F494549
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1523 | 609 | 1479 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10086341|Ga0207683_100863411 |
| Length | 210 |
| Sequence | MAPNKPLLKSSITLPTSFRAPGVQSRNGRVVFPYSVVPGGVTVSVGTDNVVTVKGPKGELKQSVDRDIKVEVKDGNVEFGRPTDQIRHKALHGLYRSLVNNMVKGVTEGYKKQLELVGVGYKAANQGNTLDLALGFSHNIVFEVPKELKVATATEKGQNPKIFLEGSDKQLLGQVAAKLRSLRKPEPYKGKGVKYSDEVVRRKAGKAAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 4 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 5 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 6 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 7 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 8 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 9 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 10 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 11 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 12 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 13 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 14 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 15 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 16 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 17 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 18 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 19 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 20 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 21 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 22 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 23 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 24 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 25 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 26 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 27 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 28 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 29 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 30 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 31 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 32 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 33 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 34 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 35 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 36 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 38 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 39 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 40 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 41 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 42 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 43 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 46 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 47 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 48 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 49 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 50 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 54 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 55 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 56 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 57 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 58 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 59 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 66 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 67 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 70 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 79 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 111 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 117 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 123 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 129 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 130 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 131 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 134 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 135 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 136 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 137 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 138 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 139 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 140 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 141 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 142 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 143 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 144 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 146 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 149 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 150 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 152 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 153 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 154 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 155 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 156 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 157 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 162 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 163 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 164 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 165 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 191 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 195 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 196 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 197 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 199 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 200 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 201 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 202 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 203 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 208 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 211 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 288 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 298 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 302 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 303 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 304 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 305 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 306 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 307 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 308 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 309 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 310 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 311 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 312 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 313 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 314 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 315 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 316 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 317 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 318 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 319 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 320 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 321 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 322 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 323 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 324 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 325 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 326 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 327 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 329 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 334 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 335 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 336 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 337 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 338 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 342 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 344 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 345 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 347 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 348 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 349 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 350 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 351 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 352 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 353 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 354 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 355 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 357 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 358 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 359 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 360 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 361 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 362 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 363 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 364 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 365 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 366 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 367 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 368 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 369 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 370 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 371 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 372 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 373 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 374 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 375 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 376 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 377 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 378 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 379 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 380 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 381 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 382 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 383 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 384 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 385 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 386 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 387 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 388 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 389 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 390 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 391 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 392 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 393 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 394 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 395 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 396 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 464 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 465 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 466 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 467 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 468 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 469 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 471 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 472 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 473 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 474 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 475 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 476 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 477 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 478 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 479 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 480 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 481 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 482 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 483 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 484 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 494 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 495 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 497 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 498 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 500 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 501 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 502 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 503 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 505 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 506 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 507 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 517 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 518 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 524 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 525 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 530 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 531 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 532 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 533 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 534 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 535 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 536 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 537 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 538 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 539 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 540 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 541 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 542 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 543 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 544 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 545 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 546 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 547 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 548 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 549 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 550 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 551 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 552 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 555 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 556 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 557 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 558 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 559 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 560 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 561 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 562 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 563 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 564 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 567 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 568 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 569 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 570 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 571 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 572 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 573 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 574 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 575 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 579 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 580 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 581 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 582 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 583 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 584 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 585 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 586 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 587 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 588 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 589 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 590 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 591 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 592 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 593 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 594 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 595 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 596 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 597 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 598 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 599 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 600 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 601 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 603 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 604 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 605 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 606 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 607 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 608 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 609 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.24 |
| Metatranscriptomes | 3.87 |
| Isolates | 2.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.57 |
| Nodule | 0.33 |
| Rhizoplane | 2.43 |
| Rhizosphere | 85.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 2 | LJQas_1012500 | 3300000549 | Bacteria | 1004 |
| 3 | JGI24740J21852_10000106 | 3300001979 | Bacteria | 29886 |
| 4 | JGI24739J22299_10002345 | 3300001989 | Bacteria | 7297 |
| 5 | JGI24739J22299_10036599 | 3300001989 | Bacteria | 1657 |
| 6 | JGI25154J39366_1000001 | 3300002738 | Bacteria | 483450 |
| 7 | JGI25157J39369_1005374 | 3300002741 | Bacteria | 2102 |
| 8 | JGI25152J39213_1000006 | 3300002773 | Bacteria | 158516 |
| 9 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 10 | JGI25159J45721_1008657 | 3300002987 | Bacteria | 2772 |
| 11 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 12 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 13 | JGI25153J46596_10002304 | 3300003215 | Bacteria | 11112 |
