157372_10110467 3300013307 Bacteria 3149
370 Ga0157372_10440085 3300013307 Bacteria 1519
371 Ga0157375_10117353 3300013308 Bacteria 2766
372 Ga0157375_10154369 3300013308 Bacteria 2433
373 Ga0157375_10261845 3300013308 Bacteria 1891
374 Ga0157375_10307934 3300013308 Bacteria 1748
375 Ga0163163_10001661 3300014325 Bacteria 18758
376 Ga0163163_10016186 3300014325 Bacteria 6923
377 Ga0163163_10056807 3300014325 Bacteria 3868
378 Ga0163163_10064588 3300014325 Bacteria 3632
379 Ga0163163_10142927 3300014325 Bacteria 2435
380 Ga0163163_10174498 3300014325 Bacteria 2196
381 Ga0157380_10082968 3300014326 Bacteria 2624
382 Ga0182008_10042288 3300014497 Bacteria 2271
383 Ga0182008_10138590 3300014497 Bacteria 1216
384 Ga0157379_10139874 3300014968 Bacteria 2182
385 Ga0157376_10325574 3300014969 Bacteria 1462
386 Ga0157376_10342095 3300014969 Bacteria 1429
387 Ga0163161_10067955 3300017792 Bacteria 2603
388 Ga0163161_10249962 3300017792 Bacteria 1382
389 Ga0213874_10022482 3300021377 Bacteria 1750
390 Ga0213876_10059153 3300021384 Bacteria 2023
391 Ga0213876_10081939 3300021384 Bacteria 1707
392 Ga0213875_10000003 3300021388 Bacteria 719367
393 Ga0213875_10000963 3300021388 Bacteria 20574
394 Ga0213875_10004091 3300021388 Bacteria 8107
395 Ga0213875_10042586 3300021388 Bacteria 2132
396 Ga0213875_10044493 3300021388 Bacteria 2085
397 Ga0213875_10066342 3300021388 Bacteria 1686
398 Ga0213875_10103911 3300021388 Bacteria 1326
399 Ga0209677_100819 3300025253 Bacteria 15519
400 Ga0209148_1013398 3300025254 Bacteria 1475
401 Ga0209233_1001793 3300025261 Bacteria 8273
402 Ga0209233_1010271 3300025261 Bacteria 2815
403 Ga0209130_1000512 3300025284 Bacteria 39134
404 Ga0209025_1042940 3300025294 Bacteria 1913
405 Ga0209564_1000468 3300025295 Bacteria 67696
406 Ga0209758_1000183 3300025297 Bacteria 140623
407 Ga0209758_1006960 3300025297 Bacteria 7882
408 Ga0209758_1014185 3300025297 Bacteria 4264
409 Ga0207426_1000181 3300025302 Bacteria 158308
410 Ga0207697_10057200 3300025315 Bacteria 1619
411 Ga0207697_10067229 3300025315 Bacteria 1498
412 Ga0207682_10003795 3300025893 Bacteria 6489
413 Ga0207682_10006890 3300025893 Bacteria 4559
414 Ga0207692_10037614 3300025898 Bacteria 2368
415 Ga0207692_10049572 3300025898 Bacteria 2120
416 Ga0207692_10058438 3300025898 Bacteria 1987
417 Ga0207692_10062040 3300025898 Bacteria 1939
418 Ga0207692_10062452 3300025898 Bacteria 1933
419 Ga0207710_10069257 3300025900 Bacteria 1615
420 Ga0207688_10033577 3300025901 Bacteria 2839
421 Ga0207688_10078748 3300025901 Bacteria 1879
422 Ga0207688_10100816 3300025901 Bacteria 1667
423 Ga0207647_10000586 3300025904 Bacteria 28285
424 Ga0207647_10013944 3300025904 Bacteria 5560
425 Ga0207685_10036457 3300025905 Bacteria 1804
426 Ga0207685_10053274 3300025905 Bacteria 1571
427 Ga0207685_10056756 3300025905 Bacteria 1534
428 Ga0207699_10003724 3300025906 Bacteria 7282
429 Ga0207699_10008586 3300025906 Bacteria 5049
430 Ga0207699_10028083 3300025906 Bacteria 3123
431 Ga0207699_10029104 3300025906 Bacteria 3077
432 Ga0207699_10032883 3300025906 Bacteria 2926
433 Ga0207645_10021613 3300025907 Bacteria 4194
434 Ga0207645_10106342 3300025907 Bacteria 1814
435 Ga0207643_10002121 3300025908 Bacteria 10919
436 Ga0207643_10026134 3300025908 Bacteria 3231
437 Ga0207705_10149094 3300025909 Bacteria 1751
438 Ga0207684_10123987 3300025910 Bacteria 2216
439 Ga0207684_10457474 3300025910 Bacteria 1095
440 Ga0207654_10001537 3300025911 Bacteria 12141
441 Ga0207654_10007167 3300025911 Bacteria 5615
442 Ga0207654_10047272 3300025911 Bacteria 2458
443 Ga0207654_10051528 3300025911 Bacteria 2369
444 Ga0207707_10025624 3300025912 Bacteria 5158
445 Ga0207707_10094218 3300025912 Bacteria 2616
446 Ga0207707_10153484 3300025912 Bacteria 2013
447 Ga0207695_10001321 3300025913 Bacteria 42037
448 Ga0207695_10167106 3300025913 Bacteria 2127
449 Ga0207695_10267868 3300025913 Bacteria 1604
450 Ga0207671_10057530 3300025914 Bacteria 2882
451 Ga0207671_10066562 3300025914 Bacteria 2682
452 Ga0207693_10001110 3300025915 Bacteria 24219
453 Ga0207693_10002459 3300025915 Bacteria 16095
454 Ga0207693_10004318 3300025915 Bacteria 12030
455 Ga0207693_10014440 3300025915 Bacteria 6350
456 Ga0207693_10018111 3300025915 Bacteria 5613
457 Ga0207693_10033844 3300025915 Bacteria 4031
458 Ga0207693_10034658 3300025915 Bacteria 3982
459 Ga0207693_10036064 3300025915 Bacteria 3897
460 Ga0207693_10042723 3300025915 Bacteria 3568
461 Ga0207693_10190445 3300025915 Bacteria 1614
462 Ga0207693_10209947 3300025915 Bacteria 1530
463 Ga0207693_10320994 3300025915 Bacteria 1212
464 Ga0207663_10000147 3300025916 Bacteria 32518
465 Ga0207663_10020922 3300025916 Bacteria 3714
466 Ga0207663_10023180 3300025916 Bacteria 3558
467 Ga0207663_10036829 3300025916 Bacteria 2945
468 Ga0207663_10093465 3300025916 Bacteria 2002
469 Ga0207663_10202520 3300025916 Bacteria 1433
470 Ga0207660_10015387 3300025917 Bacteria 5048
471 Ga0207660_10032760 3300025917 Bacteria 3589
472 Ga0207660_10186834 3300025917 Bacteria 1612
473 Ga0207662_10035148 3300025918 Bacteria 2926
474 Ga0207662_10036437 3300025918 Bacteria 2875
475 Ga0207657_10008445 3300025919 Bacteria 10445
476 Ga0207657_10008926 3300025919 Bacteria 10129
477 Ga0207652_10018923 3300025921 Bacteria 5654
478 Ga0207652_10140260 3300025921 Bacteria 2161
479 Ga0207646_10012265 3300025922 Bacteria 8244
480 Ga0207646_10195069 3300025922 Bacteria 1829
481 Ga0207681_10035007 3300025923 Bacteria 3307
482 Ga0207681_10121976 3300025923 Bacteria 1913
483 Ga0207694_10000135 3300025924 Bacteria 75715
484 Ga0207694_10040754 3300025924 Bacteria 3577
485 Ga0207694_10353470 3300025924 Bacteria 1217
486 Ga0207650_10013416 3300025925 Bacteria 5673
487 Ga0207650_10027086 3300025925 Bacteria 4099
488 Ga0207650_10045621 3300025925 Bacteria 3224
489 Ga0207650_10051128 3300025925 Bacteria 3057
490 Ga0207659_10124048 3300025926 Bacteria 1983
491 Ga0207687_10090783 3300025927 Bacteria 2227
492 Ga0207687_10322240 3300025927 Bacteria 1251
493 Ga0207700_10000913 3300025928 Bacteria 16925
494 Ga0207700_10006639 3300025928 Bacteria 7013
495 Ga0207700_10023154 3300025928 Bacteria 4277
496 Ga0207700_10076814 3300025928 Bacteria 2593
497 Ga0207664_10006264 3300025929 Bacteria 8174
498 Ga0207664_10009565 3300025929 Bacteria 6807
499 Ga0207664_10053689 3300025929 Bacteria 3191
500 Ga0207664_10057349 3300025929 Bacteria 3095
501 Ga0207664_10057899 3300025929 Bacteria 3082
502 Ga0207664_10068868 3300025929 Bacteria 2844
503 Ga0207664_10080062 3300025929 Bacteria 2654
504 Ga0207664_10091415 3300025929 Bacteria 2496
505 Ga0207664_10133421 3300025929 Bacteria 2093
506 Ga0207664_10135435 3300025929 Bacteria 2078
507 Ga0207664_10141208 3300025929 Bacteria 2037
508 Ga0207644_10002406 3300025931 Bacteria 12056
509 Ga0207644_10020005 3300025931 Bacteria 4546
510 Ga0207644_10110795 3300025931 Bacteria 2075
511 Ga0207644_10258631 3300025931 Bacteria 1391
512 Ga0207644_10292364 3300025931 Bacteria 1311
513 Ga0207690_10030057 3300025932 Bacteria 3461
514 Ga0207690_10038653 3300025932 Bacteria 3107
515 Ga0207706_10019412 3300025933 Bacteria 6116
516 Ga0207706_10157785 3300025933 Bacteria 1995
517 Ga0207686_10037414 3300025934 Bacteria 2928
518 Ga0207686_10204182 3300025934 Bacteria 1417
519 Ga0207709_10181551 3300025935 Bacteria 1486
520 Ga0207670_10025262 3300025936 Bacteria 3726
521 Ga0207670_10260103 3300025936 Bacteria 1345
522 Ga0207669_10006037 3300025937 Bacteria 5495
523 Ga0207669_10020141 3300025937 Bacteria 3490
524 Ga0207669_10151539 3300025937 Bacteria 1625
525 Ga0207669_10191843 3300025937 Bacteria 1475
526 Ga0207704_10012846 3300025938 Bacteria 4168
527 Ga0207704_10100306 3300025938 Bacteria 1928
528 Ga0207665_10000868 3300025939 Bacteria 20427
529 Ga0207665_10001612 3300025939 Bacteria 15220
530 Ga0207665_10022762 3300025939 Bacteria 4125
531 Ga0207665_10039276 3300025939 Bacteria 3155
532 Ga0207665_10044668 3300025939 Bacteria 2965
533 Ga0207665_10048539 3300025939 Bacteria 2850
534 Ga0207665_10061339 3300025939 Bacteria 2548
535 Ga0207691_10073776 3300025940 Bacteria 3078
536 Ga0207691_10133186 3300025940 Bacteria 2194
537 Ga0207691_10158365 3300025940 Bacteria 1988
538 Ga0207691_10164056 3300025940 Bacteria 1948
539 Ga0207691_10280213 3300025940 Bacteria 1434
540 Ga0207711_10091014 3300025941 Bacteria 2683
541 Ga0207711_10135971 3300025941 Bacteria 2208
542 Ga0207689_10006203 3300025942 Bacteria 10591
543 Ga0207689_10007949 3300025942 Bacteria 9264
544 Ga0207689_10024639 3300025942 Bacteria 5046
545 Ga0207689_10104050 3300025942 Bacteria 2333
546 Ga0207661_10000186 3300025944 Bacteria 40168
547 Ga0207661_10014432 3300025944 Bacteria 5792
548 Ga0207661_10174743 3300025944 Bacteria 1872
549 Ga0207679_10040484 3300025945 Bacteria 3336
550 Ga0207679_10109285 3300025945 Bacteria 2179
551 Ga0207679_10218378 3300025945 Bacteria 1603
552 Ga0207667_10011574 3300025949 Bacteria 10243
553 Ga0207667_10026483 3300025949 Bacteria 6334
554 Ga0207667_10039549 3300025949 Bacteria 5026
555 Ga0207667_10116689 3300025949 Bacteria 2751
556 Ga0207651_10015499 3300025960 Bacteria 4431
557 Ga0207712_10086809 3300025961 Bacteria 2293
558 Ga0207712_10128296 3300025961 Bacteria 1929
559 Ga0207668_10097393 3300025972 Bacteria 2177
560 Ga0207668_10100568 3300025972 Bacteria 2147
561 Ga0207668_10187968 3300025972 Bacteria 1634
562 Ga0207640_10011594 3300025981 Bacteria 4995
563 Ga0207640_10048610 3300025981 Bacteria 2743
564 Ga0207677_10223554 3300026023 Bacteria 1512
565 Ga0207703_10208671 3300026035 Bacteria 1740
566 Ga0207703_10389133 3300026035 Bacteria 1291
567 Ga0207639_10014933 3300026041 Bacteria 5471
568 Ga0207639_10025356 3300026041 Bacteria 4299
569 Ga0207639_10036441 3300026041 Bacteria 3645
570 Ga0207639_10064104 3300026041 Bacteria 2848
571 Ga0207639_10104031 3300026041 Bacteria 2301
572 Ga0207639_10178353 3300026041 Bacteria 1805
573 Ga0207678_10004934 3300026067 Bacteria 11982
574 Ga0207678_10035325 3300026067 Bacteria 4352
575 Ga0207708_10009665 3300026075 Bacteria 7154
576 Ga0207708_10060920 3300026075 Bacteria 2881
577 Ga0207708_10104357 3300026075 Bacteria 2196
578 Ga0207702_10000026 3300026078 Bacteria 186067
579 Ga0207702_10000334 3300026078 Bacteria 54042
580 Ga0207702_10025557 3300026078 Bacteria 4902
581 Ga0207702_10065039 3300026078 Bacteria 3123
582 Ga0207702_10132231 3300026078 Bacteria 2246
583 Ga0207702_10323795 3300026078 Bacteria 1468
584 Ga0207641_10251126 3300026088 Bacteria 1652
585 Ga0207648_10003173 3300026089 Bacteria 17320
586 Ga0207648_10036697 3300026089 Bacteria 4318
587 Ga0207676_10082305 3300026095 Bacteria 2617
588 Ga0207676_10134860 3300026095 Bacteria 2105
589 Ga0207676_10179295 3300026095 Bacteria 1853
590 Ga0207676_10185728 3300026095 Bacteria 1824
591 Ga0207674_10012834 3300026116 Bacteria 9352
592 Ga0207674_10269749 3300026116 Bacteria 1649
593 Ga0207674_10283608 3300026116 Bacteria 1604
594 Ga0207675_100040263 3300026118 Bacteria 4363
595 Ga0207683_10009344 3300026121 Bacteria 8352
596 Ga0207683_10018089 3300026121 Bacteria 6009
597 Ga0207683_10026132 3300026121 Bacteria 5040
598 Ga0207683_10154537 3300026121 Bacteria 2072
599 Ga0207683_10247985 3300026121 Bacteria 1625
600 Ga0207698_10260667 3300026142 Bacteria 1592
601 Ga0209179_1005438 3300027512 Bacteria 1993
602 Ga0209179_1011289 3300027512 Bacteria 1579
603 Ga0209588_1000069 3300027671 Bacteria 35682
604 Ga0209971_1008234 3300027682 Bacteria 2472
605 Ga0209966_1001982 3300027695 Bacteria 3428
606 Ga0209998_10001536 3300027717 Bacteria 5548
607 Ga0207428_10004895 3300027907 Bacteria 12615
608 Ga0207428_10018002 3300027907 Bacteria 6050
609 Ga0207428_10037204 3300027907 Bacteria 3961
610 Ga0207428_10048788 3300027907 Bacteria 3395
611 Ga0207428_10212034 3300027907 Bacteria 1455
612 Ga0268266_10014465 3300028379 Bacteria 6783
613 Ga0268266_10032177 3300028379 Bacteria 4456
614 Ga0268266_10065122 3300028379 Bacteria 3150
615 Ga0268266_10182078 3300028379 Bacteria 1913
616 Ga0268266_10223090 3300028379 Bacteria 1733
617 Ga0268265_10046645 3300028380 Bacteria 3240
618 Ga0268265_10141113 3300028380 Bacteria 2017
619 Ga0268265_10141397 3300028380 Bacteria 2015
620 Ga0268265_10241385 3300028380 Bacteria 1594
621 Ga0268264_10001711 3300028381 Bacteria 20230
622 Ga0268264_10228560 3300028381 Bacteria 1717
623 Ga0265337_1000250 3300028556 Bacteria 29184
624 Ga0265334_10007287 3300028573 Bacteria 4746
625 Ga0265332_10000501 3300031238 Bacteria 26976
626 Ga0265332_10071449 3300031238 Bacteria 1478
627 Ga0265325_10000044 3300031241 Bacteria 89107
628 Ga0265325_10023243 3300031241 Bacteria 3388
629 Ga0265325_10031127 3300031241 Bacteria 2858
630 Ga0265325_10043383 3300031241 Bacteria 2347
631 Ga0265325_10053338 3300031241 Bacteria 2073
632 Ga0265325_10086153 3300031241 Bacteria 1555
633 Ga0265339_10000038 3300031249 Bacteria 121961
634 Ga0265339_10001248 3300031249 Bacteria 19138
635 Ga0265339_10057117 3300031249 Bacteria 2111
636 Ga0265339_10067040 3300031249 Bacteria 1921
637 Ga0265331_10022526 3300031250 Bacteria 3214
638 Ga0265331_10027548 3300031250 Bacteria 2848
639 Ga0265331_10044343 3300031250 Bacteria 2151
640 Ga0265316_10031941 3300031344 Bacteria 4302
641 Ga0307513_10098396 3300031456 Bacteria 2957
642 Ga0307509_10041490 3300031507 Bacteria 4993
643 Ga0265313_10000024 3300031595 Bacteria 138587
644 Ga0265313_10005699 3300031595 Bacteria 9084
645 Ga0265313_10029575 3300031595 Bacteria 2832
646 Ga0307508_10036407 3300031616 Bacteria 4431
647 Ga0265314_10013339 3300031711 Bacteria 6643
648 Ga0265314_10020715 3300031711 Bacteria 5073
649 Ga0265342_10000026 3300031712 Bacteria 166610
650 Ga0316576_10010796 3300031727 Bacteria 5951
651 Ga0316576_10093660 3300031727 Bacteria 2240
652 Ga0316578_10003537 3300031728 Bacteria 7177
653 Ga0307516_10011958 3300031730 Bacteria 9386
654 Ga0316583_10019059 3300032133 Bacteria 2465
655 Ga0307507_10081666 3300033179 Bacteria 2840
656 Ga0307510_10155405 3300033180 Bacteria 1895
657 Ga0373930_0000285 3300034816 Bacteria 6457
658 Ga0373948_0000255 3300034817 Bacteria 6425
659 Ga0373948_0003127 3300034817 Bacteria 2517
660 Ga0373950_0004659 3300034818 Bacteria 2016
661 Ga0373958_0001208 3300034819 Bacteria 3443
662 Ga0373938_0000221 3300034957 Bacteria 8764
663 Ga0373928_0000343 3300035084 Bacteria 9316
664 Ga0373929_0001109 3300035085 Bacteria 5225
665 Ga0373940_0000114 3300035088 Bacteria 9974
666 Ga0373944_0053749 3300035089 Bacteria 1275
667 Ga0373944_0054978 3300035089 Bacteria 1264
668 Ga0373949_0001190 3300035090 Bacteria 7715
669 Ga0373949_0047389 3300035090 Bacteria 1074
670 Ga0373951_0002735 3300035091 Bacteria 4415
671 Ga0373951_0037724 3300035091 Bacteria 1157
672 Ga0373952_0001334 3300035092 Bacteria 4511
673 Ga0373952_0002388 3300035092 Bacteria 3382
674 Ga0373923_0011598 3300035111 Bacteria 3239
675 Ga0373923_0020978 3300035111 Bacteria 2546
676 Ga0373923_0022755 3300035111 Bacteria 2460
677 Ga0373923_0138395 3300035111 Bacteria 1099
678 Ga0373932_0001725 3300035112 Bacteria 5931
679 Ga0373936_0000237 3300035113 Bacteria 18250
680 Ga0373936_0036041 3300035113 Bacteria 1971
681 Ga0373936_0065592 3300035113 Bacteria 1490
682 Ga0373939_0000959 3300035114 Bacteria 7190
683 Ga0373939_0006795 3300035114 Bacteria 2764
684 Ga0373941_0010405 3300035115 Bacteria 2376
685 Ga0373945_0015773 3300035116 Bacteria 2545
686 Ga0373945_0017874 3300035116 Bacteria 2407
687 Ga0373953_0004313 3300035117 Bacteria 4524
688 Ga0373954_0013326 3300035118 Bacteria 3663
689 Ga0373954_0039365 3300035118 Bacteria 2200
690 Ga0373954_0043081 3300035118 Bacteria 2105
691 Ga0373956_0008823 3300035119 Bacteria 4086
692 Ga0373956_0012295 3300035119 Bacteria 3546
693 Ga0373956_0056505 3300035119 Bacteria 1772
694 Ga0373957_0006391 3300035120 Bacteria 3709
695 Ga0373957_0022907 3300035120 Bacteria 2229
696 Ga0373960_0000015 3300035121 Bacteria 21442
697 Ga0373943_0000394 3300035170 Bacteria 18328
698 Ga0373943_0014632 3300035170 Bacteria 3556
699 Ga0373943_0039546 3300035170 Bacteria 2273
700 Ga0373943_0110368 3300035170 Bacteria 1450
701 Ga0373946_0000232 3300035171 Bacteria 17447
702 Ga0373955_0000061 3300035172 Bacteria 42652
703 Ga0373955_0003445 3300035172 Bacteria 6954
704 Ga0373955_0003707 3300035172 Bacteria 6728
705 Ga0373955_0039227 3300035172 Bacteria 2526
706 Ga0373955_0063814 3300035172 Bacteria 2040
707 Ga0373955_0111047 3300035172 Bacteria 1585
708 Ga0373942_0000964 3300035207 Bacteria 7840
709 Ga0373961_0000165 3300035241 Bacteria 32291
710 Ga0373962_0000231 3300035242 Bacteria 11768
711 Ga0373962_0003799 3300035242 Bacteria 3629
712 Ga0316574_0000478 3300035398 Bacteria 16180
713 Ga0373924_0055278 3300035410 Bacteria 1652
714 Ga0373924_0064331 3300035410 Bacteria 1539
715 Ga0373931_0004246 3300035691 Bacteria 6520
716 Ga0373931_0010933 3300035691 Bacteria 4373
717 Ga0373935_0000031 3300035692 Bacteria 55218
718 Ga0373935_0022661 3300035692 Bacteria 3854
719 Ga0373935_0047914 3300035692 Bacteria 2704
720 Ga0373935_0052771 3300035692 Bacteria 2585
721 Ga0373935_0061186 3300035692 Bacteria 2410
722 Ga0373935_0061672 3300035692 Bacteria 2400
723 Ga0373935_0083981 3300035692 Bacteria 2074
724 Ga0373935_0181584 3300035692 Bacteria 1445
725 Ga0373935_0208575 3300035692 Bacteria 1353
726 Ga0373927_0006628 3300035695 Bacteria 7887
727 Ga0373927_0009017 3300035695 Bacteria 6698
728 Ga0373927_0010978 3300035695 Bacteria 6032
729 Ga0373927_0016294 3300035695 Bacteria 4904
730 Ga0373927_0027474 3300035695 Bacteria 3715
731 Ga0373927_0260417 3300035695 Bacteria 1140
732 Ga0373933_0001012 3300035724 Bacteria 17071
733 Ga0373933_0002020 3300035724 Bacteria 11688
734 Ga0373933_0003068 3300035724 Bacteria 9321
735 Ga0373933_0006456 3300035724 Bacteria 6389
736 Ga0373933_0111882 3300035724 Bacteria 1704
737 Ga0373933_0201068 3300035724 Bacteria 1275
738 Ga0373933_0210708 3300035724 Bacteria 1245
739 Ga0373947_0001036 3300035725 Bacteria 17008
740 Ga0373947_0008122 3300035725 Bacteria 6052
741 Ga0373947_0013004 3300035725 Bacteria 4773
742 Ga0373947_0031872 3300035725 Bacteria 3104
743 Ga0373937_0000917 3300036401 Bacteria 24992
744 Ga0373937_0001778 3300036401 Bacteria 18113
745 Ga0373937_0004311 3300036401 Bacteria 12061
746 Ga0373937_0004394 3300036401 Bacteria 11977
747 Ga0373937_0010221 3300036401 Bacteria 8188
748 Ga0373937_0010273 3300036401 Bacteria 8170
749 Ga0373937_0031578 3300036401 Bacteria 4801
750 Ga0373937_0053831 3300036401 Bacteria 3691
751 Ga0373937_0063222 3300036401 Bacteria 3404
752 Ga0373937_0087207 3300036401 Bacteria 2888
753 Ga0373937_0090791 3300036401 Bacteria 2829
754 Ga0373937_0191192 3300036401 Bacteria 1923
755 Ga0373937_0252341 3300036401 Bacteria 1663
756 Ga0316582_0127707 3300036647 Bacteria 1705
757 Ga0316584_0006790 3300036712 Bacteria 7767
758 Ga0373925_0000047 3300037068 Bacteria 130221
759 Ga0373925_0060195 3300037068 Bacteria 2851
760 Ga0373925_0063407 3300037068 Bacteria 2781
761 Ga0373925_0068619 3300037068 Bacteria 2677
762 Ga0373925_0082094 3300037068 Bacteria 2452
763 Ga0373925_0250769 3300037068 Bacteria 1419
764 Ga0373925_0254235 3300037068 Bacteria 1410
765 Ga0395900_0001197 3300037418 Bacteria 32092
766 Ga0395898_0008952 3300037466 Bacteria 10540
767 Ga0395898_0009002 3300037466 Bacteria 10509
768 Ga0395898_0288286 3300037466 Bacteria 1566
769 Ga0436364_0049569 3300037853 Bacteria 19405
770 Ga0436364_0318193 3300037853 Bacteria 2063
771 Ga0436364_0713044 3300037853 Bacteria 3340
772 Ga0436364_0813343 3300037853 Bacteria 2451
773 Ga0436364_0832396 3300037853 Bacteria 21955
774 Ga0436364_0843803 3300037853 Bacteria 1844
775 Ga0436364_0959638 3300037853 Bacteria 6878
776 Ga0436364_0968940 3300037853 Bacteria 3847
777 Ga0436364_0979303 3300037853 Bacteria 39415
778 Ga0436364_1393029 3300037853 Bacteria 2726
779 Ga0395901_0020398 3300038443 Bacteria 6784
780 Ga0395901_0032979 3300038443 Bacteria 5343
781 Ga0395901_0036241 3300038443 Bacteria 5097
782 Ga0395901_0101219 3300038443 Bacteria 3024
783 Ga0395901_0192033 3300038443 Bacteria 2141
784 Ga0395901_0361794 3300038443 Bacteria 1496
785 Ga0436365_0173076 3300039437 Bacteria 9946
786 Ga0436365_0208349 3300039437 Bacteria 3164
787 Ga0436365_0361957 3300039437 Bacteria 3046
788 Ga0436365_0393367 3300039437 Bacteria 3655
789 Ga0436365_0496933 3300039437 Bacteria 1771
790 Ga0436365_1286248 3300039437 Bacteria 1321
791 Ga0436365_1330831 3300039437 Bacteria 1514
792 Ga0436365_1792230 3300039437 Bacteria 3060
793 Ga0436360_0054000 3300039438 Bacteria 3495
794 Ga0436360_0752235 3300039438 Bacteria 1291
795 Ga0436360_0762392 3300039438 Bacteria 4314
796 Ga0436360_1099493 3300039438 Bacteria 4444
797 Ga0436361_0098870 3300039447 Bacteria 2614
798 Ga0436361_0210970 3300039447 Bacteria 1310
799 Ga0436361_0227531 3300039447 Bacteria 5946
800 Ga0436361_0321614 3300039447 Bacteria 1087
801 Ga0436361_1219947 3300039447 Bacteria 9925
802 Ga0436363_0067855 3300039450 Bacteria 3174
803 Ga0436363_0432237 3300039450 Bacteria 1581
804 Ga0436363_0578297 3300039450 Bacteria 2022
805 Ga0436362_0130013 3300039453 Bacteria 1468
806 Ga0436362_0310543 3300039453 Bacteria 2659
807 Ga0436362_0336667 3300039453 Bacteria 1169
808 Ga0436362_0360236 3300039453 Bacteria 2673
809 Ga0436362_0591734 3300039453 Bacteria 4047
810 Ga0436362_0712365 3300039453 Bacteria 1945
811 Ga0439453_0000488 3300041408 Bacteria 4357
812 Ga0439465_0080343 3300041413 Bacteria 1105
813 Ga0439431_0044055 3300041997 Bacteria 1143
814 Ga0439464_0047196 3300042439 Bacteria 1239
815 Ga0439460_0054302 3300042461 Bacteria 1208
816 Ga0439440_0002663 3300042993 Bacteria 3389
817 Ga0466969_0117243 3300044656 Bacteria 1242
818 Ga0466963_0047445 3300044694 Bacteria 2835
819 Ga0466963_0157560 3300044694 Bacteria 1579
820 Ga0466963_0159451 3300044694 Bacteria 1570
821 Ga0453684_0104350 3300044712 Bacteria 3461
822 Ga0466971_0025592 3300044719 Bacteria 2635
823 Ga0466957_0025975 3300044842 Bacteria 3473
824 Ga0466957_0068529 3300044842 Bacteria 2190
825 Ga0466960_0185708 3300044901 Bacteria 1129
826 Ga0451576_0005584 3300045051 Bacteria 15714
827 Ga0451576_0086655 3300045051 Bacteria 3257
828 Ga0451576_0100940 3300045051 Bacteria 3000
829 Ga0495592_0000323 3300046454 Bacteria 39878
830 Ga0495592_0005160 3300046454 Bacteria 9628
831 Ga0495592_0009379 3300046454 Bacteria 7359
832 Ga0495592_0031990 3300046454 Bacteria 3973
833 Ga0495592_0061264 3300046454 Bacteria 2765
834 Ga0495592_0149612 3300046454 Bacteria 1616
835 Ga0495603_0002560 3300046455 Bacteria 10719
836 Ga0495603_0015396 3300046455 Bacteria 4627
837 Ga0495603_0036892 3300046455 Bacteria 2933
838 Ga0495603_0078788 3300046455 Bacteria 1932
839 Ga0495590_0060728 3300046457 Bacteria 1324
840 Ga0495629_0000466 3300046459 Bacteria 33891
841 Ga0495629_0000702 3300046459 Bacteria 27126
842 Ga0495629_0004045 3300046459 Bacteria 11023
843 Ga0495629_0011035 3300046459 Bacteria 6565
844 Ga0495629_0068226 3300046459 Bacteria 2481
845 Ga0495629_0072650 3300046459 Bacteria 2401
846 Ga0495629_0252465 3300046459 Bacteria 1213
847 Ga0495638_0018564 3300046460 Bacteria 4616
848 Ga0495638_0034368 3300046460 Bacteria 3236
849 Ga0495638_0142915 3300046460 Bacteria 1394
850 Ga0495641_0005439 3300046461 Bacteria 8611
851 Ga0495641_0007901 3300046461 Bacteria 6568
852 Ga0495641_0012562 3300046461 Bacteria 4723
853 Ga0495641_0092502 3300046461 Bacteria 1351
854 Ga0495651_0000168 3300046462 Bacteria 48211
855 Ga0495651_0002990 3300046462 Bacteria 13046
856 Ga0495651_0003405 3300046462 Bacteria 12195
857 Ga0495651_0027176 3300046462 Bacteria 4458
858 Ga0495651_0055594 3300046462 Bacteria 3041
859 Ga0495651_0152373 3300046462 Bacteria 1665
860 Ga0495651_0181559 3300046462 Bacteria 1489
861 Ga0495653_0000027 3300046463 Bacteria 154096
862 Ga0495653_0004606 3300046463 Bacteria 11151
863 Ga0495653_0016772 3300046463 Bacteria 5960
864 Ga0495653_0019362 3300046463 Bacteria 5520
865 Ga0495653_0147847 3300046463 Bacteria 1645
866 Ga0495580_0003213 3300046472 Bacteria 13987
867 Ga0495580_0059842 3300046472 Bacteria 2677
868 Ga0495580_0074304 3300046472 Bacteria 2372
869 Ga0495582_0008925 3300046473 Bacteria 5534
870 Ga0495582_0098026 3300046473 Bacteria 1640
871 Ga0495582_0099357 3300046473 Bacteria 1629
872 Ga0495605_0075594 3300046474 Bacteria 1584
873 Ga0495605_0082353 3300046474 Bacteria 1503
874 Ga0495639_0004249 3300046475 Bacteria 6148
875 Ga0495639_0047600 3300046475 Bacteria 1943
876 Ga0495639_0079949 3300046475 Bacteria 1521
877 Ga0495662_0000863 3300046476 Bacteria 14796
878 Ga0495662_0001686 3300046476 Bacteria 11028
879 Ga0495662_0005554 3300046476 Bacteria 6307
880 Ga0495662_0042394 3300046476 Bacteria 2196
881 Ga0495662_0148936 3300046476 Bacteria 1152
882 Ga0495664_0000021 3300046477 Bacteria 145551
883 Ga0495664_0003491 3300046477 Bacteria 8561
884 Ga0495664_0009248 3300046477 Bacteria 5510
885 Ga0495664_0015250 3300046477 Bacteria 4366
886 Ga0495664_0042148 3300046477 Bacteria 2702
887 Ga0495594_0041513 3300046499 Bacteria 2519
888 Ga0495607_0026190 3300046501 Bacteria 3620
889 Ga0495606_0005431 3300046507 Bacteria 12209
890 Ga0495608_0000020 3300046511 Bacteria 169036
891 Ga0495608_0001907 3300046511 Bacteria 14950
892 Ga0495608_0003600 3300046511 Bacteria 11116
893 Ga0495608_0004139 3300046511 Bacteria 10398
894 Ga0495608_0015405 3300046511 Bacteria 5303
895 Ga0495608_0017296 3300046511 Bacteria 4988
896 Ga0495608_0031322 3300046511 Bacteria 3596
897 Ga0495608_0128785 3300046511 Bacteria 1620
898 Ga0495618_0000117 3300046514 Bacteria 58104
899 Ga0495618_0003862 3300046514 Bacteria 9265
900 Ga0495618_0004717 3300046514 Bacteria 8336
901 Ga0495618_0095391 3300046514 Bacteria 1902
902 Ga0495628_0000005 3300046516 Bacteria 420969
903 Ga0495628_0026555 3300046516 Bacteria 4719
904 Ga0495628_0046909 3300046516 Bacteria 3430
905 Ga0495628_0140222 3300046516 Bacteria 1845
906 Ga0495630_0000272 3300046517 Bacteria 42046
907 Ga0495630_0018316 3300046517 Bacteria 5142
908 Ga0495630_0086490 3300046517 Bacteria 2367
909 Ga0495632_0024697 3300046519 Bacteria 3188
910 Ga0495632_0160763 3300046519 Bacteria 1035
911 Ga0495643_0077778 3300046522 Bacteria 1733
912 Ga0495648_0008992 3300046524 Bacteria 7801
913 Ga0495648_0052262 3300046524 Bacteria 2483
914 Ga0495666_0035533 3300046526 Bacteria 2429
915 Ga0495666_0063183 3300046526 Bacteria 1767
916 Ga0495652_0000001 3300046529 Bacteria 1045081
917 Ga0495652_0004593 3300046529 Bacteria 13163
918 Ga0495652_0006319 3300046529 Bacteria 11037
919 Ga0495652_0109064 3300046529 Bacteria 2229
920 Ga0495652_0279814 3300046529 Bacteria 1222
921 Ga0495652_0292575 3300046529 Bacteria 1187
922 Ga0495665_0043107 3300046531 Bacteria 2400
923 Ga0495665_0048707 3300046531 Bacteria 2247
924 Ga0495665_0048779 3300046531 Bacteria 2245
925 Ga0495640_0000035 3300046533 Bacteria 73471
926 Ga0495640_0015200 3300046533 Bacteria 5795
927 Ga0495640_0018973 3300046533 Bacteria 5086
928 Ga0495640_0029039 3300046533 Bacteria 3975
929 Ga0495640_0051335 3300046533 Bacteria 2835
930 Ga0495640_0060738 3300046533 Bacteria 2570
931 Ga0495640_0110575 3300046533 Bacteria 1796