| 14 | JGI25153J46596_10009633 | 3300003215 | Bacteria | 4456 |
| 15 | JGI25153J46596_10081054 | 3300003215 | Bacteria | 809 |
| 16 | rootH2_10052858 | 3300003320 | Bacteria | 6186 |
| 17 | rootH2_10069215 | 3300003320 | Bacteria | 8580 |
| 18 | rootH2_10116651 | 3300003320 | Bacteria | 2121 |
| 19 | rootL2_10084253 | 3300003322 | Bacteria | 1942 |
| 20 | rootH1_10008389 | 3300003323 | Bacteria | 21562 |
| 21 | rootH1_10024399 | 3300003323 | Bacteria | 9655 |
| 22 | rootH1_10137015 | 3300003323 | Bacteria | 3689 |
| 23 | JGI26129J50193_1007612 | 3300003349 | Unclassified | 783 |
| 24 | JGI25160J50197_1002424 | 3300003354 | Bacteria | 8693 |
| 25 | JGI25160J50197_1004776 | 3300003354 | Bacteria | 5786 |
| 26 | JGI25160J50197_1032347 | 3300003354 | Bacteria | 1330 |
| 27 | JGI25160J50197_1051232 | 3300003354 | Bacteria | 874 |
| 28 | Ga0006562J51391_1003423 | 3300003578 | Bacteria | 13910 |
| 29 | Ga0055535_1006118 | 3300003761 | Bacteria | 2495 |
| 30 | Ga0055542_1017834 | 3300003762 | Bacteria | 1090 |
| 31 | Ga0055526_1004445 | 3300003771 | Bacteria | 8418 |
| 32 | Ga0055528_1000330 | 3300003790 | Bacteria | 39818 |
| 33 | Ga0055530_10000331 | 3300003791 | Bacteria | 42800 |
| 34 | Ga0055531_10000133 | 3300003794 | Bacteria | 84995 |
| 35 | Ga0055531_10000166 | 3300003794 | Bacteria | 74728 |
| 36 | Ga0055531_10008711 | 3300003794 | Bacteria | 5300 |
| 37 | Ga0058860_10114316 | 3300004801 | Bacteria | 13584 |
| 38 | Ga0065165_1000105 | 3300005262 | Bacteria | 140409 |
| 39 | Ga0065165_1007036 | 3300005262 | Bacteria | 5666 |
| 40 | Ga0065714_10023783 | 3300005288 | Bacteria | 1302 |
| 41 | Ga0065714_10156834 | 3300005288 | Bacteria | 1073 |
| 42 | Ga0065704_10086392 | 3300005289 | Bacteria | 3122 |
| 43 | Ga0065704_10103057 | 3300005289 | Bacteria | 2184 |
| 44 | Ga0065712_10008429 | 3300005290 | Bacteria | 3026 |
| 45 | Ga0065712_10008525 | 3300005290 | Bacteria | 2646 |
| 46 | Ga0065712_10113906 | 3300005290 | Bacteria | 1772 |
| 47 | Ga0065715_10093983 | 3300005293 | Bacteria | 4482 |
| 48 | Ga0065715_10124098 | 3300005293 | Bacteria | 2162 |
| 49 | Ga0065715_10177959 | 3300005293 | Bacteria | 1497 |
| 50 | Ga0065715_10508194 | 3300005293 | Bacteria | 766 |
| 51 | Ga0065715_10581349 | 3300005293 | Bacteria | 718 |
| 52 | Ga0065707_10097311 | 3300005295 | Bacteria | 3185 |
| 53 | Ga0070658_10009019 | 3300005327 | Bacteria | 8022 |
| 54 | Ga0070658_10169704 | 3300005327 | Bacteria | 1833 |
| 55 | Ga0070658_10186882 | 3300005327 | Bacteria | 1745 |
| 56 | Ga0070658_10306771 | 3300005327 | Bacteria | 1354 |
| 57 | Ga0070658_10343531 | 3300005327 | Bacteria | 1277 |
| 58 | Ga0070658_10357028 | 3300005327 | Bacteria | 1251 |
| 59 | Ga0070658_10530426 | 3300005327 | Bacteria | 1018 |
| 60 | Ga0070658_10562857 | 3300005327 | Unclassified | 987 |
| 61 | Ga0070658_11414870 | 3300005327 | Bacteria | 603 |
| 62 | Ga0070676_10004653 | 3300005328 | Bacteria | 7249 |
| 63 | Ga0070676_10024284 | 3300005328 | Bacteria | 3414 |
| 64 | Ga0070676_10062712 | 3300005328 | Bacteria | 2212 |
| 65 | Ga0070676_10313604 | 3300005328 | Bacteria | 1067 |
| 66 | Ga0070676_10621000 | 3300005328 | Bacteria | 781 |
| 67 | Ga0070676_11087944 | 3300005328 | Bacteria | 603 |
| 68 | Ga0070683_100003340 | 3300005329 | Bacteria | 12981 |
| 69 | Ga0070683_100009922 | 3300005329 | Bacteria | 8162 |
| 70 | Ga0070683_100081164 | 3300005329 | Bacteria | 3036 |
| 71 | Ga0070683_100241279 | 3300005329 | Bacteria | 1719 |
| 72 | Ga0070683_100298539 | 3300005329 | Bacteria | 1532 |
| 73 | Ga0070683_101267235 | 3300005329 | Bacteria | 708 |
| 74 | Ga0070690_100233403 | 3300005330 | Bacteria | 1294 |
| 75 | Ga0070690_100589134 | 3300005330 | Bacteria | 843 |
| 76 | Ga0070670_100060731 | 3300005331 | Bacteria | 3245 |
| 77 | Ga0070670_100468747 | 3300005331 | Bacteria | 1117 |
| 78 | Ga0070677_10001593 | 3300005333 | Bacteria | 7176 |
| 79 | Ga0070677_10046785 | 3300005333 | Bacteria | 1732 |
| 80 | Ga0070677_10252608 | 3300005333 | Bacteria | 876 |
| 81 | Ga0068869_100051776 | 3300005334 | Bacteria | 2979 |
| 82 | Ga0068869_100185023 | 3300005334 | Bacteria | 1635 |
| 83 | Ga0068869_100271127 | 3300005334 | Bacteria | 1362 |
| 84 | Ga0068869_100442893 | 3300005334 | Bacteria | 1075 |
| 85 | Ga0070666_10000191 | 3300005335 | Bacteria | 42149 |
| 86 | Ga0070666_10189487 | 3300005335 | Unclassified | 1445 |
| 87 | Ga0070666_10217369 | 3300005335 | Bacteria | 1347 |
| 88 | Ga0070666_10463033 | 3300005335 | Bacteria | 916 |
| 89 | Ga0070666_10507550 | 3300005335 | Bacteria | 875 |
| 90 | Ga0070680_100064155 | 3300005336 | Bacteria | 3010 |
| 91 | Ga0070680_100088507 | 3300005336 | Bacteria | 2561 |
| 92 | Ga0070680_100259279 | 3300005336 | Bacteria | 1470 |
| 93 | Ga0070680_100349840 | 3300005336 | Bacteria | 1256 |
| 94 | Ga0070680_100411529 | 3300005336 | Bacteria | 1153 |
| 95 | Ga0070682_100007172 | 3300005337 | Bacteria | 6277 |
| 96 | Ga0070682_100010066 | 3300005337 | Bacteria | 5358 |
| 97 | Ga0070682_100016944 | 3300005337 | Bacteria | 4241 |
| 98 | Ga0070682_100126149 | 3300005337 | Bacteria | 1725 |
| 99 | Ga0070682_100373008 | 3300005337 | Bacteria | 1071 |
| 100 | Ga0070682_100686045 | 3300005337 | Bacteria | 820 |
| 101 | Ga0070682_101108578 | 3300005337 | Bacteria | 663 |
| 102 | Ga0068868_100004630 | 3300005338 | Bacteria | 9650 |
| 103 | Ga0068868_100013181 | 3300005338 | Bacteria | 6055 |
| 104 | Ga0068868_100344761 | 3300005338 | Bacteria | 1274 |
| 105 | Ga0068868_100478873 | 3300005338 | Bacteria | 1087 |
| 106 | Ga0070660_100180211 | 3300005339 | Bacteria | 1709 |
| 107 | Ga0070660_100334563 | 3300005339 | Bacteria | 1245 |
| 108 | Ga0070660_100384174 | 3300005339 | Bacteria | 1159 |
| 109 | Ga0070660_100401734 | 3300005339 | Bacteria | 1133 |
| 110 | Ga0070660_100652046 | 3300005339 | Bacteria | 882 |
| 111 | Ga0070660_100926298 | 3300005339 | Bacteria | 735 |
| 112 | Ga0070660_101030934 | 3300005339 | Bacteria | 695 |
| 113 | Ga0070689_100053901 | 3300005340 | Bacteria | 3113 |
| 114 | Ga0070689_100053903 | 3300005340 | Bacteria | 3113 |
| 115 | Ga0070689_101177376 | 3300005340 | Unclassified | 687 |
| 116 | Ga0070691_10005091 | 3300005341 | Bacteria | 5973 |
| 117 | Ga0070691_10007739 | 3300005341 | Bacteria | 4920 |
| 118 | Ga0070691_10038620 | 3300005341 | Bacteria | 2254 |
| 119 | Ga0070691_10077262 | 3300005341 | Bacteria | 1625 |
| 120 | Ga0070687_100019156 | 3300005343 | Bacteria | 3180 |
| 121 | Ga0070687_100346159 | 3300005343 | Bacteria | 958 |
| 122 | Ga0070661_100020833 | 3300005344 | Bacteria | 4678 |
| 123 | Ga0070661_100065820 | 3300005344 | Bacteria | 2663 |
| 124 | Ga0070661_100068143 | 3300005344 | Bacteria | 2615 |
| 125 | Ga0070661_100579274 | 3300005344 | Bacteria | 905 |
| 126 | Ga0070668_100004151 | 3300005347 | Bacteria | 10731 |
| 127 | Ga0070668_100038069 | 3300005347 | Bacteria | 3674 |
| 128 | Ga0070668_100271417 | 3300005347 | Bacteria | 1414 |
| 129 | Ga0070668_100658622 | 3300005347 | Bacteria | 920 |
| 130 | Ga0070669_100008677 | 3300005353 | Bacteria | 7251 |
| 131 | Ga0070669_100125906 | 3300005353 | Bacteria | 1960 |
| 132 | Ga0070669_100132566 | 3300005353 | Bacteria | 1913 |
| 133 | Ga0070669_100140043 | 3300005353 | Bacteria | 1864 |
| 134 | Ga0070669_100546586 | 3300005353 | Bacteria | 965 |
| 135 | Ga0070669_100704253 | 3300005353 | Bacteria | 853 |
| 136 | Ga0070675_100022693 | 3300005354 | Bacteria | 5014 |
| 137 | Ga0070675_100070749 | 3300005354 | Bacteria | 2892 |
| 138 | Ga0070675_100148933 | 3300005354 | Bacteria | 2005 |
| 139 | Ga0070675_100149729 | 3300005354 | Bacteria | 2000 |
| 140 | Ga0070675_100254829 | 3300005354 | Bacteria | 1537 |
| 141 | Ga0070675_100266704 | 3300005354 | Bacteria | 1502 |
| 142 | Ga0070675_100289788 | 3300005354 | Bacteria | 1440 |
| 143 | Ga0070675_100361131 | 3300005354 | Bacteria | 1289 |
| 144 | Ga0070671_100036529 | 3300005355 | Bacteria | 4074 |
| 145 | Ga0070671_100190007 | 3300005355 | Bacteria | 1740 |
| 146 | Ga0070674_100002220 | 3300005356 | Bacteria | 10679 |
| 147 | Ga0070674_100087796 | 3300005356 | Bacteria | 2237 |
| 148 | Ga0070673_100006656 | 3300005364 | Bacteria | 7534 |
| 149 | Ga0070673_100011200 | 3300005364 | Bacteria | 6115 |
| 150 | Ga0070673_100055828 | 3300005364 | Bacteria | 3113 |
| 151 | Ga0070673_100160707 | 3300005364 | Bacteria | 1910 |
| 152 | Ga0070673_100679499 | 3300005364 | Bacteria | 944 |
| 153 | Ga0070673_101564579 | 3300005364 | Bacteria | 622 |
| 154 | Ga0070688_100005699 | 3300005365 | Bacteria | 6582 |
| 155 | Ga0070688_100037058 | 3300005365 | Bacteria | 2970 |
| 156 | Ga0070688_100099130 | 3300005365 | Bacteria | 1918 |
| 157 | Ga0070688_100416885 | 3300005365 | Bacteria | 997 |
| 158 | Ga0070659_100265579 | 3300005366 | Bacteria | 1425 |
| 159 | Ga0070659_100426578 | 3300005366 | Bacteria | 1122 |
| 160 | Ga0070659_100541933 | 3300005366 | Bacteria | 995 |
| 161 | Ga0070667_100000248 | 3300005367 | Bacteria | 61183 |
| 162 | Ga0070667_100027949 | 3300005367 | Bacteria | 4694 |
| 163 | Ga0070667_100074036 | 3300005367 | Bacteria | 2905 |
| 164 | Ga0070667_100170442 | 3300005367 | Bacteria | 1921 |
| 165 | Ga0070667_100194249 | 3300005367 | Bacteria | 1799 |
| 166 | Ga0070667_100215840 | 3300005367 | Bacteria | 1706 |
| 167 | Ga0070667_100230033 | 3300005367 | Bacteria | 1653 |
| 168 | Ga0070667_100561217 | 3300005367 | Bacteria | 1050 |
| 169 | Ga0070709_10178408 | 3300005434 | Bacteria | 1490 |
| 170 | Ga0070714_100119027 | 3300005435 | Bacteria | 2347 |
| 171 | Ga0070714_100166074 | 3300005435 | Bacteria | 2000 |
| 172 | Ga0070714_100968588 | 3300005435 | Bacteria | 827 |
| 173 | Ga0070713_100072196 | 3300005436 | Bacteria | 2919 |
| 174 | Ga0070713_100549100 | 3300005436 | Bacteria | 1094 |
| 175 | Ga0070713_100715239 | 3300005436 | Bacteria | 957 |
| 176 | Ga0070710_10193372 | 3300005437 | Bacteria | 1281 |
| 177 | Ga0070710_10244122 | 3300005437 | Bacteria | 1152 |
| 178 | Ga0070701_10022246 | 3300005438 | Bacteria | 3037 |
| 179 | Ga0070701_10355167 | 3300005438 | Bacteria | 917 |
| 180 | Ga0070711_100132105 | 3300005439 | Bacteria | 1860 |
| 181 | Ga0070711_100481273 | 3300005439 | Bacteria | 1020 |
| 182 | Ga0070705_100842829 | 3300005440 | Bacteria | 733 |
| 183 | Ga0070694_100087623 | 3300005444 | Bacteria | 2178 |
| 184 | Ga0070694_100249688 | 3300005444 | Bacteria | 1341 |
| 185 | Ga0070708_100001661 | 3300005445 | Bacteria | 17067 |
| 186 | Ga0070708_100006987 | 3300005445 | Bacteria | 9006 |
| 187 | Ga0070708_100021209 | 3300005445 | Bacteria | 5490 |
| 188 | Ga0070708_100107836 | 3300005445 | Bacteria | 2557 |
| 189 | Ga0070663_100084547 | 3300005455 | Bacteria | 2339 |
| 190 | Ga0070663_100521323 | 3300005455 | Bacteria | 989 |
| 191 | Ga0070678_100003711 | 3300005456 | Bacteria | 8544 |
| 192 | Ga0070678_100064863 | 3300005456 | Bacteria | 2709 |
| 193 | Ga0070678_100277908 | 3300005456 | Bacteria | 1415 |
| 194 | Ga0070662_100007728 | 3300005457 | Bacteria | 6979 |
| 195 | Ga0070662_100066199 | 3300005457 | Bacteria | 2650 |
| 196 | Ga0070662_100094007 | 3300005457 | Bacteria | 2256 |
| 197 | Ga0070662_100427648 | 3300005457 | Bacteria | 1096 |
| 198 | Ga0070662_100485217 | 3300005457 | Bacteria | 1029 |
| 199 | Ga0070662_100499086 | 3300005457 | Bacteria | 1015 |
| 200 | Ga0070662_100637874 | 3300005457 | Bacteria | 898 |
| 201 | Ga0070662_100734367 | 3300005457 | Bacteria | 837 |
| 202 | Ga0070681_10083427 | 3300005458 | Bacteria | 3149 |
| 203 | Ga0070681_10113109 | 3300005458 | Bacteria | 2654 |
| 204 | Ga0070681_10229479 | 3300005458 | Bacteria | 1771 |
| 205 | Ga0070681_10431495 | 3300005458 | Bacteria | 1230 |
| 206 | Ga0068867_100063230 | 3300005459 | Bacteria | 2750 |
| 207 | Ga0068867_100078755 | 3300005459 | Bacteria | 2479 |
| 208 | Ga0068867_100123545 | 3300005459 | Bacteria | 2003 |
| 209 | Ga0068867_100187653 | 3300005459 | Bacteria | 1648 |
| 210 | Ga0070685_10015284 | 3300005466 | Bacteria | 4076 |
| 211 | Ga0070685_10520902 | 3300005466 | Bacteria | 844 |
| 212 | Ga0070706_100001389 | 3300005467 | Bacteria | 25655 |
| 213 | Ga0070706_100031896 | 3300005467 | Bacteria | 4858 |
| 214 | Ga0070706_100317757 | 3300005467 | Bacteria | 1452 |
| 215 | Ga0070707_100000141 | 3300005468 | Bacteria | 67927 |
| 216 | Ga0070707_100008479 | 3300005468 | Bacteria | 9549 |
| 217 | Ga0070707_100020977 | 3300005468 | Bacteria | 6169 |
| 218 | Ga0070707_100697027 | 3300005468 | Bacteria | 978 |
| 219 | Ga0070698_100000139 | 3300005471 | Bacteria | 65079 |
| 220 | Ga0070698_100002247 | 3300005471 | Bacteria | 21366 |
| 221 | Ga0070698_100002802 | 3300005471 | Bacteria | 19186 |
| 222 | Ga0070698_100005143 | 3300005471 | Bacteria | 14306 |
| 223 | Ga0070698_100042072 | 3300005471 | Bacteria | 4687 |
| 224 | Ga0070698_100296642 | 3300005471 | Bacteria | 1547 |
| 225 | Ga0070698_100490060 | 3300005471 | Bacteria | 1166 |
| 226 | Ga0070699_100001695 | 3300005518 | Bacteria | 20060 |
| 227 | Ga0070699_100100649 | 3300005518 | Bacteria | 2533 |
| 228 | Ga0070699_100230854 | 3300005518 | Bacteria | 1650 |
| 229 | Ga0070699_100518074 | 3300005518 | Bacteria | 1084 |
| 230 | Ga0070679_100002167 | 3300005530 | Bacteria | 17712 |
| 231 | Ga0070679_100018421 | 3300005530 | Bacteria | 6776 |
| 232 | Ga0070679_100122192 | 3300005530 | Bacteria | 2588 |
| 233 | Ga0070679_100196306 | 3300005530 | Bacteria | 1986 |
| 234 | Ga0070679_100455102 | 3300005530 | Bacteria | 1224 |
| 235 | Ga0070684_100005718 | 3300005535 | Bacteria | 9552 |
| 236 | Ga0070684_100021469 | 3300005535 | Bacteria | 5373 |
| 237 | Ga0070684_100054023 | 3300005535 | Bacteria | 3499 |
| 238 | Ga0070684_100222706 | 3300005535 | Bacteria | 1721 |
| 239 | Ga0070684_100240060 | 3300005535 | Bacteria | 1656 |
| 240 | Ga0070697_100000181 | 3300005536 | Bacteria | 51962 |
| 241 | Ga0070697_100042276 | 3300005536 | Bacteria | 3688 |
| 242 | Ga0070697_100069683 | 3300005536 | Bacteria | 2881 |
| 243 | Ga0070697_100178920 | 3300005536 | Bacteria | 1797 |
| 244 | Ga0070697_100440906 | 3300005536 | Bacteria | 1133 |
| 245 | Ga0068853_100000250 | 3300005539 | Bacteria | 37737 |
| 246 | Ga0068853_100006139 | 3300005539 | Bacteria | 9517 |
| 247 | Ga0068853_100077661 | 3300005539 | Bacteria | 2901 |
| 248 | Ga0068853_100143789 | 3300005539 | Bacteria | 2142 |
| 249 | Ga0068853_100642229 | 3300005539 | Bacteria | 1010 |
| 250 | Ga0068853_100736552 | 3300005539 | Bacteria | 942 |
| 251 | Ga0068853_100836277 | 3300005539 | Bacteria | 882 |
| 252 | Ga0070672_100001565 | 3300005543 | Bacteria | 14168 |
| 253 | Ga0070672_100015656 | 3300005543 | Bacteria | 5410 |
| 254 | Ga0070672_100038692 | 3300005543 | Bacteria | 3647 |
| 255 | Ga0070672_100045260 | 3300005543 | Bacteria | 3403 |
| 256 | Ga0070672_100175780 | 3300005543 | Bacteria | 1782 |
| 257 | Ga0070672_100199872 | 3300005543 | Bacteria | 1671 |
| 258 | Ga0070686_100042966 | 3300005544 | Bacteria | 2833 |
| 259 | Ga0070686_100142468 | 3300005544 | Bacteria | 1670 |
| 260 | Ga0070695_100136072 | 3300005545 | Bacteria | 1698 |
| 261 | Ga0070696_100728298 | 3300005546 | Bacteria | 811 |
| 262 | Ga0070665_100000641 | 3300005548 | Bacteria | 47468 |
| 263 | Ga0070665_100018617 | 3300005548 | Bacteria | 6960 |
| 264 | Ga0070665_100027047 | 3300005548 | Bacteria | 5777 |
| 265 | Ga0070665_100293202 | 3300005548 | Bacteria | 1629 |
| 266 | Ga0070704_100174793 | 3300005549 | Bacteria | 1712 |
| 267 | Ga0070704_101042778 | 3300005549 | Bacteria | 741 |
| 268 | Ga0068855_100000133 | 3300005563 | Bacteria | 94906 |
| 269 | Ga0068855_100003486 | 3300005563 | Bacteria | 19264 |
| 270 | Ga0068855_100019947 | 3300005563 | Bacteria | 8051 |
| 271 | Ga0068855_100060509 | 3300005563 | Bacteria | 4429 |
| 272 | Ga0068855_100205594 | 3300005563 | Bacteria | 2215 |
| 273 | Ga0068855_100235336 | 3300005563 | Bacteria | 2048 |
| 274 | Ga0068855_100578001 | 3300005563 | Bacteria | 1214 |
| 275 | Ga0068855_100719953 | 3300005563 | Bacteria | 1066 |
| 276 | Ga0068855_101019638 | 3300005563 | Bacteria | 869 |
| 277 | Ga0070664_100008033 | 3300005564 | Bacteria | 8527 |
| 278 | Ga0070664_100009616 | 3300005564 | Bacteria | 7841 |
| 279 | Ga0070664_100020536 | 3300005564 | Bacteria | 5439 |
| 280 | Ga0070664_100359643 | 3300005564 | Bacteria | 1325 |
| 281 | Ga0070664_100387209 | 3300005564 | Bacteria | 1277 |
| 282 | Ga0070664_100412715 | 3300005564 | Bacteria | 1236 |
| 283 | Ga0070664_100436905 | 3300005564 | Bacteria | 1200 |
| 284 | Ga0070664_101143510 | 3300005564 | Bacteria | 734 |
| 285 | Ga0070664_101220799 | 3300005564 | Bacteria | 709 |
| 286 | Ga0068857_100006227 | 3300005577 | Bacteria | 10201 |
| 287 | Ga0068857_100024735 | 3300005577 | Bacteria | 5289 |
| 288 | Ga0068857_100046762 | 3300005577 | Bacteria | 3841 |
| 289 | Ga0068857_100085235 | 3300005577 | Bacteria | 2824 |
| 290 | Ga0068857_100100573 | 3300005577 | Bacteria | 2593 |
| 291 | Ga0068857_100268992 | 3300005577 | Bacteria | 1566 |
| 292 | Ga0068857_100309363 | 3300005577 | Bacteria | 1457 |
| 293 | Ga0068857_100315809 | 3300005577 | Bacteria | 1442 |
| 294 | Ga0068857_100343991 | 3300005577 | Bacteria | 1380 |
| 295 | Ga0068857_100596109 | 3300005577 | Bacteria | 1044 |
| 296 | Ga0068854_100014628 | 3300005578 | Bacteria | 5178 |
| 297 | Ga0068854_100021100 | 3300005578 | Bacteria | 4417 |
| 298 | Ga0068854_100590613 | 3300005578 | Bacteria | 947 |
| 299 | Ga0068854_100749247 | 3300005578 | Bacteria | 847 |
| 300 | Ga0068856_100028869 | 3300005614 | Bacteria | 5420 |
| 301 | Ga0068856_100100151 | 3300005614 | Bacteria | 2889 |
| 302 | Ga0068856_100102289 | 3300005614 | Bacteria | 2858 |
| 303 | Ga0068856_100154352 | 3300005614 | Bacteria | 2306 |
| 304 | Ga0068856_100282487 | 3300005614 | Bacteria | 1676 |
| 305 | Ga0068856_100720216 | 3300005614 | Bacteria | 1018 |
| 306 | Ga0070702_100058590 | 3300005615 | Bacteria | 2232 |
| 307 | Ga0070702_100130492 | 3300005615 | Bacteria | 1586 |
| 308 | Ga0070702_100339189 | 3300005615 | Bacteria | 1054 |
| 309 | Ga0068852_100029891 | 3300005616 | Bacteria | 4479 |
| 310 | Ga0068852_100048492 | 3300005616 | Bacteria | 3629 |
| 311 | Ga0068852_100081986 | 3300005616 | Bacteria | 2865 |