932 Ga0495587_0000017 3300046536 Bacteria 172923
933 Ga0495587_0002660 3300046536 Bacteria 11930
934 Ga0495587_0013547 3300046536 Bacteria 5123
935 Ga0495587_0050707 3300046536 Bacteria 2455
936 Ga0495587_0072282 3300046536 Bacteria 2005
937 Ga0495587_0155522 3300046536 Bacteria 1302
938 Ga0495598_0004320 3300046537 Bacteria 3071
939 Ga0495645_0000014 3300046543 Bacteria 172712
940 Ga0495645_0001156 3300046543 Bacteria 17944
941 Ga0495645_0005973 3300046543 Bacteria 8419
942 Ga0495645_0006879 3300046543 Bacteria 7905
943 Ga0495645_0014184 3300046543 Bacteria 5649
944 Ga0495645_0060341 3300046543 Bacteria 2749
945 Ga0495645_0103393 3300046543 Bacteria 2024
946 Ga0495622_0002009 3300046557 Bacteria 9951
947 Ga0495667_0000031 3300046559 Bacteria 147377
948 Ga0495667_0002184 3300046559 Bacteria 13079
949 Ga0495667_0003812 3300046559 Bacteria 10125
950 Ga0495667_0021766 3300046559 Bacteria 4325
951 Ga0495667_0025307 3300046559 Bacteria 3999
952 Ga0495667_0046353 3300046559 Bacteria 2875
953 Ga0495667_0058404 3300046559 Bacteria 2534
954 Ga0495667_0102997 3300046559 Bacteria 1846
955 Ga0495656_0026672 3300046615 Bacteria 2302
956 Ga0495656_0107425 3300046615 Bacteria 1300
957 Ga0495668_0065266 3300046616 Bacteria 2004
958 Ga0495668_0119733 3300046616 Bacteria 1440
959 Ga0495634_0000006 3300046642 Bacteria 172775
960 Ga0495634_0011452 3300046642 Bacteria 6454
961 Ga0495634_0064926 3300046642 Bacteria 2419
962 Ga0495634_0073204 3300046642 Bacteria 2253
963 Ga0495634_0109427 3300046642 Bacteria 1778
964 Ga0495635_0000030 3300046663 Bacteria 117651
965 Ga0495635_0003606 3300046663 Bacteria 10723
966 Ga0495635_0007131 3300046663 Bacteria 7814
967 Ga0495635_0010546 3300046663 Bacteria 6468
968 Ga0495635_0040920 3300046663 Bacteria 3202
969 Ga0495635_0048162 3300046663 Bacteria 2938
970 Ga0495635_0114394 3300046663 Bacteria 1842
971 Ga0495635_0152960 3300046663 Bacteria 1570
972 Ga0495635_0203455 3300046663 Bacteria 1342
973 Ga0495659_0008660 3300046664 Bacteria 3239
974 Ga0495588_0002266 3300046674 Bacteria 8231
975 Ga0495588_0007628 3300046674 Bacteria 4938
976 Ga0495588_0010627 3300046674 Bacteria 4289
977 Ga0495657_0001166 3300046675 Bacteria 23015
978 Ga0495657_0007822 3300046675 Bacteria 8204
979 Ga0495657_0014680 3300046675 Bacteria 5749
980 Ga0495599_0000002 3300046678 Bacteria 348168
981 Ga0495599_0005496 3300046678 Bacteria 7586
982 Ga0495599_0011271 3300046678 Bacteria 5492
983 Ga0495599_0015198 3300046678 Bacteria 4774
984 Ga0495599_0056945 3300046678 Bacteria 2446
985 Ga0495599_0062405 3300046678 Bacteria 2328
986 Ga0495599_0068301 3300046678 Bacteria 2219
987 Ga0495599_0148690 3300046678 Bacteria 1452
988 Ga0495599_0228174 3300046678 Bacteria 1137
989 Ga0495623_0000089 3300046679 Bacteria 53855
990 Ga0495623_0001753 3300046679 Bacteria 14560
991 Ga0495623_0060205 3300046679 Bacteria 2383
992 Ga0495646_0000018 3300046680 Bacteria 121135
993 Ga0495646_0010018 3300046680 Bacteria 6025
994 Ga0495646_0018039 3300046680 Bacteria 4469
995 Ga0495647_0000907 3300046681 Bacteria 8886
996 Ga0495647_0005483 3300046681 Bacteria 4156
997 Ga0495647_0013670 3300046681 Bacteria 2817
998 Ga0495647_0104819 3300046681 Bacteria 1174
999 Ga0495647_0123839 3300046681 Bacteria 1090
1000 Ga0495658_0000435 3300046683 Bacteria 23271
1001 Ga0495658_0021532 3300046683 Bacteria 3399
1002 Ga0495658_0076471 3300046683 Bacteria 1956
1003 Ga0495658_0210430 3300046683 Bacteria 1215
1004 Ga0495613_0013449 3300046689 Bacteria 6078
1005 Ga0495613_0026096 3300046689 Bacteria 4354
1006 Ga0495613_0081167 3300046689 Bacteria 2356
1007 Ga0495613_0116493 3300046689 Bacteria 1922
1008 Ga0495613_0264797 3300046689 Bacteria 1196
1009 Ga0495624_0011061 3300046690 Bacteria 6211
1010 Ga0495624_0019205 3300046690 Bacteria 4566
1011 Ga0495624_0034884 3300046690 Bacteria 3251
1012 Ga0495624_0070423 3300046690 Bacteria 2177
1013 Ga0495624_0093590 3300046690 Bacteria 1853
1014 Ga0495624_0096220 3300046690 Bacteria 1824
1015 Ga0495670_0003592 3300046691 Bacteria 7613
1016 Ga0495670_0026402 3300046691 Bacteria 2874
1017 Ga0495589_0048563 3300046794 Bacteria 2101
1018 Ga0495589_0058023 3300046794 Bacteria 1903
1019 Ga0495600_0000048 3300046809 Bacteria 70636
1020 Ga0495600_0000361 3300046809 Bacteria 23816
1021 Ga0495600_0003284 3300046809 Bacteria 9481
1022 Ga0495600_0015220 3300046809 Bacteria 4860
1023 Ga0495600_0097062 3300046809 Bacteria 1921
1024 Ga0495600_0216490 3300046809 Bacteria 1226
1025 Ga0495581_0004036 3300047315 Bacteria 8450
1026 Ga0495581_0005977 3300047315 Bacteria 7050
1027 Ga0495581_0016766 3300047315 Bacteria 4258
1028 Ga0495581_0019386 3300047315 Bacteria 3948
1029 Ga0495581_0042430 3300047315 Bacteria 2633
1030 Ga0495604_0000007 3300047317 Bacteria 412174
1031 Ga0495604_0001751 3300047317 Bacteria 17746
1032 Ga0495604_0020174 3300047317 Bacteria 5326
1033 Ga0495604_0039908 3300047317 Bacteria 3688
1034 Ga0495604_0054438 3300047317 Bacteria 3087
1035 Ga0495604_0105045 3300047317 Bacteria 2068
1036 Ga0495604_0292836 3300047317 Bacteria 1096
1037 Ga0495636_0056699 3300047318 Bacteria 1650
1038 Ga0495674_0000001 3300047319 Bacteria 778665
1039 Ga0495674_0006049 3300047319 Bacteria 11620
1040 Ga0495674_0006535 3300047319 Bacteria 11188
1041 Ga0495674_0017906 3300047319 Bacteria 6596
1042 Ga0495674_0032613 3300047319 Bacteria 4724
1043 Ga0495672_0044723 3300047320 Bacteria 2654
1044 Ga0495676_0027465 3300047321 Bacteria 4878
1045 Ga0495676_0196181 3300047321 Bacteria 1405
1046 Ga0495680_0000308 3300047322 Bacteria 54837
1047 Ga0495680_0008639 3300047322 Bacteria 9245
1048 Ga0495680_0009804 3300047322 Bacteria 8589
1049 Ga0495680_0016872 3300047322 Bacteria 6254
1050 Ga0495680_0024585 3300047322 Bacteria 4996
1051 Ga0495680_0058267 3300047322 Bacteria 2985
1052 Ga0495680_0062318 3300047322 Bacteria 2867
1053 Ga0495680_0095696 3300047322 Bacteria 2219
1054 Ga0495680_0111057 3300047322 Bacteria 2031
1055 Ga0495675_0012536 3300047444 Bacteria 5336
1056 Ga0495675_0022422 3300047444 Bacteria 4024
1057 Ga0495675_0052079 3300047444 Bacteria 2599
1058 Ga0495675_0066346 3300047444 Bacteria 2281
1059 Ga0495675_0124063 3300047444 Bacteria 1607
1060 Ga0495675_0129687 3300047444 Bacteria 1568
1061 Ga0495677_0034540 3300047445 Bacteria 1845
1062 Ga0495677_0036530 3300047445 Bacteria 1795
1063 Ga0495684_0000009 3300047471 Bacteria 199436
1064 Ga0495684_0004059 3300047471 Bacteria 11423
1065 Ga0495684_0009914 3300047471 Bacteria 7355
1066 Ga0495684_0138396 3300047471 Bacteria 1826
1067 Ga0495686_0104200 3300047472 Bacteria 1708
1068 Ga0495593_0000621 3300047673 Bacteria 20271
1069 Ga0495593_0001635 3300047673 Bacteria 13269
1070 Ga0495593_0007523 3300047673 Bacteria 6368
1071 Ga0495593_0019141 3300047673 Bacteria 3842
1072 Ga0495593_0032921 3300047673 Bacteria 2824
1073 Ga0495593_0100267 3300047673 Bacteria 1485
1074 Ga0495593_0153498 3300047673 Bacteria 1164
1075 Ga0495602_0000004 3300048088 Bacteria 326932
1076 Ga0495602_0006015 3300048088 Bacteria 12741
1077 Ga0495602_0006248 3300048088 Bacteria 12496
1078 Ga0495602_0018460 3300048088 Bacteria 6966
1079 Ga0495602_0033855 3300048088 Bacteria 4787
1080 Ga0495602_0050122 3300048088 Bacteria 3734
1081 Ga0495602_0133719 3300048088 Bacteria 1974
1082 Ga0495602_0178948 3300048088 Bacteria 1638
1083 Ga0495602_0245492 3300048088 Bacteria 1337
1084 Ga0495602_0247694 3300048088 Bacteria 1330
1085 Ga0495614_0005640 3300048089 Bacteria 5646
1086 Ga0495626_0076320 3300048091 Bacteria 1496
1087 Ga0496100_0132117 3300048903 Bacteria 1760
1088 Ga0496100_0170802 3300048903 Bacteria 1566
1089 Ga0496101_0109286 3300048904 Bacteria 2080
1090 Ga0496102_0026588 3300048905 Bacteria 5164
1091 Ga0496102_0037974 3300048905 Bacteria 4344
1092 Ga0496102_0307703 3300048905 Bacteria 1493
1093 Ga0496102_0353379 3300048905 Bacteria 1384
1094 Ga0496103_0035141 3300048906 Bacteria 3068
1095 Ga0496103_0054160 3300048906 Bacteria 2486
1096 Ga0496103_0071295 3300048906 Bacteria 2174
1097 Ga0496103_0088156 3300048906 Bacteria 1956
1098 Ga0496103_0101451 3300048906 Bacteria 1822
1099 Ga0496104_0001251 3300048907 Bacteria 21891
1100 Ga0496104_0001999 3300048907 Bacteria 17695
1101 Ga0496104_0055176 3300048907 Bacteria 3756
1102 Ga0496104_0188094 3300048907 Bacteria 1976
1103 Ga0496104_0233775 3300048907 Bacteria 1750
1104 Ga0496104_0283844 3300048907 Bacteria 1568
1105 Ga0496105_0010624 3300048908 Bacteria 7243
1106 Ga0496105_0025949 3300048908 Bacteria 4775
1107 Ga0496105_0157729 3300048908 Bacteria 1863
1108 Ga0496105_0205996 3300048908 Bacteria 1604
1109 Ga0496106_0001947 3300048909 Bacteria 15498
1110 Ga0496106_0012581 3300048909 Bacteria 6249
1111 Ga0496106_0018895 3300048909 Bacteria 5107
1112 Ga0496106_0078735 3300048909 Bacteria 2530
1113 Ga0496106_0171240 3300048909 Bacteria 1721
1114 Ga0496106_0173198 3300048909 Bacteria 1711
1115 Ga0496106_0216892 3300048909 Bacteria 1525
1116 Ga0496106_0223166 3300048909 Bacteria 1503
1117 Ga0496106_0285895 3300048909 Bacteria 1322
1118 Ga0496106_0366655 3300048909 Bacteria 1157
1119 Ga0496106_0407641 3300048909 Bacteria 1092
1120 Ga0496107_0010784 3300048910 Bacteria 6355
1121 Ga0496107_0102220 3300048910 Bacteria 2101
1122 Ga0496108_0011395 3300048911 Bacteria 7226
1123 Ga0496108_0012784 3300048911 Bacteria 6836
1124 Ga0496108_0030283 3300048911 Bacteria 4485
1125 Ga0496108_0167460 3300048911 Bacteria 1900
1126 Ga0496108_0312290 3300048911 Bacteria 1370
1127 Ga0496108_0355750 3300048911 Bacteria 1278
1128 Ga0496109_0006022 3300048912 Bacteria 10188
1129 Ga0496109_0067360 3300048912 Bacteria 3279
1130 Ga0496109_0247928 3300048912 Bacteria 1677
1131 Ga0496109_0259622 3300048912 Unclassified 1636
1132 Ga0496109_0488434 3300048912 Bacteria 1162
1133 Ga0496110_0014880 3300048913 Bacteria 6465
1134 Ga0496110_0017279 3300048913 Bacteria 6034
1135 Ga0496110_0051499 3300048913 Bacteria 3618
1136 Ga0496110_0089831 3300048913 Bacteria 2746
1137 Ga0496110_0111022 3300048913 Bacteria 2464
1138 Ga0496110_0142478 3300048913 Bacteria 2167
1139 Ga0496110_0564285 3300048913 Bacteria 1034
1140 Ga0496111_0062976 3300048914 Bacteria 2690
1141 Ga0496111_0089300 3300048914 Bacteria 2257
1142 Ga0496112_0000008 3300048915 Bacteria 310323
1143 Ga0496112_0043530 3300048915 Bacteria 4396
1144 Ga0496112_0057630 3300048915 Bacteria 3825
1145 Ga0496112_0072365 3300048915 Bacteria 3407
1146 Ga0496112_0120140 3300048915 Bacteria 2598
1147 Ga0496112_0123013 3300048915 Bacteria 2565
1148 Ga0496112_0211708 3300048915 Bacteria 1895
1149 Ga0496113_0037396 3300048916 Bacteria 3562
1150 Ga0496113_0049398 3300048916 Bacteria 3132
1151 Ga0496113_0053066 3300048916 Bacteria 3030
1152 Ga0496113_0081605 3300048916 Bacteria 2479
1153 Ga0496113_0091061 3300048916 Bacteria 2350
1154 Ga0496113_0096491 3300048916 Bacteria 2286
1155 Ga0496113_0103535 3300048916 Bacteria 2208
1156 Ga0496113_0145702 3300048916 Unclassified 1866
1157 Ga0496113_0183562 3300048916 Bacteria 1659
1158 Ga0496113_0272614 3300048916 Bacteria 1352
1159 Ga0496113_0393340 3300048916 Bacteria 1113
1160 Ga0496114_0236256 3300048917 Bacteria 1606
1161 Ga0496115_0037461 3300048918 Bacteria 3843
1162 Ga0496115_0049884 3300048918 Bacteria 3351
1163 Ga0496115_0053871 3300048918 Bacteria 3230
1164 Ga0496115_0078968 3300048918 Bacteria 2678
1165 Ga0496115_0080516 3300048918 Bacteria 2652
1166 Ga0496115_0221194 3300048918 Bacteria 1562
1167 Ga0496116_0003779 3300048919 Bacteria 14802
1168 Ga0496116_0150301 3300048919 Bacteria 1295
1169 Ga0496117_0152860 3300048920 Bacteria 1363
1170 Ga0496118_0037196 3300048921 Bacteria 3922
1171 Ga0496118_0075235 3300048921 Bacteria 2409
1172 Ga0496119_0051135 3300048922 Bacteria 2542
1173 Ga0496119_0082712 3300048922 Bacteria 1846
1174 Ga0496120_0044624 3300048923 Bacteria 2574
1175 Ga0496120_0045317 3300048923 Bacteria 2548
1176 Ga0496121_0000774 3300048924 Bacteria 58528
1177 Ga0496121_0002381 3300048924 Bacteria 28889
1178 Ga0496121_0002382 3300048924 Bacteria 28853
1179 Ga0496121_0011136 3300048924 Bacteria 10029
1180 Ga0496121_0027414 3300048924 Bacteria 5332
1181 Ga0496121_0072313 3300048924 Bacteria 2769
1182 Ga0496121_0148129 3300048924 Bacteria 1731
1183 Ga0496121_0193630 3300048924 Bacteria 1455
1184 Ga0496121_0346730 3300048924 Bacteria 990
1185 Ga0496124_0009931 3300048927 Bacteria 9727
1186 Ga0496124_0053613 3300048927 Bacteria 3417
1187 Ga0496124_0064362 3300048927 Bacteria 3061
1188 Ga0496124_0079520 3300048927 Bacteria 2700
1189 Ga0496125_0000063 3300048928 Bacteria 250260
1190 Ga0496126_0008902 3300048929 Bacteria 10747
1191 Ga0496126_0012849 3300048929 Bacteria 8556
1192 Ga0496126_0033245 3300048929 Bacteria 4852
1193 Ga0496126_0052396 3300048929 Bacteria 3709
1194 Ga0496126_0055832 3300048929 Bacteria 3571
1195 Ga0496126_0059251 3300048929 Bacteria 3448
1196 Ga0496126_0091820 3300048929 Bacteria 2669
1197 Ga0496126_0110123 3300048929 Bacteria 2399
1198 Ga0496126_0161726 3300048929 Bacteria 1913
1199 Ga0496126_0163287 3300048929 Bacteria 1902
1200 Ga0496126_0203654 3300048929 Bacteria 1669
1201 Ga0496126_0325362 3300048929 Bacteria 1263
1202 Ga0501031_0021841 3300049568 Bacteria 4170
1203 Ga0501032_0000244 3300049569 Bacteria 45114
1204 Ga0501032_0007003 3300049569 Bacteria 8268
1205 Ga0501032_0049124 3300049569 Bacteria 2847
1206 Ga0501032_0073333 3300049569 Bacteria 2280
1207 Ga0501033_0001501 3300049570 Bacteria 20667
1208 Ga0501033_0009491 3300049570 Bacteria 7493
1209 Ga0501033_0159217 3300049570 Bacteria 1626
1210 Ga0501033_0299851 3300049570 Bacteria 1131
1211 Ga0501034_0001010 3300049571 Bacteria 40327
1212 Ga0501034_0004456 3300049571 Bacteria 15570
1213 Ga0501034_0025205 3300049571 Bacteria 6053
1214 Ga0501034_0027460 3300049571 Bacteria 5790
1215 Ga0501034_0032536 3300049571 Bacteria 5294
1216 Ga0501034_0053438 3300049571 Bacteria 4067
1217 Ga0501034_0062536 3300049571 Bacteria 3738
1218 Ga0501034_0097007 3300049571 Bacteria 2943
1219 Ga0501034_0279497 3300049571 Bacteria 1609
1220 Ga0501036_0007992 3300049572 Bacteria 8656
1221 Ga0501036_0015886 3300049572 Bacteria 6287
1222 Ga0501036_0047124 3300049572 Bacteria 3650
1223 Ga0501036_0123821 3300049572 Bacteria 2183
1224 Ga0501036_0364996 3300049572 Bacteria 1205
1225 Ga0501037_0000139 3300049573 Bacteria 67890
1226 Ga0501037_0002392 3300049573 Bacteria 13546
1227 Ga0501037_0009891 3300049573 Bacteria 6995
1228 Ga0501037_0025271 3300049573 Bacteria 4388
1229 Ga0501037_0103123 3300049573 Bacteria 2057
1230 Ga0501038_0000404 3300049574 Bacteria 37454
1231 Ga0501038_0029148 3300049574 Bacteria 4894
1232 Ga0501038_0036159 3300049574 Bacteria 4334
1233 Ga0501038_0054759 3300049574 Bacteria 3429
1234 Ga0501038_0099032 3300049574 Bacteria 2430
1235 Ga0501039_0000323 3300049575 Bacteria 34020
1236 Ga0501039_0036477 3300049575 Bacteria 3794
1237 Ga0501039_0404140 3300049575 Bacteria 1072
1238 Ga0501041_0242487 3300049577 Bacteria 1133
1239 Ga0501042_0039194 3300049578 Bacteria 3366
1240 Ga0501042_0050537 3300049578 Bacteria 2965
1241 Ga0501043_0000021 3300049579 Bacteria 155025
1242 Ga0501043_0000959 3300049579 Bacteria 25541
1243 Ga0501043_0191254 3300049579 Bacteria 1591
1244 Ga0501046_0004069 3300049580 Bacteria 13339
1245 Ga0501046_0008284 3300049580 Bacteria 9076
1246 Ga0501046_0022147 3300049580 Bacteria 5237
1247 Ga0501046_0270652 3300049580 Bacteria 1246
1248 Ga0501047_0000041 3300049581 Bacteria 184355
1249 Ga0501047_0010517 3300049581 Bacteria 8753
1250 Ga0501047_0042697 3300049581 Bacteria 4381
1251 Ga0501047_0046029 3300049581 Bacteria 4217
1252 Ga0501047_0178204 3300049581 Bacteria 1992
1253 Ga0501048_0003605 3300049582 Bacteria 11790
1254 Ga0501048_0016835 3300049582 Bacteria 5389
1255 Ga0501048_0033070 3300049582 Bacteria 3737
1256 Ga0501067_0003176 3300049583 Bacteria 9067
1257 Ga0501067_0008943 3300049583 Bacteria 5550
1258 Ga0501067_0025069 3300049583 Bacteria 3307
1259 Ga0501068_0019094 3300049584 Bacteria 3974
1260 Ga0501068_0148073 3300049584 Bacteria 1474
1261 Ga0501069_0004624 3300049585 Bacteria 7120
1262 Ga0501069_0007710 3300049585 Bacteria 5648
1263 Ga0501069_0081733 3300049585 Bacteria 1820
1264 Ga0501069_0114521 3300049585 Bacteria 1538
1265 Ga0501070_0003487 3300049586 Bacteria 13644
1266 Ga0501070_0083423 3300049586 Bacteria 2645
1267 Ga0501071_0035196 3300049587 Bacteria 3567
1268 Ga0501071_0073302 3300049587 Bacteria 2497
1269 Ga0501072_0002290 3300049588 Bacteria 14329
1270 Ga0501072_0139202 3300049588 Bacteria 1935
1271 Ga0501072_0180112 3300049588 Bacteria 1686
1272 Ga0501072_0272263 3300049588 Bacteria 1347
1273 Ga0501073_0000726 3300049589 Bacteria 23280
1274 Ga0501073_0010678 3300049589 Bacteria 6724
1275 Ga0501073_0030215 3300049589 Bacteria 3869
1276 Ga0501073_0101988 3300049589 Bacteria 1992
1277 Ga0501073_0190721 3300049589 Bacteria 1418
1278 Ga0501074_0002972 3300049590 Bacteria 11915
1279 Ga0501074_0005925 3300049590 Bacteria 8814
1280 Ga0501074_0027820 3300049590 Bacteria 4099
1281 Ga0501074_0068086 3300049590 Bacteria 2559
1282 Ga0501074_0128878 3300049590 Bacteria 1810
1283 Ga0501075_0066146 3300049591 Bacteria 2728
1284 Ga0501075_0077606 3300049591 Bacteria 2513
1285 Ga0501075_0147735 3300049591 Bacteria 1792
1286 Ga0501076_0033858 3300049592 Bacteria 3990
1287 Ga0501076_0144368 3300049592 Bacteria 1935
1288 Ga0501077_0011883 3300049593 Bacteria 5445
1289 Ga0501077_0022407 3300049593 Bacteria 4001
1290 Ga0501077_0229346 3300049593 Bacteria 1180
1291 Ga0501079_0013190 3300049741 Bacteria 6301
1292 Ga0501079_0282690 3300049741 Bacteria 1297
1293 Ga0501080_0017289 3300049742 Bacteria 6666
1294 Ga0501080_0049335 3300049742 Bacteria 3918
1295 Ga0501080_0058816 3300049742 Bacteria 3577
1296 Ga0501080_0136419 3300049742 Bacteria 2271
1297 Ga0501080_0223961 3300049742 Bacteria 1720
1298 Ga0501083_0006439 3300049744 Bacteria 8330
1299 Ga0501083_0014851 3300049744 Bacteria 5446
1300 Ga0501083_0018151 3300049744 Bacteria 4904
1301 Ga0501083_0112787 3300049744 Bacteria 1786
1302 Ga0501083_0170178 3300049744 Bacteria 1424
1303 Ga0501035_0000090 3300049822 Bacteria 112445
1304 Ga0501035_0000267 3300049822 Bacteria 61712
1305 Ga0501035_0016159 3300049822 Bacteria 6886
1306 Ga0501035_0026473 3300049822 Bacteria 5305
1307 Ga0501035_0060418 3300049822 Bacteria 3374
1308 Ga0501044_0000054 3300049823 Bacteria 141399
1309 Ga0501044_0001046 3300049823 Bacteria 33251
1310 Ga0501044_0028089 3300049823 Bacteria 5938
1311 Ga0501044_0127215 3300049823 Bacteria 2544
1312 Ga0501044_0489862 3300049823 Bacteria 1131
1313 Ga0501045_0025375 3300049824 Bacteria 4261
1314 Ga0501045_0054842 3300049824 Bacteria 2915
1315 Ga0501045_0094235 3300049824 Bacteria 2214
1316 Ga0501045_0263434 3300049824 Bacteria 1283
1317 nmdc:mga03n38_26707_c1 3300050490 Bacteria 2387
1318 nmdc:mga03n38_669_c1 3300050490 Bacteria 8868
1319 nmdc:mga03n38_81964_c1 3300050490 Bacteria 1518
1320 nmdc:mga00v17_271938_c1 3300050491 Bacteria 1099
1321 nmdc:mga0yw44_271379_c1 3300050492 Bacteria 1132
1322 nmdc:mga0yw44_72207_c1 3300050492 Bacteria 2145
1323 nmdc:mga0k408_17157_c1 3300050493 Bacteria 4030
1324 nmdc:mga0k408_6577_c1 3300050493 Bacteria 6193
1325 nmdc:mga06z11_132592_c1 3300050494 Bacteria 1400
1326 nmdc:mga06z11_142930_c1 3300050494 Bacteria 1354
1327 nmdc:mga06z11_18155_c1 3300050494 Bacteria 3208
1328 nmdc:mga04h51_39155_c1 3300050495 Bacteria 1539
1329 nmdc:mga05p37_23899_c1 3300050507 Bacteria 7420
1330 nmdc:mga05p37_322_c1 3300050507 Bacteria 43725
1331 nmdc:mga05p37_32928_c1 3300050507 Bacteria 6345
1332 nmdc:mga05p37_41237_c1 3300050507 Bacteria 5668
1333 nmdc:mga05p37_463834_c1 3300050507 Bacteria 1463
1334 nmdc:mga05p37_80518_c1 3300050507 Bacteria 4012
1335 nmdc:mga09592_1363_c1 3300050508 Bacteria 19542
1336 nmdc:mga09592_252532_c1 3300050508 Bacteria 1528
1337 nmdc:mga09592_4562_c1 3300050508 Bacteria 11209
1338 nmdc:mga0qj67_47_c1 3300050509 Bacteria 86979
1339 nmdc:mga0qj67_5189_c1 3300050509 Bacteria 9508
1340 nmdc:mga0qj67_5914_c1 3300050509 Bacteria 8961
1341 nmdc:mga06r32_16898_c1 3300050510 Bacteria 6656
1342 nmdc:mga06r32_211834_c1 3300050510 Bacteria 1925
1343 nmdc:mga06r32_597906_c1 3300050510 Bacteria 1074
1344 nmdc:mga06r32_7884_c1 3300050510 Bacteria 9569
1345 nmdc:mga08y16_123459_c1 3300050511 Bacteria 2695
1346 nmdc:mga08y16_24211_c1 3300050511 Bacteria 6409
1347 nmdc:mga08y16_269506_c1 3300050511 Bacteria 1758
1348 nmdc:mga08y16_339_c1 3300050511 Bacteria 42408
1349 nmdc:mga08y16_60305_c1 3300050511 Bacteria 3963
1350 nmdc:mga08y16_61374_c1 3300050511 Bacteria 3926
1351 nmdc:mga0n895_170560_c1 3300050512 Bacteria 2208
1352 nmdc:mga0n895_174075_c1 3300050512 Bacteria 2184
1353 nmdc:mga0n895_18648_c1 3300050512 Bacteria 6426
1354 nmdc:mga0n895_25817_c1 3300050512 Bacteria 5556
1355 nmdc:mga0n895_528729_c1 3300050512 Bacteria 1186
1356 nmdc:mga0n895_56505_c1 3300050512 Bacteria 3866
1357 nmdc:mga0rr50_193739_c1 3300050513 Bacteria 1667
1358 nmdc:mga0rr50_2534_c1 3300050513 Bacteria 10350
1359 nmdc:mga0rr50_281981_c1 3300050513 Bacteria 1386
1360 nmdc:mga0rr50_290797_c1 3300050513 Bacteria 1365
1361 nmdc:mga0rr50_75618_c1 3300050513 Bacteria 2582
1362 nmdc:mga08x19_119274_c1 3300050514 Bacteria 1767
1363 nmdc:mga08x19_4826_c1 3300050514 Bacteria 7981
1364 nmdc:mga08x19_55995_c1 3300050514 Bacteria 2543
1365 nmdc:mga0a205_4597_c1 3300050515 Bacteria 12377
1366 nmdc:mga0sz30_22292_c1 3300050516 Bacteria 2570
1367 nmdc:mga0sz30_92340_c1 3300050516 Bacteria 1318
1368 Ga0495601_0000020 3300053077 Bacteria 160011
1369 Ga0495601_0001311 3300053077 Bacteria 13647
1370 Ga0495601_0002946 3300053077 Bacteria 9676
1371 Ga0495601_0008405 3300053077 Bacteria 6098
1372 Ga0495601_0011803 3300053077 Bacteria 5238
1373 Ga0495601_0031369 3300053077 Bacteria 3302
1374 Ga0495601_0119950 3300053077 Bacteria 1707
1375 Ga0495601_0165465 3300053077 Bacteria 1445
1376 Ga0495601_0183951 3300053077 Bacteria 1366
1377 Ga0495601_0203613 3300053077 Bacteria 1293
1378 Ga0495612_0000020 3300053078 Bacteria 137759
1379 Ga0495612_0001687 3300053078 Bacteria 9085
1380 Ga0495612_0001781 3300053078 Bacteria 8821
1381 Ga0495612_0015978 3300053078 Bacteria 3007
1382 Ga0495612_0024777 3300053078 Bacteria 2409
1383 Ga0495612_0030802 3300053078 Bacteria 2161
1384 Ga0495612_0036129 3300053078 Bacteria 2005
1385 Ga0495612_0059215 3300053078 Bacteria 1583
1386 Ga0495612_0066106 3300053078 Bacteria 1502
1387 Ga0495612_0086572 3300053078 Bacteria 1321
1388 Ga0500635_0018295 3300053080 Bacteria 2112
1389 Ga0495595_0000047 3300053084 Bacteria 62097
1390 Ga0495595_0002838 3300053084 Bacteria 6817
1391 Ga0495595_0014698 3300053084 Bacteria 3325
1392 Ga0495595_0016846 3300053084 Bacteria 3134
1393 Ga0495595_0082608 3300053084 Bacteria 1532
1394 Ga0495595_0100958 3300053084 Bacteria 1392
1395 Ga0495619_0000011 3300053085 Bacteria 287128
1396 Ga0495619_0000666 3300053085 Bacteria 22530
1397 Ga0495619_0001703 3300053085 Bacteria 14563
1398 Ga0495619_0003610 3300053085 Bacteria 9964
1399 Ga0495619_0004499 3300053085 Bacteria 8905
1400 Ga0495619_0023548 3300053085 Bacteria 3949
1401 Ga0495619_0033892 3300053085 Bacteria 3317
1402 Ga0495619_0050747 3300053085 Bacteria 2739
1403 Ga0495619_0087340 3300053085 Bacteria 2108
1404 Ga0495619_0087482 3300053085 Bacteria 2106
1405 Ga0495619_0149703 3300053085 Bacteria 1610
1406 Ga0495619_0162315 3300053085 Bacteria 1544
1407 Ga0495619_0186112 3300053085 Bacteria 1437
1408 Ga0495619_0269360 3300053085 Bacteria 1180
1409 Ga0495619_0275163 3300053085 Bacteria 1166
1410 Ga0500578_0078209 3300053086 Bacteria 2105
1411 Ga0500643_000060 3300053087 Bacteria 128090
1412 Ga0500643_021915 3300053087 Bacteria 2066
1413 Ga0500644_0000801 3300053088 Bacteria 10681
1414 Ga0500566_0000153 3300053094 Bacteria 35620
1415 Ga0500566_0001073 3300053094 Bacteria 15835
1416 Ga0500640_007920 3300053095 Bacteria 4170
1417 Ga0500641_0004731 3300053096 Bacteria 4813
1418 Ga0500641_0036080 3300053096 Bacteria 1976
1419 Ga0500648_090630 3300053097 Bacteria 1711
1420 Ga0500650_0057997 3300053098 Bacteria 1805
1421 Ga0500554_001720 3300053102 Bacteria 4216
1422 Ga0500556_0000002 3300053104 Bacteria 773626
1423 Ga0500562_011377 3300053108 Bacteria 2260
1424 Ga0500572_000037 3300053111 Bacteria 42272
1425 Ga0500572_003966 3300053111 Bacteria 3362
1426 Ga0500591_016088 3300053115 Bacteria 3603
1427 Ga0500593_000675 3300053117 Bacteria 12972
1428 Ga0500595_000321 3300053119 Bacteria 31508
1429 Ga0500595_000928 3300053119 Bacteria 16602
1430 Ga0500595_010514 3300053119 Bacteria 3674
1431 Ga0500595_022665 3300053119 Bacteria 2218
1432 Ga0500595_047748 3300053119 Bacteria 1340
1433 Ga0500608_006163 3300053122 Bacteria 4854
1434 Ga0500608_015900 3300053122 Bacteria 3390
1435 Ga0500614_001350 3300053123 Bacteria 5906
1436 Ga0500642_0000026 3300053130 Bacteria 127731
1437 Ga0500642_0000121 3300053130 Bacteria 35928
1438 Ga0500642_0040854 3300053130 Bacteria 2003
1439 Ga0500642_0085220 3300053130 Bacteria 1456
1440 Ga0500652_000006 3300053131 Bacteria 167437
1441 Ga0500652_012872 3300053131 Bacteria 2949
1442 Ga0500559_0000820 3300053136 Bacteria 20199
1443 Ga0500559_0001249 3300053136 Bacteria 14963
1444 Ga0500559_0009672 3300053136 Bacteria 4163
1445 Ga0500568_0020417 3300053139 Bacteria 2865
1446 Ga0500568_0061858 3300053139 Bacteria 1447
1447 Ga0500568_0066617 3300053139 Bacteria 1384
1448 Ga0500590_032737 3300053148 Bacteria 2696
1449 Ga0500603_002170 3300053150 Bacteria 4333
1450 Ga0500603_006476 3300053150 Bacteria 2546
1451 Ga0500603_009924 3300053150 Bacteria 2140
1452 Ga0500604_0012379 3300053151 Bacteria 2302
1453 Ga0500616_0000031 3300053153 Bacteria 415013
1454 Ga0500616_0014826 3300053153 Bacteria 4469
1455 Ga0500616_0064420 3300053153 Bacteria 1888
1456 Ga0500620_041627 3300053155 Bacteria 1510
1457 Ga0500622_0000994 3300053156 Bacteria 23922
1458 Ga0500627_0113564 3300053158 Bacteria 1220
1459 Ga0500634_0020533 3300053161 Bacteria 3572
1460 Ga0500638_000125 3300053162 Bacteria 14917
1461 Ga0500638_042347 3300053162 Bacteria 2211
1462 Ga0500639_029738 3300053163 Bacteria 2886
1463 Ga0500639_029795 3300053163 Bacteria 2884
1464 Ga0500636_0002229 3300053177 Bacteria 10734
1465 Ga0500636_0026285 3300053177 Bacteria 3441
1466 Ga0500637_0000264 3300053178 Bacteria 19641
1467 Ga0500645_029995 3300053730 Bacteria 1639
1468 Ga0500645_034242 3300053730 Bacteria 1517
1469 Ga0500609_005484 3300053731 Bacteria 1736
1470 Ga0500552_001273 3300053733 Bacteria 2395
1471 Ga0500596_000261 3300053735 Bacteria 9281
1472 Ga0500596_005857 3300053735 Bacteria 2125
1473 Ga0500601_002226 3300053737 Bacteria 2084
1474 Ga0501084_0074754 3300054114 Bacteria 2838
1475 Ga0501084_0173987 3300054114 Bacteria 1817
1476 Ga0501082_0009080 3300060353 Bacteria 8577
1477 Ga0501082_0013829 3300060353 Bacteria 6939
1478 Ga0501082_0030790 3300060353 Bacteria 4625
1479 Ga0501082_0089631 3300060353 Bacteria 2655
1480 Ga0501082_0147344 3300060353 Bacteria 2044
1481 Ga0466962_0089752 3300061719 Bacteria 1472
1482 Ga0466962_0108108 3300061719 Bacteria 1338
1483 Ga0530510_0008568 3300061734 Bacteria 7140
1484 Ga0530510_0122990 3300061734 Bacteria 1906