| 312 | Ga0068852_100448814 | 3300005616 | Bacteria | 1276 |
| 313 | Ga0068852_100474206 | 3300005616 | Bacteria | 1242 |
| 314 | Ga0068852_100569972 | 3300005616 | Bacteria | 1134 |
| 315 | Ga0068852_100980316 | 3300005616 | Bacteria | 864 |
| 316 | Ga0068859_100037937 | 3300005617 | Bacteria | 4835 |
| 317 | Ga0068859_100104175 | 3300005617 | Bacteria | 2896 |
| 318 | Ga0068859_100173657 | 3300005617 | Bacteria | 2237 |
| 319 | Ga0068859_100191198 | 3300005617 | Bacteria | 2131 |
| 320 | Ga0068864_100005272 | 3300005618 | Bacteria | 10592 |
| 321 | Ga0068864_100015889 | 3300005618 | Bacteria | 6265 |
| 322 | Ga0068864_100034196 | 3300005618 | Bacteria | 4322 |
| 323 | Ga0068864_100112202 | 3300005618 | Bacteria | 2430 |
| 324 | Ga0068864_100176796 | 3300005618 | Bacteria | 1949 |
| 325 | Ga0068864_100323618 | 3300005618 | Bacteria | 1448 |
| 326 | Ga0068864_100358046 | 3300005618 | Bacteria | 1378 |
| 327 | Ga0068864_100529709 | 3300005618 | Unclassified | 1137 |
| 328 | Ga0068864_101385571 | 3300005618 | Bacteria | 705 |
| 329 | Ga0068866_10043211 | 3300005718 | Bacteria | 2248 |
| 330 | Ga0068866_10215915 | 3300005718 | Bacteria | 1154 |
| 331 | Ga0068861_100028330 | 3300005719 | Bacteria | 4086 |
| 332 | Ga0068851_10001337 | 3300005834 | Bacteria | 10765 |
| 333 | Ga0068870_10321014 | 3300005840 | Bacteria | 984 |
| 334 | Ga0068863_100001373 | 3300005841 | Bacteria | 24175 |
| 335 | Ga0068863_100292329 | 3300005841 | Bacteria | 1579 |
| 336 | Ga0068863_100412768 | 3300005841 | Bacteria | 1322 |
| 337 | Ga0068863_100545888 | 3300005841 | Bacteria | 1144 |
| 338 | Ga0068863_100955446 | 3300005841 | Bacteria | 859 |
| 339 | Ga0068858_100009451 | 3300005842 | Bacteria | 9299 |
| 340 | Ga0068860_100004260 | 3300005843 | Bacteria | 14650 |
| 341 | Ga0068860_100007830 | 3300005843 | Bacteria | 10668 |
| 342 | Ga0068860_100022955 | 3300005843 | Bacteria | 6033 |
| 343 | Ga0068862_100468583 | 3300005844 | Bacteria | 1190 |
| 344 | Ga0068862_101143425 | 3300005844 | Bacteria | 775 |
| 345 | Ga0081539_10002233 | 3300005985 | Bacteria | 28209 |
| 346 | Ga0081539_10096810 | 3300005985 | Bacteria | 1512 |
| 347 | Ga0081539_10115723 | 3300005985 | Bacteria | 1341 |
| 348 | Ga0070717_10027264 | 3300006028 | Bacteria | 4565 |
| 349 | Ga0070717_10088723 | 3300006028 | Bacteria | 2607 |
| 350 | Ga0070717_10572561 | 3300006028 | Bacteria | 1024 |
| 351 | Ga0075432_10196707 | 3300006058 | Bacteria | 796 |
| 352 | Ga0070716_100093082 | 3300006173 | Bacteria | 1829 |
| 353 | Ga0070712_100140461 | 3300006175 | Bacteria | 1842 |
| 354 | Ga0070712_100144992 | 3300006175 | Bacteria | 1816 |
| 355 | Ga0070712_100195740 | 3300006175 | Bacteria | 1585 |
| 356 | Ga0075362_10019709 | 3300006177 | Bacteria | 2809 |
| 357 | Ga0075366_10005546 | 3300006195 | Bacteria | 6839 |
| 358 | Ga0075366_10005748 | 3300006195 | Bacteria | 6733 |
| 359 | Ga0075366_10052705 | 3300006195 | Bacteria | 2417 |
| 360 | Ga0075366_10055884 | 3300006195 | Bacteria | 2344 |
| 361 | Ga0075366_10063553 | 3300006195 | Bacteria | 2194 |
| 362 | Ga0075366_10190067 | 3300006195 | Bacteria | 1248 |
| 363 | Ga0075366_10303361 | 3300006195 | Bacteria | 977 |
| 364 | Ga0075366_10391996 | 3300006195 | Bacteria | 854 |
| 365 | Ga0097621_100015711 | 3300006237 | Bacteria | 5704 |
| 366 | Ga0097621_100218088 | 3300006237 | Bacteria | 1661 |
| 367 | Ga0097621_100362135 | 3300006237 | Bacteria | 1292 |
| 368 | Ga0097621_100702806 | 3300006237 | Bacteria | 931 |
| 369 | Ga0075370_10010465 | 3300006353 | Bacteria | 4852 |
| 370 | Ga0068871_100015089 | 3300006358 | Bacteria | 5775 |
| 371 | Ga0068871_100017988 | 3300006358 | Bacteria | 5361 |
| 372 | Ga0068871_100274363 | 3300006358 | Bacteria | 1473 |
| 373 | Ga0068871_100337625 | 3300006358 | Bacteria | 1330 |
| 374 | Ga0068871_100597142 | 3300006358 | Bacteria | 1004 |
| 375 | Ga0068871_101323254 | 3300006358 | Bacteria | 678 |
| 376 | Ga0075428_100013576 | 3300006844 | Bacteria | 9071 |
| 377 | Ga0075428_100041637 | 3300006844 | Bacteria | 5050 |
| 378 | Ga0075430_100011474 | 3300006846 | Bacteria | 7527 |
| 379 | Ga0075431_100022872 | 3300006847 | Bacteria | 6389 |
| 380 | Ga0075431_100051260 | 3300006847 | Bacteria | 4257 |
| 381 | Ga0075431_100276634 | 3300006847 | Bacteria | 1700 |
| 382 | Ga0075434_100350726 | 3300006871 | Bacteria | 1497 |
| 383 | Ga0075429_100048422 | 3300006880 | Bacteria | 3696 |
| 384 | Ga0075429_100070557 | 3300006880 | Unclassified | 3042 |
| 385 | Ga0075429_100221343 | 3300006880 | Bacteria | 1658 |
| 386 | Ga0068865_100003571 | 3300006881 | Bacteria | 9342 |
| 387 | Ga0068865_100036788 | 3300006881 | Bacteria | 3302 |
| 388 | Ga0068865_100672503 | 3300006881 | Bacteria | 882 |
| 389 | Ga0075436_100077507 | 3300006914 | Bacteria | 2302 |
| 390 | Ga0075436_100768590 | 3300006914 | Bacteria | 716 |
| 391 | Ga0097620_100037934 | 3300006931 | Bacteria | 4835 |
| 392 | Ga0097620_100104177 | 3300006931 | Bacteria | 2896 |
| 393 | Ga0097620_100173665 | 3300006931 | Bacteria | 2237 |
| 394 | Ga0097620_100191198 | 3300006931 | Bacteria | 2131 |
| 395 | Ga0099824_1003374 | 3300006942 | Bacteria | 23361 |
| 396 | Ga0079104_1060427 | 3300006946 | Bacteria | 818 |
| 397 | Ga0099826_10000125 | 3300006948 | Bacteria | 34471 |
| 398 | Ga0075435_100077319 | 3300007076 | Bacteria | 2728 |
| 399 | Ga0105244_10017933 | 3300009036 | Bacteria | 3985 |
| 400 | Ga0105244_10354646 | 3300009036 | Bacteria | 676 |
| 401 | Ga0105240_10000398 | 3300009093 | Bacteria | 81045 |
| 402 | Ga0105240_10011307 | 3300009093 | Bacteria | 12434 |
| 403 | Ga0105240_10016926 | 3300009093 | Bacteria | 9853 |
| 404 | Ga0105240_10050473 | 3300009093 | Bacteria | 5244 |
| 405 | Ga0105240_10059925 | 3300009093 | Bacteria | 4747 |
| 406 | Ga0105240_10194521 | 3300009093 | Bacteria | 2382 |
| 407 | Ga0105240_10254590 | 3300009093 | Bacteria | 2028 |
| 408 | Ga0105240_10366202 | 3300009093 | Bacteria | 1631 |
| 409 | Ga0105240_10443235 | 3300009093 | Bacteria | 1455 |
| 410 | Ga0105240_10609984 | 3300009093 | Bacteria | 1200 |
| 411 | Ga0111539_10042072 | 3300009094 | Bacteria | 5489 |
| 412 | Ga0111539_10236719 | 3300009094 | Bacteria | 2125 |
| 413 | Ga0111539_11024621 | 3300009094 | Unclassified | 960 |
| 414 | Ga0111539_11573137 | 3300009094 | Bacteria | 762 |
| 415 | Ga0105245_10088801 | 3300009098 | Bacteria | 2840 |
| 416 | Ga0105245_10274777 | 3300009098 | Bacteria | 1645 |
| 417 | Ga0105245_10296671 | 3300009098 | Bacteria | 1584 |
| 418 | Ga0105247_10060663 | 3300009101 | Bacteria | 2344 |
| 419 | Ga0105247_10102224 | 3300009101 | Bacteria | 1833 |
| 420 | Ga0114129_10006463 | 3300009147 | Bacteria | 16621 |
| 421 | Ga0114129_10350815 | 3300009147 | Bacteria | 1955 |
| 422 | Ga0114129_10999154 | 3300009147 | Bacteria | 1054 |
| 423 | Ga0105241_10000769 | 3300009174 | Bacteria | 24406 |
| 424 | Ga0105241_10027526 | 3300009174 | Bacteria | 4235 |
| 425 | Ga0105241_10078388 | 3300009174 | Bacteria | 2581 |
| 426 | Ga0105241_10083318 | 3300009174 | Bacteria | 2509 |
| 427 | Ga0105241_10145153 | 3300009174 | Bacteria | 1936 |
| 428 | Ga0105241_10174702 | 3300009174 | Bacteria | 1777 |
| 429 | Ga0105241_10247098 | 3300009174 | Bacteria | 1511 |
| 430 | Ga0105241_10263697 | 3300009174 | Bacteria | 1465 |
| 431 | Ga0105242_10013197 | 3300009176 | Bacteria | 6378 |
| 432 | Ga0105242_10043231 | 3300009176 | Bacteria | 3644 |
| 433 | Ga0105242_10066640 | 3300009176 | Bacteria | 2975 |
| 434 | Ga0105248_10198497 | 3300009177 | Bacteria | 2260 |
| 435 | Ga0105248_10311359 | 3300009177 | Bacteria | 1773 |
| 436 | Ga0105248_11519373 | 3300009177 | Bacteria | 758 |
| 437 | Ga0105237_10002553 | 3300009545 | Bacteria | 22488 |
| 438 | Ga0105237_10002614 | 3300009545 | Bacteria | 22176 |
| 439 | Ga0105237_10026344 | 3300009545 | Bacteria | 5942 |
| 440 | Ga0105237_10033162 | 3300009545 | Bacteria | 5232 |
| 441 | Ga0105237_10037227 | 3300009545 | Bacteria | 4919 |
| 442 | Ga0105237_10427042 | 3300009545 | Bacteria | 1331 |
| 443 | Ga0105238_10008067 | 3300009551 | Bacteria | 10530 |
| 444 | Ga0105238_10439991 | 3300009551 | Bacteria | 1300 |
| 445 | Ga0105249_10000247 | 3300009553 | Bacteria | 59908 |
| 446 | Ga0105249_10182013 | 3300009553 | Bacteria | 2045 |
| 447 | Ga0105239_10000436 | 3300010375 | Bacteria | 61031 |
| 448 | Ga0105239_10010718 | 3300010375 | Bacteria | 10239 |
| 449 | Ga0105239_10086030 | 3300010375 | Bacteria | 3465 |
| 450 | Ga0105239_10212579 | 3300010375 | Bacteria | 2168 |
| 451 | Ga0105239_10253214 | 3300010375 | Bacteria | 1978 |
| 452 | Ga0105239_10320114 | 3300010375 | Bacteria | 1749 |
| 453 | Ga0105239_10959003 | 3300010375 | Bacteria | 983 |
| 454 | Ga0105246_10010740 | 3300011119 | Bacteria | 5674 |
| 455 | Ga0105246_10298781 | 3300011119 | Unclassified | 1299 |
| 456 | Ga0105246_10395794 | 3300011119 | Bacteria | 1146 |
| 457 | Ga0157373_10123735 | 3300013100 | Bacteria | 1818 |
| 458 | Ga0157373_10169698 | 3300013100 | Bacteria | 1535 |
| 459 | Ga0157373_10336033 | 3300013100 | Bacteria | 1076 |
| 460 | Ga0157373_10420570 | 3300013100 | Bacteria | 959 |
| 461 | Ga0157373_10570695 | 3300013100 | Unclassified | 822 |
| 462 | Ga0157371_10001678 | 3300013102 | Bacteria | 22612 |
| 463 | Ga0157371_10016037 | 3300013102 | Bacteria | 5602 |
| 464 | Ga0157371_10019616 | 3300013102 | Bacteria | 4981 |
| 465 | Ga0157371_10087179 | 3300013102 | Bacteria | 2211 |
| 466 | Ga0157371_10308206 | 3300013102 | Bacteria | 1147 |
| 467 | Ga0157371_10334383 | 3300013102 | Bacteria | 1101 |
| 468 | Ga0157371_10468294 | 3300013102 | Bacteria | 928 |
| 469 | Ga0157371_10679687 | 3300013102 | Bacteria | 770 |
| 470 | Ga0157370_10072569 | 3300013104 | Bacteria | 3247 |
| 471 | Ga0157370_10075905 | 3300013104 | Bacteria | 3167 |
| 472 | Ga0157370_10086830 | 3300013104 | Bacteria | 2938 |
| 473 | Ga0157370_10127974 | 3300013104 | Bacteria | 2370 |
| 474 | Ga0157370_10139130 | 3300013104 | Bacteria | 2262 |
| 475 | Ga0157370_10290292 | 3300013104 | Bacteria | 1511 |
| 476 | Ga0157370_10402029 | 3300013104 | Bacteria | 1261 |
| 477 | Ga0157370_10413261 | 3300013104 | Bacteria | 1242 |
| 478 | Ga0157370_10453181 | 3300013104 | Bacteria | 1179 |
| 479 | Ga0157370_10509257 | 3300013104 | Bacteria | 1105 |
| 480 | Ga0157370_10536180 | 3300013104 | Bacteria | 1073 |
| 481 | Ga0157370_10551623 | 3300013104 | Bacteria | 1056 |
| 482 | Ga0157370_10739218 | 3300013104 | Bacteria | 897 |
| 483 | Ga0157370_10890643 | 3300013104 | Bacteria | 808 |
| 484 | Ga0157370_11183978 | 3300013104 | Bacteria | 690 |
| 485 | Ga0157370_11238193 | 3300013104 | Bacteria | 673 |
| 486 | Ga0157369_10000023 | 3300013105 | Bacteria | 226955 |
| 487 | Ga0157369_10000613 | 3300013105 | Bacteria | 46357 |
| 488 | Ga0157369_10032433 | 3300013105 | Bacteria | 5745 |
| 489 | Ga0157369_10071232 | 3300013105 | Bacteria | 3732 |
| 490 | Ga0157369_10135046 | 3300013105 | Bacteria | 2612 |
| 491 | Ga0157369_10346409 | 3300013105 | Bacteria | 1543 |
| 492 | Ga0157369_10541989 | 3300013105 | Bacteria | 1203 |
| 493 | Ga0157369_10777525 | 3300013105 | Bacteria | 984 |
| 494 | Ga0157369_10781971 | 3300013105 | Unclassified | 981 |
| 495 | Ga0157369_10787754 | 3300013105 | Bacteria | 977 |
| 496 | Ga0157369_11055116 | 3300013105 | Bacteria | 831 |
| 497 | Ga0157374_10007705 | 3300013296 | Bacteria | 9193 |
| 498 | Ga0157374_10055359 | 3300013296 | Bacteria | 3702 |
| 499 | Ga0157374_10172431 | 3300013296 | Bacteria | 2111 |
| 500 | Ga0157374_10180882 | 3300013296 | Bacteria | 2060 |
| 501 | Ga0157374_10320385 | 3300013296 | Bacteria | 1536 |
| 502 | Ga0157374_10832188 | 3300013296 | Bacteria | 939 |
| 503 | Ga0157378_10005083 | 3300013297 | Bacteria | 11558 |
| 504 | Ga0157378_10008184 | 3300013297 | Bacteria | 9121 |
| 505 | Ga0157378_10019722 | 3300013297 | Bacteria | 5929 |
| 506 | Ga0157378_10087620 | 3300013297 | Bacteria | 2824 |
| 507 | Ga0157378_10163750 | 3300013297 | Bacteria | 2082 |
| 508 | Ga0157378_10181392 | 3300013297 | Bacteria | 1981 |
| 509 | Ga0157378_10445427 | 3300013297 | Bacteria | 1284 |
| 510 | Ga0157378_10605303 | 3300013297 | Bacteria | 1107 |
| 511 | Ga0163162_10008143 | 3300013306 | Bacteria | 10230 |
| 512 | Ga0163162_10022452 | 3300013306 | Bacteria | 6216 |
| 513 | Ga0163162_10102052 | 3300013306 | Bacteria | 2961 |
| 514 | Ga0163162_10393923 | 3300013306 | Bacteria | 1518 |
| 515 | Ga0163162_10469381 | 3300013306 | Bacteria | 1390 |
| 516 | Ga0163162_10654724 | 3300013306 | Bacteria | 1174 |
| 517 | Ga0163162_10711473 | 3300013306 | Bacteria | 1125 |
| 518 | Ga0163162_11679631 | 3300013306 | Bacteria | 725 |
| 519 | Ga0157372_10003109 | 3300013307 | Bacteria | 17892 |
| 520 | Ga0157372_10017897 | 3300013307 | Bacteria | 7614 |
| 521 | Ga0157372_10027457 | 3300013307 | Bacteria | 6200 |
| 522 | Ga0157372_10032433 | 3300013307 | Bacteria | 5728 |
| 523 | Ga0157372_10048397 | 3300013307 | Bacteria | 4726 |
| 524 | Ga0157372_10053864 | 3300013307 | Bacteria | 4485 |
| 525 | Ga0157372_10054127 | 3300013307 | Bacteria | 4475 |
| 526 | Ga0157372_10093748 | 3300013307 | Bacteria | 3418 |
| 527 | Ga0157372_10110207 | 3300013307 | Bacteria | 3153 |
| 528 | Ga0157372_10120036 | 3300013307 | Bacteria | 3018 |
| 529 | Ga0157372_10160741 | 3300013307 | Bacteria | 2596 |
| 530 | Ga0157372_10163953 | 3300013307 | Bacteria | 2569 |
| 531 | Ga0157372_10468633 | 3300013307 | Bacteria | 1468 |
| 532 | Ga0157372_11026389 | 3300013307 | Bacteria | 955 |
| 533 | Ga0157372_11520980 | 3300013307 | Bacteria | 771 |
| 534 | Ga0157375_10010453 | 3300013308 | Bacteria | 8166 |
| 535 | Ga0157375_10035811 | 3300013308 | Bacteria | 4742 |
| 536 | Ga0157375_10099282 | 3300013308 | Bacteria | 2990 |
| 537 | Ga0157375_10115562 | 3300013308 | Bacteria | 2787 |
| 538 | Ga0157375_10434170 | 3300013308 | Bacteria | 1479 |
| 539 | Ga0157375_10564583 | 3300013308 | Bacteria | 1299 |
| 540 | Ga0157375_10581980 | 3300013308 | Bacteria | 1280 |
| 541 | Ga0157375_10865563 | 3300013308 | Bacteria | 1049 |
| 542 | Ga0163163_10023493 | 3300014325 | Bacteria | 5852 |
| 543 | Ga0163163_10069920 | 3300014325 | Bacteria | 3495 |
| 544 | Ga0163163_10105619 | 3300014325 | Bacteria | 2842 |
| 545 | Ga0163163_10139608 | 3300014325 | Bacteria | 2465 |
| 546 | Ga0163163_11379332 | 3300014325 | Bacteria | 767 |
| 547 | Ga0157380_10018384 | 3300014326 | Bacteria | 5186 |
| 548 | Ga0157380_10109862 | 3300014326 | Bacteria | 2314 |
| 549 | Ga0157380_10141735 | 3300014326 | Bacteria | 2066 |
| 550 | Ga0157380_10153019 | 3300014326 | Bacteria | 1996 |
| 551 | Ga0157380_10382952 | 3300014326 | Bacteria | 1328 |
| 552 | Ga0157380_10453539 | 3300014326 | Bacteria | 1232 |
| 553 | Ga0157380_10914621 | 3300014326 | Bacteria | 904 |
| 554 | Ga0182008_10003643 | 3300014497 | Bacteria | 9192 |
| 555 | Ga0157377_10023986 | 3300014745 | Bacteria | 3240 |
| 556 | Ga0157377_10070039 | 3300014745 | Bacteria | 2025 |
| 557 | Ga0157379_10000845 | 3300014968 | Bacteria | 24814 |
| 558 | Ga0157379_10258780 | 3300014968 | Bacteria | 1581 |
| 559 | Ga0157379_10465606 | 3300014968 | Bacteria | 1168 |
| 560 | Ga0157379_10675067 | 3300014968 | Bacteria | 969 |
| 561 | Ga0157379_10879361 | 3300014968 | Bacteria | 849 |
| 562 | Ga0157376_10011738 | 3300014969 | Bacteria | 6470 |
| 563 | Ga0157376_10050917 | 3300014969 | Unclassified | 3438 |
| 564 | Ga0157376_10162799 | 3300014969 | Bacteria | 2024 |
| 565 | Ga0157376_10188093 | 3300014969 | Bacteria | 1892 |
| 566 | Ga0157376_10215918 | 3300014969 | Bacteria | 1773 |
| 567 | Ga0157376_10229581 | 3300014969 | Bacteria | 1723 |
| 568 | Ga0182006_1000103 | 3300015261 | Bacteria | 93638 |
| 569 | Ga0182006_1166423 | 3300015261 | Bacteria | 740 |
| 570 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 571 | Ga0182007_10084666 | 3300015262 | Bacteria | 1041 |
| 572 | Ga0182005_1000147 | 3300015265 | Bacteria | 49428 |
| 573 | Ga0163161_10000039 | 3300017792 | Bacteria | 148130 |
| 574 | Ga0163161_10011145 | 3300017792 | Bacteria | 6229 |
| 575 | Ga0163161_10079062 | 3300017792 | Bacteria | 2417 |
| 576 | Ga0163161_10085599 | 3300017792 | Bacteria | 2325 |
| 577 | Ga0163161_10139438 | 3300017792 | Bacteria | 1835 |
| 578 | Ga0163161_10379068 | 3300017792 | Bacteria | 1130 |
| 579 | Ga0163161_10460238 | 3300017792 | Bacteria | 1030 |
| 580 | Ga0163161_10504512 | 3300017792 | Bacteria | 986 |
| 581 | Ga0206356_10956043 | 3300020070 | Bacteria | 1945 |
| 582 | Ga0206356_11673591 | 3300020070 | Bacteria | 1607 |
| 583 | Ga0206351_10597380 | 3300020077 | Bacteria | 1411 |
| 584 | Ga0206354_10616054 | 3300020081 | Bacteria | 1282 |
| 585 | Ga0206354_11354915 | 3300020081 | Bacteria | 1557 |
| 586 | Ga0206353_11411444 | 3300020082 | Bacteria | 1221 |
| 587 | Ga0213876_10015549 | 3300021384 | Bacteria | 4026 |
| 588 | Ga0213876_10038947 | 3300021384 | Bacteria | 2510 |
| 589 | Ga0213876_10059966 | 3300021384 | Bacteria | 2008 |
| 590 | Ga0213876_10153069 | 3300021384 | Bacteria | 1226 |
| 591 | Ga0209436_100232 | 3300025208 | Bacteria | 25536 |
| 592 | Ga0209436_103246 | 3300025208 | Bacteria | 4411 |
| 593 | Ga0209258_100041 | 3300025242 | Bacteria | 381381 |
| 594 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 595 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 596 | Ga0209026_1000299 | 3300025250 | Bacteria | 54147 |
| 597 | Ga0209148_1000090 | 3300025254 | Bacteria | 250982 |
| 598 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 599 | Ga0209673_1000034 | 3300025273 | Bacteria | 328788 |
| 600 | Ga0209130_1001055 | 3300025284 | Bacteria | 20897 |
| 601 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 602 | Ga0209564_1011927 | 3300025295 | Bacteria | 3840 |
| 603 | Ga0209564_1031946 | 3300025295 | Bacteria | 1595 |
| 604 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 605 | Ga0209758_1001438 | 3300025297 | Bacteria | 28062 |
| 606 | Ga0209758_1022949 | 3300025297 | Bacteria | 2839 |
| 607 | Ga0209758_1030098 | 3300025297 | Bacteria | 2255 |
| 608 | Ga0209050_1000207 | 3300025298 | Bacteria | 131328 |
| 609 | Ga0209050_1002964 | 3300025298 | Bacteria | 13262 |
| 610 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 611 | Ga0207426_1000603 | 3300025302 | Bacteria | 46872 |