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10156980 Ga0157369_101569803 288
2 3300021384 Ga0213876_10081939 Ga0213876_100819393 303
3 3300039437 Ga0436365_0393367 Ga0436365_0393367_1652_2638 303
4 3300021388 Ga0213875_10066342 Ga0213875_100663422 307
5 3300037853 Ga0436364_0843803 Ga0436364_0843803_26_1012 307
6 3300046463 Ga0495653_0147847 Ga0495653_0147847_118_1044 307
7 3300045051 Ga0451576_0005584 Ga0451576_0005584_5012_5992 309
8 3300048924 Ga0496121_0346730 Ga0496121_0346730_45_977 310
9 3300006195 Ga0075366_10015635 Ga0075366_100156352 311
10 3300046689 Ga0495613_0013449 Ga0495613_0013449_5130_6065 311
11 3300048912 Ga0496109_0488434 Ga0496109_0488434_14_949 311
12 3300049572 Ga0501036_0364996 Ga0501036_0364996_257_1192 311
13 3300049580 Ga0501046_0270652 Ga0501046_0270652_297_1232 311
14 3300050491 nmdc:mga00v17_271938_c1 nmdc:mga00v17_271938_c1_53_1033 311
15 3300050493 nmdc:mga0k408_6577_c1 nmdc:mga0k408_6577_c1_4812_5792 311
16 3300010159 Ga0099796_10079182 Ga0099796_100791822 312
17 3300047322 Ga0495680_0008639 Ga0495680_0008639_36_974 312
18 3300053085 Ga0495619_0186112 Ga0495619_0186112_36_974 312
19 3300046462 Ga0495651_0181559 Ga0495651_0181559_18_959 313
20 iso_pu_bacteria 2883577096 2883578142 316
21 3300031727 Ga0316576_10010796 Ga0316576_100107965 317
22 3300031727 Ga0316576_10093660 Ga0316576_100936602 317
23 3300045051 Ga0451576_0100940 Ga0451576_0100940_651_1616 317
24 3300025898 Ga0207692_10049572 Ga0207692_100495722 318
25 3300025915 Ga0207693_10190445 Ga0207693_101904452 318
26 3300035692 Ga0373935_0047914 Ga0373935_0047914_1076_2053 319
27 3300039447 Ga0436361_0227531 Ga0436361_0227531_3901_4881 319
28 iso_pu_bacteria 2909399089 2909401485 319
29 iso_pu_bacteria 641228493 641334889 319
30 iso_pu_bacteria 643348555 643390622 319
31 iso_pu_bacteria 2876761206 2876769543 320
32 iso_pu_bacteria 2513237101 2513695357 321
33 iso_pu_bacteria 2721755755 2723843739 321
34 iso_pu_bacteria 2791355199 2793079431 321
35 iso_pu_bacteria 2874604998 2874609983 321
36 iso_pu_bacteria 2879110137 2879114800 321
37 iso_pu_bacteria 2889033259 2889042062 321
38 iso_pu_bacteria 8006964411 8006971581 321
39 iso_pu_bacteria 8006984368 8006988697 321
40 iso_pu_bacteria 8056673599 8056681120 321
41 3300006175 Ga0070712_100221855 Ga0070712_1002218552 322
42 iso_pu_bacteria 2508501128 2509152937 322
43 iso_pu_bacteria 2513237104 2513716011 322
44 iso_pu_bacteria 2513237141 2513890141 322
45 iso_pu_bacteria 2515154112 2515630539 322
46 iso_pu_bacteria 2528768022 2528857204 322
47 iso_pu_bacteria 2602042107 2603861359 322
48 iso_pu_bacteria 2643221547 2643755331 322
49 iso_pu_bacteria 2643221651 2644287601 322
50 iso_pu_bacteria 2824696289 2824700300 322
51 iso_pu_bacteria 2842775625 2842777545 322
52 iso_pu_bacteria 2857524615 2857530130 322
53 iso_pu_bacteria 2874645413 2874646667 322
54 iso_pu_bacteria 2879099564 2879109913 322
55 iso_pu_bacteria 2879127579 2879128871 322
56 iso_pu_bacteria 2879142872 2879144226 322
57 iso_pu_bacteria 2885383462 2885390258 322
58 iso_pu_bacteria 2893066018 2893071743 322
59 iso_pu_bacteria 2919073203 2919076867 322
60 iso_pu_bacteria 2922393267 2922399153 322
61 iso_pu_bacteria 2935769743 2935774453 322
62 iso_pu_bacteria 2935785616 2935790528 322
63 iso_pu_bacteria 2935793552 2935799064 322
64 iso_pu_bacteria 2935908558 2935916024 322
65 iso_pu_bacteria 2935926038 2935933357 322
66 iso_pu_bacteria 2935934488 2935941912 322
67 iso_pu_bacteria 2935942939 2935950302 322
68 iso_pu_bacteria 2935951376 2935958848 322
69 iso_pu_bacteria 2935967501 2935970343 322
70 iso_pu_bacteria 2935975950 2935979849 322
71 iso_pu_bacteria 8006926726 8006932628 322
72 iso_pu_bacteria 8019659431 8019664029 322
73 iso_pu_bacteria 8019668869 8019673645 322
74 iso_pu_bacteria 8019678201 8019682487 322
75 iso_pu_bacteria 8019687851 8019688125 322
76 iso_pu_bacteria 8056681323 8056686532 322
77 3300002987 JGI25159J45721_1002373 JGI25159J45721_10023737 323
78 3300003322 rootL2_10035570 rootL2_100355707 323
79 3300003354 JGI25160J50197_1008548 JGI25160J50197_10085482 323
80 3300005262 Ga0065165_1015151 Ga0065165_10151512 323
81 3300005435 Ga0070714_100331926 Ga0070714_1003319262 323
82 3300005435 Ga0070714_100336179 Ga0070714_1003361792 323
83 3300005436 Ga0070713_100296596 Ga0070713_1002965962 323
84 3300005439 Ga0070711_100152549 Ga0070711_1001525492 323
85 3300005614 Ga0068856_100081399 Ga0068856_1000813993 323
86 3300005983 Ga0081540_1000003 Ga0081540_1000003186 323
87 3300005983 Ga0081540_1038349 Ga0081540_10383492 323
88 3300006028 Ga0070717_10098689 Ga0070717_100986892 323
89 3300006038 Ga0075365_10000242 Ga0075365_100002429 323
90 3300006177 Ga0075362_10051567 Ga0075362_100515672 323
91 3300006178 Ga0075367_10084632 Ga0075367_100846322 323
92 3300006914 Ga0075436_100265563 Ga0075436_1002655631 323
93 3300007788 Ga0099795_10020009 Ga0099795_100200092 323
94 3300025284 Ga0209130_1000512 Ga0209130_100051226 323
95 3300025294 Ga0209025_1042940 Ga0209025_10429402 323
96 3300025302 Ga0207426_1000181 Ga0207426_100018153 323
97 3300025928 Ga0207700_10076814 Ga0207700_100768142 323
98 3300025929 Ga0207664_10006264 Ga0207664_100062644 323
99 3300025929 Ga0207664_10057899 Ga0207664_100578993 323
100 3300025939 Ga0207665_10044668 Ga0207665_100446681 323
101 3300035691 Ga0373931_0010933 Ga0373931_0010933_1714_2697 323
102 3300036401 Ga0373937_0031578 Ga0373937_0031578_523_1518 323
103 3300037853 Ga0436364_0713044 Ga0436364_0713044_1437_2411 323
104 3300041997 Ga0439431_0044055 Ga0439431_0044055_39_1019 323
105 3300048916 Ga0496113_0103535 Ga0496113_0103535_1055_2038 323
106 3300050512 nmdc:mga0n895_528729_c1 nmdc:mga0n895_528729_c1_26_1009 323
107 3300053733 Ga0500552_001273 Ga0500552_001273_524_1504 323
108 3300005335 Ga0070666_10083456 Ga0070666_100834562 324
109 3300005355 Ga0070671_100045329 Ga0070671_1000453292 324
110 3300005458 Ga0070681_10047909 Ga0070681_100479095 324
111 3300005530 Ga0070679_100085711 Ga0070679_1000857112 324
112 3300007788 Ga0099795_10017418 Ga0099795_100174183 324
113 3300014969 Ga0157376_10342095 Ga0157376_103420951 324
114 3300021388 Ga0213875_10004091 Ga0213875_100040914 324
115 3300025931 Ga0207644_10110795 Ga0207644_101107952 324
116 3300035119 Ga0373956_0056505 Ga0373956_0056505_329_1339 324
117 3300036401 Ga0373937_0063222 Ga0373937_0063222_1678_2652 324
118 3300037068 Ga0373925_0254235 Ga0373925_0254235_54_1037 324
119 3300037853 Ga0436364_0049569 Ga0436364_0049569_8892_9881 324
120 3300039437 Ga0436365_0496933 Ga0436365_0496933_347_1330 324
121 3300039437 Ga0436365_1330831 Ga0436365_1330831_35_1030 324
122 3300039438 Ga0436360_0054000 Ga0436360_0054000_112_1089 324
123 3300039447 Ga0436361_0098870 Ga0436361_0098870_468_1445 324
124 3300039453 Ga0436362_0130013 Ga0436362_0130013_326_1303 324
125 3300039453 Ga0436362_0591734 Ga0436362_0591734_227_1219 324
126 3300046454 Ga0495592_0149612 Ga0495592_0149612_143_1153 324
127 3300046559 Ga0495667_0102997 Ga0495667_0102997_158_1168 324
128 3300046642 Ga0495634_0073204 Ga0495634_0073204_1006_2016 324
129 3300046678 Ga0495599_0068301 Ga0495599_0068301_762_1772 324
130 3300046809 Ga0495600_0015220 Ga0495600_0015220_2592_3602 324
131 3300047322 Ga0495680_0024585 Ga0495680_0024585_404_1414 324
132 3300048913 Ga0496110_0564285 Ga0496110_0564285_49_1023 324
133 3300003215 JGI25153J46596_10000487 JGI25153J46596_1000048715 325
134 3300005330 Ga0070690_100227422 Ga0070690_1002274221 325
135 3300005334 Ga0068869_100072512 Ga0068869_1000725122 325
136 3300005334 Ga0068869_100192242 Ga0068869_1001922421 325
137 3300005338 Ga0068868_100062206 Ga0068868_1000622063 325
138 3300005347 Ga0070668_100025278 Ga0070668_1000252781 325
139 3300005347 Ga0070668_100139262 Ga0070668_1001392622 325
140 3300005347 Ga0070668_100144764 Ga0070668_1001447642 325
141 3300005347 Ga0070668_100219007 Ga0070668_1002190072 325
142 3300005365 Ga0070688_100181163 Ga0070688_1001811631 325
143 3300005434 Ga0070709_10081358 Ga0070709_100813583 325
144 3300005434 Ga0070709_10273150 Ga0070709_102731502 325
145 3300005435 Ga0070714_100022109 Ga0070714_1000221096 325
146 3300005435 Ga0070714_100203947 Ga0070714_1002039471 325
147 3300005436 Ga0070713_100362381 Ga0070713_1003623812 325
148 3300005455 Ga0070663_100006797 Ga0070663_1000067972 325
149 3300005467 Ga0070706_100040304 Ga0070706_1000403042 325
150 3300005471 Ga0070698_100107280 Ga0070698_1001072802 325
151 3300005518 Ga0070699_100311481 Ga0070699_1003114811 325
152 3300005530 Ga0070679_100107171 Ga0070679_1001071712 325
153 3300005535 Ga0070684_100373045 Ga0070684_1003730451 325
154 3300005548 Ga0070665_100079561 Ga0070665_1000795612 325
155 3300005548 Ga0070665_100442794 Ga0070665_1004427941 325
156 3300005614 Ga0068856_100174091 Ga0068856_1001740912 325
157 3300005841 Ga0068863_100513802 Ga0068863_1005138021 325
158 3300005842 Ga0068858_100244723 Ga0068858_1002447232 325
159 3300005844 Ga0068862_100501227 Ga0068862_1005012272 325
160 3300005937 Ga0081455_10017750 Ga0081455_100177506 325
161 3300005983 Ga0081540_1003893 Ga0081540_10038937 325
162 3300005983 Ga0081540_1023367 Ga0081540_10233672 325
163 3300006048 Ga0075363_100059080 Ga0075363_1000590802 325
164 3300006051 Ga0075364_10158271 Ga0075364_101582711 325
165 3300006175 Ga0070712_100017387 Ga0070712_1000173872 325
166 3300006178 Ga0075367_10194180 Ga0075367_101941801 325
167 3300006237 Ga0097621_100416881 Ga0097621_1004168812 325
168 3300006353 Ga0075370_10030883 Ga0075370_100308832 325
169 3300006847 Ga0075431_100352663 Ga0075431_1003526632 325
170 3300009094 Ga0111539_10102681 Ga0111539_101026814 325
171 3300009098 Ga0105245_10131448 Ga0105245_101314482 325
172 3300009098 Ga0105245_10229147 Ga0105245_102291471 325
173 3300009553 Ga0105249_10301794 Ga0105249_103017942 325
174 3300010159 Ga0099796_10000883 Ga0099796_100008833 325
175 3300013100 Ga0157373_10082428 Ga0157373_100824282 325
176 3300013297 Ga0157378_10008253 Ga0157378_100082534 325
177 3300013297 Ga0157378_10042454 Ga0157378_100424542 325
178 3300014325 Ga0163163_10064588 Ga0163163_100645883 325
179 3300014497 Ga0182008_10042288 Ga0182008_100422882 325
180 3300021377 Ga0213874_10022482 Ga0213874_100224822 325
181 3300021388 Ga0213875_10000963 Ga0213875_1000096319 325
182 3300021388 Ga0213875_10042586 Ga0213875_100425863 325
183 3300021388 Ga0213875_10103911 Ga0213875_101039112 325
184 3300025297 Ga0209758_1014185 Ga0209758_10141852 325
185 3300025315 Ga0207697_10067229 Ga0207697_100672292 325
186 3300025901 Ga0207688_10078748 Ga0207688_100787482 325
187 3300025908 Ga0207643_10026134 Ga0207643_100261343 325
188 3300025910 Ga0207684_10123987 Ga0207684_101239872 325
189 3300025910 Ga0207684_10457474 Ga0207684_104574741 325
190 3300025911 Ga0207654_10007167 Ga0207654_100071674 325
191 3300025915 Ga0207693_10034658 Ga0207693_100346586 325
192 3300025918 Ga0207662_10036437 Ga0207662_100364372 325
193 3300025922 Ga0207646_10012265 Ga0207646_100122652 325
194 3300025923 Ga0207681_10121976 Ga0207681_101219762 325
195 3300025929 Ga0207664_10133421 Ga0207664_101334212 325
196 3300025938 Ga0207704_10100306 Ga0207704_101003062 325
197 3300025939 Ga0207665_10061339 Ga0207665_100613391 325
198 3300025940 Ga0207691_10158365 Ga0207691_101583652 325
199 3300025942 Ga0207689_10104050 Ga0207689_101040502 325
200 3300025972 Ga0207668_10187968 Ga0207668_101879682 325
201 3300026075 Ga0207708_10060920 Ga0207708_100609202 325
202 3300026078 Ga0207702_10065039 Ga0207702_100650393 325
203 3300026121 Ga0207683_10154537 Ga0207683_101545372 325
204 3300028379 Ga0268266_10032177 Ga0268266_100321772 325
205 3300028379 Ga0268266_10182078 Ga0268266_101820782 325
206 3300028379 Ga0268266_10223090 Ga0268266_102230902 325
207 3300028380 Ga0268265_10141113 Ga0268265_101411132 325
208 3300028380 Ga0268265_10141397 Ga0268265_101413972 325
209 3300028380 Ga0268265_10241385 Ga0268265_102413851 325
210 3300035111 Ga0373923_0138395 Ga0373923_0138395_56_1036 325
211 3300035118 Ga0373954_0039365 Ga0373954_0039365_361_1341 325
212 3300035692 Ga0373935_0083981 Ga0373935_0083981_478_1458 325
213 3300035692 Ga0373935_0208575 Ga0373935_0208575_321_1301 325
214 3300035724 Ga0373933_0002020 Ga0373933_0002020_3142_4122 325
215 3300035724 Ga0373933_0111882 Ga0373933_0111882_482_1465 325
216 3300036401 Ga0373937_0004311 Ga0373937_0004311_3870_4850 325
217 3300036401 Ga0373937_0004394 Ga0373937_0004394_927_1907 325
218 3300036401 Ga0373937_0010221 Ga0373937_0010221_1512_2492 325
219 3300036401 Ga0373937_0090791 Ga0373937_0090791_1565_2548 325
220 3300036401 Ga0373937_0252341 Ga0373937_0252341_660_1637 325
221 3300037068 Ga0373925_0068619 Ga0373925_0068619_1298_2275 325
222 3300037068 Ga0373925_0082094 Ga0373925_0082094_1353_2333 325
223 3300037853 Ga0436364_0813343 Ga0436364_0813343_1086_2066 325
224 3300037853 Ga0436364_0959638 Ga0436364_0959638_1062_2042 325
225 3300037853 Ga0436364_0979303 Ga0436364_0979303_25235_26215 325
226 3300037853 Ga0436364_1393029 Ga0436364_1393029_1392_2372 325
227 3300038443 Ga0395901_0020398 Ga0395901_0020398_3472_4452 325
228 3300039437 Ga0436365_0208349 Ga0436365_0208349_367_1347 325
229 3300039437 Ga0436365_1792230 Ga0436365_1792230_1727_2707 325
230 3300039438 Ga0436360_0762392 Ga0436360_0762392_869_1849 325
231 3300039450 Ga0436363_0578297 Ga0436363_0578297_748_1728 325
232 3300039453 Ga0436362_0360236 Ga0436362_0360236_748_1728 325
233 3300041413 Ga0439465_0080343 Ga0439465_0080343_16_993 325
234 3300044656 Ga0466969_0117243 Ga0466969_0117243_116_1093 325
235 3300044694 Ga0466963_0047445 Ga0466963_0047445_1028_2008 325
236 3300044694 Ga0466963_0159451 Ga0466963_0159451_114_1091 325
237 3300044719 Ga0466971_0025592 Ga0466971_0025592_108_1085 325
238 3300044842 Ga0466957_0025975 Ga0466957_0025975_1903_2880 325
239 3300046454 Ga0495592_0061264 Ga0495592_0061264_1695_2672 325
240 3300046460 Ga0495638_0142915 Ga0495638_0142915_288_1265 325
241 3300046462 Ga0495651_0055594 Ga0495651_0055594_863_1843 325
242 3300046474 Ga0495605_0082353 Ga0495605_0082353_169_1146 325
243 3300046477 Ga0495664_0009248 Ga0495664_0009248_3632_4612 325
244 3300046511 Ga0495608_0004139 Ga0495608_0004139_1336_2316 325
245 3300046516 Ga0495628_0140222 Ga0495628_0140222_305_1285 325
246 3300046519 Ga0495632_0024697 Ga0495632_0024697_491_1468 325
247 3300046524 Ga0495648_0052262 Ga0495648_0052262_1229_2206 325
248 3300046533 Ga0495640_0060738 Ga0495640_0060738_1187_2167 325
249 3300046536 Ga0495587_0072282 Ga0495587_0072282_800_1780 325
250 3300046543 Ga0495645_0001156 Ga0495645_0001156_15190_16170 325
251 3300046543 Ga0495645_0060341 Ga0495645_0060341_424_1404 325
252 3300046543 Ga0495645_0103393 Ga0495645_0103393_642_1625 325
253 3300046559 Ga0495667_0025307 Ga0495667_0025307_23_1003 325
254 3300046615 Ga0495656_0026672 Ga0495656_0026672_310_1287 325
255 3300046615 Ga0495656_0107425 Ga0495656_0107425_214_1191 325
256 3300046663 Ga0495635_0040920 Ga0495635_0040920_422_1402 325
257 3300046663 Ga0495635_0114394 Ga0495635_0114394_744_1724 325
258 3300046674 Ga0495588_0002266 Ga0495588_0002266_737_1729 325
259 3300046678 Ga0495599_0005496 Ga0495599_0005496_4933_5913 325
260 3300046678 Ga0495599_0062405 Ga0495599_0062405_1150_2130 325
261 3300046794 Ga0495589_0058023 Ga0495589_0058023_800_1777 325
262 3300046809 Ga0495600_0216490 Ga0495600_0216490_177_1157 325
263 3300047317 Ga0495604_0054438 Ga0495604_0054438_1399_2379 325
264 3300047319 Ga0495674_0017906 Ga0495674_0017906_4360_5340 325
265 3300047444 Ga0495675_0066346 Ga0495675_0066346_436_1416 325
266 3300047444 Ga0495675_0129687 Ga0495675_0129687_32_1012 325
267 3300047445 Ga0495677_0034540 Ga0495677_0034540_91_1068 325
268 3300048088 Ga0495602_0006015 Ga0495602_0006015_10475_11455 325
269 3300048088 Ga0495602_0133719 Ga0495602_0133719_927_1904 325
270 3300048088 Ga0495602_0245492 Ga0495602_0245492_60_1040 325
271 3300048905 Ga0496102_0353379 Ga0496102_0353379_139_1116 325
272 3300048907 Ga0496104_0188094 Ga0496104_0188094_939_1931 325
273 3300048909 Ga0496106_0216892 Ga0496106_0216892_427_1419 325
274 3300048909 Ga0496106_0366655 Ga0496106_0366655_113_1090 325
275 3300048924 Ga0496121_0148129 Ga0496121_0148129_624_1601 325
276 3300048927 Ga0496124_0079520 Ga0496124_0079520_1097_2074 325
277 3300048929 Ga0496126_0055832 Ga0496126_0055832_2140_3117 325
278 3300048929 Ga0496126_0163287 Ga0496126_0163287_189_1166 325
279 3300049571 Ga0501034_0004456 Ga0501034_0004456_8132_9112 325
280 3300049571 Ga0501034_0053438 Ga0501034_0053438_942_1922 325
281 3300049588 Ga0501072_0139202 Ga0501072_0139202_358_1338 325
282 3300050490 nmdc:mga03n38_669_c1 nmdc:mga03n38_669_c1_7317_8309 325
283 3300050492 nmdc:mga0yw44_72207_c1 nmdc:mga0yw44_72207_c1_449_1441 325
284 3300050494 nmdc:mga06z11_18155_c1 nmdc:mga06z11_18155_c1_2168_3160 325
285 3300050507 nmdc:mga05p37_23899_c1 nmdc:mga05p37_23899_c1_6218_7210 325
286 3300050508 nmdc:mga09592_252532_c1 nmdc:mga09592_252532_c1_126_1118 325
287 3300050510 nmdc:mga06r32_597906_c1 nmdc:mga06r32_597906_c1_20_1012 325
288 3300050513 nmdc:mga0rr50_193739_c1 nmdc:mga0rr50_193739_c1_421_1413 325
289 3300050513 nmdc:mga0rr50_75618_c1 nmdc:mga0rr50_75618_c1_376_1353 325
290 3300050516 nmdc:mga0sz30_92340_c1 nmdc:mga0sz30_92340_c1_210_1202 325
291 3300053077 Ga0495601_0165465 Ga0495601_0165465_200_1177 325
292 3300053078 Ga0495612_0001781 Ga0495612_0001781_149_1129 325
293 3300053078 Ga0495612_0015978 Ga0495612_0015978_435_1412 325
294 3300053080 Ga0500635_0018295 Ga0500635_0018295_127_1104 325
295 3300053084 Ga0495595_0082608 Ga0495595_0082608_35_1015 325
296 3300053085 Ga0495619_0087340 Ga0495619_0087340_843_1823 325
297 3300053085 Ga0495619_0269360 Ga0495619_0269360_68_1045 325
298 3300053087 Ga0500643_021915 Ga0500643_021915_927_1904 325
299 3300053102 Ga0500554_001720 Ga0500554_001720_652_1629 325
300 3300053119 Ga0500595_000321 Ga0500595_000321_17644_18621 325
301 3300053150 Ga0500603_006476 Ga0500603_006476_1434_2411 325
302 3300053162 Ga0500638_000125 Ga0500638_000125_2463_3440 325
303 3300053178 Ga0500637_0000264 Ga0500637_0000264_15382_16359 325
304 3300061719 Ga0466962_0108108 Ga0466962_0108108_244_1221 325
305 iso_pu_bacteria 8006994254 8006994404 325
306 3300001990 JGI24737J22298_10004234 JGI24737J22298_100042343 326
307 3300003203 JGI25406J46586_10001807 JGI25406J46586_100018074 326
308 3300003659 JGI25404J52841_10000331 JGI25404J52841_100003312 326
309 3300003752 Ga0055539_1008792 Ga0055539_10087921 326
310 3300005290 Ga0065712_10014527 Ga0065712_100145272 326
311 3300005293 Ga0065715_10125584 Ga0065715_101255841 326
312 3300005328 Ga0070676_10044069 Ga0070676_100440692 326
313 3300005329 Ga0070683_100021496 Ga0070683_1000214962 326
314 3300005329 Ga0070683_100028246 Ga0070683_1000282461 326
315 3300005330 Ga0070690_100129280 Ga0070690_1001292802 326
316 3300005331 Ga0070670_100017111 Ga0070670_1000171112 326
317 3300005331 Ga0070670_100110755 Ga0070670_1001107552 326
318 3300005335 Ga0070666_10191800 Ga0070666_101918002 326
319 3300005336 Ga0070680_100077189 Ga0070680_1000771892 326
320 3300005336 Ga0070680_100099444 Ga0070680_1000994441 326
321 3300005339 Ga0070660_100050510 Ga0070660_1000505103 326
322 3300005340 Ga0070689_100010962 Ga0070689_1000109622 326
323 3300005340 Ga0070689_100038918 Ga0070689_1000389184 326
324 3300005340 Ga0070689_100040581 Ga0070689_1000405812 326
325 3300005354 Ga0070675_100064011 Ga0070675_1000640112 326
326 3300005355 Ga0070671_100003119 Ga0070671_1000031196 326
327 3300005355 Ga0070671_100021146 Ga0070671_1000211462 326
328 3300005356 Ga0070674_100002557 Ga0070674_1000025579 326
329 3300005356 Ga0070674_100090856 Ga0070674_1000908562 326
330 3300005364 Ga0070673_100475891 Ga0070673_1004758911 326
331 3300005434 Ga0070709_10000509 Ga0070709_100005096 326
332 3300005434 Ga0070709_10011378 Ga0070709_100113786 326
333 3300005434 Ga0070709_10098674 Ga0070709_100986741 326
334 3300005435 Ga0070714_100003312 Ga0070714_1000033129 326
335 3300005435 Ga0070714_100236571 Ga0070714_1002365712 326
336 3300005436 Ga0070713_100001696 Ga0070713_1000016963 326
337 3300005436 Ga0070713_100027160 Ga0070713_1000271602 326
338 3300005436 Ga0070713_100041422 Ga0070713_1000414222 326
339 3300005436 Ga0070713_100042540 Ga0070713_1000425401 326
340 3300005436 Ga0070713_100064977 Ga0070713_1000649772 326
341 3300005436 Ga0070713_100227739 Ga0070713_1002277392 326
342 3300005436 Ga0070713_100293520 Ga0070713_1002935202 326
343 3300005437 Ga0070710_10001354 Ga0070710_100013543 326
344 3300005437 Ga0070710_10012316 Ga0070710_100123163 326
345 3300005437 Ga0070710_10020598 Ga0070710_100205983 326
346 3300005437 Ga0070710_10032801 Ga0070710_100328012 326
347 3300005437 Ga0070710_10068681 Ga0070710_100686812 326
348 3300005438 Ga0070701_10117689 Ga0070701_101176892 326
349 3300005439 Ga0070711_100003821 Ga0070711_1000038213 326
350 3300005439 Ga0070711_100011119 Ga0070711_1000111192 326
351 3300005439 Ga0070711_100025633 Ga0070711_1000256333 326
352 3300005439 Ga0070711_100045359 Ga0070711_1000453592 326
353 3300005439 Ga0070711_100156735 Ga0070711_1001567352 326
354 3300005440 Ga0070705_100100330 Ga0070705_1001003302 326
355 3300005445 Ga0070708_100006143 Ga0070708_1000061439 326
356 3300005445 Ga0070708_100024183 Ga0070708_1000241832 326
357 3300005445 Ga0070708_100154601 Ga0070708_1001546012 326
358 3300005456 Ga0070678_100022783 Ga0070678_1000227832 326
359 3300005456 Ga0070678_100055373 Ga0070678_1000553732 326
360 3300005457 Ga0070662_100223923 Ga0070662_1002239231 326
361 3300005458 Ga0070681_10051123 Ga0070681_100511234 326
362 3300005458 Ga0070681_10110680 Ga0070681_101106802 326
363 3300005466 Ga0070685_10183209 Ga0070685_101832092 326
364 3300005468 Ga0070707_100049530 Ga0070707_1000495303 326
365 3300005471 Ga0070698_100056017 Ga0070698_1000560174 326
366 3300005518 Ga0070699_100000676 Ga0070699_10000067615 326
367 3300005530 Ga0070679_100038866 Ga0070679_1000388663 326
368 3300005530 Ga0070679_100109721 Ga0070679_1001097212 326
369 3300005535 Ga0070684_100004031 Ga0070684_10000403111 326
370 3300005535 Ga0070684_100129024 Ga0070684_1001290241 326
371 3300005535 Ga0070684_100199619 Ga0070684_1001996192 326
372 3300005535 Ga0070684_100205607 Ga0070684_1002056072 326
373 3300005535 Ga0070684_100270120 Ga0070684_1002701202 326
374 3300005539 Ga0068853_100004863 Ga0068853_1000048633 326
375 3300005539 Ga0068853_100036973 Ga0068853_1000369733 326
376 3300005539 Ga0068853_100069653 Ga0068853_1000696532 326
377 3300005543 Ga0070672_100045947 Ga0070672_1000459473 326
378 3300005543 Ga0070672_100246221 Ga0070672_1002462212 326
379 3300005543 Ga0070672_100258535 Ga0070672_1002585352 326
380 3300005547 Ga0070693_100061469 Ga0070693_1000614691 326
381 3300005548 Ga0070665_100089345 Ga0070665_1000893452 326
382 3300005563 Ga0068855_100013119 Ga0068855_1000131194 326
383 3300005563 Ga0068855_100110088 Ga0068855_1001100883 326
384 3300005563 Ga0068855_100152379 Ga0068855_1001523792 326
385 3300005563 Ga0068855_100290290 Ga0068855_1002902902 326
386 3300005564 Ga0070664_100080565 Ga0070664_1000805652 326
387 3300005564 Ga0070664_100330346 Ga0070664_1003303462 326
388 3300005564 Ga0070664_100395748 Ga0070664_1003957481 326
389 3300005564 Ga0070664_100421072 Ga0070664_1004210721 326
390 3300005577 Ga0068857_100002370 Ga0068857_1000023708 326
391 3300005577 Ga0068857_100071902 Ga0068857_1000719023 326
392 3300005577 Ga0068857_100320026 Ga0068857_1003200262 326
393 3300005578 Ga0068854_100028344 Ga0068854_1000283442 326
394 3300005578 Ga0068854_100404105 Ga0068854_1004041051 326
395 3300005614 Ga0068856_100000780 Ga0068856_10000078015 326
396 3300005614 Ga0068856_100029786 Ga0068856_1000297864 326
397 3300005614 Ga0068856_100216509 Ga0068856_1002165092 326
398 3300005614 Ga0068856_100319407 Ga0068856_1003194072 326
399 3300005616 Ga0068852_100107680 Ga0068852_1001076802 326
400 3300005834 Ga0068851_10013595 Ga0068851_100135954 326
401 3300005937 Ga0081455_10002315 Ga0081455_1000231510 326
402 3300005937 Ga0081455_10003763 Ga0081455_100037636 326
403 3300005937 Ga0081455_10038127 Ga0081455_100381274 326
404 3300005937 Ga0081455_10238741 Ga0081455_102387412 326
405 3300005983 Ga0081540_1004729 Ga0081540_10047292 326
406 3300005983 Ga0081540_1014288 Ga0081540_10142882 326
407 3300005983 Ga0081540_1015004 Ga0081540_10150042 326
408 3300005983 Ga0081540_1015322 Ga0081540_10153222 326
409 3300005983 Ga0081540_1024105 Ga0081540_10241052 326
410 3300005983 Ga0081540_1057966 Ga0081540_10579661 326
411 3300005983 Ga0081540_1071051 Ga0081540_10710512 326
412 3300005985 Ga0081539_10000008 Ga0081539_10000008196 326
413 3300005985 Ga0081539_10006916 Ga0081539_100069168 326
414 3300005985 Ga0081539_10010135 Ga0081539_100101355 326
415 3300005985 Ga0081539_10016204 Ga0081539_100162042 326
416 3300005985 Ga0081539_10078586 Ga0081539_100785862 326
417 3300006028 Ga0070717_10021096 Ga0070717_100210962 326
418 3300006028 Ga0070717_10065763 Ga0070717_100657633 326
419 3300006028 Ga0070717_10287224 Ga0070717_102872241 326
420 3300006038 Ga0075365_10029260 Ga0075365_100292604 326
421 3300006042 Ga0075368_10027568 Ga0075368_100275682 326
422 3300006048 Ga0075363_100024654 Ga0075363_1000246542 326
423 3300006051 Ga0075364_10048549 Ga0075364_100485493 326
424 3300006163 Ga0070715_10000234 Ga0070715_100002347 326
425 3300006173 Ga0070716_100093009 Ga0070716_1000930092 326
426 3300006175 Ga0070712_100002949 Ga0070712_10000294910 326
427 3300006175 Ga0070712_100005993 Ga0070712_1000059933 326
428 3300006175 Ga0070712_100043102 Ga0070712_1000431023 326
429 3300006175 Ga0070712_100050528 Ga0070712_1000505282 326
430 3300006175 Ga0070712_100379631 Ga0070712_1003796311 326
431 3300006177 Ga0075362_10001713 Ga0075362_100017134 326
432 3300006178 Ga0075367_10057343 Ga0075367_100573432 326
433 3300006237 Ga0097621_100129398 Ga0097621_1001293982 326
434 3300006358 Ga0068871_100042409 Ga0068871_1000424093 326
435 3300006358 Ga0068871_100134519 Ga0068871_1001345192 326
436 3300006844 Ga0075428_100011670 Ga0075428_1000116706 326
437 3300006846 Ga0075430_100000001 Ga0075430_10000000145 326
438 3300006846 Ga0075430_100022548 Ga0075430_1000225482 326
439 3300006846 Ga0075430_100066797 Ga0075430_1000667973 326
440 3300006847 Ga0075431_100001191 Ga0075431_1000011919 326
441 3300006847 Ga0075431_100021984 Ga0075431_1000219845 326
442 3300006847 Ga0075431_100340666 Ga0075431_1003406662 326
443 3300006871 Ga0075434_100044201 Ga0075434_1000442014 326
444 3300006880 Ga0075429_100003393 Ga0075429_1000033938 326
445 3300006914 Ga0075436_100002402 Ga0075436_1000024025 326
446 3300006914 Ga0075436_100065205 Ga0075436_1000652052 326
447 3300007076 Ga0075435_100317555 Ga0075435_1003175552 326
448 3300007076 Ga0075435_100403504 Ga0075435_1004035041 326
449 3300007265 Ga0099794_10022019 Ga0099794_100220193 326
450 3300007788 Ga0099795_10009678 Ga0099795_100096782 326
451 3300007788 Ga0099795_10037739 Ga0099795_100377392 326
452 3300009093 Ga0105240_10014285 Ga0105240_100142852 326
453 3300009093 Ga0105240_10020795 Ga0105240_100207955 326
454 3300009093 Ga0105240_10066581 Ga0105240_100665814 326
455 3300009093 Ga0105240_10133416 Ga0105240_101334162 326
456 3300009093 Ga0105240_10417260 Ga0105240_104172601 326
457 3300009094 Ga0111539_10004446 Ga0111539_100044469 326
458 3300009094 Ga0111539_10062850 Ga0111539_100628502 326
459 3300009094 Ga0111539_10167744 Ga0111539_101677442 326
460 3300009094 Ga0111539_10208128 Ga0111539_102081282 326
461 3300009094 Ga0111539_10282285 Ga0111539_102822852 326
462 3300009098 Ga0105245_10116736 Ga0105245_101167362 326
463 3300009098 Ga0105245_10149612 Ga0105245_101496122 326
464 3300009101 Ga0105247_10033382 Ga0105247_100333822 326
465 3300009147 Ga0114129_10000067 Ga0114129_1000006749 326
466 3300009147 Ga0114129_10000707 Ga0114129_1000070720 326
467 3300009147 Ga0114129_10013399 Ga0114129_100133993 326
468 3300009148 Ga0105243_10039792 Ga0105243_100397922 326
469 3300009174 Ga0105241_10003647 Ga0105241_100036472 326
470 3300009174 Ga0105241_10281687 Ga0105241_102816872 326
471 3300009177 Ga0105248_10064455 Ga0105248_100644552 326
472 3300009545 Ga0105237_10027598 Ga0105237_100275982 326
473 3300009545 Ga0105237_10051061 Ga0105237_100510613 326
474 3300009545 Ga0105237_10063062 Ga0105237_100630624 326
475 3300009545 Ga0105237_10085442 Ga0105237_100854423 326
476 3300009545 Ga0105237_10179347 Ga0105237_101793471 326
477 3300009545 Ga0105237_10294344 Ga0105237_102943442 326
478 3300009551 Ga0105238_10019168 Ga0105238_100191682 326
479 3300009551 Ga0105238_10031479 Ga0105238_100314795 326
480 3300009551 Ga0105238_10066692 Ga0105238_100666922 326
481 3300009551 Ga0105238_10069141 Ga0105238_100691412 326
482 3300009551 Ga0105238_10073402 Ga0105238_100734022 326
483 3300009551 Ga0105238_10086803 Ga0105238_100868033 326
484 3300009553 Ga0105249_10356404 Ga0105249_103564042 326
485 3300009553 Ga0105249_10374243 Ga0105249_103742431 326
486 3300010159 Ga0099796_10007449 Ga0099796_100074492 326
487 3300010159 Ga0099796_10019458 Ga0099796_100194582 326
488 3300010375 Ga0105239_10010188 Ga0105239_100101885 326
489 3300010375 Ga0105239_10264808 Ga0105239_102648082 326
490 3300010375 Ga0105239_10381254 Ga0105239_103812541 326
491 3300013100 Ga0157373_10018231 Ga0157373_100182312 326
492 3300013104 Ga0157370_10068122 Ga0157370_100681223 326
493 3300013105 Ga0157369_10004285 Ga0157369_1000428512 326
494 3300013105 Ga0157369_10023392 Ga0157369_100233924 326
495 3300013296 Ga0157374_10157143 Ga0157374_101571432 326
496 3300013296 Ga0157374_10560657 Ga0157374_105606571 326
497 3300013297 Ga0157378_10131499 Ga0157378_101314992 326
498 3300013307 Ga0157372_10440085 Ga0157372_104400852 326
499 3300013308 Ga0157375_10117353 Ga0157375_101173532 326
500 3300013308 Ga0157375_10154369 Ga0157375_101543692 326
501 3300013308 Ga0157375_10261845 Ga0157375_102618452 326
502 3300014325 Ga0163163_10016186 Ga0163163_100161863 326
503 3300014325 Ga0163163_10056807 Ga0163163_100568072 326
504 3300014325 Ga0163163_10174498 Ga0163163_101744982 326
505 3300014326 Ga0157380_10082968 Ga0157380_100829682 326
506 3300014968 Ga0157379_10139874 Ga0157379_101398742 326
507 3300014969 Ga0157376_10325574 Ga0157376_103255742 326
508 3300017792 Ga0163161_10249962 Ga0163161_102499621 326
509 3300021384 Ga0213876_10059153 Ga0213876_100591531 326
510 3300021388 Ga0213875_10000003 Ga0213875_10000003474 326
511 3300021388 Ga0213875_10044493 Ga0213875_100444932 326
512 3300025253 Ga0209677_100819 Ga0209677_1008199 326
513 3300025254 Ga0209148_1013398 Ga0209148_10133981 326
514 3300025261 Ga0209233_1001793 Ga0209233_10017933 326
515 3300025261 Ga0209233_1010271 Ga0209233_10102712 326
516 3300025295 Ga0209564_1000468 Ga0209564_100046846 326
517 3300025297 Ga0209758_1000183 Ga0209758_10001838 326
518 3300025297 Ga0209758_1006960 Ga0209758_10069606 326
519 3300025315 Ga0207697_10057200 Ga0207697_100572002 326
520 3300025893 Ga0207682_10006890 Ga0207682_100068904 326
521 3300025898 Ga0207692_10037614 Ga0207692_100376142 326
522 3300025898 Ga0207692_10062040 Ga0207692_100620402 326
523 3300025898 Ga0207692_10062452 Ga0207692_100624521 326
524 3300025904 Ga0207647_10000586 Ga0207647_100005868 326
525 3300025905 Ga0207685_10053274 Ga0207685_100532742 326
526 3300025905 Ga0207685_10056756 Ga0207685_100567562 326
527 3300025906 Ga0207699_10008586 Ga0207699_100085864 326
528 3300025906 Ga0207699_10028083 Ga0207699_100280834 326
529 3300025906 Ga0207699_10029104 Ga0207699_100291042 326
530 3300025906 Ga0207699_10032883 Ga0207699_100328832 326
531 3300025907 Ga0207645_10021613 Ga0207645_100216133 326
532 3300025907 Ga0207645_10106342 Ga0207645_101063422 326
533 3300025909 Ga0207705_10149094 Ga0207705_101490942 326
534 3300025911 Ga0207654_10001537 Ga0207654_1000153710 326
535 3300025911 Ga0207654_10047272 Ga0207654_100472722 326
536 3300025912 Ga0207707_10025624 Ga0207707_100256242 326
537 3300025912 Ga0207707_10094218 Ga0207707_100942182 326
538 3300025912 Ga0207707_10153484 Ga0207707_101534842 326
539 3300025913 Ga0207695_10001321 Ga0207695_1000132111 326
540 3300025913 Ga0207695_10167106 Ga0207695_101671062 326
541 3300025913 Ga0207695_10267868 Ga0207695_102678682 326
542 3300025914 Ga0207671_10057530 Ga0207671_100575302 326
543 3300025914 Ga0207671_10066562 Ga0207671_100665622 326
544 3300025915 Ga0207693_10001110 Ga0207693_1000111015 326
545 3300025915 Ga0207693_10002459 Ga0207693_1000245917 326
546 3300025915 Ga0207693_10004318 Ga0207693_1000431810 326
547 3300025915 Ga0207693_10018111 Ga0207693_100181113 326
548 3300025915 Ga0207693_10033844 Ga0207693_100338443 326
549 3300025915 Ga0207693_10036064 Ga0207693_100360643 326
550 3300025915 Ga0207693_10042723 Ga0207693_100427232 326
551 3300025915 Ga0207693_10209947 Ga0207693_102099472 326
552 3300025915 Ga0207693_10320994 Ga0207693_103209942 326
553 3300025916 Ga0207663_10000147 Ga0207663_100001472 326
554 3300025916 Ga0207663_10020922 Ga0207663_100209223 326
555 3300025916 Ga0207663_10023180 Ga0207663_100231802 326
556 3300025916 Ga0207663_10036829 Ga0207663_100368291 326
557 3300025916 Ga0207663_10093465 Ga0207663_100934652 326
558 3300025917 Ga0207660_10032760 Ga0207660_100327603 326
559 3300025918 Ga0207662_10035148 Ga0207662_100351482 326
560 3300025919 Ga0207657_10008926 Ga0207657_100089263 326
561 3300025921 Ga0207652_10018923 Ga0207652_100189232 326
562 3300025921 Ga0207652_10140260 Ga0207652_101402602 326
563 3300025922 Ga0207646_10195069 Ga0207646_101950691 326
564 3300025923 Ga0207681_10035007 Ga0207681_100350073 326
565 3300025924 Ga0207694_10000135 Ga0207694_1000013537 326
566 3300025924 Ga0207694_10040754 Ga0207694_100407542 326
567 3300025924 Ga0207694_10353470 Ga0207694_103534701 326
568 3300025925 Ga0207650_10013416 Ga0207650_100134163 326
569 3300025926 Ga0207659_10124048 Ga0207659_101240482 326
570 3300025927 Ga0207687_10090783 Ga0207687_100907832 326
571 3300025927 Ga0207687_10322240 Ga0207687_103222401 326
572 3300025928 Ga0207700_10006639 Ga0207700_100066395 326
573 3300025928 Ga0207700_10023154 Ga0207700_100231542 326
574 3300025929 Ga0207664_10009565 Ga0207664_100095658 326
575 3300025929 Ga0207664_10053689 Ga0207664_100536892 326
576 3300025929 Ga0207664_10057349 Ga0207664_100573491 326
577 3300025929 Ga0207664_10068868 Ga0207664_100688682 326
578 3300025929 Ga0207664_10080062 Ga0207664_100800622 326
579 3300025929 Ga0207664_10091415 Ga0207664_100914153 326
580 3300025929 Ga0207664_10141208 Ga0207664_101412082 326
581 3300025931 Ga0207644_10002406 Ga0207644_100024063 326
582 3300025931 Ga0207644_10292364 Ga0207644_102923642 326
583 3300025933 Ga0207706_10157785 Ga0207706_101577852 326
584 3300025934 Ga0207686_10037414 Ga0207686_100374143 326
585 3300025934 Ga0207686_10204182 Ga0207686_102041822 326
586 3300025935 Ga0207709_10181551 Ga0207709_101815512 326
587 3300025936 Ga0207670_10025262 Ga0207670_100252622 326
588 3300025936 Ga0207670_10260103 Ga0207670_102601031 326
589 3300025937 Ga0207669_10006037 Ga0207669_100060375 326
590 3300025937 Ga0207669_10151539 Ga0207669_101515392 326
591 3300025937 Ga0207669_10191843 Ga0207669_101918431 326
592 3300025939 Ga0207665_10000868 Ga0207665_100008689 326
593 3300025939 Ga0207665_10022762 Ga0207665_100227624 326
594 3300025939 Ga0207665_10039276 Ga0207665_100392762 326
595 3300025939 Ga0207665_10048539 Ga0207665_100485391 326
596 3300025940 Ga0207691_10133186 Ga0207691_101331862 326
597 3300025940 Ga0207691_10164056 Ga0207691_101640562 326
598 3300025940 Ga0207691_10280213 Ga0207691_102802132 326
599 3300025941 Ga0207711_10091014 Ga0207711_100910142 326
600 3300025942 Ga0207689_10006203 Ga0207689_100062037 326
601 3300025942 Ga0207689_10024639 Ga0207689_100246392 326
602 3300025944 Ga0207661_10000186 Ga0207661_1000018624 326
603 3300025944 Ga0207661_10014432 Ga0207661_100144326 326
604 3300025945 Ga0207679_10109285 Ga0207679_101092852 326
605 3300025945 Ga0207679_10218378 Ga0207679_102183782 326
606 3300025949 Ga0207667_10011574 Ga0207667_100115742 326
607 3300025949 Ga0207667_10026483 Ga0207667_100264834 326
608 3300025949 Ga0207667_10039549 Ga0207667_100395495 326
609 3300025949 Ga0207667_10116689 Ga0207667_101166892 326
610 3300025960 Ga0207651_10015499 Ga0207651_100154994 326
611 3300025981 Ga0207640_10011594 Ga0207640_100115945 326
612 3300026023 Ga0207677_10223554 Ga0207677_102235542 326
613 3300026035 Ga0207703_10208671 Ga0207703_102086712 326
614 3300026035 Ga0207703_10389133 Ga0207703_103891331 326
615 3300026041 Ga0207639_10025356 Ga0207639_100253564 326
616 3300026041 Ga0207639_10036441 Ga0207639_100364414 326
617 3300026041 Ga0207639_10064104 Ga0207639_100641042 326
618 3300026041 Ga0207639_10104031 Ga0207639_101040312 326
619 3300026041 Ga0207639_10178353 Ga0207639_101783532 326
620 3300026067 Ga0207678_10035325 Ga0207678_100353252 326
621 3300026078 Ga0207702_10000026 Ga0207702_10000026141 326
622 3300026078 Ga0207702_10000334 Ga0207702_1000033411 326
623 3300026078 Ga0207702_10025557 Ga0207702_100255575 326
624 3300026078 Ga0207702_10323795 Ga0207702_103237952 326
625 3300026089 Ga0207648_10003173 Ga0207648_1000317315 326
626 3300026095 Ga0207676_10134860 Ga0207676_101348602 326
627 3300026095 Ga0207676_10185728 Ga0207676_101857282 326
628 3300026116 Ga0207674_10269749 Ga0207674_102697492 326
629 3300026116 Ga0207674_10283608 Ga0207674_102836082 326
630 3300026121 Ga0207683_10018089 Ga0207683_100180893 326
631 3300026121 Ga0207683_10026132 Ga0207683_100261322 326
632 3300026121 Ga0207683_10247985 Ga0207683_102479852 326
633 3300026142 Ga0207698_10260667 Ga0207698_102606672 326
634 3300027512 Ga0209179_1005438 Ga0209179_10054382 326
635 3300027512 Ga0209179_1011289 Ga0209179_10112892 326
636 3300027671 Ga0209588_1000069 Ga0209588_100006919 326
637 3300027907 Ga0207428_10018002 Ga0207428_100180025 326
638 3300027907 Ga0207428_10037204 Ga0207428_100372043 326
639 3300028379 Ga0268266_10065122 Ga0268266_100651222 326
640 3300028381 Ga0268264_10001711 Ga0268264_100017118 326
641 3300028381 Ga0268264_10228560 Ga0268264_102285601 326
642 3300028573 Ga0265334_10007287 Ga0265334_100072872 326
643 3300031238 Ga0265332_10000501 Ga0265332_1000050124 326
644 3300031241 Ga0265325_10031127 Ga0265325_100311272 326
645 3300031241 Ga0265325_10043383 Ga0265325_100433831 326
646 3300031241 Ga0265325_10086153 Ga0265325_100861532 326
647 3300031249 Ga0265339_10000038 Ga0265339_1000003881 326