| 612 | Ga0207426_1000813 | 3300025302 | Bacteria | 33506 |
| 613 | Ga0207426_1001314 | 3300025302 | Bacteria | 21207 |
| 614 | Ga0207426_1012108 | 3300025302 | Bacteria | 3255 |
| 615 | Ga0207426_1045428 | 3300025302 | Bacteria | 1336 |
| 616 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 617 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 618 | Ga0209257_1001824 | 3300025304 | Bacteria | 23309 |
| 619 | Ga0207697_10008991 | 3300025315 | Bacteria | 4335 |
| 620 | Ga0207697_10168485 | 3300025315 | Bacteria | 957 |
| 621 | Ga0207656_10002290 | 3300025321 | Bacteria | 6429 |
| 622 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 623 | Ga0207682_10005663 | 3300025893 | Bacteria | 5074 |
| 624 | Ga0207682_10021729 | 3300025893 | Bacteria | 2525 |
| 625 | Ga0207682_10029977 | 3300025893 | Bacteria | 2177 |
| 626 | Ga0207682_10049495 | 3300025893 | Bacteria | 1735 |
| 627 | Ga0207682_10064402 | 3300025893 | Bacteria | 1540 |
| 628 | Ga0207682_10383149 | 3300025893 | Bacteria | 664 |
| 629 | Ga0207692_10063935 | 3300025898 | Bacteria | 1914 |
| 630 | Ga0207692_10283514 | 3300025898 | Bacteria | 1003 |
| 631 | Ga0207692_10341726 | 3300025898 | Bacteria | 921 |
| 632 | Ga0207642_10023001 | 3300025899 | Bacteria | 2482 |
| 633 | Ga0207642_10389518 | 3300025899 | Bacteria | 831 |
| 634 | Ga0207710_10049842 | 3300025900 | Bacteria | 1877 |
| 635 | Ga0207688_10118589 | 3300025901 | Bacteria | 1542 |
| 636 | Ga0207680_10000957 | 3300025903 | Bacteria | 13597 |
| 637 | Ga0207680_10108367 | 3300025903 | Bacteria | 1797 |
| 638 | Ga0207680_10161717 | 3300025903 | Bacteria | 1502 |
| 639 | Ga0207647_10050985 | 3300025904 | Bacteria | 2560 |
| 640 | Ga0207647_10060143 | 3300025904 | Bacteria | 2323 |
| 641 | Ga0207647_10333726 | 3300025904 | Bacteria | 860 |
| 642 | Ga0207685_10319617 | 3300025905 | Bacteria | 774 |
| 643 | Ga0207699_10159810 | 3300025906 | Bacteria | 1499 |
| 644 | Ga0207645_10003925 | 3300025907 | Bacteria | 11107 |
| 645 | Ga0207645_10047294 | 3300025907 | Bacteria | 2747 |
| 646 | Ga0207645_10197099 | 3300025907 | Bacteria | 1324 |
| 647 | Ga0207645_10636283 | 3300025907 | Bacteria | 725 |
| 648 | Ga0207643_10105259 | 3300025908 | Bacteria | 1658 |
| 649 | Ga0207705_10002123 | 3300025909 | Bacteria | 15388 |
| 650 | Ga0207705_10006233 | 3300025909 | Bacteria | 8858 |
| 651 | Ga0207705_10027457 | 3300025909 | Bacteria | 4059 |
| 652 | Ga0207705_10162822 | 3300025909 | Bacteria | 1676 |
| 653 | Ga0207705_10287956 | 3300025909 | Bacteria | 1258 |
| 654 | Ga0207705_10450797 | 3300025909 | Bacteria | 997 |
| 655 | Ga0207705_10610307 | 3300025909 | Bacteria | 848 |
| 656 | Ga0207684_10000188 | 3300025910 | Bacteria | 97995 |
| 657 | Ga0207684_10041535 | 3300025910 | Bacteria | 3899 |
| 658 | Ga0207684_10205446 | 3300025910 | Bacteria | 1699 |
| 659 | Ga0207684_10207259 | 3300025910 | Bacteria | 1691 |
| 660 | Ga0207654_10048247 | 3300025911 | Bacteria | 2436 |
| 661 | Ga0207654_10180937 | 3300025911 | Bacteria | 1375 |
| 662 | Ga0207654_10292629 | 3300025911 | Bacteria | 1105 |
| 663 | Ga0207654_10310569 | 3300025911 | Bacteria | 1075 |
| 664 | Ga0207654_10418340 | 3300025911 | Bacteria | 935 |
| 665 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 666 | Ga0207707_10009127 | 3300025912 | Bacteria | 8613 |
| 667 | Ga0207707_10171625 | 3300025912 | Bacteria | 1895 |
| 668 | Ga0207707_10504761 | 3300025912 | Bacteria | 1031 |
| 669 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 670 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 671 | Ga0207695_10004617 | 3300025913 | Bacteria | 18682 |
| 672 | Ga0207695_10009751 | 3300025913 | Bacteria | 11818 |
| 673 | Ga0207695_10013424 | 3300025913 | Bacteria | 9771 |
| 674 | Ga0207695_10020633 | 3300025913 | Bacteria | 7543 |
| 675 | Ga0207695_10042816 | 3300025913 | Bacteria | 4831 |
| 676 | Ga0207695_10060304 | 3300025913 | Bacteria | 3928 |
| 677 | Ga0207695_10072097 | 3300025913 | Bacteria | 3526 |
| 678 | Ga0207695_10129510 | 3300025913 | Bacteria | 2482 |
| 679 | Ga0207695_10326487 | 3300025913 | Bacteria | 1423 |
| 680 | Ga0207695_10824849 | 3300025913 | Bacteria | 807 |
| 681 | Ga0207671_10000762 | 3300025914 | Bacteria | 40951 |
| 682 | Ga0207671_10003750 | 3300025914 | Bacteria | 14958 |
| 683 | Ga0207671_10005849 | 3300025914 | Bacteria | 11173 |
| 684 | Ga0207671_10022562 | 3300025914 | Bacteria | 4756 |
| 685 | Ga0207671_10029007 | 3300025914 | Bacteria | 4134 |
| 686 | Ga0207671_10197519 | 3300025914 | Bacteria | 1570 |
| 687 | Ga0207663_10272547 | 3300025916 | Bacteria | 1254 |
| 688 | Ga0207660_10155047 | 3300025917 | Bacteria | 1763 |
| 689 | Ga0207660_10172670 | 3300025917 | Bacteria | 1674 |
| 690 | Ga0207660_10318693 | 3300025917 | Bacteria | 1241 |
| 691 | Ga0207662_10007273 | 3300025918 | Bacteria | 6019 |
| 692 | Ga0207657_10001138 | 3300025919 | Bacteria | 28229 |
| 693 | Ga0207657_10090942 | 3300025919 | Bacteria | 2546 |
| 694 | Ga0207657_10122866 | 3300025919 | Bacteria | 2135 |
| 695 | Ga0207657_10141001 | 3300025919 | Bacteria | 1969 |
| 696 | Ga0207657_10729739 | 3300025919 | Bacteria | 768 |
| 697 | Ga0207649_10016202 | 3300025920 | Bacteria | 4198 |
| 698 | Ga0207649_10019877 | 3300025920 | Bacteria | 3844 |
| 699 | Ga0207649_10061543 | 3300025920 | Bacteria | 2363 |
| 700 | Ga0207652_10536478 | 3300025921 | Bacteria | 1052 |
| 701 | Ga0207646_10000238 | 3300025922 | Bacteria | 75978 |
| 702 | Ga0207646_10000258 | 3300025922 | Bacteria | 72085 |
| 703 | Ga0207646_10028761 | 3300025922 | Bacteria | 5056 |
| 704 | Ga0207646_10117918 | 3300025922 | Bacteria | 2384 |
| 705 | Ga0207646_10119383 | 3300025922 | Bacteria | 2369 |
| 706 | Ga0207646_11088683 | 3300025922 | Bacteria | 704 |
| 707 | Ga0207681_10296179 | 3300025923 | Bacteria | 1279 |
| 708 | Ga0207681_10532272 | 3300025923 | Bacteria | 965 |
| 709 | Ga0207681_10696836 | 3300025923 | Bacteria | 844 |
| 710 | Ga0207694_10223798 | 3300025924 | Bacteria | 1535 |
| 711 | Ga0207650_10010393 | 3300025925 | Bacteria | 6382 |
| 712 | Ga0207650_10030217 | 3300025925 | Bacteria | 3901 |
| 713 | Ga0207650_10030666 | 3300025925 | Bacteria | 3875 |
| 714 | Ga0207650_10258272 | 3300025925 | Bacteria | 1412 |
| 715 | Ga0207659_10023967 | 3300025926 | Bacteria | 4083 |
| 716 | Ga0207659_10024258 | 3300025926 | Bacteria | 4060 |
| 717 | Ga0207659_10027831 | 3300025926 | Bacteria | 3833 |
| 718 | Ga0207659_10059948 | 3300025926 | Bacteria | 2737 |
| 719 | Ga0207659_10342424 | 3300025926 | Bacteria | 1238 |
| 720 | Ga0207659_10455869 | 3300025926 | Bacteria | 1078 |
| 721 | Ga0207659_10595457 | 3300025926 | Bacteria | 942 |
| 722 | Ga0207659_11180188 | 3300025926 | Bacteria | 658 |
| 723 | Ga0207687_10403595 | 3300025927 | Bacteria | 1124 |
| 724 | Ga0207700_10040763 | 3300025928 | Bacteria | 3391 |
| 725 | Ga0207700_10220515 | 3300025928 | Bacteria | 1607 |
| 726 | Ga0207700_10520674 | 3300025928 | Bacteria | 1054 |
| 727 | Ga0207664_10035039 | 3300025929 | Bacteria | 3870 |
| 728 | Ga0207664_10068385 | 3300025929 | Bacteria | 2853 |
| 729 | Ga0207664_10554156 | 3300025929 | Bacteria | 1031 |
| 730 | Ga0207644_10019521 | 3300025931 | Bacteria | 4599 |
| 731 | Ga0207644_10562384 | 3300025931 | Bacteria | 945 |
| 732 | Ga0207644_10853110 | 3300025931 | Bacteria | 763 |
| 733 | Ga0207690_10142736 | 3300025932 | Bacteria | 1766 |
| 734 | Ga0207690_10170316 | 3300025932 | Bacteria | 1631 |
| 735 | Ga0207690_10421218 | 3300025932 | Bacteria | 1068 |
| 736 | Ga0207706_10023803 | 3300025933 | Bacteria | 5494 |
| 737 | Ga0207706_10073828 | 3300025933 | Bacteria | 2999 |
| 738 | Ga0207706_10275820 | 3300025933 | Bacteria | 1467 |
| 739 | Ga0207686_10180303 | 3300025934 | Bacteria | 1497 |
| 740 | Ga0207686_10278695 | 3300025934 | Bacteria | 1233 |
| 741 | Ga0207709_10134731 | 3300025935 | Bacteria | 1689 |
| 742 | Ga0207670_10104915 | 3300025936 | Bacteria | 2025 |
| 743 | Ga0207670_10180630 | 3300025936 | Bacteria | 1589 |
| 744 | Ga0207670_10904556 | 3300025936 | Bacteria | 739 |
| 745 | Ga0207669_10015591 | 3300025937 | Bacteria | 3836 |
| 746 | Ga0207669_10028016 | 3300025937 | Bacteria | 3093 |
| 747 | Ga0207704_10018685 | 3300025938 | Bacteria | 3625 |
| 748 | Ga0207704_10800941 | 3300025938 | Bacteria | 787 |
| 749 | Ga0207665_10034509 | 3300025939 | Bacteria | 3356 |
| 750 | Ga0207665_10108119 | 3300025939 | Bacteria | 1951 |
| 751 | Ga0207665_10553953 | 3300025939 | Bacteria | 894 |
| 752 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 753 | Ga0207691_10002741 | 3300025940 | Bacteria | 17182 |
| 754 | Ga0207691_10016872 | 3300025940 | Bacteria | 6929 |
| 755 | Ga0207691_10021049 | 3300025940 | Bacteria | 6162 |
| 756 | Ga0207691_10037594 | 3300025940 | Bacteria | 4483 |
| 757 | Ga0207691_10084460 | 3300025940 | Bacteria | 2850 |
| 758 | Ga0207711_10168742 | 3300025941 | Bacteria | 1985 |
| 759 | Ga0207711_11074903 | 3300025941 | Bacteria | 745 |
| 760 | Ga0207689_10007410 | 3300025942 | Bacteria | 9621 |
| 761 | Ga0207689_10108306 | 3300025942 | Bacteria | 2283 |
| 762 | Ga0207689_10108678 | 3300025942 | Bacteria | 2279 |
| 763 | Ga0207689_10258512 | 3300025942 | Bacteria | 1440 |
| 764 | Ga0207661_10001907 | 3300025944 | Bacteria | 14301 |
| 765 | Ga0207661_10008533 | 3300025944 | Bacteria | 7322 |
| 766 | Ga0207661_10018456 | 3300025944 | Bacteria | 5181 |
| 767 | Ga0207661_10021263 | 3300025944 | Bacteria | 4860 |
| 768 | Ga0207661_10064624 | 3300025944 | Bacteria | 2967 |
| 769 | Ga0207661_10304431 | 3300025944 | Bacteria | 1430 |
| 770 | Ga0207661_10566291 | 3300025944 | Bacteria | 1041 |
| 771 | Ga0207661_10600791 | 3300025944 | Bacteria | 1010 |
| 772 | Ga0207679_10002650 | 3300025945 | Bacteria | 11044 |
| 773 | Ga0207679_10053946 | 3300025945 | Bacteria | 2957 |
| 774 | Ga0207679_10082806 | 3300025945 | Bacteria | 2457 |
| 775 | Ga0207679_10103150 | 3300025945 | Bacteria | 2235 |
| 776 | Ga0207679_10122373 | 3300025945 | Bacteria | 2074 |
| 777 | Ga0207679_10407126 | 3300025945 | Bacteria | 1198 |
| 778 | Ga0207679_10494135 | 3300025945 | Bacteria | 1091 |
| 779 | Ga0207679_10548217 | 3300025945 | Bacteria | 1037 |
| 780 | Ga0207667_10000453 | 3300025949 | Bacteria | 54929 |
| 781 | Ga0207667_10009521 | 3300025949 | Bacteria | 11431 |
| 782 | Ga0207667_10063175 | 3300025949 | Bacteria | 3869 |
| 783 | Ga0207667_10106276 | 3300025949 | Bacteria | 2895 |
| 784 | Ga0207667_10183304 | 3300025949 | Bacteria | 2149 |
| 785 | Ga0207667_10401927 | 3300025949 | Bacteria | 1395 |
| 786 | Ga0207667_10407436 | 3300025949 | Bacteria | 1384 |
| 787 | Ga0207667_11385274 | 3300025949 | Unclassified | 677 |
| 788 | Ga0207651_10002109 | 3300025960 | Bacteria | 9388 |
| 789 | Ga0207651_10019970 | 3300025960 | Bacteria | 4030 |
| 790 | Ga0207651_10110064 | 3300025960 | Bacteria | 2066 |
| 791 | Ga0207651_10110238 | 3300025960 | Bacteria | 2064 |
| 792 | Ga0207651_10232903 | 3300025960 | Bacteria | 1496 |
| 793 | Ga0207651_10545173 | 3300025960 | Bacteria | 1008 |
| 794 | Ga0207651_11398247 | 3300025960 | Bacteria | 630 |
| 795 | Ga0207712_10000236 | 3300025961 | Bacteria | 54231 |
| 796 | Ga0207712_10017014 | 3300025961 | Bacteria | 4717 |
| 797 | Ga0207712_10268576 | 3300025961 | Bacteria | 1386 |
| 798 | Ga0207712_10273512 | 3300025961 | Bacteria | 1375 |
| 799 | Ga0207712_10983646 | 3300025961 | Unclassified | 748 |
| 800 | Ga0207668_10000869 | 3300025972 | Bacteria | 18234 |
| 801 | Ga0207668_10124203 | 3300025972 | Bacteria | 1959 |
| 802 | Ga0207668_10676347 | 3300025972 | Bacteria | 905 |
| 803 | Ga0207668_10685879 | 3300025972 | Bacteria | 899 |
| 804 | Ga0207640_10001854 | 3300025981 | Bacteria | 11325 |
| 805 | Ga0207640_10137420 | 3300025981 | Bacteria | 1776 |
| 806 | Ga0207640_10419521 | 3300025981 | Bacteria | 1095 |
| 807 | Ga0207640_10433596 | 3300025981 | Bacteria | 1079 |
| 808 | Ga0207658_10002877 | 3300025986 | Bacteria | 12335 |
| 809 | Ga0207658_10077846 | 3300025986 | Bacteria | 2531 |
| 810 | Ga0207658_10077939 | 3300025986 | Bacteria | 2530 |
| 811 | Ga0207658_10206299 | 3300025986 | Bacteria | 1644 |
| 812 | Ga0207658_10338678 | 3300025986 | Bacteria | 1307 |
| 813 | Ga0207658_10368749 | 3300025986 | Bacteria | 1255 |
| 814 | Ga0207658_10454404 | 3300025986 | Bacteria | 1134 |
| 815 | Ga0207658_10941263 | 3300025986 | Bacteria | 787 |
| 816 | Ga0207658_11469930 | 3300025986 | Bacteria | 623 |
| 817 | Ga0207677_10007143 | 3300026023 | Bacteria | 6150 |
| 818 | Ga0207677_10102756 | 3300026023 | Bacteria | 2108 |
| 819 | Ga0207677_10331030 | 3300026023 | Bacteria | 1269 |
| 820 | Ga0207677_10439386 | 3300026023 | Bacteria | 1115 |
| 821 | Ga0207677_11133257 | 3300026023 | Bacteria | 714 |
| 822 | Ga0207703_10004088 | 3300026035 | Bacteria | 12037 |
| 823 | Ga0207703_10086913 | 3300026035 | Bacteria | 2620 |
| 824 | Ga0207703_10107075 | 3300026035 | Bacteria | 2379 |
| 825 | Ga0207703_11059340 | 3300026035 | Bacteria | 778 |
| 826 | Ga0207639_10002238 | 3300026041 | Bacteria | 13008 |
| 827 | Ga0207639_10086818 | 3300026041 | Bacteria | 2492 |
| 828 | Ga0207639_10144907 | 3300026041 | Bacteria | 1983 |
| 829 | Ga0207639_10206104 | 3300026041 | Bacteria | 1690 |
| 830 | Ga0207639_10553949 | 3300026041 | Bacteria | 1056 |
| 831 | Ga0207678_10001614 | 3300026067 | Bacteria | 20747 |
| 832 | Ga0207678_10102818 | 3300026067 | Bacteria | 2439 |
| 833 | Ga0207678_10125918 | 3300026067 | Bacteria | 2186 |
| 834 | Ga0207678_10318133 | 3300026067 | Bacteria | 1339 |
| 835 | Ga0207678_10564686 | 3300026067 | Bacteria | 996 |
| 836 | Ga0207708_10061743 | 3300026075 | Bacteria | 2861 |
| 837 | Ga0207708_10152014 | 3300026075 | Bacteria | 1823 |
| 838 | Ga0207702_10026759 | 3300026078 | Bacteria | 4789 |
| 839 | Ga0207702_10082065 | 3300026078 | Bacteria | 2802 |
| 840 | Ga0207702_10828111 | 3300026078 | Bacteria | 915 |
| 841 | Ga0207641_10005564 | 3300026088 | Bacteria | 10740 |
| 842 | Ga0207648_10002625 | 3300026089 | Bacteria | 19241 |
| 843 | Ga0207648_10013430 | 3300026089 | Bacteria | 7622 |
| 844 | Ga0207648_10076452 | 3300026089 | Bacteria | 2919 |
| 845 | Ga0207648_10437276 | 3300026089 | Bacteria | 1189 |
| 846 | Ga0207648_10606113 | 3300026089 | Bacteria | 1010 |
| 847 | Ga0207676_10009796 | 3300026095 | Bacteria | 6814 |
| 848 | Ga0207676_10063612 | 3300026095 | Bacteria | 2931 |
| 849 | Ga0207676_10257111 | 3300026095 | Bacteria | 1575 |
| 850 | Ga0207676_10299754 | 3300026095 | Bacteria | 1467 |
| 851 | Ga0207676_10556643 | 3300026095 | Bacteria | 1096 |
| 852 | Ga0207676_10757273 | 3300026095 | Bacteria | 945 |
| 853 | Ga0207674_10007100 | 3300026116 | Bacteria | 13087 |
| 854 | Ga0207674_10008361 | 3300026116 | Bacteria | 11971 |
| 855 | Ga0207674_10031980 | 3300026116 | Bacteria | 5521 |
| 856 | Ga0207674_10051368 | 3300026116 | Bacteria | 4207 |
| 857 | Ga0207674_10102267 | 3300026116 | Bacteria | 2846 |
| 858 | Ga0207674_10160215 | 3300026116 | Bacteria | 2205 |
| 859 | Ga0207674_10298511 | 3300026116 | Bacteria | 1560 |
| 860 | Ga0207674_10374567 | 3300026116 | Bacteria | 1376 |
| 861 | Ga0207674_10405111 | 3300026116 | Bacteria | 1318 |
| 862 | Ga0207675_100011158 | 3300026118 | Bacteria | 8416 |
| 863 | Ga0207675_100023752 | 3300026118 | Bacteria | 5704 |
| 864 | Ga0207675_100029391 | 3300026118 | Bacteria | 5122 |
| 865 | Ga0207675_100053069 | 3300026118 | Bacteria | 3783 |
| 866 | Ga0207675_100746893 | 3300026118 | Bacteria | 989 |
| 867 | Ga0207675_101218918 | 3300026118 | Bacteria | 773 |
| 868 | Ga0207683_10006890 | 3300026121 | Bacteria | 9730 |
| 869 | Ga0207683_10017329 | 3300026121 | Bacteria | 6139 |
| 870 | Ga0207683_10086341 | 3300026121 | Bacteria | 2789 |
| 871 | Ga0207683_10135228 | 3300026121 | Bacteria | 2219 |
| 872 | Ga0207683_10225777 | 3300026121 | Bacteria | 1707 |
| 873 | Ga0207683_10243080 | 3300026121 | Bacteria | 1642 |
| 874 | Ga0207683_10943649 | 3300026121 | Bacteria | 801 |
| 875 | Ga0207698_10089720 | 3300026142 | Bacteria | 2512 |
| 876 | Ga0207698_10252161 | 3300026142 | Bacteria | 1616 |
| 877 | Ga0207698_10602074 | 3300026142 | Bacteria | 1084 |
| 878 | Ga0207698_10605257 | 3300026142 | Bacteria | 1081 |
| 879 | Ga0207698_10689462 | 3300026142 | Bacteria | 1015 |
| 880 | Ga0209281_1050393 | 3300027111 | Bacteria | 666 |
| 881 | Ga0209969_1001951 | 3300027360 | Bacteria | 2835 |
| 882 | Ga0209489_111364 | 3300027361 | Bacteria | 9138 |
| 883 | Ga0209967_1017786 | 3300027364 | Bacteria | 1027 |
| 884 | Ga0209984_1016798 | 3300027424 | Bacteria | 979 |
| 885 | Ga0210000_1006710 | 3300027462 | Bacteria | 1678 |
| 886 | Ga0209995_1012225 | 3300027471 | Bacteria | 1400 |
| 887 | Ga0209968_1000671 | 3300027526 | Bacteria | 5278 |
| 888 | Ga0209968_1001933 | 3300027526 | Bacteria | 3149 |
| 889 | Ga0209968_1012248 | 3300027526 | Bacteria | 1335 |
| 890 | Ga0209970_1038065 | 3300027614 | Bacteria | 850 |
| 891 | Ga0210002_1001591 | 3300027617 | Bacteria | 3225 |
| 892 | Ga0209998_10001251 | 3300027717 | Bacteria | 6232 |
| 893 | Ga0209974_10012090 | 3300027876 | Bacteria | 2890 |
| 894 | Ga0209974_10206493 | 3300027876 | Bacteria | 727 |
| 895 | Ga0207428_10241738 | 3300027907 | Bacteria | 1348 |
| 896 | Ga0268266_10006831 | 3300028379 | Bacteria | 10392 |
| 897 | Ga0268266_10010826 | 3300028379 | Bacteria | 7945 |
| 898 | Ga0268266_10019858 | 3300028379 | Bacteria | 5726 |
| 899 | Ga0268266_10075607 | 3300028379 | Bacteria | 2926 |
| 900 | Ga0268266_10221528 | 3300028379 | Bacteria | 1739 |
| 901 | Ga0268265_10312908 | 3300028380 | Bacteria | 1419 |
| 902 | Ga0268265_10430882 | 3300028380 | Bacteria | 1227 |
| 903 | Ga0268264_10027923 | 3300028381 | Bacteria | 4614 |
| 904 | Ga0268264_10085138 | 3300028381 | Bacteria | 2713 |
| 905 | Ga0268264_10355798 | 3300028381 | Bacteria | 1395 |
| 906 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 907 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 908 | Ga0307515_10409858 | 3300028794 | Bacteria | 978 |
| 909 | Ga0307515_10411520 | 3300028794 | Bacteria | 975 |
| 910 | Ga0265338_10104635 | 3300028800 | Bacteria | 2296 |
| 911 | Ga0265324_10009470 | 3300029957 | Bacteria | 3800 |
| 912 | Ga0316177_1063448 | 3300030731 | Bacteria | 1123 |
| 913 | Ga0316179_1109740 | 3300030734 | Bacteria | 3245 |
| 914 | Ga0316181_1180820 | 3300030744 | Bacteria | 822 |
| 915 | Ga0265327_10000244 | 3300031251 | Bacteria | 108867 |
| 916 | Ga0265327_10000298 | 3300031251 | Bacteria | 96149 |
| 917 | Ga0265327_10034879 | 3300031251 | Bacteria | 2787 |
| 918 | Ga0265327_10124294 | 3300031251 | Bacteria | 1220 |
| 919 | Ga0307513_10100314 | 3300031456 | Bacteria | 2921 |
| 920 | Ga0307513_10196164 | 3300031456 | Bacteria | 1865 |
| 921 | Ga0307513_10205509 | 3300031456 | Unclassified | 1806 |
| 922 | Ga0307513_10358454 | 3300031456 | Bacteria | 1204 |
| 923 | Ga0307509_10122814 | 3300031507 | Bacteria | 2571 |
| 924 | Ga0307509_10132538 | 3300031507 | Bacteria | 2444 |
| 925 | Ga0307408_100056125 | 3300031548 | Bacteria | 2855 |
| 926 | Ga0307408_100060065 | 3300031548 | Bacteria | 2770 |
| 927 | Ga0307408_100075805 | 3300031548 | Bacteria | 2500 |
| 928 | Ga0307408_100478862 | 3300031548 | Bacteria | 1085 |
| 929 | Ga0307408_100868518 | 3300031548 | Bacteria | 823 |
| 930 | Ga0307408_101355421 | 3300031548 | Bacteria | 668 |
| 931 | Ga0307508_10001613 | 3300031616 | Bacteria | 25177 |
| 932 | Ga0265314_10003664 | 3300031711 | Bacteria | 14742 |
| 933 | Ga0316576_10001081 | 3300031727 | Bacteria | 14158 |
| 934 | Ga0316576_10598958 | 3300031727 | Bacteria | 805 |
| 935 | Ga0316578_10025018 | 3300031728 | Bacteria | 3353 |
| 936 | Ga0316578_10044909 | 3300031728 | Bacteria | 2571 |
| 937 | Ga0307516_10004268 | 3300031730 | Bacteria | 17759 |
| 938 | Ga0307516_10182934 | 3300031730 | Bacteria | 1828 |
| 939 | Ga0307405_10000005 | 3300031731 | Bacteria | 376536 |
| 940 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 941 | Ga0307405_10090080 | 3300031731 | Bacteria | 2028 |
| 942 | Ga0307413_10001307 | 3300031824 | Bacteria | 9311 |
| 943 | Ga0307413_10249917 | 3300031824 | Bacteria | 1315 |
| 944 | Ga0307413_10353719 | 3300031824 | Bacteria | 1134 |
| 945 | Ga0307410_10000034 | 3300031852 | Bacteria | 48449 |
| 946 | Ga0307410_10048579 | 3300031852 | Bacteria | 2843 |
| 947 | Ga0307410_10157622 | 3300031852 | Bacteria | 1697 |
| 948 | Ga0307410_10287412 | 3300031852 | Bacteria | 1293 |
| 949 | Ga0307410_10644627 | 3300031852 | Bacteria | 888 |
| 950 | Ga0307406_10000004 | 3300031901 | Bacteria | 179772 |
| 951 | Ga0307406_10033753 | 3300031901 | Bacteria | 3134 |
| 952 | Ga0307406_10651741 | 3300031901 | Bacteria | 874 |
| 953 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 954 | Ga0307407_10000196 | 3300031903 | Bacteria | 18233 |
| 955 | Ga0307407_10014444 | 3300031903 | Bacteria | 3867 |
| 956 | Ga0307407_10095116 | 3300031903 | Bacteria | 1836 |
| 957 | Ga0307407_10191846 | 3300031903 | Bacteria | 1362 |
| 958 | Ga0307412_10053164 | 3300031911 | Bacteria | 2684 |
| 959 | Ga0307412_10061465 | 3300031911 | Bacteria | 2525 |
| 960 | Ga0307412_10257328 | 3300031911 | Bacteria | 1359 |
| 961 | Ga0307412_10610000 | 3300031911 | Bacteria | 925 |
| 962 | Ga0307409_100028055 | 3300031995 | Bacteria | 4003 |
| 963 | Ga0307409_100057484 | 3300031995 | Bacteria | 3014 |
| 964 | Ga0307409_100139429 | 3300031995 | Bacteria | 2087 |
| 965 | Ga0307409_100219286 | 3300031995 | Bacteria | 1716 |
| 966 | Ga0307409_100386844 | 3300031995 | Bacteria | 1332 |
| 967 | Ga0307409_100810802 | 3300031995 | Bacteria | 944 |
| 968 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 969 | Ga0307416_100008439 | 3300032002 | Bacteria | 6650 |
| 970 | Ga0307416_100010892 | 3300032002 | Bacteria | 6031 |
| 971 | Ga0307416_100087680 | 3300032002 | Bacteria | 2658 |
| 972 | Ga0307416_100188953 | 3300032002 | Bacteria | 1940 |
| 973 | Ga0307416_100411395 | 3300032002 | Bacteria | 1393 |
| 974 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 975 | Ga0307414_10000527 | 3300032004 | Bacteria | 19931 |
| 976 | Ga0307414_10009965 | 3300032004 | Bacteria | 5484 |
| 977 | Ga0307414_10011571 | 3300032004 | Bacteria | 5180 |
| 978 | Ga0307414_10024140 | 3300032004 | Bacteria | 3871 |
| 979 | Ga0307414_10098384 | 3300032004 | Bacteria | 2195 |
| 980 | Ga0307414_10178342 | 3300032004 | Bacteria | 1706 |
| 981 | Ga0307414_10663521 | 3300032004 | Bacteria | 941 |
| 982 | Ga0307414_10735107 | 3300032004 | Bacteria | 896 |
| 983 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 984 | Ga0307411_10126234 | 3300032005 | Bacteria | 1861 |
| 985 | Ga0307411_10153223 | 3300032005 | Bacteria | 1716 |
| 986 | Ga0307411_10330459 | 3300032005 | Bacteria | 1235 |
| 987 | Ga0307411_10343930 | 3300032005 | Bacteria | 1213 |
| 988 | Ga0307415_100300684 | 3300032126 | Bacteria | 1329 |
| 989 | Ga0307415_100926206 | 3300032126 | Bacteria | 805 |
| 990 | Ga0307415_100931172 | 3300032126 | Bacteria | 803 |
| 991 | Ga0316593_10001741 | 3300032168 | Bacteria | 4931 |
| 992 | Ga0307510_10000380 | 3300033180 | Bacteria | 42243 |
| 993 | Ga0307510_10035700 | 3300033180 | Bacteria | 5546 |
| 994 | Ga0316592_1000022 | 3300033524 | Bacteria | 11920 |
| 995 | Ga0316592_1000131 | 3300033524 | Bacteria | 8112 |
| 996 | Ga0316592_1013307 | 3300033524 | Bacteria | 1694 |
| 997 | Ga0316586_1001816 | 3300033527 | Bacteria | 2550 |
| 998 | Ga0316588_1002172 | 3300033528 | Bacteria | 3382 |
| 999 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 1000 | Ga0316596_1002626 | 3300033541 | Bacteria | 3852 |
| 1001 | Ga0316596_1003825 | 3300033541 | Bacteria | 3331 |
| 1002 | Ga0316596_1005444 | 3300033541 | Bacteria | 2909 |
| 1003 | Ga0316596_1016458 | 3300033541 | Bacteria | 1853 |
| 1004 | Ga0316596_1036039 | 3300033541 | Bacteria | 1293 |
| 1005 | Ga0373940_0148248 | 3300035088 | Bacteria | 746 |
| 1006 | Ga0373956_0098722 | 3300035119 | Bacteria | 1353 |
| 1007 | Ga0373960_0152321 | 3300035121 | Bacteria | 791 |
| 1008 | Ga0373955_0329565 | 3300035172 | Bacteria | 923 |
| 1009 | Ga0373955_0854685 | 3300035172 | Bacteria | 560 |
| 1010 | Ga0373962_0095519 | 3300035242 | Bacteria | 921 |
| 1011 | Ga0316574_0007562 | 3300035398 | Bacteria | 5965 |
| 1012 | Ga0316574_0045952 | 3300035398 | Bacteria | 2706 |
| 1013 | Ga0373924_0230165 | 3300035410 | Bacteria | 819 |
| 1014 | Ga0373935_0051868 | 3300035692 | Bacteria | 2606 |
| 1015 | Ga0373935_0473866 | 3300035692 | Unclassified | 906 |
| 1016 | Ga0373933_0303736 | 3300035724 | Bacteria | 1033 |
| 1017 | Ga0373937_0036462 | 3300036401 | Bacteria | 4481 |
| 1018 | Ga0373937_0048653 | 3300036401 | Bacteria | 3882 |
| 1019 | Ga0373937_0076521 | 3300036401 | Bacteria | 3091 |
| 1020 | Ga0373937_0140348 | 3300036401 | Bacteria | 2260 |
| 1021 | Ga0373937_0547176 | 3300036401 | Bacteria | 1099 |
| 1022 | Ga0373937_1340874 | 3300036401 | Bacteria | 663 |
| 1023 | Ga0316582_0022702 | 3300036647 | Bacteria | 3729 |
| 1024 | Ga0316584_0020181 | 3300036712 | Bacteria | 4827 |
| 1025 | Ga0316584_0020615 | 3300036712 | Bacteria | 4783 |
| 1026 | Ga0316584_0065628 | 3300036712 | Bacteria | 2719 |
| 1027 | Ga0373925_0165850 | 3300037068 | Unclassified | 1742 |
| 1028 | Ga0395899_0378083 | 3300037312 | Bacteria | 942 |
| 1029 | Ga0395900_0193418 | 3300037418 | Bacteria | 2062 |
| 1030 | Ga0395905_1167085 | 3300037471 | Bacteria | 673 |
| 1031 | Ga0436365_0781227 | 3300039437 | Bacteria | 11182 |
| 1032 | Ga0436365_1208365 | 3300039437 | Bacteria | 1296 |
| 1033 | Ga0436365_1690067 | 3300039437 | Bacteria | 10061 |
| 1034 | Ga0439436_0010012 | 3300041404 | Bacteria | 2899 |
| 1035 | Ga0439436_0054621 | 3300041404 | Bacteria | 1123 |
| 1036 | Ga0439439_0015663 | 3300041406 | Bacteria | 1853 |
| 1037 | Ga0439439_0099531 | 3300041406 | Bacteria | 799 |
| 1038 | Ga0439447_000447 | 3300041407 | Bacteria | 15369 |
| 1039 | Ga0439466_0004165 | 3300041411 | Bacteria | 5582 |
| 1040 | Ga0439465_0006490 | 3300041413 | Bacteria | 3718 |
| 1041 | Ga0451787_419093 | 3300041441 | Bacteria | 1894 |
| 1042 | Ga0451789_0687116 | 3300041443 | Bacteria | 807 |
| 1043 | Ga0451790_22988 | 3300041444 | Bacteria | 1085 |
| 1044 | Ga0451794_56897 | 3300041446 | Bacteria | 638 |
| 1045 | Ga0451791_1675939 | 3300041451 | Bacteria | 2636 |
| 1046 | Ga0451797_0519695 | 3300041453 | Bacteria | 753 |
| 1047 | Ga0451795_0165098 | 3300041456 | Bacteria | 893 |
| 1048 | Ga0451795_0802875 | 3300041456 | Bacteria | 829 |
| 1049 | Ga0451795_1231582 | 3300041456 | Bacteria | 734 |
| 1050 | Ga0451795_1330461 | 3300041456 | Bacteria | 1148 |
| 1051 | Ga0451802_2169794 | 3300041460 | Bacteria | 1023 |
| 1052 | Ga0451807_1248443 | 3300041486 | Bacteria | 675 |
| 1053 | Ga0451837_0716352 | 3300041494 | Bacteria | 4319 |
| 1054 | Ga0451837_1056715 | 3300041494 | Bacteria | 8321 |
| 1055 | Ga0451841_0588885 | 3300041498 | Bacteria | 1229 |
| 1056 | Ga0451841_0610576 | 3300041498 | Bacteria | 615 |
| 1057 | Ga0451852_13332 | 3300041508 | Bacteria | 9060 |
| 1058 | Ga0451843_1326072 | 3300041509 | Bacteria | 2370 |
| 1059 | Ga0451855_0576277 | 3300041511 | Bacteria | 594 |
| 1060 | Ga0451853_0701685 | 3300041512 | Bacteria | 2711 |
| 1061 | Ga0439431_0000148 | 3300041997 | Bacteria | 12795 |
| 1062 | Ga0439431_0006932 | 3300041997 | Bacteria | 2520 |
| 1063 | Ga0439445_0006554 | 3300042004 | Bacteria | 2678 |
| 1064 | Ga0439449_0003312 | 3300042007 | Bacteria | 6287 |
| 1065 | Ga0439449_0159683 | 3300042007 | Bacteria | 841 |
| 1066 | Ga0439452_017641 | 3300042010 | Bacteria | 1914 |
| 1067 | Ga0439457_001021 | 3300042014 | Bacteria | 8445 |
| 1068 | Ga0439457_012873 | 3300042014 | Bacteria | 1883 |
| 1069 | Ga0439457_018331 | 3300042014 | Bacteria | 1555 |
| 1070 | Ga0450922_004074 | 3300042124 | Bacteria | 1343 |
| 1071 | Ga0450898_001130 | 3300042134 | Bacteria | 3418 |
| 1072 | Ga0450898_013724 | 3300042134 | Bacteria | 1354 |
| 1073 | Ga0439446_0066036 | 3300042156 | Bacteria | 1100 |
| 1074 | Ga0439446_0207057 | 3300042156 | Bacteria | 664 |
| 1075 | Ga0439434_0005882 | 3300042435 | Bacteria | 3583 |
| 1076 | Ga0439464_0140095 | 3300042439 | Unclassified | 753 |
| 1077 | Ga0451577_0004463 | 3300042876 | Bacteria | 14775 |
| 1078 | Ga0451577_0054888 | 3300042876 | Bacteria | 3556 |
| 1079 | Ga0451577_0242501 | 3300042876 | Bacteria | 1631 |
| 1080 | Ga0451577_0348490 | 3300042876 | Bacteria | 1343 |
| 1081 | Ga0466969_0000246 | 3300044656 | Bacteria | 29777 |
| 1082 | Ga0466982_0127768 | 3300044672 | Bacteria | 1565 |
| 1083 | Ga0453683_0009005 | 3300044673 | Bacteria | 6671 |
| 1084 | Ga0453683_0011208 | 3300044673 | Bacteria | 5922 |
| 1085 | Ga0453683_0044004 | 3300044673 | Bacteria | 2801 |
| 1086 | Ga0453683_0083828 | 3300044673 | Unclassified | 1997 |
| 1087 | Ga0453683_0151769 | 3300044673 | Bacteria | 1464 |
| 1088 | Ga0453683_0189848 | 3300044673 | Bacteria | 1303 |
| 1089 | Ga0453683_0318980 | 3300044673 | Bacteria | 996 |
| 1090 | Ga0453683_0430917 | 3300044673 | Bacteria | 852 |
| 1091 | Ga0453683_0462118 | 3300044673 | Bacteria | 821 |
| 1092 | Ga0466965_0041805 | 3300044683 | Bacteria | 2259 |
| 1093 | Ga0466965_0358535 | 3300044683 | Bacteria | 800 |
| 1094 | Ga0466966_0018671 | 3300044684 | Bacteria | 4570 |
| 1095 | Ga0466961_0125059 | 3300044693 | Bacteria | 1614 |
| 1096 | Ga0466963_0820038 | 3300044694 | Bacteria | 656 |
| 1097 | Ga0453684_0000413 | 3300044712 | Bacteria | 174924 |
| 1098 | Ga0453684_0012544 | 3300044712 | Bacteria | 13952 |
| 1099 | Ga0453684_0031999 | 3300044712 | Bacteria | 7376 |
| 1100 | Ga0453684_0038585 | 3300044712 | Bacteria | 6526 |
| 1101 | Ga0453684_0068294 | 3300044712 | Bacteria | 4514 |
| 1102 | Ga0453684_0081028 | 3300044712 | Bacteria | 4050 |
| 1103 | Ga0453684_0109499 | 3300044712 | Bacteria | 3360 |
| 1104 | Ga0453684_0174513 | 3300044712 | Bacteria | 2530 |
| 1105 | Ga0453684_0217161 | 3300044712 | Bacteria | 2218 |
| 1106 | Ga0453684_0446341 | 3300044712 | Bacteria | 1441 |
| 1107 | Ga0453684_0453389 | 3300044712 | Bacteria | 1427 |
| 1108 | Ga0453684_0546517 | 3300044712 | Bacteria | 1276 |
| 1109 | Ga0453684_0950475 | 3300044712 | Bacteria | 917 |
| 1110 | Ga0466968_0042386 | 3300044735 | Bacteria | 1924 |
| 1111 | Ga0466970_0380832 | 3300044765 | Bacteria | 803 |
| 1112 | Ga0466957_0001187 | 3300044842 | Bacteria | 13537 |
| 1113 | Ga0466959_0000017 | 3300045049 | Bacteria | 143170 |
| 1114 | Ga0466959_0027432 | 3300045049 | Bacteria | 4225 |
| 1115 | Ga0451576_0012395 | 3300045051 | Bacteria | 9577 |
| 1116 | Ga0451576_0027225 | 3300045051 | Bacteria | 6142 |
| 1117 | Ga0451576_0042307 | 3300045051 | Bacteria | 4810 |
| 1118 | Ga0451576_0062199 | 3300045051 | Bacteria | 3892 |
| 1119 | Ga0451576_0062248 | 3300045051 | Bacteria | 3890 |
| 1120 | Ga0451576_0370146 | 3300045051 | Bacteria | 1501 |
| 1121 | Ga0451576_0559542 | 3300045051 | Bacteria | 1201 |
| 1122 | Ga0466958_0422315 | 3300045836 | Bacteria | 862 |
| 1123 | Ga0466967_0036213 | 3300045976 | Bacteria | 4211 |
| 1124 | Ga0466967_0213816 | 3300045976 | Bacteria | 1830 |
| 1125 | Ga0495627_001896 | 3300046453 | Bacteria | 10966 |
| 1126 | Ga0495627_050922 | 3300046453 | Bacteria | 1246 |
| 1127 | Ga0495592_0199036 | 3300046454 | Bacteria | 1353 |
| 1128 | Ga0495603_0018332 | 3300046455 | Bacteria | 4234 |
| 1129 | Ga0495603_0347795 | 3300046455 | Bacteria | 851 |
| 1130 | Ga0495629_0019985 | 3300046459 | Bacteria | 4779 |
| 1131 | Ga0495629_0146129 | 3300046459 | Bacteria | 1644 |
| 1132 | Ga0495629_0194689 | 3300046459 | Bacteria | 1402 |
| 1133 | Ga0495629_0348777 | 3300046459 | Bacteria | 1010 |
| 1134 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 1135 | Ga0495638_0043942 | 3300046460 | Bacteria | 2817 |
| 1136 | Ga0495638_0072019 | 3300046460 | Bacteria | 2113 |
| 1137 | Ga0495651_0224316 | 3300046462 | Bacteria | 1298 |
| 1138 | Ga0495651_0233321 | 3300046462 | Bacteria | 1266 |
| 1139 | Ga0495653_0127165 | 3300046463 | Bacteria | 1808 |
| 1140 | Ga0495580_0015211 | 3300046472 | Bacteria | 5816 |
| 1141 | Ga0495580_0057113 | 3300046472 | Bacteria | 2747 |
| 1142 | Ga0495580_0160474 | 3300046472 | Bacteria | 1556 |
| 1143 | Ga0495582_0004780 | 3300046473 | Bacteria | 7611 |
| 1144 | Ga0495582_0302421 | 3300046473 | Unclassified | 919 |
| 1145 | Ga0495582_0312016 | 3300046473 | Unclassified | 905 |
| 1146 | Ga0495639_0002494 | 3300046475 | Bacteria | 8031 |
| 1147 | Ga0495639_0009573 | 3300046475 | Bacteria | 4158 |
| 1148 | Ga0495639_0134983 | 3300046475 | Bacteria | 1183 |
| 1149 | Ga0495639_0148496 | 3300046475 | Bacteria | 1130 |
| 1150 | Ga0495662_0023228 | 3300046476 | Bacteria | 2994 |
| 1151 | Ga0495662_0121873 | 3300046476 | Bacteria | 1280 |
| 1152 | Ga0495664_0004041 | 3300046477 | Bacteria | 8003 |
| 1153 | Ga0495664_0051857 | 3300046477 | Bacteria | 2436 |
| 1154 | Ga0495594_0002236 | 3300046499 | Bacteria | 10074 |
| 1155 | Ga0495594_0012720 | 3300046499 | Bacteria | 4391 |
| 1156 | Ga0495594_0017843 | 3300046499 | Bacteria | 3754 |
| 1157 | Ga0495607_0014863 | 3300046501 | Bacteria | 5059 |
| 1158 | Ga0495606_0006493 | 3300046507 | Bacteria | 10759 |
| 1159 | Ga0495606_0010457 | 3300046507 | Bacteria | 7698 |
| 1160 | Ga0495606_0208853 | 3300046507 | Bacteria | 1107 |
| 1161 | Ga0495606_0265398 | 3300046507 | Bacteria | 945 |
| 1162 | Ga0495608_0111772 | 3300046511 | Bacteria | 1756 |
| 1163 | Ga0495618_0019866 | 3300046514 | Bacteria | 4135 |
| 1164 | Ga0495618_0058209 | 3300046514 | Bacteria | 2447 |
| 1165 | Ga0495618_0059831 | 3300046514 | Bacteria | 2415 |
| 1166 | Ga0495620_0309598 | 3300046515 | Bacteria | 600 |
| 1167 | Ga0495628_0063967 | 3300046516 | Bacteria | 2881 |
| 1168 | Ga0495628_0112366 | 3300046516 | Bacteria | 2094 |
| 1169 | Ga0495630_0003672 | 3300046517 | Bacteria | 10702 |
| 1170 | Ga0495630_0068879 | 3300046517 | Bacteria | 2661 |
| 1171 | Ga0495630_0079270 | 3300046517 | Bacteria | 2477 |
| 1172 | Ga0495632_0088893 | 3300046519 | Bacteria | 1467 |
| 1173 | Ga0495643_0000294 | 3300046522 | Bacteria | 70329 |
| 1174 | Ga0495643_0009099 | 3300046522 | Bacteria | 6221 |
| 1175 | Ga0495663_0016116 | 3300046525 | Bacteria | 2111 |
| 1176 | Ga0495666_0007984 | 3300046526 | Bacteria | 5299 |
| 1177 | Ga0495666_0022515 | 3300046526 | Bacteria | 3121 |
| 1178 | Ga0495642_0069999 | 3300046528 | Bacteria | 1466 |
| 1179 | Ga0495642_0148655 | 3300046528 | Bacteria | 1013 |
| 1180 | Ga0495652_0098996 | 3300046529 | Bacteria | 2368 |
| 1181 | Ga0495652_0170490 | 3300046529 | Bacteria | 1680 |
| 1182 | Ga0495652_0279721 | 3300046529 | Bacteria | 1222 |
| 1183 | Ga0495654_0031697 | 3300046530 | Bacteria | 2683 |
| 1184 | Ga0495665_0016600 | 3300046531 | Bacteria | 3966 |
| 1185 | Ga0495665_0066629 | 3300046531 | Bacteria | 1900 |
| 1186 | Ga0495665_0075756 | 3300046531 | Bacteria | 1771 |
| 1187 | Ga0495640_0013380 | 3300046533 | Bacteria | 6233 |
| 1188 | Ga0495640_0045154 | 3300046533 | Bacteria | 3058 |
| 1189 | Ga0495640_0071948 | 3300046533 | Bacteria | 2318 |
| 1190 | Ga0495586_0005406 | 3300046535 | Bacteria | 6831 |
| 1191 | Ga0495587_0017860 | 3300046536 | Bacteria | 4401 |
| 1192 | Ga0495587_0027547 | 3300046536 | Bacteria | 3460 |
| 1193 | Ga0495598_0097956 | 3300046537 | Bacteria | 966 |
| 1194 | Ga0495621_0013304 | 3300046539 | Bacteria | 2582 |
| 1195 | Ga0495645_0293881 | 3300046543 | Bacteria | 1064 |
| 1196 | Ga0495645_0433006 | 3300046543 | Unclassified | 833 |
| 1197 | Ga0495622_0413731 | 3300046557 | Bacteria | 580 |
| 1198 | Ga0495633_0000049 | 3300046558 | Bacteria | 156684 |
| 1199 | Ga0495633_0061152 | 3300046558 | Bacteria | 1764 |
| 1200 | Ga0495633_0153686 | 3300046558 | Bacteria | 1062 |
| 1201 | Ga0495633_0236041 | 3300046558 | Bacteria | 835 |
| 1202 | Ga0495667_0001513 | 3300046559 | Bacteria | 15343 |
| 1203 | Ga0495667_0054956 | 3300046559 | Bacteria | 2618 |
| 1204 | Ga0495667_0068058 | 3300046559 | Bacteria | 2326 |
| 1205 | Ga0495656_0516114 | 3300046615 | Bacteria | 635 |
| 1206 | Ga0495668_0161287 | 3300046616 | Bacteria | 1228 |
| 1207 | Ga0495634_0001123 | 3300046642 | Bacteria | 24774 |
| 1208 | Ga0495634_0074722 | 3300046642 | Bacteria | 2227 |
| 1209 | Ga0495611_0003370 | 3300046648 | Bacteria | 7051 |
| 1210 | Ga0495625_0001933 | 3300046660 | Bacteria | 23424 |
| 1211 | Ga0495625_0089987 | 3300046660 | Bacteria | 2124 |
| 1212 | Ga0495625_0346569 | 3300046660 | Bacteria | 940 |