648 3300031249 Ga0265339_10001248 Ga0265339_100012482 326
649 3300031249 Ga0265339_10057117 Ga0265339_100571172 326
650 3300031249 Ga0265339_10067040 Ga0265339_100670402 326
651 3300031250 Ga0265331_10022526 Ga0265331_100225262 326
652 3300031250 Ga0265331_10044343 Ga0265331_100443432 326
653 3300031456 Ga0307513_10098396 Ga0307513_100983962 326
654 3300031507 Ga0307509_10041490 Ga0307509_100414903 326
655 3300031595 Ga0265313_10000024 Ga0265313_1000002415 326
656 3300031616 Ga0307508_10036407 Ga0307508_100364074 326
657 3300031711 Ga0265314_10013339 Ga0265314_100133395 326
658 3300031712 Ga0265342_10000026 Ga0265342_10000026132 326
659 3300031728 Ga0316578_10003537 Ga0316578_100035374 326
660 3300031730 Ga0307516_10011958 Ga0307516_100119589 326
661 3300032133 Ga0316583_10019059 Ga0316583_100190592 326
662 3300033179 Ga0307507_10081666 Ga0307507_100816662 326
663 3300033180 Ga0307510_10155405 Ga0307510_101554051 326
664 3300035089 Ga0373944_0053749 Ga0373944_0053749_191_1171 326
665 3300035089 Ga0373944_0054978 Ga0373944_0054978_33_1013 326
666 3300035091 Ga0373951_0037724 Ga0373951_0037724_146_1126 326
667 3300035111 Ga0373923_0011598 Ga0373923_0011598_1823_2803 326
668 3300035111 Ga0373923_0020978 Ga0373923_0020978_1390_2370 326
669 3300035111 Ga0373923_0022755 Ga0373923_0022755_954_1934 326
670 3300035113 Ga0373936_0000237 Ga0373936_0000237_10268_11248 326
671 3300035113 Ga0373936_0065592 Ga0373936_0065592_379_1359 326
672 3300035114 Ga0373939_0006795 Ga0373939_0006795_669_1649 326
673 3300035116 Ga0373945_0015773 Ga0373945_0015773_1514_2494 326
674 3300035117 Ga0373953_0004313 Ga0373953_0004313_2164_3144 326
675 3300035118 Ga0373954_0013326 Ga0373954_0013326_11_991 326
676 3300035119 Ga0373956_0012295 Ga0373956_0012295_113_1093 326
677 3300035120 Ga0373957_0022907 Ga0373957_0022907_333_1313 326
678 3300035170 Ga0373943_0000394 Ga0373943_0000394_6245_7225 326
679 3300035170 Ga0373943_0014632 Ga0373943_0014632_1772_2752 326
680 3300035170 Ga0373943_0039546 Ga0373943_0039546_315_1295 326
681 3300035170 Ga0373943_0110368 Ga0373943_0110368_166_1146 326
682 3300035171 Ga0373946_0000232 Ga0373946_0000232_5474_6454 326
683 3300035172 Ga0373955_0000061 Ga0373955_0000061_15395_16375 326
684 3300035172 Ga0373955_0003707 Ga0373955_0003707_304_1284 326
685 3300035172 Ga0373955_0039227 Ga0373955_0039227_1527_2507 326
686 3300035172 Ga0373955_0111047 Ga0373955_0111047_556_1536 326
687 3300035398 Ga0316574_0000478 Ga0316574_0000478_3490_4470 326
688 3300035410 Ga0373924_0055278 Ga0373924_0055278_116_1096 326
689 3300035410 Ga0373924_0064331 Ga0373924_0064331_97_1077 326
690 3300035692 Ga0373935_0000031 Ga0373935_0000031_18353_19333 326
691 3300035692 Ga0373935_0061186 Ga0373935_0061186_147_1127 326
692 3300035692 Ga0373935_0061672 Ga0373935_0061672_285_1265 326
693 3300035692 Ga0373935_0181584 Ga0373935_0181584_354_1334 326
694 3300035695 Ga0373927_0006628 Ga0373927_0006628_2939_3919 326
695 3300035695 Ga0373927_0009017 Ga0373927_0009017_1046_2026 326
696 3300035695 Ga0373927_0010978 Ga0373927_0010978_1481_2461 326
697 3300035695 Ga0373927_0016294 Ga0373927_0016294_1601_2581 326
698 3300035695 Ga0373927_0027474 Ga0373927_0027474_1129_2109 326
699 3300035695 Ga0373927_0260417 Ga0373927_0260417_141_1121 326
700 3300035724 Ga0373933_0001012 Ga0373933_0001012_4283_5263 326
701 3300035724 Ga0373933_0003068 Ga0373933_0003068_5073_6053 326
702 3300035724 Ga0373933_0006456 Ga0373933_0006456_4967_5947 326
703 3300035724 Ga0373933_0201068 Ga0373933_0201068_128_1108 326
704 3300035725 Ga0373947_0001036 Ga0373947_0001036_15711_16691 326
705 3300035725 Ga0373947_0008122 Ga0373947_0008122_1630_2610 326
706 3300035725 Ga0373947_0013004 Ga0373947_0013004_2220_3200 326
707 3300035725 Ga0373947_0031872 Ga0373947_0031872_1090_2070 326
708 3300036401 Ga0373937_0000917 Ga0373937_0000917_10612_11592 326
709 3300036401 Ga0373937_0001778 Ga0373937_0001778_2411_3391 326
710 3300036401 Ga0373937_0053831 Ga0373937_0053831_2130_3110 326
711 3300036401 Ga0373937_0087207 Ga0373937_0087207_375_1355 326
712 3300036647 Ga0316582_0127707 Ga0316582_0127707_233_1213 326
713 3300036712 Ga0316584_0006790 Ga0316584_0006790_5577_6557 326
714 3300037068 Ga0373925_0000047 Ga0373925_0000047_38206_39186 326
715 3300037068 Ga0373925_0060195 Ga0373925_0060195_37_1017 326
716 3300037068 Ga0373925_0063407 Ga0373925_0063407_551_1531 326
717 3300037418 Ga0395900_0001197 Ga0395900_0001197_18042_19022 326
718 3300037466 Ga0395898_0008952 Ga0395898_0008952_5502_6482 326
719 3300037466 Ga0395898_0009002 Ga0395898_0009002_4040_5020 326
720 3300037466 Ga0395898_0288286 Ga0395898_0288286_158_1138 326
721 3300037853 Ga0436364_0318193 Ga0436364_0318193_522_1502 326
722 3300037853 Ga0436364_0832396 Ga0436364_0832396_9854_10834 326
723 3300037853 Ga0436364_0968940 Ga0436364_0968940_407_1387 326
724 3300038443 Ga0395901_0032979 Ga0395901_0032979_195_1175 326
725 3300038443 Ga0395901_0036241 Ga0395901_0036241_1831_2811 326
726 3300038443 Ga0395901_0101219 Ga0395901_0101219_1769_2749 326
727 3300038443 Ga0395901_0192033 Ga0395901_0192033_750_1730 326
728 3300038443 Ga0395901_0361794 Ga0395901_0361794_107_1087 326
729 3300039437 Ga0436365_0173076 Ga0436365_0173076_7621_8601 326
730 3300039437 Ga0436365_0361957 Ga0436365_0361957_522_1502 326
731 3300039437 Ga0436365_1286248 Ga0436365_1286248_171_1151 326
732 3300039438 Ga0436360_0752235 Ga0436360_0752235_145_1125 326
733 3300039438 Ga0436360_1099493 Ga0436360_1099493_647_1627 326
734 3300039447 Ga0436361_0210970 Ga0436361_0210970_254_1234 326
735 3300039447 Ga0436361_0321614 Ga0436361_0321614_18_998 326
736 3300039447 Ga0436361_1219947 Ga0436361_1219947_7936_8919 326
737 3300039450 Ga0436363_0067855 Ga0436363_0067855_986_1966 326
738 3300039450 Ga0436363_0432237 Ga0436363_0432237_193_1173 326
739 3300039453 Ga0436362_0310543 Ga0436362_0310543_1442_2446 326
740 3300039453 Ga0436362_0336667 Ga0436362_0336667_88_1068 326
741 3300039453 Ga0436362_0712365 Ga0436362_0712365_351_1331 326
742 3300041408 Ga0439453_0000488 Ga0439453_0000488_1590_2570 326
743 3300042439 Ga0439464_0047196 Ga0439464_0047196_53_1033 326
744 3300042461 Ga0439460_0054302 Ga0439460_0054302_62_1042 326
745 3300042993 Ga0439440_0002663 Ga0439440_0002663_1863_2843 326
746 3300044694 Ga0466963_0157560 Ga0466963_0157560_205_1185 326
747 3300044842 Ga0466957_0068529 Ga0466957_0068529_940_1923 326
748 3300044901 Ga0466960_0185708 Ga0466960_0185708_130_1110 326
749 3300046454 Ga0495592_0000323 Ga0495592_0000323_22117_23097 326
750 3300046454 Ga0495592_0005160 Ga0495592_0005160_5337_6317 326
751 3300046454 Ga0495592_0009379 Ga0495592_0009379_376_1356 326
752 3300046454 Ga0495592_0031990 Ga0495592_0031990_2578_3558 326
753 3300046455 Ga0495603_0002560 Ga0495603_0002560_4950_5930 326
754 3300046455 Ga0495603_0036892 Ga0495603_0036892_703_1683 326
755 3300046455 Ga0495603_0078788 Ga0495603_0078788_287_1267 326
756 3300046457 Ga0495590_0060728 Ga0495590_0060728_64_1044 326
757 3300046459 Ga0495629_0000466 Ga0495629_0000466_22074_23054 326
758 3300046459 Ga0495629_0004045 Ga0495629_0004045_7594_8574 326
759 3300046459 Ga0495629_0011035 Ga0495629_0011035_3302_4282 326
760 3300046459 Ga0495629_0068226 Ga0495629_0068226_70_1050 326
761 3300046459 Ga0495629_0252465 Ga0495629_0252465_175_1155 326
762 3300046460 Ga0495638_0018564 Ga0495638_0018564_2194_3174 326
763 3300046460 Ga0495638_0034368 Ga0495638_0034368_746_1726 326
764 3300046461 Ga0495641_0007901 Ga0495641_0007901_125_1105 326
765 3300046461 Ga0495641_0092502 Ga0495641_0092502_60_1040 326
766 3300046462 Ga0495651_0000168 Ga0495651_0000168_19932_20912 326
767 3300046462 Ga0495651_0003405 Ga0495651_0003405_587_1567 326
768 3300046462 Ga0495651_0152373 Ga0495651_0152373_225_1205 326
769 3300046463 Ga0495653_0000027 Ga0495653_0000027_91129_92109 326
770 3300046463 Ga0495653_0016772 Ga0495653_0016772_3283_4263 326
771 3300046463 Ga0495653_0019362 Ga0495653_0019362_3373_4353 326
772 3300046472 Ga0495580_0003213 Ga0495580_0003213_11613_12593 326
773 3300046472 Ga0495580_0059842 Ga0495580_0059842_635_1615 326
774 3300046472 Ga0495580_0074304 Ga0495580_0074304_1019_1999 326
775 3300046473 Ga0495582_0098026 Ga0495582_0098026_324_1304 326
776 3300046473 Ga0495582_0099357 Ga0495582_0099357_158_1138 326
777 3300046474 Ga0495605_0075594 Ga0495605_0075594_217_1197 326
778 3300046475 Ga0495639_0004249 Ga0495639_0004249_3330_4310 326
779 3300046475 Ga0495639_0047600 Ga0495639_0047600_485_1465 326
780 3300046476 Ga0495662_0000863 Ga0495662_0000863_7274_8254 326
781 3300046476 Ga0495662_0001686 Ga0495662_0001686_5731_6711 326
782 3300046476 Ga0495662_0042394 Ga0495662_0042394_486_1466 326
783 3300046476 Ga0495662_0148936 Ga0495662_0148936_51_1031 326
784 3300046477 Ga0495664_0000021 Ga0495664_0000021_53459_54439 326
785 3300046477 Ga0495664_0003491 Ga0495664_0003491_5743_6723 326
786 3300046477 Ga0495664_0015250 Ga0495664_0015250_2646_3626 326
787 3300046477 Ga0495664_0042148 Ga0495664_0042148_241_1221 326
788 3300046507 Ga0495606_0005431 Ga0495606_0005431_3095_4075 326
789 3300046511 Ga0495608_0000020 Ga0495608_0000020_131795_132775 326
790 3300046511 Ga0495608_0001907 Ga0495608_0001907_7963_8943 326
791 3300046511 Ga0495608_0003600 Ga0495608_0003600_8436_9416 326
792 3300046511 Ga0495608_0017296 Ga0495608_0017296_999_1979 326
793 3300046511 Ga0495608_0128785 Ga0495608_0128785_561_1541 326
794 3300046514 Ga0495618_0000117 Ga0495618_0000117_11715_12695 326
795 3300046514 Ga0495618_0003862 Ga0495618_0003862_2542_3522 326
796 3300046514 Ga0495618_0004717 Ga0495618_0004717_1761_2741 326
797 3300046514 Ga0495618_0095391 Ga0495618_0095391_475_1455 326
798 3300046516 Ga0495628_0000005 Ga0495628_0000005_185012_185992 326
799 3300046516 Ga0495628_0026555 Ga0495628_0026555_2054_3034 326
800 3300046516 Ga0495628_0046909 Ga0495628_0046909_382_1362 326
801 3300046517 Ga0495630_0000272 Ga0495630_0000272_30226_31206 326
802 3300046517 Ga0495630_0018316 Ga0495630_0018316_2631_3611 326
803 3300046517 Ga0495630_0086490 Ga0495630_0086490_1262_2242 326
804 3300046519 Ga0495632_0160763 Ga0495632_0160763_25_1005 326
805 3300046522 Ga0495643_0077778 Ga0495643_0077778_494_1474 326
806 3300046524 Ga0495648_0008992 Ga0495648_0008992_6602_7582 326
807 3300046526 Ga0495666_0063183 Ga0495666_0063183_362_1342 326
808 3300046529 Ga0495652_0000001 Ga0495652_0000001_893174_894154 326
809 3300046529 Ga0495652_0004593 Ga0495652_0004593_6606_7586 326
810 3300046529 Ga0495652_0006319 Ga0495652_0006319_2118_3098 326
811 3300046529 Ga0495652_0109064 Ga0495652_0109064_539_1519 326
812 3300046529 Ga0495652_0279814 Ga0495652_0279814_48_1028 326
813 3300046529 Ga0495652_0292575 Ga0495652_0292575_68_1048 326
814 3300046531 Ga0495665_0043107 Ga0495665_0043107_136_1116 326
815 3300046531 Ga0495665_0048707 Ga0495665_0048707_319_1299 326
816 3300046531 Ga0495665_0048779 Ga0495665_0048779_780_1760 326
817 3300046533 Ga0495640_0000035 Ga0495640_0000035_55731_56711 326
818 3300046533 Ga0495640_0018973 Ga0495640_0018973_2090_3070 326
819 3300046533 Ga0495640_0029039 Ga0495640_0029039_1635_2615 326
820 3300046533 Ga0495640_0051335 Ga0495640_0051335_1663_2643 326
821 3300046533 Ga0495640_0110575 Ga0495640_0110575_526_1506 326
822 3300046536 Ga0495587_0000017 Ga0495587_0000017_134276_135256 326
823 3300046536 Ga0495587_0002660 Ga0495587_0002660_10575_11555 326
824 3300046536 Ga0495587_0013547 Ga0495587_0013547_2154_3134 326
825 3300046536 Ga0495587_0050707 Ga0495587_0050707_53_1033 326
826 3300046537 Ga0495598_0004320 Ga0495598_0004320_764_1744 326
827 3300046543 Ga0495645_0000014 Ga0495645_0000014_91096_92076 326
828 3300046543 Ga0495645_0005973 Ga0495645_0005973_133_1113 326
829 3300046543 Ga0495645_0006879 Ga0495645_0006879_6459_7439 326
830 3300046543 Ga0495645_0014184 Ga0495645_0014184_3968_4948 326
831 3300046557 Ga0495622_0002009 Ga0495622_0002009_5334_6314 326
832 3300046559 Ga0495667_0000031 Ga0495667_0000031_13420_14400 326
833 3300046559 Ga0495667_0002184 Ga0495667_0002184_10593_11573 326
834 3300046559 Ga0495667_0021766 Ga0495667_0021766_2624_3604 326
835 3300046559 Ga0495667_0058404 Ga0495667_0058404_1407_2387 326
836 3300046616 Ga0495668_0065266 Ga0495668_0065266_696_1676 326
837 3300046616 Ga0495668_0119733 Ga0495668_0119733_282_1262 326
838 3300046642 Ga0495634_0000006 Ga0495634_0000006_20987_21967 326
839 3300046642 Ga0495634_0011452 Ga0495634_0011452_5172_6152 326
840 3300046642 Ga0495634_0109427 Ga0495634_0109427_103_1083 326
841 3300046663 Ga0495635_0000030 Ga0495635_0000030_25589_26569 326
842 3300046663 Ga0495635_0003606 Ga0495635_0003606_4966_5946 326
843 3300046663 Ga0495635_0007131 Ga0495635_0007131_4379_5359 326
844 3300046663 Ga0495635_0048162 Ga0495635_0048162_221_1201 326
845 3300046663 Ga0495635_0152960 Ga0495635_0152960_83_1063 326
846 3300046663 Ga0495635_0203455 Ga0495635_0203455_77_1057 326
847 3300046674 Ga0495588_0010627 Ga0495588_0010627_1507_2487 326
848 3300046675 Ga0495657_0001166 Ga0495657_0001166_5324_6304 326
849 3300046675 Ga0495657_0014680 Ga0495657_0014680_4170_5150 326
850 3300046678 Ga0495599_0000002 Ga0495599_0000002_24597_25577 326
851 3300046678 Ga0495599_0011271 Ga0495599_0011271_4295_5275 326
852 3300046678 Ga0495599_0015198 Ga0495599_0015198_1950_2930 326
853 3300046678 Ga0495599_0056945 Ga0495599_0056945_1247_2227 326
854 3300046678 Ga0495599_0148690 Ga0495599_0148690_311_1291 326
855 3300046678 Ga0495599_0228174 Ga0495599_0228174_18_998 326
856 3300046679 Ga0495623_0000089 Ga0495623_0000089_45185_46165 326
857 3300046679 Ga0495623_0001753 Ga0495623_0001753_2693_3673 326
858 3300046679 Ga0495623_0060205 Ga0495623_0060205_1382_2362 326
859 3300046680 Ga0495646_0000018 Ga0495646_0000018_29029_30009 326
860 3300046680 Ga0495646_0010018 Ga0495646_0010018_2599_3579 326
861 3300046680 Ga0495646_0018039 Ga0495646_0018039_3042_4022 326
862 3300046681 Ga0495647_0000907 Ga0495647_0000907_5539_6519 326
863 3300046681 Ga0495647_0013670 Ga0495647_0013670_821_1801 326
864 3300046681 Ga0495647_0123839 Ga0495647_0123839_58_1038 326
865 3300046683 Ga0495658_0021532 Ga0495658_0021532_194_1174 326
866 3300046683 Ga0495658_0076471 Ga0495658_0076471_473_1453 326
867 3300046683 Ga0495658_0210430 Ga0495658_0210430_91_1071 326
868 3300046689 Ga0495613_0026096 Ga0495613_0026096_2962_3942 326
869 3300046689 Ga0495613_0116493 Ga0495613_0116493_326_1306 326
870 3300046689 Ga0495613_0264797 Ga0495613_0264797_166_1146 326
871 3300046690 Ga0495624_0011061 Ga0495624_0011061_3281_4261 326
872 3300046690 Ga0495624_0034884 Ga0495624_0034884_888_1868 326
873 3300046690 Ga0495624_0070423 Ga0495624_0070423_361_1341 326
874 3300046690 Ga0495624_0093590 Ga0495624_0093590_585_1565 326
875 3300046690 Ga0495624_0096220 Ga0495624_0096220_502_1482 326
876 3300046691 Ga0495670_0003592 Ga0495670_0003592_1587_2567 326
877 3300046794 Ga0495589_0048563 Ga0495589_0048563_496_1476 326
878 3300046809 Ga0495600_0000048 Ga0495600_0000048_33905_34885 326
879 3300046809 Ga0495600_0003284 Ga0495600_0003284_375_1355 326
880 3300046809 Ga0495600_0097062 Ga0495600_0097062_153_1133 326
881 3300047315 Ga0495581_0004036 Ga0495581_0004036_5661_6641 326
882 3300047315 Ga0495581_0005977 Ga0495581_0005977_2922_3902 326
883 3300047315 Ga0495581_0042430 Ga0495581_0042430_1292_2272 326
884 3300047317 Ga0495604_0000007 Ga0495604_0000007_260224_261204 326
885 3300047317 Ga0495604_0001751 Ga0495604_0001751_10527_11507 326
886 3300047317 Ga0495604_0020174 Ga0495604_0020174_3122_4102 326
887 3300047317 Ga0495604_0039908 Ga0495604_0039908_2668_3648 326
888 3300047317 Ga0495604_0105045 Ga0495604_0105045_436_1416 326
889 3300047317 Ga0495604_0292836 Ga0495604_0292836_12_992 326
890 3300047318 Ga0495636_0056699 Ga0495636_0056699_325_1305 326
891 3300047319 Ga0495674_0000001 Ga0495674_0000001_132948_133928 326
892 3300047319 Ga0495674_0006049 Ga0495674_0006049_2147_3127 326
893 3300047319 Ga0495674_0006535 Ga0495674_0006535_4839_5819 326
894 3300047319 Ga0495674_0032613 Ga0495674_0032613_2367_3347 326
895 3300047320 Ga0495672_0044723 Ga0495672_0044723_922_1902 326
896 3300047321 Ga0495676_0027465 Ga0495676_0027465_1769_2749 326
897 3300047322 Ga0495680_0000308 Ga0495680_0000308_24805_25785 326
898 3300047322 Ga0495680_0009804 Ga0495680_0009804_5546_6526 326
899 3300047322 Ga0495680_0016872 Ga0495680_0016872_539_1519 326
900 3300047322 Ga0495680_0058267 Ga0495680_0058267_1644_2624 326
901 3300047322 Ga0495680_0095696 Ga0495680_0095696_934_1914 326
902 3300047444 Ga0495675_0012536 Ga0495675_0012536_2532_3512 326
903 3300047444 Ga0495675_0022422 Ga0495675_0022422_2704_3684 326
904 3300047444 Ga0495675_0052079 Ga0495675_0052079_866_1846 326
905 3300047444 Ga0495675_0124063 Ga0495675_0124063_383_1363 326
906 3300047471 Ga0495684_0000009 Ga0495684_0000009_150973_151953 326
907 3300047471 Ga0495684_0004059 Ga0495684_0004059_7666_8646 326
908 3300047471 Ga0495684_0138396 Ga0495684_0138396_181_1161 326
909 3300047472 Ga0495686_0104200 Ga0495686_0104200_212_1192 326
910 3300047673 Ga0495593_0000621 Ga0495593_0000621_9217_10197 326
911 3300047673 Ga0495593_0001635 Ga0495593_0001635_2508_3488 326
912 3300047673 Ga0495593_0007523 Ga0495593_0007523_2959_3939 326
913 3300047673 Ga0495593_0032921 Ga0495593_0032921_314_1294 326
914 3300047673 Ga0495593_0100267 Ga0495593_0100267_186_1166 326
915 3300047673 Ga0495593_0153498 Ga0495593_0153498_154_1134 326
916 3300048088 Ga0495602_0000004 Ga0495602_0000004_234858_235838 326
917 3300048088 Ga0495602_0006248 Ga0495602_0006248_2072_3052 326
918 3300048088 Ga0495602_0018460 Ga0495602_0018460_3507_4487 326
919 3300048088 Ga0495602_0033855 Ga0495602_0033855_3241_4221 326
920 3300048088 Ga0495602_0178948 Ga0495602_0178948_594_1574 326
921 3300048088 Ga0495602_0247694 Ga0495602_0247694_219_1199 326
922 3300048091 Ga0495626_0076320 Ga0495626_0076320_89_1069 326
923 3300048903 Ga0496100_0132117 Ga0496100_0132117_460_1440 326
924 3300048903 Ga0496100_0170802 Ga0496100_0170802_166_1146 326
925 3300048904 Ga0496101_0109286 Ga0496101_0109286_472_1452 326
926 3300048905 Ga0496102_0026588 Ga0496102_0026588_2692_3672 326
927 3300048905 Ga0496102_0037974 Ga0496102_0037974_963_1943 326
928 3300048905 Ga0496102_0307703 Ga0496102_0307703_76_1056 326
929 3300048906 Ga0496103_0035141 Ga0496103_0035141_1661_2641 326
930 3300048906 Ga0496103_0101451 Ga0496103_0101451_339_1319 326
931 3300048907 Ga0496104_0001251 Ga0496104_0001251_9322_10302 326
932 3300048907 Ga0496104_0001999 Ga0496104_0001999_11969_12949 326
933 3300048907 Ga0496104_0055176 Ga0496104_0055176_2372_3352 326
934 3300048907 Ga0496104_0233775 Ga0496104_0233775_661_1641 326
935 3300048907 Ga0496104_0283844 Ga0496104_0283844_133_1113 326
936 3300048908 Ga0496105_0010624 Ga0496105_0010624_1271_2251 326
937 3300048908 Ga0496105_0025949 Ga0496105_0025949_1545_2525 326
938 3300048908 Ga0496105_0157729 Ga0496105_0157729_527_1507 326
939 3300048908 Ga0496105_0205996 Ga0496105_0205996_436_1416 326
940 3300048909 Ga0496106_0001947 Ga0496106_0001947_7036_8016 326
941 3300048909 Ga0496106_0018895 Ga0496106_0018895_3988_4968 326
942 3300048909 Ga0496106_0078735 Ga0496106_0078735_994_1974 326
943 3300048909 Ga0496106_0171240 Ga0496106_0171240_199_1182 326
944 3300048909 Ga0496106_0173198 Ga0496106_0173198_196_1176 326
945 3300048909 Ga0496106_0223166 Ga0496106_0223166_30_1010 326
946 3300048909 Ga0496106_0285895 Ga0496106_0285895_313_1293 326
947 3300048911 Ga0496108_0012784 Ga0496108_0012784_728_1708 326
948 3300048911 Ga0496108_0030283 Ga0496108_0030283_1921_2901 326
949 3300048911 Ga0496108_0167460 Ga0496108_0167460_278_1258 326
950 3300048911 Ga0496108_0312290 Ga0496108_0312290_128_1108 326
951 3300048911 Ga0496108_0355750 Ga0496108_0355750_173_1153 326
952 3300048912 Ga0496109_0006022 Ga0496109_0006022_2352_3332 326
953 3300048912 Ga0496109_0247928 Ga0496109_0247928_283_1263 326
954 3300048912 Ga0496109_0259622 Ga0496109_0259622_119_1099 326
955 3300048913 Ga0496110_0014880 Ga0496110_0014880_1571_2551 326
956 3300048913 Ga0496110_0017279 Ga0496110_0017279_3584_4564 326
957 3300048913 Ga0496110_0051499 Ga0496110_0051499_1835_2815 326
958 3300048913 Ga0496110_0089831 Ga0496110_0089831_1039_2022 326
959 3300048913 Ga0496110_0111022 Ga0496110_0111022_334_1314 326
960 3300048913 Ga0496110_0142478 Ga0496110_0142478_482_1462 326
961 3300048914 Ga0496111_0089300 Ga0496111_0089300_213_1193 326
962 3300048915 Ga0496112_0000008 Ga0496112_0000008_281215_282195 326
963 3300048915 Ga0496112_0043530 Ga0496112_0043530_368_1348 326
964 3300048915 Ga0496112_0057630 Ga0496112_0057630_1084_2064 326
965 3300048915 Ga0496112_0120140 Ga0496112_0120140_247_1230 326
966 3300048915 Ga0496112_0123013 Ga0496112_0123013_1520_2500 326
967 3300048915 Ga0496112_0211708 Ga0496112_0211708_194_1174 326
968 3300048916 Ga0496113_0037396 Ga0496113_0037396_1228_2208 326
969 3300048916 Ga0496113_0081605 Ga0496113_0081605_1113_2093 326
970 3300048916 Ga0496113_0091061 Ga0496113_0091061_565_1545 326
971 3300048916 Ga0496113_0145702 Ga0496113_0145702_702_1682 326
972 3300048916 Ga0496113_0183562 Ga0496113_0183562_613_1593 326
973 3300048916 Ga0496113_0272614 Ga0496113_0272614_120_1100 326
974 3300048916 Ga0496113_0393340 Ga0496113_0393340_62_1042 326
975 3300048917 Ga0496114_0236256 Ga0496114_0236256_34_1014 326
976 3300048918 Ga0496115_0037461 Ga0496115_0037461_947_1927 326
977 3300048918 Ga0496115_0053871 Ga0496115_0053871_1752_2732 326
978 3300048918 Ga0496115_0078968 Ga0496115_0078968_1296_2276 326
979 3300048918 Ga0496115_0221194 Ga0496115_0221194_142_1122 326
980 3300048919 Ga0496116_0003779 Ga0496116_0003779_4869_5849 326
981 3300048919 Ga0496116_0150301 Ga0496116_0150301_227_1207 326
982 3300048920 Ga0496117_0152860 Ga0496117_0152860_155_1135 326
983 3300048921 Ga0496118_0037196 Ga0496118_0037196_2188_3168 326
984 3300048921 Ga0496118_0075235 Ga0496118_0075235_818_1798 326
985 3300048922 Ga0496119_0051135 Ga0496119_0051135_536_1516 326
986 3300048922 Ga0496119_0082712 Ga0496119_0082712_106_1086 326
987 3300048923 Ga0496120_0044624 Ga0496120_0044624_408_1388 326
988 3300048923 Ga0496120_0045317 Ga0496120_0045317_595_1575 326
989 3300048924 Ga0496121_0000774 Ga0496121_0000774_15012_15992 326
990 3300048924 Ga0496121_0002381 Ga0496121_0002381_23368_24348 326
991 3300048924 Ga0496121_0002382 Ga0496121_0002382_25462_26472 326
992 3300048924 Ga0496121_0011136 Ga0496121_0011136_6958_7938 326
993 3300048924 Ga0496121_0027414 Ga0496121_0027414_2884_3864 326
994 3300048924 Ga0496121_0072313 Ga0496121_0072313_1694_2674 326
995 3300048924 Ga0496121_0193630 Ga0496121_0193630_180_1160 326
996 3300048927 Ga0496124_0009931 Ga0496124_0009931_2672_3652 326
997 3300048927 Ga0496124_0053613 Ga0496124_0053613_360_1340 326
998 3300048927 Ga0496124_0064362 Ga0496124_0064362_1903_2883 326
999 3300048928 Ga0496125_0000063 Ga0496125_0000063_206581_207561 326
1000 3300048929 Ga0496126_0008902 Ga0496126_0008902_1206_2186 326
1001 3300048929 Ga0496126_0012849 Ga0496126_0012849_5374_6354 326
1002 3300048929 Ga0496126_0033245 Ga0496126_0033245_486_1466 326
1003 3300048929 Ga0496126_0052396 Ga0496126_0052396_1630_2610 326
1004 3300048929 Ga0496126_0059251 Ga0496126_0059251_913_1893 326
1005 3300048929 Ga0496126_0091820 Ga0496126_0091820_435_1415 326
1006 3300048929 Ga0496126_0110123 Ga0496126_0110123_1319_2299 326
1007 3300048929 Ga0496126_0161726 Ga0496126_0161726_579_1559 326
1008 3300048929 Ga0496126_0203654 Ga0496126_0203654_640_1650 326
1009 3300048929 Ga0496126_0325362 Ga0496126_0325362_250_1230 326
1010 3300049568 Ga0501031_0021841 Ga0501031_0021841_2625_3605 326
1011 3300049569 Ga0501032_0000244 Ga0501032_0000244_10482_11462 326
1012 3300049569 Ga0501032_0007003 Ga0501032_0007003_5227_6207 326
1013 3300049569 Ga0501032_0049124 Ga0501032_0049124_1137_2117 326
1014 3300049569 Ga0501032_0073333 Ga0501032_0073333_1244_2224 326
1015 3300049570 Ga0501033_0001501 Ga0501033_0001501_9750_10730 326
1016 3300049570 Ga0501033_0009491 Ga0501033_0009491_3045_4025 326
1017 3300049570 Ga0501033_0159217 Ga0501033_0159217_567_1547 326
1018 3300049570 Ga0501033_0299851 Ga0501033_0299851_57_1037 326
1019 3300049571 Ga0501034_0001010 Ga0501034_0001010_37201_38181 326
1020 3300049571 Ga0501034_0025205 Ga0501034_0025205_4481_5461 326
1021 3300049571 Ga0501034_0027460 Ga0501034_0027460_3061_4041 326
1022 3300049571 Ga0501034_0032536 Ga0501034_0032536_3309_4289 326
1023 3300049571 Ga0501034_0062536 Ga0501034_0062536_1376_2356 326
1024 3300049571 Ga0501034_0097007 Ga0501034_0097007_1218_2198 326
1025 3300049571 Ga0501034_0279497 Ga0501034_0279497_301_1281 326
1026 3300049572 Ga0501036_0007992 Ga0501036_0007992_2712_3692 326
1027 3300049572 Ga0501036_0015886 Ga0501036_0015886_230_1210 326
1028 3300049572 Ga0501036_0047124 Ga0501036_0047124_995_1975 326
1029 3300049572 Ga0501036_0123821 Ga0501036_0123821_949_1929 326
1030 3300049573 Ga0501037_0000139 Ga0501037_0000139_56819_57799 326
1031 3300049573 Ga0501037_0002392 Ga0501037_0002392_3493_4473 326
1032 3300049573 Ga0501037_0009891 Ga0501037_0009891_4078_5058 326
1033 3300049573 Ga0501037_0025271 Ga0501037_0025271_495_1475 326
1034 3300049573 Ga0501037_0103123 Ga0501037_0103123_778_1758 326
1035 3300049574 Ga0501038_0000404 Ga0501038_0000404_10199_11179 326
1036 3300049574 Ga0501038_0029148 Ga0501038_0029148_1468_2448 326
1037 3300049574 Ga0501038_0036159 Ga0501038_0036159_103_1083 326
1038 3300049574 Ga0501038_0054759 Ga0501038_0054759_1285_2265 326
1039 3300049574 Ga0501038_0099032 Ga0501038_0099032_851_1831 326
1040 3300049575 Ga0501039_0000323 Ga0501039_0000323_23922_24902 326
1041 3300049575 Ga0501039_0036477 Ga0501039_0036477_2572_3552 326
1042 3300049575 Ga0501039_0404140 Ga0501039_0404140_37_1017 326
1043 3300049577 Ga0501041_0242487 Ga0501041_0242487_43_1023 326
1044 3300049578 Ga0501042_0039194 Ga0501042_0039194_1179_2159 326
1045 3300049578 Ga0501042_0050537 Ga0501042_0050537_166_1146 326
1046 3300049579 Ga0501043_0000021 Ga0501043_0000021_150345_151325 326
1047 3300049579 Ga0501043_0000959 Ga0501043_0000959_15612_16592 326
1048 3300049579 Ga0501043_0191254 Ga0501043_0191254_437_1417 326
1049 3300049580 Ga0501046_0004069 Ga0501046_0004069_2507_3487 326
1050 3300049580 Ga0501046_0008284 Ga0501046_0008284_1576_2556 326
1051 3300049580 Ga0501046_0022147 Ga0501046_0022147_2402_3382 326
1052 3300049581 Ga0501047_0000041 Ga0501047_0000041_2147_3127 326
1053 3300049581 Ga0501047_0010517 Ga0501047_0010517_615_1595 326
1054 3300049581 Ga0501047_0042697 Ga0501047_0042697_390_1370 326
1055 3300049581 Ga0501047_0046029 Ga0501047_0046029_1307_2287 326
1056 3300049581 Ga0501047_0178204 Ga0501047_0178204_918_1898 326
1057 3300049582 Ga0501048_0003605 Ga0501048_0003605_4543_5523 326
1058 3300049582 Ga0501048_0016835 Ga0501048_0016835_3185_4165 326
1059 3300049582 Ga0501048_0033070 Ga0501048_0033070_725_1705 326
1060 3300049583 Ga0501067_0003176 Ga0501067_0003176_423_1403 326
1061 3300049583 Ga0501067_0008943 Ga0501067_0008943_1614_2594 326
1062 3300049583 Ga0501067_0025069 Ga0501067_0025069_1446_2426 326
1063 3300049584 Ga0501068_0019094 Ga0501068_0019094_159_1139 326
1064 3300049584 Ga0501068_0148073 Ga0501068_0148073_24_1004 326
1065 3300049585 Ga0501069_0004624 Ga0501069_0004624_4692_5672 326
1066 3300049585 Ga0501069_0007710 Ga0501069_0007710_103_1083 326
1067 3300049585 Ga0501069_0081733 Ga0501069_0081733_665_1645 326
1068 3300049586 Ga0501070_0003487 Ga0501070_0003487_4422_5402 326
1069 3300049586 Ga0501070_0083423 Ga0501070_0083423_1151_2131 326
1070 3300049587 Ga0501071_0035196 Ga0501071_0035196_1739_2719 326
1071 3300049587 Ga0501071_0073302 Ga0501071_0073302_1438_2418 326
1072 3300049588 Ga0501072_0002290 Ga0501072_0002290_9759_10739 326
1073 3300049588 Ga0501072_0180112 Ga0501072_0180112_143_1123 326
1074 3300049588 Ga0501072_0272263 Ga0501072_0272263_284_1264 326
1075 3300049589 Ga0501073_0000726 Ga0501073_0000726_9051_10031 326
1076 3300049589 Ga0501073_0010678 Ga0501073_0010678_4566_5546 326
1077 3300049589 Ga0501073_0030215 Ga0501073_0030215_416_1396 326
1078 3300049589 Ga0501073_0101988 Ga0501073_0101988_861_1841 326
1079 3300049589 Ga0501073_0190721 Ga0501073_0190721_45_1025 326
1080 3300049590 Ga0501074_0002972 Ga0501074_0002972_8776_9756 326
1081 3300049590 Ga0501074_0005925 Ga0501074_0005925_7699_8679 326
1082 3300049590 Ga0501074_0027820 Ga0501074_0027820_2714_3694 326
1083 3300049590 Ga0501074_0068086 Ga0501074_0068086_1394_2374 326
1084 3300049590 Ga0501074_0128878 Ga0501074_0128878_523_1503 326
1085 3300049591 Ga0501075_0066146 Ga0501075_0066146_157_1143 326
1086 3300049591 Ga0501075_0077606 Ga0501075_0077606_127_1107 326
1087 3300049592 Ga0501076_0033858 Ga0501076_0033858_730_1716 326
1088 3300049592 Ga0501076_0144368 Ga0501076_0144368_922_1902 326
1089 3300049593 Ga0501077_0011883 Ga0501077_0011883_509_1495 326
1090 3300049593 Ga0501077_0229346 Ga0501077_0229346_28_1008 326
1091 3300049741 Ga0501079_0013190 Ga0501079_0013190_5215_6195 326
1092 3300049741 Ga0501079_0282690 Ga0501079_0282690_94_1074 326
1093 3300049742 Ga0501080_0017289 Ga0501080_0017289_2147_3127 326
1094 3300049742 Ga0501080_0049335 Ga0501080_0049335_1606_2586 326
1095 3300049742 Ga0501080_0058816 Ga0501080_0058816_1326_2306 326
1096 3300049742 Ga0501080_0136419 Ga0501080_0136419_984_2021 326
1097 3300049742 Ga0501080_0223961 Ga0501080_0223961_95_1075 326
1098 3300049744 Ga0501083_0006439 Ga0501083_0006439_4504_5484 326
1099 3300049744 Ga0501083_0014851 Ga0501083_0014851_4350_5330 326
1100 3300049744 Ga0501083_0018151 Ga0501083_0018151_3870_4850 326
1101 3300049744 Ga0501083_0112787 Ga0501083_0112787_518_1498 326
1102 3300049744 Ga0501083_0170178 Ga0501083_0170178_111_1097 326
1103 3300049822 Ga0501035_0000090 Ga0501035_0000090_102614_103594 326
1104 3300049822 Ga0501035_0000267 Ga0501035_0000267_17155_18135 326
1105 3300049822 Ga0501035_0016159 Ga0501035_0016159_467_1447 326
1106 3300049822 Ga0501035_0026473 Ga0501035_0026473_103_1083 326
1107 3300049822 Ga0501035_0060418 Ga0501035_0060418_879_1859 326
1108 3300049823 Ga0501044_0000054 Ga0501044_0000054_138273_139253 326
1109 3300049823 Ga0501044_0001046 Ga0501044_0001046_18699_19679 326
1110 3300049823 Ga0501044_0028089 Ga0501044_0028089_2760_3740 326
1111 3300049823 Ga0501044_0127215 Ga0501044_0127215_1300_2280 326
1112 3300049823 Ga0501044_0489862 Ga0501044_0489862_95_1075 326
1113 3300049824 Ga0501045_0025375 Ga0501045_0025375_904_1884 326
1114 3300049824 Ga0501045_0054842 Ga0501045_0054842_878_1858 326
1115 3300049824 Ga0501045_0094235 Ga0501045_0094235_95_1075 326
1116 3300049824 Ga0501045_0263434 Ga0501045_0263434_72_1058 326
1117 3300050490 nmdc:mga03n38_26707_c1 nmdc:mga03n38_26707_c1_968_1948 326
1118 3300050490 nmdc:mga03n38_81964_c1 nmdc:mga03n38_81964_c1_101_1081 326
1119 3300050493 nmdc:mga0k408_17157_c1 nmdc:mga0k408_17157_c1_390_1370 326
1120 3300050494 nmdc:mga06z11_132592_c1 nmdc:mga06z11_132592_c1_181_1161 326
1121 3300050494 nmdc:mga06z11_142930_c1 nmdc:mga06z11_142930_c1_217_1233 326
1122 3300050495 nmdc:mga04h51_39155_c1 nmdc:mga04h51_39155_c1_183_1163 326
1123 3300050507 nmdc:mga05p37_322_c1 nmdc:mga05p37_322_c1_5368_6348 326
1124 3300050507 nmdc:mga05p37_463834_c1 nmdc:mga05p37_463834_c1_342_1322 326
1125 3300050507 nmdc:mga05p37_80518_c1 nmdc:mga05p37_80518_c1_2489_3541 326
1126 3300050508 nmdc:mga09592_1363_c1 nmdc:mga09592_1363_c1_10837_11817 326
1127 3300050509 nmdc:mga0qj67_47_c1 nmdc:mga0qj67_47_c1_40973_42061 326
1128 3300050509 nmdc:mga0qj67_5914_c1 nmdc:mga0qj67_5914_c1_6964_7944 326
1129 3300050510 nmdc:mga06r32_211834_c1 nmdc:mga06r32_211834_c1_682_1662 326
1130 3300050510 nmdc:mga06r32_7884_c1 nmdc:mga06r32_7884_c1_2503_3483 326
1131 3300050511 nmdc:mga08y16_339_c1 nmdc:mga08y16_339_c1_36425_37405 326
1132 3300050511 nmdc:mga08y16_60305_c1 nmdc:mga08y16_60305_c1_2160_3140 326
1133 3300050512 nmdc:mga0n895_170560_c1 nmdc:mga0n895_170560_c1_295_1275 326
1134 3300050512 nmdc:mga0n895_18648_c1 nmdc:mga0n895_18648_c1_1517_2497 326
1135 3300050512 nmdc:mga0n895_56505_c1 nmdc:mga0n895_56505_c1_1372_2352 326
1136 3300050513 nmdc:mga0rr50_281981_c1 nmdc:mga0rr50_281981_c1_134_1114 326
1137 3300050513 nmdc:mga0rr50_290797_c1 nmdc:mga0rr50_290797_c1_158_1138 326
1138 3300050514 nmdc:mga08x19_4826_c1 nmdc:mga08x19_4826_c1_4421_5401 326
1139 3300050514 nmdc:mga08x19_55995_c1 nmdc:mga08x19_55995_c1_364_1344 326
1140 3300050516 nmdc:mga0sz30_22292_c1 nmdc:mga0sz30_22292_c1_308_1288 326
1141 3300053077 Ga0495601_0000020 Ga0495601_0000020_26150_27130 326
1142 3300053077 Ga0495601_0001311 Ga0495601_0001311_11053_12033 326
1143 3300053077 Ga0495601_0011803 Ga0495601_0011803_670_1650 326
1144 3300053077 Ga0495601_0031369 Ga0495601_0031369_1864_2844 326
1145 3300053077 Ga0495601_0183951 Ga0495601_0183951_239_1219 326
1146 3300053077 Ga0495601_0203613 Ga0495601_0203613_198_1178 326
1147 3300053078 Ga0495612_0000020 Ga0495612_0000020_45670_46650 326
1148 3300053078 Ga0495612_0024777 Ga0495612_0024777_270_1250 326
1149 3300053078 Ga0495612_0030802 Ga0495612_0030802_306_1286 326
1150 3300053078 Ga0495612_0036129 Ga0495612_0036129_263_1243 326
1151 3300053078 Ga0495612_0059215 Ga0495612_0059215_69_1049 326
1152 3300053078 Ga0495612_0066106 Ga0495612_0066106_176_1156 326
1153 3300053078 Ga0495612_0086572 Ga0495612_0086572_265_1245 326
1154 3300053084 Ga0495595_0000047 Ga0495595_0000047_36853_37833 326
1155 3300053084 Ga0495595_0002838 Ga0495595_0002838_2474_3454 326
1156 3300053084 Ga0495595_0016846 Ga0495595_0016846_550_1530 326
1157 3300053085 Ga0495619_0000011 Ga0495619_0000011_91069_92049 326
1158 3300053085 Ga0495619_0000666 Ga0495619_0000666_8150_9130 326
1159 3300053085 Ga0495619_0004499 Ga0495619_0004499_7076_8056 326
1160 3300053085 Ga0495619_0023548 Ga0495619_0023548_1743_2723 326
1161 3300053085 Ga0495619_0033892 Ga0495619_0033892_1909_2889 326
1162 3300053085 Ga0495619_0149703 Ga0495619_0149703_25_1005 326
1163 3300053085 Ga0495619_0162315 Ga0495619_0162315_279_1259 326
1164 3300053085 Ga0495619_0275163 Ga0495619_0275163_151_1131 326
1165 3300053086 Ga0500578_0078209 Ga0500578_0078209_752_1732 326
1166 3300053087 Ga0500643_000060 Ga0500643_000060_37575_38555 326
1167 3300053094 Ga0500566_0000153 Ga0500566_0000153_2101_3081 326
1168 3300053094 Ga0500566_0001073 Ga0500566_0001073_8217_9197 326
1169 3300053095 Ga0500640_007920 Ga0500640_007920_2869_3849 326
1170 3300053096 Ga0500641_0004731 Ga0500641_0004731_2209_3189 326
1171 3300053096 Ga0500641_0036080 Ga0500641_0036080_628_1644 326
1172 3300053097 Ga0500648_090630 Ga0500648_090630_232_1212 326
1173 3300053098 Ga0500650_0057997 Ga0500650_0057997_151_1131 326
1174 3300053104 Ga0500556_0000002 Ga0500556_0000002_22247_23227 326
1175 3300053108 Ga0500562_011377 Ga0500562_011377_1081_2097 326
1176 3300053111 Ga0500572_000037 Ga0500572_000037_6258_7238 326
1177 3300053111 Ga0500572_003966 Ga0500572_003966_180_1160 326
1178 3300053115 Ga0500591_016088 Ga0500591_016088_2531_3511 326
1179 3300053117 Ga0500593_000675 Ga0500593_000675_9477_10457 326
1180 3300053119 Ga0500595_000928 Ga0500595_000928_13947_14927 326
1181 3300053119 Ga0500595_010514 Ga0500595_010514_207_1223 326
1182 3300053119 Ga0500595_022665 Ga0500595_022665_360_1340 326
1183 3300053119 Ga0500595_047748 Ga0500595_047748_159_1139 326
1184 3300053122 Ga0500608_006163 Ga0500608_006163_3828_4808 326
1185 3300053122 Ga0500608_015900 Ga0500608_015900_735_1715 326
1186 3300053123 Ga0500614_001350 Ga0500614_001350_1920_2900 326
1187 3300053130 Ga0500642_0000026 Ga0500642_0000026_31807_32787 326
1188 3300053130 Ga0500642_0000121 Ga0500642_0000121_12725_13705 326
1189 3300053130 Ga0500642_0040854 Ga0500642_0040854_159_1139 326
1190 3300053130 Ga0500642_0085220 Ga0500642_0085220_455_1435 326
1191 3300053131 Ga0500652_000006 Ga0500652_000006_9648_10628 326
1192 3300053131 Ga0500652_012872 Ga0500652_012872_455_1435 326
1193 3300053136 Ga0500559_0000820 Ga0500559_0000820_353_1333 326
1194 3300053136 Ga0500559_0001249 Ga0500559_0001249_12102_13082 326
1195 3300053136 Ga0500559_0009672 Ga0500559_0009672_3110_4090 326
1196 3300053139 Ga0500568_0020417 Ga0500568_0020417_1563_2543 326
1197 3300053139 Ga0500568_0061858 Ga0500568_0061858_19_999 326
1198 3300053139 Ga0500568_0066617 Ga0500568_0066617_12_992 326
1199 3300053148 Ga0500590_032737 Ga0500590_032737_1579_2559 326
1200 3300053150 Ga0500603_002170 Ga0500603_002170_316_1296 326
1201 3300053150 Ga0500603_009924 Ga0500603_009924_884_1864 326
1202 3300053151 Ga0500604_0012379 Ga0500604_0012379_1262_2242 326
1203 3300053153 Ga0500616_0000031 Ga0500616_0000031_125482_126462 326
1204 3300053153 Ga0500616_0014826 Ga0500616_0014826_69_1049 326
1205 3300053153 Ga0500616_0064420 Ga0500616_0064420_858_1838 326
1206 3300053155 Ga0500620_041627 Ga0500620_041627_77_1057 326
1207 3300053156 Ga0500622_0000994 Ga0500622_0000994_14063_15043 326
1208 3300053158 Ga0500627_0113564 Ga0500627_0113564_110_1090 326
1209 3300053161 Ga0500634_0020533 Ga0500634_0020533_811_1791 326
1210 3300053162 Ga0500638_042347 Ga0500638_042347_1167_2147 326
1211 3300053163 Ga0500639_029738 Ga0500639_029738_1788_2768 326
1212 3300053163 Ga0500639_029795 Ga0500639_029795_309_1289 326
1213 3300053177 Ga0500636_0002229 Ga0500636_0002229_8868_9848 326
1214 3300053177 Ga0500636_0026285 Ga0500636_0026285_2045_3025 326
1215 3300053730 Ga0500645_029995 Ga0500645_029995_237_1217 326
1216 3300053730 Ga0500645_034242 Ga0500645_034242_202_1182 326
1217 3300053731 Ga0500609_005484 Ga0500609_005484_330_1310 326
1218 3300053735 Ga0500596_000261 Ga0500596_000261_1336_2316 326
1219 3300053735 Ga0500596_005857 Ga0500596_005857_141_1121 326
1220 3300053737 Ga0500601_002226 Ga0500601_002226_292_1272 326
1221 3300054114 Ga0501084_0074754 Ga0501084_0074754_1682_2662 326
1222 3300054114 Ga0501084_0173987 Ga0501084_0173987_36_1016 326
1223 3300060353 Ga0501082_0009080 Ga0501082_0009080_1046_2032 326
1224 3300060353 Ga0501082_0013829 Ga0501082_0013829_3890_4870 326
1225 3300060353 Ga0501082_0030790 Ga0501082_0030790_2092_3072 326
1226 3300060353 Ga0501082_0089631 Ga0501082_0089631_1454_2434 326
1227 3300061719 Ga0466962_0089752 Ga0466962_0089752_61_1041 326
1228 3300061734 Ga0530510_0008568 Ga0530510_0008568_1230_2210 326
1229 3300061734 Ga0530510_0122990 Ga0530510_0122990_449_1486 326
1230 2209111006 2214884083 2213936990 327
1231 3300000042 ARSoilYngRDRAFT_c00098 ARSoilYngRDRAFT_0009814 327