| 1213 | Ga0495635_0028641 | 3300046663 | Bacteria | 3871 |
| 1214 | Ga0495635_0041441 | 3300046663 | Bacteria | 3180 |
| 1215 | Ga0495588_0017168 | 3300046674 | Bacteria | 3509 |
| 1216 | Ga0495588_0321334 | 3300046674 | Unclassified | 814 |
| 1217 | Ga0495657_0017987 | 3300046675 | Bacteria | 5123 |
| 1218 | Ga0495623_0044936 | 3300046679 | Bacteria | 2806 |
| 1219 | Ga0495623_0173557 | 3300046679 | Bacteria | 1258 |
| 1220 | Ga0495623_0326114 | 3300046679 | Bacteria | 842 |
| 1221 | Ga0495646_0052770 | 3300046680 | Bacteria | 2454 |
| 1222 | Ga0495658_0003330 | 3300046683 | Bacteria | 7973 |
| 1223 | Ga0495658_0097935 | 3300046683 | Bacteria | 1746 |
| 1224 | Ga0495669_0406772 | 3300046684 | Bacteria | 660 |
| 1225 | Ga0495613_0021242 | 3300046689 | Unclassified | 4841 |
| 1226 | Ga0495613_0073700 | 3300046689 | Bacteria | 2487 |
| 1227 | Ga0495613_0130705 | 3300046689 | Bacteria | 1798 |
| 1228 | Ga0495613_0134788 | 3300046689 | Bacteria | 1767 |
| 1229 | Ga0495624_0187737 | 3300046690 | Bacteria | 1258 |
| 1230 | Ga0495624_0190316 | 3300046690 | Bacteria | 1248 |
| 1231 | Ga0495649_0078773 | 3300046694 | Bacteria | 1763 |
| 1232 | Ga0495600_0008219 | 3300046809 | Bacteria | 6406 |
| 1233 | Ga0495600_0034516 | 3300046809 | Bacteria | 3284 |
| 1234 | Ga0495600_0064475 | 3300046809 | Bacteria | 2395 |
| 1235 | Ga0495581_0061450 | 3300047315 | Bacteria | 2171 |
| 1236 | Ga0495581_0093525 | 3300047315 | Bacteria | 1745 |
| 1237 | Ga0495581_0165347 | 3300047315 | Bacteria | 1294 |
| 1238 | Ga0495581_0171961 | 3300047315 | Bacteria | 1267 |
| 1239 | Ga0495604_0215319 | 3300047317 | Bacteria | 1325 |
| 1240 | Ga0495636_0000012 | 3300047318 | Bacteria | 85270 |
| 1241 | Ga0495636_0274795 | 3300047318 | Bacteria | 784 |
| 1242 | Ga0495674_0006511 | 3300047319 | Bacteria | 11206 |
| 1243 | Ga0495674_0057314 | 3300047319 | Bacteria | 3409 |
| 1244 | Ga0495674_0269977 | 3300047319 | Bacteria | 1396 |
| 1245 | Ga0495672_0256583 | 3300047320 | Bacteria | 846 |
| 1246 | Ga0495676_0108551 | 3300047321 | Bacteria | 2041 |
| 1247 | Ga0495676_0127835 | 3300047321 | Bacteria | 1839 |
| 1248 | Ga0495680_0012216 | 3300047322 | Bacteria | 7573 |
| 1249 | Ga0495680_0013035 | 3300047322 | Bacteria | 7271 |
| 1250 | Ga0495680_0082584 | 3300047322 | Bacteria | 2424 |
| 1251 | Ga0495675_0017264 | 3300047444 | Bacteria | 4573 |
| 1252 | Ga0495675_0212592 | 3300047444 | Bacteria | 1173 |
| 1253 | Ga0495675_0397031 | 3300047444 | Bacteria | 804 |
| 1254 | Ga0495685_117616 | 3300047447 | Bacteria | 873 |
| 1255 | Ga0495684_0014936 | 3300047471 | Bacteria | 5981 |
| 1256 | Ga0495684_0075992 | 3300047471 | Bacteria | 2551 |
| 1257 | Ga0495684_0246355 | 3300047471 | Bacteria | 1301 |
| 1258 | Ga0495684_0321795 | 3300047471 | Bacteria | 1105 |
| 1259 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 1260 | Ga0495686_0025653 | 3300047472 | Bacteria | 3863 |
| 1261 | Ga0495593_0090810 | 3300047673 | Bacteria | 1573 |
| 1262 | Ga0495593_0125487 | 3300047673 | Bacteria | 1305 |
| 1263 | Ga0495602_0080010 | 3300048088 | Bacteria | 2754 |
| 1264 | Ga0495615_0037513 | 3300048090 | Bacteria | 1194 |
| 1265 | Ga0496100_0049531 | 3300048903 | Bacteria | 2717 |
| 1266 | Ga0496101_0108575 | 3300048904 | Bacteria | 2086 |
| 1267 | Ga0496102_1047154 | 3300048905 | Bacteria | 736 |
| 1268 | Ga0496104_0097105 | 3300048907 | Bacteria | 2820 |
| 1269 | Ga0496104_0098047 | 3300048907 | Bacteria | 2806 |
| 1270 | Ga0496104_0204889 | 3300048907 | Bacteria | 1884 |
| 1271 | Ga0496104_0300644 | 3300048907 | Bacteria | 1517 |
| 1272 | Ga0496105_0140004 | 3300048908 | Bacteria | 1992 |
| 1273 | Ga0496105_0435725 | 3300048908 | Unclassified | 1036 |
| 1274 | Ga0496107_0727748 | 3300048910 | Bacteria | 729 |
| 1275 | Ga0496108_0098307 | 3300048911 | Bacteria | 2494 |
| 1276 | Ga0496109_0051846 | 3300048912 | Bacteria | 3738 |
| 1277 | Ga0496109_0230464 | 3300048912 | Bacteria | 1742 |
| 1278 | Ga0496110_0955274 | 3300048913 | Bacteria | 764 |
| 1279 | Ga0496111_0184697 | 3300048914 | Bacteria | 1550 |
| 1280 | Ga0496112_0039773 | 3300048915 | Bacteria | 4596 |
| 1281 | Ga0496112_0560136 | 3300048915 | Bacteria | 1076 |
| 1282 | Ga0496112_0733194 | 3300048915 | Bacteria | 915 |
| 1283 | Ga0496113_0033990 | 3300048916 | Bacteria | 3717 |
| 1284 | Ga0496113_0078240 | 3300048916 | Bacteria | 2530 |
| 1285 | Ga0496113_0782428 | 3300048916 | Bacteria | 759 |
| 1286 | Ga0496114_0001912 | 3300048917 | Bacteria | 15852 |
| 1287 | Ga0496114_1137310 | 3300048917 | Bacteria | 666 |
| 1288 | Ga0496115_0094411 | 3300048918 | Bacteria | 2447 |
| 1289 | Ga0496115_0141131 | 3300048918 | Bacteria | 1988 |
| 1290 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 1291 | Ga0496121_0062508 | 3300048924 | Bacteria | 3049 |
| 1292 | Ga0496122_0000862 | 3300048925 | Bacteria | 57049 |
| 1293 | Ga0496123_0029231 | 3300048926 | Bacteria | 4064 |
| 1294 | Ga0496124_0035036 | 3300048927 | Bacteria | 4396 |
| 1295 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 1296 | Ga0496125_0105937 | 3300048928 | Bacteria | 2054 |
| 1297 | Ga0496126_0089554 | 3300048929 | Bacteria | 2708 |
| 1298 | Ga0501306_019863 | 3300049127 | Bacteria | 929 |
| 1299 | Ga0501308_037880 | 3300049128 | Bacteria | 670 |
| 1300 | Ga0501308_052130 | 3300049128 | Bacteria | 601 |
| 1301 | Ga0501309_000005 | 3300049129 | Bacteria | 11119 |
| 1302 | Ga0501310_000149 | 3300049130 | Bacteria | 6887 |
| 1303 | Ga0501341_00421 | 3300049131 | Bacteria | 1765 |
| 1304 | Ga0501343_002364 | 3300049132 | Bacteria | 1341 |
| 1305 | Ga0501345_01514 | 3300049134 | Bacteria | 898 |
| 1306 | Ga0501305_001515 | 3300049161 | Bacteria | 2293 |
| 1307 | Ga0501305_009592 | 3300049161 | Bacteria | 1276 |
| 1308 | Ga0501305_037209 | 3300049161 | Bacteria | 780 |
| 1309 | Ga0501307_014525 | 3300049162 | Bacteria | 963 |
| 1310 | Ga0501298_015704 | 3300049521 | Bacteria | 1366 |
| 1311 | Ga0501299_017189 | 3300049522 | Bacteria | 1288 |
| 1312 | Ga0501311_003947 | 3300049527 | Bacteria | 1550 |
| 1313 | Ga0501312_000702 | 3300049528 | Bacteria | 2872 |
| 1314 | Ga0501312_017506 | 3300049528 | Bacteria | 1035 |
| 1315 | Ga0501314_000001 | 3300049530 | Bacteria | 13837 |
| 1316 | Ga0501314_005402 | 3300049530 | Bacteria | 1087 |
| 1317 | Ga0501315_005172 | 3300049531 | Bacteria | 1403 |
| 1318 | Ga0501315_013721 | 3300049531 | Bacteria | 1018 |
| 1319 | Ga0501316_000418 | 3300049532 | Bacteria | 2880 |
| 1320 | Ga0501317_013917 | 3300049533 | Bacteria | 1012 |
| 1321 | Ga0501319_000018 | 3300049535 | Bacteria | 6166 |
| 1322 | Ga0501320_000042 | 3300049536 | Bacteria | 6003 |
| 1323 | Ga0501320_002561 | 3300049536 | Bacteria | 1465 |
| 1324 | Ga0501320_002568 | 3300049536 | Bacteria | 1464 |
| 1325 | Ga0501321_036530 | 3300049537 | Bacteria | 676 |
| 1326 | Ga0501323_000002 | 3300049539 | Bacteria | 14311 |
| 1327 | Ga0501323_001249 | 3300049539 | Bacteria | 2198 |
| 1328 | Ga0501323_001617 | 3300049539 | Bacteria | 2046 |
| 1329 | Ga0501324_000002 | 3300049540 | Bacteria | 14212 |
| 1330 | Ga0501324_000446 | 3300049540 | Bacteria | 2211 |
| 1331 | Ga0501326_00020 | 3300049542 | Bacteria | 5374 |
| 1332 | Ga0501329_00025 | 3300049545 | Bacteria | 3428 |
| 1333 | Ga0501335_006458 | 3300049551 | Bacteria | 1069 |
| 1334 | Ga0501033_0125267 | 3300049570 | Bacteria | 1863 |
| 1335 | Ga0501034_0068864 | 3300049571 | Bacteria | 3549 |
| 1336 | Ga0501034_0156774 | 3300049571 | Bacteria | 2250 |
| 1337 | Ga0501034_0506147 | 3300049571 | Bacteria | 1121 |
| 1338 | Ga0501034_0753057 | 3300049571 | Bacteria | 869 |
| 1339 | Ga0501036_0044298 | 3300049572 | Bacteria | 3769 |
| 1340 | Ga0501036_0469331 | 3300049572 | Bacteria | 1048 |
| 1341 | Ga0501037_0336815 | 3300049573 | Bacteria | 1043 |
| 1342 | Ga0501038_0011902 | 3300049574 | Bacteria | 7941 |
| 1343 | Ga0501039_0278926 | 3300049575 | Bacteria | 1314 |
| 1344 | Ga0501040_0023723 | 3300049576 | Bacteria | 4114 |
| 1345 | Ga0501041_0022629 | 3300049577 | Bacteria | 3764 |
| 1346 | Ga0501042_0111407 | 3300049578 | Bacteria | 1971 |
| 1347 | Ga0501043_0014339 | 3300049579 | Bacteria | 6203 |
| 1348 | Ga0501043_0252400 | 3300049579 | Unclassified | 1358 |
| 1349 | Ga0501043_0347853 | 3300049579 | Unclassified | 1127 |
| 1350 | Ga0501043_0412068 | 3300049579 | Bacteria | 1020 |
| 1351 | Ga0501043_0840598 | 3300049579 | Bacteria | 662 |
| 1352 | Ga0501047_0028661 | 3300049581 | Bacteria | 5370 |
| 1353 | Ga0501047_0154966 | 3300049581 | Bacteria | 2165 |
| 1354 | Ga0501047_0645969 | 3300049581 | Bacteria | 878 |
| 1355 | Ga0501067_0132877 | 3300049583 | Bacteria | 1385 |
| 1356 | Ga0501069_0360955 | 3300049585 | Bacteria | 857 |
| 1357 | Ga0501070_0177473 | 3300049586 | Bacteria | 1753 |
| 1358 | Ga0501070_0597127 | 3300049586 | Bacteria | 880 |
| 1359 | Ga0501071_0342927 | 3300049587 | Bacteria | 1136 |
| 1360 | Ga0501072_0702432 | 3300049588 | Bacteria | 795 |
| 1361 | Ga0501073_0067112 | 3300049589 | Bacteria | 2501 |
| 1362 | Ga0501073_0568293 | 3300049589 | Bacteria | 783 |
| 1363 | Ga0501075_0331579 | 3300049591 | Bacteria | 1160 |
| 1364 | Ga0501076_0311540 | 3300049592 | Bacteria | 1291 |
| 1365 | Ga0501077_0037660 | 3300049593 | Bacteria | 3080 |
| 1366 | Ga0501202_001841 | 3300049652 | Bacteria | 3476 |
| 1367 | Ga0501207_004686 | 3300049654 | Bacteria | 1870 |
| 1368 | Ga0501207_063034 | 3300049654 | Bacteria | 683 |
| 1369 | Ga0501209_069646 | 3300049656 | Bacteria | 998 |
| 1370 | Ga0501222_004291 | 3300049662 | Bacteria | 1937 |
| 1371 | Ga0501223_012279 | 3300049663 | Bacteria | 1713 |
| 1372 | Ga0501224_032102 | 3300049664 | Bacteria | 787 |
| 1373 | Ga0501227_049108 | 3300049665 | Bacteria | 1061 |
| 1374 | Ga0501233_015944 | 3300049668 | Bacteria | 1553 |
| 1375 | Ga0501235_011426 | 3300049669 | Bacteria | 1948 |
| 1376 | Ga0501236_002270 | 3300049670 | Bacteria | 2204 |
| 1377 | Ga0501238_000015 | 3300049671 | Bacteria | 31964 |
| 1378 | Ga0501239_014102 | 3300049672 | Bacteria | 921 |
| 1379 | Ga0501242_020336 | 3300049674 | Bacteria | 852 |
| 1380 | Ga0501246_006229 | 3300049676 | Bacteria | 1018 |
| 1381 | Ga0501248_011597 | 3300049678 | Bacteria | 798 |
| 1382 | Ga0501249_011337 | 3300049679 | Bacteria | 1870 |
| 1383 | Ga0501249_037489 | 3300049679 | Bacteria | 1094 |
| 1384 | Ga0501249_062867 | 3300049679 | Bacteria | 861 |
| 1385 | Ga0501251_007216 | 3300049681 | Bacteria | 1231 |
| 1386 | Ga0501251_044664 | 3300049681 | Bacteria | 683 |
| 1387 | Ga0501256_016105 | 3300049685 | Bacteria | 754 |
| 1388 | Ga0501257_005052 | 3300049686 | Bacteria | 2896 |
| 1389 | Ga0501257_057909 | 3300049686 | Bacteria | 975 |
| 1390 | Ga0501259_004749 | 3300049688 | Bacteria | 2155 |
| 1391 | Ga0501225_0003051 | 3300049705 | Bacteria | 5115 |
| 1392 | Ga0501225_0049385 | 3300049705 | Bacteria | 1170 |
| 1393 | Ga0501225_0095137 | 3300049705 | Bacteria | 866 |
| 1394 | Ga0501234_005497 | 3300049707 | Bacteria | 1983 |
| 1395 | Ga0501245_055162 | 3300049708 | Bacteria | 713 |
| 1396 | Ga0501079_0269060 | 3300049741 | Bacteria | 1332 |
| 1397 | Ga0501079_0363211 | 3300049741 | Bacteria | 1135 |
| 1398 | Ga0501080_0995597 | 3300049742 | Bacteria | 727 |
| 1399 | Ga0501241_002523 | 3300049758 | Bacteria | 3531 |
| 1400 | Ga0501263_003314 | 3300049760 | Bacteria | 1712 |
| 1401 | Ga0501263_036753 | 3300049760 | Bacteria | 708 |
| 1402 | Ga0501264_000971 | 3300049761 | Bacteria | 3525 |
| 1403 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 1404 | Ga0501268_000392 | 3300049765 | Bacteria | 4659 |
| 1405 | Ga0501269_027813 | 3300049766 | Bacteria | 719 |
| 1406 | Ga0501270_000461 | 3300049767 | Bacteria | 3478 |
| 1407 | Ga0501274_008220 | 3300049771 | Bacteria | 932 |
| 1408 | Ga0501280_000239 | 3300049776 | Bacteria | 13899 |
| 1409 | Ga0501280_038589 | 3300049776 | Bacteria | 768 |
| 1410 | Ga0501283_018119 | 3300049779 | Bacteria | 1106 |
| 1411 | Ga0501035_0493382 | 3300049822 | Bacteria | 1009 |
| 1412 | Ga0501045_0778464 | 3300049824 | Unclassified | 705 |
| 1413 | Ga0501226_018378 | 3300049853 | Bacteria | 770 |
| 1414 | nmdc:mga0k408_106616_c1 | 3300050493 | Bacteria | 1655 |
| 1415 | nmdc:mga0k408_17232_c1 | 3300050493 | Bacteria | 4021 |
| 1416 | nmdc:mga0k408_176521_c1 | 3300050493 | Bacteria | 1274 |
| 1417 | nmdc:mga0k408_20199_c1 | 3300050493 | Bacteria | 3729 |
| 1418 | nmdc:mga0k408_41944_c2 | 3300050493 | Bacteria | 2051 |
| 1419 | nmdc:mga0k408_43078_c1 | 3300050493 | Bacteria | 2600 |
| 1420 | nmdc:mga0k408_62301_c2 | 3300050493 | Bacteria | 1583 |
| 1421 | nmdc:mga07m45_26725_c1 | 3300050496 | Bacteria | 3173 |
| 1422 | nmdc:mga05p37_3944_c1 | 3300050507 | Bacteria | 17380 |
| 1423 | nmdc:mga05p37_396256_c1 | 3300050507 | Bacteria | 1613 |
| 1424 | nmdc:mga05p37_886407_c1 | 3300050507 | Bacteria | 964 |
| 1425 | nmdc:mga09592_65841_c1 | 3300050508 | Unclassified | 3070 |
| 1426 | nmdc:mga09592_828015_c1 | 3300050508 | Bacteria | 782 |
| 1427 | nmdc:mga0qj67_333638_c1 | 3300050509 | Bacteria | 1227 |
| 1428 | nmdc:mga0qj67_644073_c1 | 3300050509 | Bacteria | 846 |
| 1429 | nmdc:mga06r32_157920_c1 | 3300050510 | Bacteria | 2250 |
| 1430 | nmdc:mga06r32_260089_c1 | 3300050510 | Bacteria | 1723 |
| 1431 | nmdc:mga06r32_600359_c1 | 3300050510 | Bacteria | 1072 |
| 1432 | nmdc:mga0n895_346964_c1 | 3300050512 | Bacteria | 1503 |
| 1433 | nmdc:mga08x19_41680_c1 | 3300050514 | Bacteria | 2924 |
| 1434 | nmdc:mga08x19_9157_c1 | 3300050514 | Bacteria | 5911 |
| 1435 | Ga0495601_0347318 | 3300053077 | Bacteria | 965 |
| 1436 | Ga0495601_0963338 | 3300053077 | Bacteria | 537 |
| 1437 | Ga0495612_0153909 | 3300053078 | Bacteria | 1002 |
| 1438 | Ga0495619_0238679 | 3300053085 | Bacteria | 1260 |
| 1439 | Ga0495619_0263150 | 3300053085 | Bacteria | 1195 |
| 1440 | Ga0500644_0012343 | 3300053088 | Bacteria | 2359 |
| 1441 | Ga0500644_0012427 | 3300053088 | Bacteria | 2354 |
| 1442 | Ga0500644_0299116 | 3300053088 | Bacteria | 688 |
| 1443 | Ga0500646_0021012 | 3300053090 | Bacteria | 1737 |
| 1444 | Ga0500646_0093703 | 3300053090 | Bacteria | 933 |
| 1445 | Ga0500583_0037830 | 3300053092 | Bacteria | 2169 |
| 1446 | Ga0500651_0207492 | 3300053093 | Bacteria | 1153 |
| 1447 | Ga0500651_0309979 | 3300053093 | Bacteria | 904 |
| 1448 | Ga0500641_0000168 | 3300053096 | Bacteria | 24462 |
| 1449 | Ga0500641_0006404 | 3300053096 | Bacteria | 4180 |
| 1450 | Ga0500650_0159914 | 3300053098 | Bacteria | 1039 |
| 1451 | Ga0500556_0109981 | 3300053104 | Bacteria | 1068 |
| 1452 | Ga0500569_000284 | 3300053109 | Bacteria | 8035 |
| 1453 | Ga0500594_0010092 | 3300053118 | Bacteria | 2185 |
| 1454 | Ga0500652_003935 | 3300053131 | Bacteria | 4539 |
| 1455 | Ga0500652_181177 | 3300053131 | Bacteria | 863 |
| 1456 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 1457 | Ga0500658_0001077 | 3300053134 | Bacteria | 11171 |
| 1458 | Ga0500559_0017721 | 3300053136 | Bacteria | 3010 |
| 1459 | Ga0500568_0053162 | 3300053139 | Bacteria | 1588 |
| 1460 | Ga0500577_0000711 | 3300053142 | Bacteria | 8518 |
| 1461 | Ga0500588_0148287 | 3300053146 | Bacteria | 847 |
| 1462 | Ga0500590_052622 | 3300053148 | Bacteria | 2066 |
| 1463 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 1464 | Ga0500616_0108629 | 3300053153 | Bacteria | 1343 |
| 1465 | Ga0500622_0000655 | 3300053156 | Bacteria | 30835 |
| 1466 | Ga0500622_0022828 | 3300053156 | Bacteria | 3313 |
| 1467 | Ga0500622_0278125 | 3300053156 | Bacteria | 722 |
| 1468 | Ga0500627_0019206 | 3300053158 | Bacteria | 2719 |
| 1469 | Ga0500627_0075223 | 3300053158 | Bacteria | 1501 |
| 1470 | Ga0500633_0007899 | 3300053160 | Bacteria | 2710 |
| 1471 | Ga0500634_0210131 | 3300053161 | Bacteria | 846 |
| 1472 | Ga0500636_0005509 | 3300053177 | Bacteria | 7233 |
| 1473 | Ga0500656_018218 | 3300053732 | Bacteria | 847 |
| 1474 | Ga0501084_0573462 | 3300054114 | Bacteria | 953 |
| 1475 | Ga0590074_023625 | 3300059423 | Bacteria | 1067 |
| 1476 | Ga0587077_000157 | 3300059493 | Bacteria | 4488 |
| 1477 | Ga0587068_001506 | 3300059641 | Bacteria | 2637 |
| 1478 | Ga0466962_0058532 | 3300061719 | Bacteria | 1839 |
| 1479 | Ga0530510_0086201 | 3300061734 | Bacteria | 2288 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100132105 | Ga0070711_1001321053 | 144 |
| 2 | 3300006028 | Ga0070717_10027264 | Ga0070717_100272643 | 144 |
| 3 | 3300006175 | Ga0070712_100140461 | Ga0070712_1001404613 | 144 |
| 4 | 3300005347 | Ga0070668_100271417 | Ga0070668_1002714172 | 145 |
| 5 | 3300005436 | Ga0070713_100549100 | Ga0070713_1005491002 | 145 |
| 6 | 3300005437 | Ga0070710_10244122 | Ga0070710_102441222 | 145 |
| 7 | 3300006028 | Ga0070717_10572561 | Ga0070717_105725612 | 145 |
| 8 | 3300025898 | Ga0207692_10283514 | Ga0207692_102835142 | 145 |
| 9 | 3300025898 | Ga0207692_10341726 | Ga0207692_103417262 | 145 |
| 10 | 3300025928 | Ga0207700_10040763 | Ga0207700_100407633 | 145 |
| 11 | 3300025928 | Ga0207700_10220515 | Ga0207700_102205151 | 145 |
| 12 | 3300025928 | Ga0207700_10520674 | Ga0207700_105206742 | 145 |
| 13 | 3300025972 | Ga0207668_10676347 | Ga0207668_106763472 | 145 |
| 14 | 3300031548 | Ga0307408_101355421 | Ga0307408_1013554211 | 145 |
| 15 | 3300031995 | Ga0307409_100139429 | Ga0307409_1001394294 | 145 |
| 16 | 3300032126 | Ga0307415_100926206 | Ga0307415_1009262062 | 145 |
| 17 | 3300045976 | Ga0466967_0036213 | Ga0466967_0036213_2469_3008 | 145 |
| 18 | 3300049522 | Ga0501299_017189 | Ga0501299_017189_336_875 | 145 |
| 19 | 3300049654 | Ga0501207_004686 | Ga0501207_004686_468_1007 | 145 |
| 20 | 3300049705 | Ga0501225_0049385 | Ga0501225_0049385_562_1101 | 145 |
| 21 | 3300005985 | Ga0081539_10096810 | Ga0081539_100968102 | 146 |
| 22 | 3300031852 | Ga0307410_10644627 | Ga0307410_106446271 | 146 |
| 23 | 3300032005 | Ga0307411_10343930 | Ga0307411_103439302 | 146 |
| 24 | 3300035121 | Ga0373960_0152321 | Ga0373960_0152321_89_586 | 147 |
| 25 | 3300041486 | Ga0451807_1248443 | Ga0451807_1248443_34_510 | 147 |
| 26 | 3300046459 | Ga0495629_0019985 | Ga0495629_0019985_3947_4438 | 147 |
| 27 | 3300046683 | Ga0495658_0097935 | Ga0495658_0097935_298_789 | 147 |
| 28 | 3300048916 | Ga0496113_0782428 | Ga0496113_0782428_272_748 | 147 |