1232 3300000043 ARcpr5yngRDRAFT_c000086 ARcpr5yngRDRAFT_00008614 327
1233 3300000044 ARSoilOldRDRAFT_c000048 ARSoilOldRDRAFT_0000482 327
1234 3300000652 ARCol0yngRDRAFT_1000082 ARCol0yngRDRAFT_10000822 327
1235 3300005290 Ga0065712_10072242 Ga0065712_100722422 327
1236 3300005328 Ga0070676_10162263 Ga0070676_101622631 327
1237 3300005329 Ga0070683_100448137 Ga0070683_1004481372 327
1238 3300005330 Ga0070690_100097844 Ga0070690_1000978442 327
1239 3300005331 Ga0070670_100043084 Ga0070670_1000430844 327
1240 3300005335 Ga0070666_10007621 Ga0070666_100076217 327
1241 3300005336 Ga0070680_100029644 Ga0070680_1000296442 327
1242 3300005338 Ga0068868_100029584 Ga0068868_1000295842 327
1243 3300005340 Ga0070689_100016023 Ga0070689_1000160233 327
1244 3300005340 Ga0070689_100065050 Ga0070689_1000650502 327
1245 3300005341 Ga0070691_10074836 Ga0070691_100748361 327
1246 3300005343 Ga0070687_100013740 Ga0070687_1000137402 327
1247 3300005343 Ga0070687_100076060 Ga0070687_1000760602 327
1248 3300005344 Ga0070661_100025301 Ga0070661_1000253013 327
1249 3300005347 Ga0070668_100102669 Ga0070668_1001026691 327
1250 3300005353 Ga0070669_100054343 Ga0070669_1000543432 327
1251 3300005354 Ga0070675_100029836 Ga0070675_1000298364 327
1252 3300005364 Ga0070673_100020397 Ga0070673_1000203974 327
1253 3300005365 Ga0070688_100003579 Ga0070688_1000035796 327
1254 3300005366 Ga0070659_100033865 Ga0070659_1000338653 327
1255 3300005367 Ga0070667_100420976 Ga0070667_1004209761 327
1256 3300005406 Ga0070703_10037630 Ga0070703_100376302 327
1257 3300005434 Ga0070709_10002226 Ga0070709_100022262 327
1258 3300005434 Ga0070709_10050661 Ga0070709_100506611 327
1259 3300005435 Ga0070714_100070998 Ga0070714_1000709982 327
1260 3300005436 Ga0070713_100000538 Ga0070713_1000005385 327
1261 3300005438 Ga0070701_10072260 Ga0070701_100722602 327
1262 3300005439 Ga0070711_100026452 Ga0070711_1000264522 327
1263 3300005440 Ga0070705_100039403 Ga0070705_1000394031 327
1264 3300005440 Ga0070705_100108050 Ga0070705_1001080502 327
1265 3300005441 Ga0070700_100007014 Ga0070700_1000070144 327
1266 3300005441 Ga0070700_100053234 Ga0070700_1000532342 327
1267 3300005455 Ga0070663_100043820 Ga0070663_1000438203 327
1268 3300005455 Ga0070663_100062956 Ga0070663_1000629562 327
1269 3300005455 Ga0070663_100162438 Ga0070663_1001624382 327
1270 3300005455 Ga0070663_100301490 Ga0070663_1003014901 327
1271 3300005456 Ga0070678_100337228 Ga0070678_1003372282 327
1272 3300005457 Ga0070662_100011242 Ga0070662_1000112423 327
1273 3300005458 Ga0070681_10039483 Ga0070681_100394833 327
1274 3300005459 Ga0068867_100033723 Ga0068867_1000337233 327
1275 3300005466 Ga0070685_10036133 Ga0070685_100361332 327
1276 3300005466 Ga0070685_10145315 Ga0070685_101453151 327
1277 3300005530 Ga0070679_100148576 Ga0070679_1001485762 327
1278 3300005535 Ga0070684_100021333 Ga0070684_1000213333 327
1279 3300005539 Ga0068853_100021935 Ga0068853_1000219354 327
1280 3300005543 Ga0070672_100095742 Ga0070672_1000957422 327
1281 3300005544 Ga0070686_100005455 Ga0070686_1000054552 327
1282 3300005544 Ga0070686_100010968 Ga0070686_1000109682 327
1283 3300005546 Ga0070696_100104723 Ga0070696_1001047232 327
1284 3300005549 Ga0070704_100008183 Ga0070704_1000081835 327
1285 3300005549 Ga0070704_100138024 Ga0070704_1001380242 327
1286 3300005564 Ga0070664_100124211 Ga0070664_1001242112 327
1287 3300005564 Ga0070664_100296469 Ga0070664_1002964692 327
1288 3300005577 Ga0068857_100009393 Ga0068857_1000093938 327
1289 3300005578 Ga0068854_100035005 Ga0068854_1000350052 327
1290 3300005614 Ga0068856_100021983 Ga0068856_1000219832 327
1291 3300005615 Ga0070702_100018944 Ga0070702_1000189442 327
1292 3300005617 Ga0068859_100032401 Ga0068859_1000324014 327
1293 3300005719 Ga0068861_100028109 Ga0068861_1000281093 327
1294 3300005840 Ga0068870_10130626 Ga0068870_101306262 327
1295 3300005841 Ga0068863_100099967 Ga0068863_1000999672 327
1296 3300005841 Ga0068863_100246949 Ga0068863_1002469492 327
1297 3300005842 Ga0068858_100067981 Ga0068858_1000679811 327
1298 3300005842 Ga0068858_100532490 Ga0068858_1005324901 327
1299 3300005843 Ga0068860_100075857 Ga0068860_1000758573 327
1300 3300005843 Ga0068860_100275375 Ga0068860_1002753752 327
1301 3300005844 Ga0068862_100016209 Ga0068862_1000162094 327
1302 3300005937 Ga0081455_10000659 Ga0081455_1000065933 327
1303 3300005937 Ga0081455_10002747 Ga0081455_1000274715 327
1304 3300006028 Ga0070717_10000815 Ga0070717_1000081516 327
1305 3300006173 Ga0070716_100001371 Ga0070716_1000013716 327
1306 3300006178 Ga0075367_10141784 Ga0075367_101417842 327
1307 3300006237 Ga0097621_100096666 Ga0097621_1000966662 327
1308 3300006358 Ga0068871_100010107 Ga0068871_1000101072 327
1309 3300006844 Ga0075428_100432883 Ga0075428_1004328832 327
1310 3300006846 Ga0075430_100004445 Ga0075430_10000444510 327
1311 3300006847 Ga0075431_100010046 Ga0075431_1000100463 327
1312 3300006852 Ga0075433_10003020 Ga0075433_100030209 327
1313 3300006871 Ga0075434_100007759 Ga0075434_1000077597 327
1314 3300006880 Ga0075429_100064925 Ga0075429_1000649253 327
1315 3300006881 Ga0068865_100097443 Ga0068865_1000974432 327
1316 3300006881 Ga0068865_100224404 Ga0068865_1002244042 327
1317 3300006914 Ga0075436_100060762 Ga0075436_1000607622 327
1318 3300006931 Ga0097620_100032402 Ga0097620_1000324022 327
1319 3300009094 Ga0111539_10001617 Ga0111539_100016176 327
1320 3300009094 Ga0111539_10088673 Ga0111539_100886732 327
1321 3300009094 Ga0111539_10346264 Ga0111539_103462642 327
1322 3300009098 Ga0105245_10124352 Ga0105245_101243521 327
1323 3300009101 Ga0105247_10079870 Ga0105247_100798702 327
1324 3300009101 Ga0105247_10206924 Ga0105247_102069241 327
1325 3300009147 Ga0114129_10040152 Ga0114129_100401525 327
1326 3300009148 Ga0105243_10012416 Ga0105243_100124162 327
1327 3300009176 Ga0105242_10008510 Ga0105242_100085107 327
1328 3300009177 Ga0105248_10013566 Ga0105248_100135666 327
1329 3300009177 Ga0105248_10608941 Ga0105248_106089411 327
1330 3300009545 Ga0105237_10118799 Ga0105237_101187992 327
1331 3300009553 Ga0105249_10027543 Ga0105249_100275434 327
1332 3300009553 Ga0105249_10047216 Ga0105249_100472162 327
1333 3300010375 Ga0105239_10026875 Ga0105239_100268754 327
1334 3300013104 Ga0157370_10072039 Ga0157370_100720393 327
1335 3300013307 Ga0157372_10110467 Ga0157372_101104673 327
1336 3300013308 Ga0157375_10307934 Ga0157375_103079342 327
1337 3300014325 Ga0163163_10001661 Ga0163163_1000166115 327
1338 3300014325 Ga0163163_10142927 Ga0163163_101429272 327
1339 3300014497 Ga0182008_10138590 Ga0182008_101385902 327
1340 3300017792 Ga0163161_10067955 Ga0163161_100679552 327
1341 3300025893 Ga0207682_10003795 Ga0207682_100037954 327
1342 3300025898 Ga0207692_10058438 Ga0207692_100584382 327
1343 3300025900 Ga0207710_10069257 Ga0207710_100692572 327
1344 3300025901 Ga0207688_10033577 Ga0207688_100335771 327
1345 3300025901 Ga0207688_10100816 Ga0207688_101008162 327
1346 3300025904 Ga0207647_10013944 Ga0207647_100139442 327
1347 3300025905 Ga0207685_10036457 Ga0207685_100364572 327
1348 3300025906 Ga0207699_10003724 Ga0207699_100037242 327
1349 3300025908 Ga0207643_10002121 Ga0207643_100021215 327
1350 3300025911 Ga0207654_10051528 Ga0207654_100515282 327
1351 3300025915 Ga0207693_10014440 Ga0207693_100144406 327
1352 3300025916 Ga0207663_10202520 Ga0207663_102025201 327
1353 3300025917 Ga0207660_10015387 Ga0207660_100153875 327
1354 3300025917 Ga0207660_10186834 Ga0207660_101868342 327
1355 3300025919 Ga0207657_10008445 Ga0207657_100084454 327
1356 3300025925 Ga0207650_10027086 Ga0207650_100270864 327
1357 3300025925 Ga0207650_10045621 Ga0207650_100456212 327
1358 3300025925 Ga0207650_10051128 Ga0207650_100511281 327
1359 3300025928 Ga0207700_10000913 Ga0207700_100009139 327
1360 3300025929 Ga0207664_10135435 Ga0207664_101354352 327
1361 3300025931 Ga0207644_10020005 Ga0207644_100200054 327
1362 3300025931 Ga0207644_10258631 Ga0207644_102586312 327
1363 3300025932 Ga0207690_10030057 Ga0207690_100300574 327
1364 3300025932 Ga0207690_10038653 Ga0207690_100386532 327
1365 3300025933 Ga0207706_10019412 Ga0207706_100194124 327
1366 3300025937 Ga0207669_10020141 Ga0207669_100201414 327
1367 3300025938 Ga0207704_10012846 Ga0207704_100128463 327
1368 3300025939 Ga0207665_10001612 Ga0207665_100016126 327
1369 3300025940 Ga0207691_10073776 Ga0207691_100737763 327
1370 3300025941 Ga0207711_10135971 Ga0207711_101359711 327
1371 3300025942 Ga0207689_10007949 Ga0207689_100079497 327
1372 3300025944 Ga0207661_10174743 Ga0207661_101747432 327
1373 3300025945 Ga0207679_10040484 Ga0207679_100404843 327
1374 3300025961 Ga0207712_10086809 Ga0207712_100868092 327
1375 3300025961 Ga0207712_10128296 Ga0207712_101282962 327
1376 3300025972 Ga0207668_10097393 Ga0207668_100973932 327
1377 3300025972 Ga0207668_10100568 Ga0207668_101005682 327
1378 3300025981 Ga0207640_10048610 Ga0207640_100486102 327
1379 3300026041 Ga0207639_10014933 Ga0207639_100149335 327
1380 3300026067 Ga0207678_10004934 Ga0207678_100049348 327
1381 3300026075 Ga0207708_10009665 Ga0207708_100096654 327
1382 3300026075 Ga0207708_10104357 Ga0207708_101043572 327
1383 3300026078 Ga0207702_10132231 Ga0207702_101322312 327
1384 3300026088 Ga0207641_10251126 Ga0207641_102511261 327
1385 3300026089 Ga0207648_10036697 Ga0207648_100366972 327
1386 3300026095 Ga0207676_10082305 Ga0207676_100823053 327
1387 3300026095 Ga0207676_10179295 Ga0207676_101792952 327
1388 3300026116 Ga0207674_10012834 Ga0207674_100128344 327
1389 3300026118 Ga0207675_100040263 Ga0207675_1000402632 327
1390 3300026121 Ga0207683_10009344 Ga0207683_100093447 327
1391 3300027682 Ga0209971_1008234 Ga0209971_10082342 327
1392 3300027695 Ga0209966_1001982 Ga0209966_10019821 327
1393 3300027717 Ga0209998_10001536 Ga0209998_100015364 327
1394 3300027907 Ga0207428_10004895 Ga0207428_100048954 327
1395 3300027907 Ga0207428_10048788 Ga0207428_100487881 327
1396 3300027907 Ga0207428_10212034 Ga0207428_102120342 327
1397 3300028379 Ga0268266_10014465 Ga0268266_100144652 327
1398 3300028380 Ga0268265_10046645 Ga0268265_100466452 327
1399 3300028556 Ga0265337_1000250 Ga0265337_100025010 327
1400 3300031238 Ga0265332_10071449 Ga0265332_100714491 327
1401 3300031241 Ga0265325_10000044 Ga0265325_1000004428 327
1402 3300031241 Ga0265325_10023243 Ga0265325_100232432 327
1403 3300031241 Ga0265325_10053338 Ga0265325_100533382 327
1404 3300031250 Ga0265331_10027548 Ga0265331_100275483 327
1405 3300031344 Ga0265316_10031941 Ga0265316_100319412 327
1406 3300031595 Ga0265313_10005699 Ga0265313_100056994 327
1407 3300031595 Ga0265313_10029575 Ga0265313_100295752 327
1408 3300031711 Ga0265314_10020715 Ga0265314_100207154 327
1409 3300034816 Ga0373930_0000285 Ga0373930_0000285_5191_6174 327
1410 3300034817 Ga0373948_0000255 Ga0373948_0000255_4734_5717 327
1411 3300034817 Ga0373948_0003127 Ga0373948_0003127_1278_2261 327
1412 3300034818 Ga0373950_0004659 Ga0373950_0004659_790_1773 327
1413 3300034819 Ga0373958_0001208 Ga0373958_0001208_1216_2199 327
1414 3300034957 Ga0373938_0000221 Ga0373938_0000221_5058_6041 327
1415 3300035084 Ga0373928_0000343 Ga0373928_0000343_5617_6600 327
1416 3300035085 Ga0373929_0001109 Ga0373929_0001109_3947_4930 327
1417 3300035088 Ga0373940_0000114 Ga0373940_0000114_3215_4198 327
1418 3300035090 Ga0373949_0001190 Ga0373949_0001190_1985_2968 327
1419 3300035090 Ga0373949_0047389 Ga0373949_0047389_31_1014 327
1420 3300035091 Ga0373951_0002735 Ga0373951_0002735_2714_3697 327
1421 3300035092 Ga0373952_0001334 Ga0373952_0001334_2705_3688 327
1422 3300035092 Ga0373952_0002388 Ga0373952_0002388_1339_2322 327
1423 3300035112 Ga0373932_0001725 Ga0373932_0001725_4308_5291 327
1424 3300035113 Ga0373936_0036041 Ga0373936_0036041_958_1941 327
1425 3300035114 Ga0373939_0000959 Ga0373939_0000959_593_1576 327
1426 3300035115 Ga0373941_0010405 Ga0373941_0010405_1355_2338 327
1427 3300035116 Ga0373945_0017874 Ga0373945_0017874_163_1146 327
1428 3300035118 Ga0373954_0043081 Ga0373954_0043081_323_1306 327
1429 3300035119 Ga0373956_0008823 Ga0373956_0008823_1625_2608 327
1430 3300035120 Ga0373957_0006391 Ga0373957_0006391_968_1951 327
1431 3300035121 Ga0373960_0000015 Ga0373960_0000015_3373_4356 327
1432 3300035172 Ga0373955_0003445 Ga0373955_0003445_2943_3926 327
1433 3300035172 Ga0373955_0063814 Ga0373955_0063814_111_1094 327
1434 3300035207 Ga0373942_0000964 Ga0373942_0000964_2650_3633 327
1435 3300035241 Ga0373961_0000165 Ga0373961_0000165_29452_30435 327
1436 3300035242 Ga0373962_0000231 Ga0373962_0000231_5224_6207 327
1437 3300035242 Ga0373962_0003799 Ga0373962_0003799_317_1300 327
1438 3300035691 Ga0373931_0004246 Ga0373931_0004246_4239_5222 327
1439 3300035692 Ga0373935_0022661 Ga0373935_0022661_289_1272 327
1440 3300035692 Ga0373935_0052771 Ga0373935_0052771_939_1922 327
1441 3300035724 Ga0373933_0210708 Ga0373933_0210708_140_1123 327
1442 3300036401 Ga0373937_0010273 Ga0373937_0010273_6242_7225 327
1443 3300036401 Ga0373937_0191192 Ga0373937_0191192_130_1113 327
1444 3300037068 Ga0373925_0250769 Ga0373925_0250769_238_1221 327
1445 3300044712 Ga0453684_0104350 Ga0453684_0104350_1762_2745 327
1446 3300045051 Ga0451576_0086655 Ga0451576_0086655_423_1406 327
1447 3300046455 Ga0495603_0015396 Ga0495603_0015396_27_1010 327
1448 3300046459 Ga0495629_0000702 Ga0495629_0000702_24535_25518 327
1449 3300046459 Ga0495629_0072650 Ga0495629_0072650_1152_2135 327
1450 3300046461 Ga0495641_0005439 Ga0495641_0005439_6519_7502 327
1451 3300046461 Ga0495641_0012562 Ga0495641_0012562_1401_2384 327
1452 3300046462 Ga0495651_0002990 Ga0495651_0002990_7316_8299 327
1453 3300046462 Ga0495651_0027176 Ga0495651_0027176_3411_4394 327
1454 3300046463 Ga0495653_0004606 Ga0495653_0004606_3021_4004 327
1455 3300046473 Ga0495582_0008925 Ga0495582_0008925_3432_4415 327
1456 3300046475 Ga0495639_0079949 Ga0495639_0079949_90_1073 327
1457 3300046476 Ga0495662_0005554 Ga0495662_0005554_3816_4799 327
1458 3300046499 Ga0495594_0041513 Ga0495594_0041513_1473_2456 327
1459 3300046501 Ga0495607_0026190 Ga0495607_0026190_1847_2830 327
1460 3300046511 Ga0495608_0015405 Ga0495608_0015405_1910_2893 327
1461 3300046511 Ga0495608_0031322 Ga0495608_0031322_876_1859 327
1462 3300046526 Ga0495666_0035533 Ga0495666_0035533_1385_2368 327
1463 3300046533 Ga0495640_0015200 Ga0495640_0015200_593_1576 327
1464 3300046536 Ga0495587_0155522 Ga0495587_0155522_61_1044 327
1465 3300046559 Ga0495667_0003812 Ga0495667_0003812_7076_8059 327
1466 3300046559 Ga0495667_0046353 Ga0495667_0046353_1045_2028 327
1467 3300046642 Ga0495634_0064926 Ga0495634_0064926_180_1163 327
1468 3300046663 Ga0495635_0010546 Ga0495635_0010546_1775_2758 327
1469 3300046664 Ga0495659_0008660 Ga0495659_0008660_1146_2129 327
1470 3300046674 Ga0495588_0007628 Ga0495588_0007628_3438_4421 327
1471 3300046675 Ga0495657_0007822 Ga0495657_0007822_2141_3124 327
1472 3300046681 Ga0495647_0005483 Ga0495647_0005483_1393_2376 327
1473 3300046681 Ga0495647_0104819 Ga0495647_0104819_88_1071 327
1474 3300046683 Ga0495658_0000435 Ga0495658_0000435_15710_16693 327
1475 3300046689 Ga0495613_0081167 Ga0495613_0081167_579_1562 327
1476 3300046690 Ga0495624_0019205 Ga0495624_0019205_2479_3462 327
1477 3300046691 Ga0495670_0026402 Ga0495670_0026402_1740_2723 327
1478 3300046809 Ga0495600_0000361 Ga0495600_0000361_14743_15726 327
1479 3300047315 Ga0495581_0016766 Ga0495581_0016766_3100_4083 327
1480 3300047315 Ga0495581_0019386 Ga0495581_0019386_729_1712 327
1481 3300047321 Ga0495676_0196181 Ga0495676_0196181_356_1339 327
1482 3300047322 Ga0495680_0062318 Ga0495680_0062318_429_1412 327
1483 3300047322 Ga0495680_0111057 Ga0495680_0111057_947_1930 327
1484 3300047445 Ga0495677_0036530 Ga0495677_0036530_667_1650 327
1485 3300047471 Ga0495684_0009914 Ga0495684_0009914_2581_3564 327
1486 3300047673 Ga0495593_0019141 Ga0495593_0019141_691_1674 327
1487 3300048088 Ga0495602_0050122 Ga0495602_0050122_1568_2551 327
1488 3300048089 Ga0495614_0005640 Ga0495614_0005640_4285_5268 327
1489 3300048906 Ga0496103_0054160 Ga0496103_0054160_1255_2238 327
1490 3300048906 Ga0496103_0071295 Ga0496103_0071295_224_1207 327
1491 3300048906 Ga0496103_0088156 Ga0496103_0088156_244_1290 327
1492 3300048909 Ga0496106_0012581 Ga0496106_0012581_3708_4754 327
1493 3300048909 Ga0496106_0407641 Ga0496106_0407641_14_997 327
1494 3300048910 Ga0496107_0010784 Ga0496107_0010784_2126_3109 327
1495 3300048910 Ga0496107_0102220 Ga0496107_0102220_957_1940 327
1496 3300048911 Ga0496108_0011395 Ga0496108_0011395_4768_5751 327
1497 3300048912 Ga0496109_0067360 Ga0496109_0067360_1077_2060 327
1498 3300048914 Ga0496111_0062976 Ga0496111_0062976_1245_2228 327
1499 3300048915 Ga0496112_0072365 Ga0496112_0072365_1348_2331 327
1500 3300048916 Ga0496113_0049398 Ga0496113_0049398_1476_2459 327
1501 3300048916 Ga0496113_0053066 Ga0496113_0053066_228_1274 327
1502 3300048916 Ga0496113_0096491 Ga0496113_0096491_149_1132 327
1503 3300048918 Ga0496115_0049884 Ga0496115_0049884_1185_2231 327
1504 3300048918 Ga0496115_0080516 Ga0496115_0080516_30_1013 327
1505 3300049585 Ga0501069_0114521 Ga0501069_0114521_309_1292 327
1506 3300049591 Ga0501075_0147735 Ga0501075_0147735_66_1049 327
1507 3300049593 Ga0501077_0022407 Ga0501077_0022407_2981_3964 327
1508 3300050492 nmdc:mga0yw44_271379_c1 nmdc:mga0yw44_271379_c1_28_1023 327
1509 3300050507 nmdc:mga05p37_32928_c1 nmdc:mga05p37_32928_c1_3548_4531 327
1510 3300050507 nmdc:mga05p37_41237_c1 nmdc:mga05p37_41237_c1_46_1029 327
1511 3300050508 nmdc:mga09592_4562_c1 nmdc:mga09592_4562_c1_8220_9203 327
1512 3300050509 nmdc:mga0qj67_5189_c1 nmdc:mga0qj67_5189_c1_1815_2798 327
1513 3300050510 nmdc:mga06r32_16898_c1 nmdc:mga06r32_16898_c1_3420_4403 327
1514 3300050511 nmdc:mga08y16_123459_c1 nmdc:mga08y16_123459_c1_984_1967 327
1515 3300050511 nmdc:mga08y16_24211_c1 nmdc:mga08y16_24211_c1_3420_4403 327
1516 3300050511 nmdc:mga08y16_269506_c1 nmdc:mga08y16_269506_c1_485_1468 327
1517 3300050511 nmdc:mga08y16_61374_c1 nmdc:mga08y16_61374_c1_2648_3631 327
1518 3300050512 nmdc:mga0n895_174075_c1 nmdc:mga0n895_174075_c1_54_1037 327
1519 3300050512 nmdc:mga0n895_25817_c1 nmdc:mga0n895_25817_c1_3253_4236 327
1520 3300050513 nmdc:mga0rr50_2534_c1 nmdc:mga0rr50_2534_c1_3434_4417 327
1521 3300050514 nmdc:mga08x19_119274_c1 nmdc:mga08x19_119274_c1_530_1513 327
1522 3300050515 nmdc:mga0a205_4597_c1 nmdc:mga0a205_4597_c1_6842_7825 327
1523 3300053077 Ga0495601_0002946 Ga0495601_0002946_7148_8131 327
1524 3300053077 Ga0495601_0008405 Ga0495601_0008405_1116_2099 327
1525 3300053077 Ga0495601_0119950 Ga0495601_0119950_25_1008 327
1526 3300053078 Ga0495612_0001687 Ga0495612_0001687_7275_8258 327
1527 3300053084 Ga0495595_0014698 Ga0495595_0014698_2156_3139 327
1528 3300053084 Ga0495595_0100958 Ga0495595_0100958_99_1082 327
1529 3300053085 Ga0495619_0001703 Ga0495619_0001703_13499_14482 327
1530 3300053085 Ga0495619_0003610 Ga0495619_0003610_2275_3258 327
1531 3300053085 Ga0495619_0050747 Ga0495619_0050747_712_1695 327
1532 3300053085 Ga0495619_0087482 Ga0495619_0087482_795_1778 327
1533 3300053088 Ga0500644_0000801 Ga0500644_0000801_4569_5552 327
1534 3300060353 Ga0501082_0147344 Ga0501082_0147344_268_1251 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

2

247

0.89

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

160

0.88

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

3

126

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

3

302

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eq2-assembly1.cif.gz_C the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase 0.9244 1 318
1eq2-assembly2.cif.gz_J the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase 0.9222 1 318
1eq2-assembly2.cif.gz_H the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase 0.9206 1 318
1eq2-assembly1.cif.gz_C the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase 0.9146 1 318
1eq2-assembly2.cif.gz_J the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase 0.9134 1 318
ID Description Score Start End Superfamily
af_Q4D0K9_1_118_3.50.50.80 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 0.9212 2 31 3.50.50.80
6iweA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9182 2 29 3.50.50.60
2x6tA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8872 1 247 3.40.50.720
af_Q9Y7N4_8_341_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.853 2 30 3.40.50.720
af_O45307_4_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8369 1 30 3.40.50.720
ID Description Score Start End GO Terms
AF-Q07RN2-F1-model_v4 ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20) (ADP-L-glycero-beta-D-manno-heptose-6-epimerase) (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep 6-epimerase) (AGME) 0.9907 1 327 GO:0005975
GO:0008712
GO:0050661
GO:0097171
AF-A0A1H4QIE1-F1-model_v4 ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20) (ADP-L-glycero-beta-D-manno-heptose-6-epimerase) (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep 6-epimerase) (AGME) 0.9907 1 327 GO:0005975
GO:0008712
GO:0050661
GO:0097171
AF-A0A355VH68-F1-model_v4 deleted 0.9895 169 327
AF-A0A533J7A2-F1-model_v4 deleted 0.9883 115 327
AF-Q07RN2-F1-model_v4 ADP-L-glycero-D-manno-heptose-6-epimerase (EC 5.1.3.20) (ADP-L-glycero-beta-D-manno-heptose-6-epimerase) (ADP-glyceromanno-heptose 6-epimerase) (ADP-hep 6-epimerase) (AGME) 0.9877 1 327 GO:0005975
GO:0008712
GO:0050661
GO:0097171

Feature Viewer

pLDDT pTM Quality
93.92 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map