| 29 | 3300049679 | Ga0501249_037489 | Ga0501249_037489_487_930 | 147 |
| 30 | 3300026075 | Ga0207708_10152014 | Ga0207708_101520143 | 150 |
| 31 | 3300006175 | Ga0070712_100144992 | Ga0070712_1001449922 | 151 |
| 32 | 3300049583 | Ga0501067_0132877 | Ga0501067_0132877_67_606 | 151 |
| 33 | 3300005327 | Ga0070658_10186882 | Ga0070658_101868824 | 152 |
| 34 | 3300025909 | Ga0207705_10162822 | Ga0207705_101628224 | 152 |
| 35 | 3300020082 | Ga0206353_11411444 | Ga0206353_114114442 | 153 |
| 36 | 3300032002 | Ga0307416_100411395 | Ga0307416_1004113952 | 154 |
| 37 | 3300036401 | Ga0373937_1340874 | Ga0373937_1340874_182_646 | 154 |
| 38 | 3300044673 | Ga0453683_0462118 | Ga0453683_0462118_117_671 | 154 |
| 39 | 3300047315 | Ga0495581_0165347 | Ga0495581_0165347_130_594 | 154 |
| 40 | 3300005293 | Ga0065715_10508194 | Ga0065715_105081942 | 155 |
| 41 | 3300005457 | Ga0070662_100499086 | Ga0070662_1004990861 | 155 |
| 42 | 3300005457 | Ga0070662_100637874 | Ga0070662_1006378742 | 155 |
| 43 | 3300009177 | Ga0105248_11519373 | Ga0105248_115193732 | 155 |
| 44 | 3300025944 | Ga0207661_10304431 | Ga0207661_103044314 | 155 |
| 45 | 3300046529 | Ga0495652_0098996 | Ga0495652_0098996_1672_2211 | 155 |
| 46 | 3300048915 | Ga0496112_0733194 | Ga0496112_0733194_428_898 | 156 |
| 47 | 3300053085 | Ga0495619_0263150 | Ga0495619_0263150_99_569 | 156 |
| 48 | 3300014326 | Ga0157380_10914621 | Ga0157380_109146212 | 157 |
| 49 | 3300005367 | Ga0070667_100561217 | Ga0070667_1005612172 | 160 |
| 50 | 3300014969 | Ga0157376_10229581 | Ga0157376_102295812 | 160 |
| 51 | 3300005577 | Ga0068857_100006227 | Ga0068857_1000062279 | 161 |
| 52 | 3300005618 | Ga0068864_100005272 | Ga0068864_10000527210 | 161 |
| 53 | 3300020081 | Ga0206354_10616054 | Ga0206354_106160543 | 161 |
| 54 | 3300032002 | Ga0307416_100188953 | Ga0307416_1001889532 | 161 |
| 55 | 3300035172 | Ga0373955_0854685 | Ga0373955_0854685_55_540 | 161 |
| 56 | 3300049672 | Ga0501239_014102 | Ga0501239_014102_344_883 | 161 |
| 57 | 3300049705 | Ga0501225_0095137 | Ga0501225_0095137_221_760 | 161 |
| 58 | 3300053077 | Ga0495601_0963338 | Ga0495601_0963338_20_505 | 161 |
| 59 | 3300005616 | Ga0068852_100980316 | Ga0068852_1009803162 | 162 |
| 60 | 3300026142 | Ga0207698_10602074 | Ga0207698_106020742 | 162 |
| 61 | 3300005434 | Ga0070709_10178408 | Ga0070709_101784083 | 163 |
| 62 | 3300005548 | Ga0070665_100293202 | Ga0070665_1002932022 | 163 |
| 63 | 3300006237 | Ga0097621_100362135 | Ga0097621_1003621352 | 163 |
| 64 | 3300028379 | Ga0268266_10221528 | Ga0268266_102215282 | 163 |
| 65 | 3300035692 | Ga0373935_0051868 | Ga0373935_0051868_307_846 | 163 |
| 66 | 3300046472 | Ga0495580_0057113 | Ga0495580_0057113_593_1132 | 163 |
| 67 | 3300046475 | Ga0495639_0134983 | Ga0495639_0134983_81_620 | 163 |
| 68 | 3300046499 | Ga0495594_0012720 | Ga0495594_0012720_296_835 | 163 |
| 69 | 3300046514 | Ga0495618_0058209 | Ga0495618_0058209_1147_1686 | 163 |
| 70 | 3300046517 | Ga0495630_0079270 | Ga0495630_0079270_510_1049 | 163 |
| 71 | 3300046526 | Ga0495666_0022515 | Ga0495666_0022515_993_1532 | 163 |
| 72 | 3300046531 | Ga0495665_0016600 | Ga0495665_0016600_2043_2582 | 163 |
| 73 | 3300046533 | Ga0495640_0071948 | Ga0495640_0071948_378_917 | 163 |
| 74 | 3300046557 | Ga0495622_0413731 | Ga0495622_0413731_73_564 | 163 |
| 75 | 3300046642 | Ga0495634_0074722 | Ga0495634_0074722_791_1330 | 163 |
| 76 | 3300046674 | Ga0495588_0321334 | Ga0495588_0321334_310_801 | 163 |
| 77 | 3300046689 | Ga0495613_0134788 | Ga0495613_0134788_648_1187 | 163 |
| 78 | 3300046690 | Ga0495624_0187737 | Ga0495624_0187737_269_808 | 163 |
| 79 | 3300047315 | Ga0495581_0171961 | Ga0495581_0171961_194_733 | 163 |
| 80 | 3300047471 | Ga0495684_0075992 | Ga0495684_0075992_394_933 | 163 |
| 81 | 3300047673 | Ga0495593_0090810 | Ga0495593_0090810_678_1217 | 163 |
| 82 | 3300048907 | Ga0496104_0098047 | Ga0496104_0098047_1206_1697 | 163 |
| 83 | 3300048908 | Ga0496105_0435725 | Ga0496105_0435725_501_992 | 163 |
| 84 | 3300048913 | Ga0496110_0955274 | Ga0496110_0955274_213_752 | 163 |
| 85 | 3300048915 | Ga0496112_0039773 | Ga0496112_0039773_486_977 | 163 |
| 86 | 3300048916 | Ga0496113_0033990 | Ga0496113_0033990_2628_3119 | 163 |
| 87 | 3300005329 | Ga0070683_100003340 | Ga0070683_10000334018 | 164 |
| 88 | 3300005336 | Ga0070680_100259279 | Ga0070680_1002592791 | 164 |
| 89 | 3300005337 | Ga0070682_100010066 | Ga0070682_1000100665 | 164 |
| 90 | 3300005344 | Ga0070661_100065820 | Ga0070661_1000658205 | 164 |
| 91 | 3300005366 | Ga0070659_100265579 | Ga0070659_1002655793 | 164 |
| 92 | 3300005458 | Ga0070681_10083427 | Ga0070681_100834272 | 164 |
| 93 | 3300005535 | Ga0070684_100005718 | Ga0070684_10000571818 | 164 |
| 94 | 3300005564 | Ga0070664_100008033 | Ga0070664_10000803315 | 164 |
| 95 | 3300013100 | Ga0157373_10169698 | Ga0157373_101696982 | 164 |
| 96 | 3300013307 | Ga0157372_10017897 | Ga0157372_100178972 | 164 |
| 97 | 3300025912 | Ga0207707_10171625 | Ga0207707_101716253 | 164 |
| 98 | 3300025920 | Ga0207649_10019877 | Ga0207649_100198772 | 164 |
| 99 | 3300025921 | Ga0207652_10536478 | Ga0207652_105364781 | 164 |
| 100 | 3300025932 | Ga0207690_10170316 | Ga0207690_101703162 | 164 |
| 101 | 3300025944 | Ga0207661_10001907 | Ga0207661_1000190718 | 164 |
| 102 | 3300025945 | Ga0207679_10002650 | Ga0207679_1000265013 | 164 |
| 103 | 3300026116 | Ga0207674_10008361 | Ga0207674_1000836111 | 164 |
| 104 | 3300036401 | Ga0373937_0036462 | Ga0373937_0036462_1013_1552 | 164 |
| 105 | 3300046459 | Ga0495629_0348777 | Ga0495629_0348777_303_845 | 164 |
| 106 | 3300046475 | Ga0495639_0002494 | Ga0495639_0002494_4220_4762 | 164 |
| 107 | 3300046476 | Ga0495662_0121873 | Ga0495662_0121873_411_953 | 164 |
| 108 | 3300046499 | Ga0495594_0017843 | Ga0495594_0017843_2443_2985 | 164 |
| 109 | 3300046531 | Ga0495665_0066629 | Ga0495665_0066629_793_1335 | 164 |
| 110 | 3300046689 | Ga0495613_0021242 | Ga0495613_0021242_3751_4293 | 164 |
| 111 | 3300046809 | Ga0495600_0034516 | Ga0495600_0034516_2429_2971 | 164 |
| 112 | 3300047315 | Ga0495581_0061450 | Ga0495581_0061450_1005_1547 | 164 |
| 113 | 3300047319 | Ga0495674_0269977 | Ga0495674_0269977_378_920 | 164 |
| 114 | 3300047444 | Ga0495675_0397031 | Ga0495675_0397031_13_552 | 164 |
| 115 | 3300047673 | Ga0495593_0125487 | Ga0495593_0125487_469_1011 | 164 |
| 116 | 3300031903 | Ga0307407_10191846 | Ga0307407_101918463 | 165 |
| 117 | 3300049708 | Ga0501245_055162 | Ga0501245_055162_206_703 | 165 |
| 118 | 3300005336 | Ga0070680_100349840 | Ga0070680_1003498402 | 166 |
| 119 | 3300005341 | Ga0070691_10038620 | Ga0070691_100386203 | 166 |
| 120 | 3300005455 | Ga0070663_100084547 | Ga0070663_1000845473 | 166 |
| 121 | 3300005458 | Ga0070681_10113109 | Ga0070681_101131094 | 166 |
| 122 | 3300005458 | Ga0070681_10229479 | Ga0070681_102294792 | 166 |
| 123 | 3300005578 | Ga0068854_100014628 | Ga0068854_1000146283 | 166 |
| 124 | 3300005614 | Ga0068856_100028869 | Ga0068856_1000288693 | 166 |
| 125 | 3300009093 | Ga0105240_10366202 | Ga0105240_103662021 | 166 |
| 126 | 3300009174 | Ga0105241_10083318 | Ga0105241_100833184 | 166 |
| 127 | 3300009551 | Ga0105238_10439991 | Ga0105238_104399913 | 166 |
| 128 | 3300013102 | Ga0157371_10016037 | Ga0157371_100160379 | 166 |
| 129 | 3300013307 | Ga0157372_10032433 | Ga0157372_100324339 | 166 |
| 130 | 3300025905 | Ga0207685_10319617 | Ga0207685_103196172 | 166 |
| 131 | 3300025909 | Ga0207705_10002123 | Ga0207705_1000212318 | 166 |
| 132 | 3300025912 | Ga0207707_10009127 | Ga0207707_100091279 | 166 |
| 133 | 3300025913 | Ga0207695_10004617 | Ga0207695_1000461718 | 166 |
| 134 | 3300025919 | Ga0207657_10001138 | Ga0207657_1000113821 | 166 |
| 135 | 3300025924 | Ga0207694_10223798 | Ga0207694_102237983 | 166 |
| 136 | 3300025949 | Ga0207667_10063175 | Ga0207667_100631759 | 166 |
| 137 | 3300025981 | Ga0207640_10001854 | Ga0207640_1000185418 | 166 |
| 138 | 3300026067 | Ga0207678_10001614 | Ga0207678_1000161421 | 166 |
| 139 | 3300026078 | Ga0207702_10082065 | Ga0207702_100820654 | 166 |
| 140 | 3300047318 | Ga0495636_0274795 | Ga0495636_0274795_74_613 | 167 |
| 141 | 3300009174 | Ga0105241_10174702 | Ga0105241_101747022 | 168 |
| 142 | 3300013307 | Ga0157372_10110207 | Ga0157372_101102073 | 168 |
| 143 | 3300048917 | Ga0496114_1137310 | Ga0496114_1137310_15_521 | 168 |
| 144 | 3300005327 | Ga0070658_11414870 | Ga0070658_114148701 | 169 |
| 145 | 3300005329 | Ga0070683_100009922 | Ga0070683_1000099222 | 169 |
| 146 | 3300005329 | Ga0070683_100081164 | Ga0070683_1000811643 | 169 |
| 147 | 3300005336 | Ga0070680_100411529 | Ga0070680_1004115292 | 169 |
| 148 | 3300005339 | Ga0070660_100652046 | Ga0070660_1006520462 | 169 |
| 149 | 3300005366 | Ga0070659_100541933 | Ga0070659_1005419331 | 169 |
| 150 | 3300005530 | Ga0070679_100196306 | Ga0070679_1001963063 | 169 |
| 151 | 3300005535 | Ga0070684_100054023 | Ga0070684_1000540236 | 169 |
| 152 | 3300005563 | Ga0068855_100719953 | Ga0068855_1007199532 | 169 |
| 153 | 3300013100 | Ga0157373_10336033 | Ga0157373_103360332 | 169 |
| 154 | 3300013104 | Ga0157370_11238193 | Ga0157370_112381932 | 169 |
| 155 | 3300013105 | Ga0157369_10777525 | Ga0157369_107775252 | 169 |
| 156 | 3300025932 | Ga0207690_10142736 | Ga0207690_101427362 | 169 |
| 157 | 3300025944 | Ga0207661_10008533 | Ga0207661_100085333 | 169 |
| 158 | 3300025944 | Ga0207661_10064624 | Ga0207661_100646243 | 169 |
| 159 | 3300044694 | Ga0466963_0820038 | Ga0466963_0820038_16_555 | 169 |
| 160 | 3300046528 | Ga0495642_0148655 | Ga0495642_0148655_11_553 | 169 |
| 161 | 3300049571 | Ga0501034_0156774 | Ga0501034_0156774_629_1171 | 169 |
| 162 | 3300049574 | Ga0501038_0011902 | Ga0501038_0011902_1674_2216 | 169 |
| 163 | 3300049575 | Ga0501039_0278926 | Ga0501039_0278926_330_872 | 169 |
| 164 | 3300049579 | Ga0501043_0014339 | Ga0501043_0014339_3988_4530 | 169 |
| 165 | 3300049581 | Ga0501047_0028661 | Ga0501047_0028661_347_889 | 169 |
| 166 | 3300049586 | Ga0501070_0177473 | Ga0501070_0177473_481_1023 | 169 |
| 167 | 3300050509 | nmdc:mga0qj67_644073_c1 | nmdc:mga0qj67_644073_c1_318_827 | 169 |
| 168 | 3300025913 | Ga0207695_10129510 | Ga0207695_101295105 | 170 |
| 169 | 3300031995 | Ga0307409_100386844 | Ga0307409_1003868443 | 170 |
| 170 | 3300044735 | Ga0466968_0042386 | Ga0466968_0042386_14_526 | 170 |
| 171 | 3300026067 | Ga0207678_10564686 | Ga0207678_105646862 | 171 |
| 172 | 3300048918 | Ga0496115_0141131 | Ga0496115_0141131_664_1203 | 172 |
| 173 | 3300005329 | Ga0070683_100241279 | Ga0070683_1002412792 | 173 |
| 174 | 3300005334 | Ga0068869_100185023 | Ga0068869_1001850233 | 173 |
| 175 | 3300005335 | Ga0070666_10189487 | Ga0070666_101894873 | 173 |
| 176 | 3300005340 | Ga0070689_100053901 | Ga0070689_1000539015 | 173 |
| 177 | 3300005365 | Ga0070688_100099130 | Ga0070688_1000991303 | 173 |
| 178 | 3300005367 | Ga0070667_100027949 | Ga0070667_1000279491 | 173 |
| 179 | 3300005457 | Ga0070662_100094007 | Ga0070662_1000940074 | 173 |
| 180 | 3300005564 | Ga0070664_100412715 | Ga0070664_1004127152 | 173 |
| 181 | 3300005616 | Ga0068852_100048492 | Ga0068852_1000484923 | 173 |
| 182 | 3300005841 | Ga0068863_100955446 | Ga0068863_1009554461 | 173 |
| 183 | 3300009174 | Ga0105241_10263697 | Ga0105241_102636972 | 173 |
| 184 | 3300013296 | Ga0157374_10055359 | Ga0157374_100553597 | 173 |
| 185 | 3300013297 | Ga0157378_10181392 | Ga0157378_101813921 | 173 |
| 186 | 3300013308 | Ga0157375_10115562 | Ga0157375_101155622 | 173 |
| 187 | 3300014968 | Ga0157379_10879361 | Ga0157379_108793611 | 173 |
| 188 | 3300014969 | Ga0157376_10188093 | Ga0157376_101880933 | 173 |
| 189 | 3300025936 | Ga0207670_10104915 | Ga0207670_101049154 | 173 |
| 190 | 3300025942 | Ga0207689_10108678 | Ga0207689_101086783 | 173 |
| 191 | 3300025986 | Ga0207658_10077939 | Ga0207658_100779392 | 173 |
| 192 | 3300026142 | Ga0207698_10252161 | Ga0207698_102521613 | 173 |
| 193 | 3300028379 | Ga0268266_10075607 | Ga0268266_100756072 | 173 |
| 194 | 3300032002 | Ga0307416_100087680 | Ga0307416_1000876805 | 173 |
| 195 | 3300046522 | Ga0495643_0000294 | Ga0495643_0000294_49323_49865 | 173 |
| 196 | 3300046660 | Ga0495625_0001933 | Ga0495625_0001933_11512_12054 | 173 |
| 197 | 3300025906 | Ga0207699_10159810 | Ga0207699_101598102 | 174 |
| 198 | 3300041997 | Ga0439431_0000148 | Ga0439431_0000148_3073_3597 | 174 |
| 199 | 3300042004 | Ga0439445_0006554 | Ga0439445_0006554_1839_2363 | 174 |
| 200 | 3300044712 | Ga0453684_0174513 | Ga0453684_0174513_673_1197 | 174 |
| 201 | 3300046462 | Ga0495651_0233321 | Ga0495651_0233321_683_1225 | 174 |
| 202 | 3300046536 | Ga0495587_0017860 | Ga0495587_0017860_1429_1971 | 174 |
| 203 | 3300046679 | Ga0495623_0326114 | Ga0495623_0326114_118_660 | 174 |
| 204 | 3300047444 | Ga0495675_0212592 | Ga0495675_0212592_350_892 | 174 |
| 205 | 3300049570 | Ga0501033_0125267 | Ga0501033_0125267_353_877 | 174 |
| 206 | 3300049571 | Ga0501034_0753057 | Ga0501034_0753057_76_600 | 174 |
| 207 | 3300049581 | Ga0501047_0645969 | Ga0501047_0645969_291_815 | 174 |
| 208 | 3300049742 | Ga0501080_0995597 | Ga0501080_0995597_110_634 | 174 |
| 209 | 3300005290 | Ga0065712_10008429 | Ga0065712_100084296 | 176 |
| 210 | 3300005293 | Ga0065715_10093983 | Ga0065715_100939833 | 176 |
| 211 | 3300005337 | Ga0070682_100007172 | Ga0070682_1000071724 | 176 |
| 212 | 3300005338 | Ga0068868_100478873 | Ga0068868_1004788732 | 176 |
| 213 | 3300005435 | Ga0070714_100968588 | Ga0070714_1009685882 | 176 |
| 214 | 3300005440 | Ga0070705_100842829 | Ga0070705_1008428291 | 176 |
| 215 | 3300005444 | Ga0070694_100249688 | Ga0070694_1002496882 | 176 |
| 216 | 3300005445 | Ga0070708_100001661 | Ga0070708_10000166118 | 176 |
| 217 | 3300005445 | Ga0070708_100006987 | Ga0070708_1000069878 | 176 |
| 218 | 3300005445 | Ga0070708_100107836 | Ga0070708_1001078364 | 176 |
| 219 | 3300005458 | Ga0070681_10431495 | Ga0070681_104314952 | 176 |
| 220 | 3300005467 | Ga0070706_100031896 | Ga0070706_1000318966 | 176 |
| 221 | 3300005467 | Ga0070706_100317757 | Ga0070706_1003177573 | 176 |
| 222 | 3300005468 | Ga0070707_100020977 | Ga0070707_1000209776 | 176 |
| 223 | 3300005468 | Ga0070707_100697027 | Ga0070707_1006970272 | 176 |
| 224 | 3300005471 | Ga0070698_100296642 | Ga0070698_1002966421 | 176 |
| 225 | 3300005471 | Ga0070698_100490060 | Ga0070698_1004900603 | 176 |
| 226 | 3300005518 | Ga0070699_100001695 | Ga0070699_10000169511 | 176 |
| 227 | 3300005518 | Ga0070699_100518074 | Ga0070699_1005180742 | 176 |
| 228 | 3300005536 | Ga0070697_100042276 | Ga0070697_1000422766 | 176 |
| 229 | 3300005536 | Ga0070697_100069683 | Ga0070697_1000696832 | 176 |
| 230 | 3300005536 | Ga0070697_100440906 | Ga0070697_1004409062 | 176 |
| 231 | 3300005539 | Ga0068853_100077661 | Ga0068853_1000776611 | 176 |
| 232 | 3300005545 | Ga0070695_100136072 | Ga0070695_1001360722 | 176 |
| 233 | 3300005546 | Ga0070696_100728298 | Ga0070696_1007282982 | 176 |
| 234 | 3300005549 | Ga0070704_100174793 | Ga0070704_1001747934 | 176 |
| 235 | 3300005563 | Ga0068855_100019947 | Ga0068855_10001994710 | 176 |
| 236 | 3300005614 | Ga0068856_100720216 | Ga0068856_1007202162 | 176 |
| 237 | 3300005615 | Ga0070702_100339189 | Ga0070702_1003391892 | 176 |
| 238 | 3300006028 | Ga0070717_10088723 | Ga0070717_100887235 | 176 |
| 239 | 3300006914 | Ga0075436_100768590 | Ga0075436_1007685902 | 176 |
| 240 | 3300007076 | Ga0075435_100077319 | Ga0075435_1000773191 | 176 |
| 241 | 3300009093 | Ga0105240_10194521 | Ga0105240_101945213 | 176 |
| 242 | 3300009098 | Ga0105245_10296671 | Ga0105245_102966713 | 176 |
| 243 | 3300010375 | Ga0105239_10320114 | Ga0105239_103201142 | 176 |
| 244 | 3300013105 | Ga0157369_11055116 | Ga0157369_110551161 | 176 |
| 245 | 3300013297 | Ga0157378_10445427 | Ga0157378_104454271 | 176 |
| 246 | 3300013307 | Ga0157372_10027457 | Ga0157372_100274573 | 176 |
| 247 | 3300025910 | Ga0207684_10041535 | Ga0207684_100415356 | 176 |
| 248 | 3300025910 | Ga0207684_10205446 | Ga0207684_102054463 | 176 |
| 249 | 3300025910 | Ga0207684_10207259 | Ga0207684_102072593 | 176 |
| 250 | 3300025922 | Ga0207646_10028761 | Ga0207646_100287612 | 176 |
| 251 | 3300025922 | Ga0207646_10117918 | Ga0207646_101179183 | 176 |
| 252 | 3300025922 | Ga0207646_10119383 | Ga0207646_101193835 | 176 |
| 253 | 3300025939 | Ga0207665_10553953 | Ga0207665_105539531 | 176 |
| 254 | 3300025960 | Ga0207651_10110238 | Ga0207651_101102382 | 176 |
| 255 | 3300026023 | Ga0207677_10102756 | Ga0207677_101027563 | 176 |
| 256 | 3300041460 | Ga0451802_2169794 | Ga0451802_2169794_288_836 | 176 |
| 257 | 3300046674 | Ga0495588_0017168 | Ga0495588_0017168_2419_2967 | 176 |
| 258 | 3300046684 | Ga0495669_0406772 | Ga0495669_0406772_94_642 | 176 |
| 259 | 3300050514 | nmdc:mga08x19_41680_c1 | nmdc:mga08x19_41680_c1_1528_2076 | 176 |
| 260 | iso_pu_bacteria | 2513020052 | 2513232379 | 176 |
| 261 | iso_pu_bacteria | 2519899754 | 2520879543 | 176 |
| 262 | iso_pu_bacteria | 2643221667 | 2644373942 | 176 |
| 263 | iso_pu_bacteria | 2738541279 | 2738733056 | 176 |
| 264 | iso_pu_bacteria | 2738541285 | 2738765594 | 176 |
| 265 | iso_pu_bacteria | 2738543007 | 2739214637 | 176 |
| 266 | iso_pu_bacteria | 2739367857 | 2740002847 | 176 |
| 267 | iso_pu_bacteria | 2739367858 | 2740007664 | 176 |
| 268 | iso_pu_bacteria | 2816332280 | 2817413537 | 176 |
| 269 | iso_pu_bacteria | 2833640130 | 2833640611 | 176 |
| 270 | iso_pu_bacteria | 2857613821 | 2857617060 | 176 |
| 271 | iso_pu_bacteria | 2857618242 | 2857619729 | 176 |
| 272 | iso_pu_bacteria | 2881359912 | 2881364113 | 176 |
| 273 | iso_pu_bacteria | 2903895155 | 2903898672 | 176 |
| 274 | iso_pu_bacteria | 2904419702 | 2904422388 | 176 |
| 275 | iso_pu_bacteria | 2904555929 | 2904558506 | 176 |
| 276 | iso_pu_bacteria | 2929150217 | 2929150593 | 176 |
| 277 | iso_pu_bacteria | 2958458903 | 2958461990 | 176 |
| 278 | iso_pu_bacteria | 8036736890 | 8036739254 | 176 |
| 279 | iso_pu_bacteria | 8056440228 | 8056443507 | 176 |
| 280 | 3300005343 | Ga0070687_100346159 | Ga0070687_1003461592 | 177 |
| 281 | 3300009177 | Ga0105248_10311359 | Ga0105248_103113594 | 177 |
| 282 | 3300026118 | Ga0207675_100053069 | Ga0207675_1000530692 | 177 |
| 283 | 3300042134 | Ga0450898_013724 | Ga0450898_013724_684_1217 | 177 |
| 284 | 3300044673 | Ga0453683_0044004 | Ga0453683_0044004_1583_2134 | 177 |
| 285 | 3300044712 | Ga0453684_0217161 | Ga0453684_0217161_1024_1575 | 177 |
| 286 | 3300049588 | Ga0501072_0702432 | Ga0501072_0702432_41_574 | 177 |
| 287 | 3300049589 | Ga0501073_0568293 | Ga0501073_0568293_205_738 | 177 |
| 288 | 3300049591 | Ga0501075_0331579 | Ga0501075_0331579_396_929 | 177 |
| 289 | 3300049592 | Ga0501076_0311540 | Ga0501076_0311540_418_951 | 177 |
| 290 | 3300049741 | Ga0501079_0363211 | Ga0501079_0363211_453_986 | 177 |
| 291 | 3300049134 | Ga0501345_01514 | Ga0501345_01514_15_551 | 178 |
| 292 | 3300003349 | JGI26129J50193_1007612 | JGI26129J50193_10076121 | 179 |
| 293 | 3300005293 | Ga0065715_10124098 | Ga0065715_101240983 | 179 |
| 294 | 3300005337 | Ga0070682_101108578 | Ga0070682_1011085781 | 179 |
| 295 | 3300005339 | Ga0070660_100180211 | Ga0070660_1001802114 | 179 |
| 296 | 3300005341 | Ga0070691_10007739 | Ga0070691_1000773910 | 179 |
| 297 | 3300005344 | Ga0070661_100068143 | Ga0070661_1000681434 | 179 |
| 298 | 3300005353 | Ga0070669_100140043 | Ga0070669_1001400433 | 179 |
| 299 | 3300005353 | Ga0070669_100704253 | Ga0070669_1007042531 | 179 |
| 300 | 3300005367 | Ga0070667_100194249 | Ga0070667_1001942492 | 179 |
| 301 | 3300005435 | Ga0070714_100119027 | Ga0070714_1001190273 | 179 |
| 302 | 3300005444 | Ga0070694_100087623 | Ga0070694_1000876232 | 179 |
| 303 | 3300005445 | Ga0070708_100021209 | Ga0070708_1000212096 | 179 |
| 304 | 3300005466 | Ga0070685_10015284 | Ga0070685_100152846 | 179 |
| 305 | 3300005467 | Ga0070706_100001389 | Ga0070706_10000138918 | 179 |
| 306 | 3300005468 | Ga0070707_100000141 | Ga0070707_10000014159 | 179 |
| 307 | 3300005468 | Ga0070707_100008479 | Ga0070707_1000084792 | 179 |
| 308 | 3300005471 | Ga0070698_100000139 | Ga0070698_10000013955 | 179 |
| 309 | 3300005471 | Ga0070698_100002247 | Ga0070698_10000224721 | 179 |
| 310 | 3300005471 | Ga0070698_100005143 | Ga0070698_10000514317 | 179 |
| 311 | 3300005471 | Ga0070698_100042072 | Ga0070698_1000420726 | 179 |
| 312 | 3300005518 | Ga0070699_100100649 | Ga0070699_1001006492 | 179 |
| 313 | 3300005530 | Ga0070679_100018421 | Ga0070679_1000184217 | 179 |
| 314 | 3300005535 | Ga0070684_100222706 | Ga0070684_1002227063 | 179 |
| 315 | 3300005535 | Ga0070684_100240060 | Ga0070684_1002400601 | 179 |
| 316 | 3300005536 | Ga0070697_100000181 | Ga0070697_10000018126 | 179 |
| 317 | 3300005536 | Ga0070697_100178920 | Ga0070697_1001789202 | 179 |
| 318 | 3300005549 | Ga0070704_101042778 | Ga0070704_1010427782 | 179 |
| 319 | 3300005563 | Ga0068855_101019638 | Ga0068855_1010196381 | 179 |
| 320 | 3300005564 | Ga0070664_100359643 | Ga0070664_1003596432 | 179 |
| 321 | 3300005564 | Ga0070664_101143510 | Ga0070664_1011435101 | 179 |
| 322 | 3300005577 | Ga0068857_100046762 | Ga0068857_1000467627 | 179 |
| 323 | 3300005614 | Ga0068856_100100151 | Ga0068856_1001001512 | 179 |
| 324 | 3300005616 | Ga0068852_100029891 | Ga0068852_1000298912 | 179 |
| 325 | 3300005617 | Ga0068859_100104175 | Ga0068859_1001041755 | 179 |
| 326 | 3300005618 | Ga0068864_100529709 | Ga0068864_1005297092 | 179 |
| 327 | 3300005985 | Ga0081539_10115723 | Ga0081539_101157232 | 179 |
| 328 | 3300006173 | Ga0070716_100093082 | Ga0070716_1000930823 | 179 |
| 329 | 3300006914 | Ga0075436_100077507 | Ga0075436_1000775073 | 179 |
| 330 | 3300006931 | Ga0097620_100104177 | Ga0097620_1001041775 | 179 |
| 331 | 3300009093 | Ga0105240_10254590 | Ga0105240_102545902 | 179 |
| 332 | 3300009147 | Ga0114129_10999154 | Ga0114129_109991542 | 179 |
| 333 | 3300009553 | Ga0105249_10000247 | Ga0105249_1000024753 | 179 |
| 334 | 3300010375 | Ga0105239_10212579 | Ga0105239_102125794 | 179 |
| 335 | 3300013100 | Ga0157373_10570695 | Ga0157373_105706952 | 179 |
| 336 | 3300013102 | Ga0157371_10679687 | Ga0157371_106796872 | 179 |
| 337 | 3300013104 | Ga0157370_10139130 | Ga0157370_101391302 | 179 |
| 338 | 3300013104 | Ga0157370_10536180 | Ga0157370_105361802 | 179 |
| 339 | 3300013104 | Ga0157370_11183978 | Ga0157370_111839782 | 179 |
| 340 | 3300013296 | Ga0157374_10832188 | Ga0157374_108321882 | 179 |
| 341 | 3300013306 | Ga0163162_10711473 | Ga0163162_107114732 | 179 |
| 342 | 3300013307 | Ga0157372_10054127 | Ga0157372_100541274 | 179 |
| 343 | 3300014745 | Ga0157377_10023986 | Ga0157377_100239867 | 179 |
| 344 | 3300015262 | Ga0182007_10084666 | Ga0182007_100846662 | 179 |
| 345 | 3300020070 | Ga0206356_10956043 | Ga0206356_109560434 | 179 |
| 346 | 3300025910 | Ga0207684_10000188 | Ga0207684_1000018860 | 179 |
| 347 | 3300025911 | Ga0207654_10048247 | Ga0207654_100482472 | 179 |
| 348 | 3300025911 | Ga0207654_10292629 | Ga0207654_102926292 | 179 |
| 349 | 3300025912 | Ga0207707_10504761 | Ga0207707_105047611 | 179 |
| 350 | 3300025913 | Ga0207695_10013424 | Ga0207695_1001342418 | 179 |
| 351 | 3300025913 | Ga0207695_10020633 | Ga0207695_100206336 | 179 |
| 352 | 3300025917 | Ga0207660_10172670 | Ga0207660_101726702 | 179 |
| 353 | 3300025920 | Ga0207649_10016202 | Ga0207649_100162026 | 179 |
| 354 | 3300025922 | Ga0207646_10000238 | Ga0207646_1000023819 | 179 |
| 355 | 3300025922 | Ga0207646_10000258 | Ga0207646_1000025863 | 179 |
| 356 | 3300025922 | Ga0207646_11088683 | Ga0207646_110886831 | 179 |
| 357 | 3300025923 | Ga0207681_10296179 | Ga0207681_102961792 | 179 |
| 358 | 3300025929 | Ga0207664_10035039 | Ga0207664_100350394 | 179 |
| 359 | 3300025929 | Ga0207664_10554156 | Ga0207664_105541561 | 179 |
| 360 | 3300025933 | Ga0207706_10073828 | Ga0207706_100738283 | 179 |
| 361 | 3300025936 | Ga0207670_10904556 | Ga0207670_109045561 | 179 |
| 362 | 3300025939 | Ga0207665_10034509 | Ga0207665_100345096 | 179 |
| 363 | 3300025939 | Ga0207665_10108119 | Ga0207665_101081192 | 179 |
| 364 | 3300025941 | Ga0207711_10168742 | Ga0207711_101687422 | 179 |
| 365 | 3300025945 | Ga0207679_10122373 | Ga0207679_101223734 | 179 |
| 366 | 3300025949 | Ga0207667_11385274 | Ga0207667_113852741 | 179 |
| 367 | 3300025960 | Ga0207651_10545173 | Ga0207651_105451733 | 179 |
| 368 | 3300025961 | Ga0207712_10000236 | Ga0207712_1000023618 | 179 |
| 369 | 3300026035 | Ga0207703_10107075 | Ga0207703_101070752 | 179 |
| 370 | 3300026067 | Ga0207678_10318133 | Ga0207678_103181333 | 179 |
| 371 | 3300026078 | Ga0207702_10026759 | Ga0207702_100267596 | 179 |
| 372 | 3300026095 | Ga0207676_10556643 | Ga0207676_105566432 | 179 |
| 373 | 3300026116 | Ga0207674_10031980 | Ga0207674_100319809 | 179 |
| 374 | 3300026116 | Ga0207674_10374567 | Ga0207674_103745673 | 179 |
| 375 | 3300027360 | Ga0209969_1001951 | Ga0209969_10019513 | 179 |
| 376 | 3300027364 | Ga0209967_1017786 | Ga0209967_10177861 | 179 |
| 377 | 3300027462 | Ga0210000_1006710 | Ga0210000_10067103 | 179 |
| 378 | 3300027471 | Ga0209995_1012225 | Ga0209995_10122252 | 179 |
| 379 | 3300027526 | Ga0209968_1001933 | Ga0209968_10019336 | 179 |
| 380 | 3300027614 | Ga0209970_1038065 | Ga0209970_10380652 | 179 |
| 381 | 3300027717 | Ga0209998_10001251 | Ga0209998_100012513 | 179 |
| 382 | 3300027876 | Ga0209974_10012090 | Ga0209974_100120906 | 179 |
| 383 | 3300028380 | Ga0268265_10430882 | Ga0268265_104308822 | 179 |
| 384 | 3300031548 | Ga0307408_100075805 | Ga0307408_1000758052 | 179 |
| 385 | 3300031548 | Ga0307408_100868518 | Ga0307408_1008685182 | 179 |
| 386 | 3300031731 | Ga0307405_10090080 | Ga0307405_100900803 | 179 |
| 387 | 3300031824 | Ga0307413_10249917 | Ga0307413_102499172 | 179 |
| 388 | 3300031852 | Ga0307410_10048579 | Ga0307410_100485796 | 179 |
| 389 | 3300031852 | Ga0307410_10157622 | Ga0307410_101576222 | 179 |
| 390 | 3300031852 | Ga0307410_10287412 | Ga0307410_102874123 | 179 |
| 391 | 3300031901 | Ga0307406_10033753 | Ga0307406_100337535 | 179 |
| 392 | 3300031903 | Ga0307407_10095116 | Ga0307407_100951164 | 179 |
| 393 | 3300031995 | Ga0307409_100057484 | Ga0307409_1000574843 | 179 |
| 394 | 3300031995 | Ga0307409_100219286 | Ga0307409_1002192864 | 179 |
| 395 | 3300031995 | Ga0307409_100810802 | Ga0307409_1008108022 | 179 |
| 396 | 3300032002 | Ga0307416_100008439 | Ga0307416_10000843912 | 179 |
| 397 | 3300032004 | Ga0307414_10178342 | Ga0307414_101783422 | 179 |
| 398 | 3300032005 | Ga0307411_10330459 | Ga0307411_103304592 | 179 |
| 399 | 3300032126 | Ga0307415_100300684 | Ga0307415_1003006843 | 179 |
| 400 | 3300035088 | Ga0373940_0148248 | Ga0373940_0148248_47_586 | 179 |
| 401 | 3300035242 | Ga0373962_0095519 | Ga0373962_0095519_30_569 | 179 |
| 402 | 3300035410 | Ga0373924_0230165 | Ga0373924_0230165_257_796 | 179 |
| 403 | 3300035724 | Ga0373933_0303736 | Ga0373933_0303736_48_587 | 179 |
| 404 | 3300036401 | Ga0373937_0048653 | Ga0373937_0048653_2035_2574 | 179 |
| 405 | 3300036401 | Ga0373937_0547176 | Ga0373937_0547176_163_702 | 179 |
| 406 | 3300044712 | Ga0453684_0950475 | Ga0453684_0950475_338_877 | 179 |
| 407 | 3300046454 | Ga0495592_0199036 | Ga0495592_0199036_610_1149 | 179 |
| 408 | 3300046455 | Ga0495603_0018332 | Ga0495603_0018332_428_967 | 179 |
| 409 | 3300046455 | Ga0495603_0347795 | Ga0495603_0347795_212_751 | 179 |
| 410 | 3300046459 | Ga0495629_0146129 | Ga0495629_0146129_634_1173 | 179 |
| 411 | 3300046459 | Ga0495629_0194689 | Ga0495629_0194689_64_603 | 179 |
| 412 | 3300046462 | Ga0495651_0224316 | Ga0495651_0224316_217_756 | 179 |
| 413 | 3300046463 | Ga0495653_0127165 | Ga0495653_0127165_550_1089 | 179 |
| 414 | 3300046472 | Ga0495580_0015211 | Ga0495580_0015211_1467_2006 | 179 |
| 415 | 3300046472 | Ga0495580_0160474 | Ga0495580_0160474_490_1029 | 179 |
| 416 | 3300046473 | Ga0495582_0004780 | Ga0495582_0004780_3311_3850 | 179 |
| 417 | 3300046473 | Ga0495582_0302421 | Ga0495582_0302421_157_696 | 179 |
| 418 | 3300046475 | Ga0495639_0009573 | Ga0495639_0009573_2075_2614 | 179 |
| 419 | 3300046475 | Ga0495639_0148496 | Ga0495639_0148496_92_631 | 179 |
| 420 | 3300046476 | Ga0495662_0023228 | Ga0495662_0023228_994_1533 | 179 |
| 421 | 3300046477 | Ga0495664_0004041 | Ga0495664_0004041_6516_7055 | 179 |
| 422 | 3300046477 | Ga0495664_0051857 | Ga0495664_0051857_264_803 | 179 |
| 423 | 3300046499 | Ga0495594_0002236 | Ga0495594_0002236_3586_4125 | 179 |
| 424 | 3300046511 | Ga0495608_0111772 | Ga0495608_0111772_670_1209 | 179 |
| 425 | 3300046514 | Ga0495618_0019866 | Ga0495618_0019866_3586_4125 | 179 |
| 426 | 3300046514 | Ga0495618_0059831 | Ga0495618_0059831_396_935 | 179 |
| 427 | 3300046516 | Ga0495628_0063967 | Ga0495628_0063967_1129_1668 | 179 |
| 428 | 3300046516 | Ga0495628_0112366 | Ga0495628_0112366_751_1290 | 179 |
| 429 | 3300046517 | Ga0495630_0003672 | Ga0495630_0003672_2306_2845 | 179 |
| 430 | 3300046517 | Ga0495630_0068879 | Ga0495630_0068879_517_1056 | 179 |
| 431 | 3300046526 | Ga0495666_0007984 | Ga0495666_0007984_791_1330 | 179 |
| 432 | 3300046529 | Ga0495652_0170490 | Ga0495652_0170490_519_1058 | 179 |
| 433 | 3300046529 | Ga0495652_0279721 | Ga0495652_0279721_66_605 | 179 |
| 434 | 3300046531 | Ga0495665_0075756 | Ga0495665_0075756_460_999 | 179 |
| 435 | 3300046533 | Ga0495640_0013380 | Ga0495640_0013380_3011_3550 | 179 |
| 436 | 3300046533 | Ga0495640_0045154 | Ga0495640_0045154_1199_1738 | 179 |
| 437 | 3300046535 | Ga0495586_0005406 | Ga0495586_0005406_4201_4740 | 179 |
| 438 | 3300046536 | Ga0495587_0027547 | Ga0495587_0027547_519_1058 | 179 |
| 439 | 3300046559 | Ga0495667_0001513 | Ga0495667_0001513_2408_2947 | 179 |
| 440 | 3300046559 | Ga0495667_0054956 | Ga0495667_0054956_425_964 | 179 |
| 441 | 3300046559 | Ga0495667_0068058 | Ga0495667_0068058_1128_1667 | 179 |
| 442 | 3300046642 | Ga0495634_0001123 | Ga0495634_0001123_7503_8042 | 179 |
| 443 | 3300046663 | Ga0495635_0028641 | Ga0495635_0028641_2787_3326 | 179 |
| 444 | 3300046663 | Ga0495635_0041441 | Ga0495635_0041441_501_1040 | 179 |
| 445 | 3300046675 | Ga0495657_0017987 | Ga0495657_0017987_4505_5044 | 179 |
| 446 | 3300046679 | Ga0495623_0044936 | Ga0495623_0044936_1507_2046 | 179 |
| 447 | 3300046680 | Ga0495646_0052770 | Ga0495646_0052770_23_562 | 179 |
| 448 | 3300046683 | Ga0495658_0003330 | Ga0495658_0003330_74_613 | 179 |
| 449 | 3300046689 | Ga0495613_0073700 | Ga0495613_0073700_79_618 | 179 |
| 450 | 3300046689 | Ga0495613_0130705 | Ga0495613_0130705_16_555 | 179 |
| 451 | 3300046690 | Ga0495624_0190316 | Ga0495624_0190316_451_990 | 179 |
| 452 | 3300046809 | Ga0495600_0008219 | Ga0495600_0008219_4575_5114 | 179 |
| 453 | 3300046809 | Ga0495600_0064475 | Ga0495600_0064475_1587_2126 | 179 |
| 454 | 3300047315 | Ga0495581_0093525 | Ga0495581_0093525_798_1337 | 179 |
| 455 | 3300047317 | Ga0495604_0215319 | Ga0495604_0215319_707_1246 | 179 |
| 456 | 3300047319 | Ga0495674_0006511 | Ga0495674_0006511_1840_2379 | 179 |
| 457 | 3300047319 | Ga0495674_0057314 | Ga0495674_0057314_2257_2796 | 179 |
| 458 | 3300047321 | Ga0495676_0108551 | Ga0495676_0108551_1055_1594 | 179 |
| 459 | 3300047321 | Ga0495676_0127835 | Ga0495676_0127835_73_612 | 179 |
| 460 | 3300047322 | Ga0495680_0012216 | Ga0495680_0012216_3943_4482 | 179 |
| 461 | 3300047322 | Ga0495680_0013035 | Ga0495680_0013035_6398_6937 | 179 |
| 462 | 3300047322 | Ga0495680_0082584 | Ga0495680_0082584_309_848 | 179 |
| 463 | 3300047444 | Ga0495675_0017264 | Ga0495675_0017264_1245_1784 | 179 |
| 464 | 3300047471 | Ga0495684_0014936 | Ga0495684_0014936_1666_2205 | 179 |
| 465 | 3300047471 | Ga0495684_0246355 | Ga0495684_0246355_398_937 | 179 |
| 466 | 3300047471 | Ga0495684_0321795 | Ga0495684_0321795_146_685 | 179 |
| 467 | 3300048088 | Ga0495602_0080010 | Ga0495602_0080010_1932_2471 | 179 |
| 468 | 3300048914 | Ga0496111_0184697 | Ga0496111_0184697_409_963 | 179 |
| 469 | 3300049521 | Ga0501298_015704 | Ga0501298_015704_415_954 | 179 |
| 470 | 3300049576 | Ga0501040_0023723 | Ga0501040_0023723_2598_3137 | 179 |
| 471 | 3300049577 | Ga0501041_0022629 | Ga0501041_0022629_969_1508 | 179 |
| 472 | 3300049578 | Ga0501042_0111407 | Ga0501042_0111407_973_1512 | 179 |
| 473 | 3300049587 | Ga0501071_0342927 | Ga0501071_0342927_372_911 | 179 |
| 474 | 3300049593 | Ga0501077_0037660 | Ga0501077_0037660_782_1321 | 179 |
| 475 | 3300049652 | Ga0501202_001841 | Ga0501202_001841_2515_3054 | 179 |
| 476 | 3300049654 | Ga0501207_063034 | Ga0501207_063034_43_582 | 179 |
| 477 | 3300049656 | Ga0501209_069646 | Ga0501209_069646_449_988 | 179 |
| 478 | 3300049662 | Ga0501222_004291 | Ga0501222_004291_855_1394 | 179 |
| 479 | 3300049663 | Ga0501223_012279 | Ga0501223_012279_297_836 | 179 |
| 480 | 3300049664 | Ga0501224_032102 | Ga0501224_032102_177_716 | 179 |
| 481 | 3300049665 | Ga0501227_049108 | Ga0501227_049108_282_821 | 179 |
| 482 | 3300049668 | Ga0501233_015944 | Ga0501233_015944_407_946 | 179 |
| 483 | 3300049669 | Ga0501235_011426 | Ga0501235_011426_1020_1559 | 179 |
| 484 | 3300049674 | Ga0501242_020336 | Ga0501242_020336_152_691 | 179 |
| 485 | 3300049676 | Ga0501246_006229 | Ga0501246_006229_68_607 | 179 |
| 486 | 3300049678 | Ga0501248_011597 | Ga0501248_011597_191_730 | 179 |
| 487 | 3300049679 | Ga0501249_011337 | Ga0501249_011337_865_1404 | 179 |
| 488 | 3300049681 | Ga0501251_007216 | Ga0501251_007216_272_811 | 179 |
| 489 | 3300049685 | Ga0501256_016105 | Ga0501256_016105_165_704 | 179 |
| 490 | 3300049686 | Ga0501257_057909 | Ga0501257_057909_140_679 | 179 |
| 491 | 3300049688 | Ga0501259_004749 | Ga0501259_004749_1257_1796 | 179 |
| 492 | 3300049705 | Ga0501225_0003051 | Ga0501225_0003051_532_1071 | 179 |
| 493 | 3300049707 | Ga0501234_005497 | Ga0501234_005497_1006_1545 | 179 |
| 494 | 3300049741 | Ga0501079_0269060 | Ga0501079_0269060_628_1167 | 179 |
| 495 | 3300049760 | Ga0501263_003314 | Ga0501263_003314_438_977 | 179 |
| 496 | 3300049765 | Ga0501268_000392 | Ga0501268_000392_3228_3767 | 179 |
| 497 | 3300049766 | Ga0501269_027813 | Ga0501269_027813_163_702 | 179 |
| 498 | 3300049767 | Ga0501270_000461 | Ga0501270_000461_1086_1625 | 179 |
| 499 | 3300049771 | Ga0501274_008220 | Ga0501274_008220_381_920 | 179 |
| 500 | 3300049779 | Ga0501283_018119 | Ga0501283_018119_524_1063 | 179 |
| 501 | 3300049824 | Ga0501045_0778464 | Ga0501045_0778464_132_671 | 179 |
| 502 | 3300049853 | Ga0501226_018378 | Ga0501226_018378_179_718 | 179 |
| 503 | 3300050509 | nmdc:mga0qj67_333638_c1 | nmdc:mga0qj67_333638_c1_264_803 | 179 |
| 504 | 3300050514 | nmdc:mga08x19_9157_c1 | nmdc:mga08x19_9157_c1_1778_2317 | 179 |
| 505 | 3300053077 | Ga0495601_0347318 | Ga0495601_0347318_290_829 | 179 |
| 506 | 3300053078 | Ga0495612_0153909 | Ga0495612_0153909_177_716 | 179 |
| 507 | 3300053085 | Ga0495619_0238679 | Ga0495619_0238679_276_815 | 179 |
| 508 | 3300054114 | Ga0501084_0573462 | Ga0501084_0573462_227_766 | 179 |
| 509 | 3300059423 | Ga0590074_023625 | Ga0590074_023625_447_986 | 179 |
| 510 | 3300061734 | Ga0530510_0086201 | Ga0530510_0086201_299_838 | 179 |
| 511 | 3300000549 | LJQas_1012500 | LJQas_10125002 | 180 |
| 512 | 3300003578 | Ga0006562J51391_1003423 | Ga0006562J51391_100342316 | 180 |
| 513 | 3300004801 | Ga0058860_10114316 | Ga0058860_1011431612 | 180 |
| 514 | 3300005289 | Ga0065704_10086392 | Ga0065704_100863923 | 180 |
| 515 | 3300005289 | Ga0065704_10103057 | Ga0065704_101030575 | 180 |
| 516 | 3300005290 | Ga0065712_10113906 | Ga0065712_101139062 | 180 |
| 517 | 3300005293 | Ga0065715_10177959 | Ga0065715_101779592 | 180 |
| 518 | 3300005293 | Ga0065715_10581349 | Ga0065715_105813491 | 180 |
| 519 | 3300005327 | Ga0070658_10169704 | Ga0070658_101697042 | 180 |
| 520 | 3300005327 | Ga0070658_10357028 | Ga0070658_103570283 | 180 |
| 521 | 3300005328 | Ga0070676_10062712 | Ga0070676_100627125 | 180 |
| 522 | 3300005328 | Ga0070676_10621000 | Ga0070676_106210001 | 180 |
| 523 | 3300005328 | Ga0070676_11087944 | Ga0070676_110879441 | 180 |
| 524 | 3300005329 | Ga0070683_100298539 | Ga0070683_1002985393 | 180 |
| 525 | 3300005329 | Ga0070683_101267235 | Ga0070683_1012672351 | 180 |
| 526 | 3300005330 | Ga0070690_100589134 | Ga0070690_1005891341 | 180 |
| 527 | 3300005331 | Ga0070670_100468747 | Ga0070670_1004687471 | 180 |
| 528 | 3300005334 | Ga0068869_100271127 | Ga0068869_1002711272 | 180 |
| 529 | 3300005335 | Ga0070666_10463033 | Ga0070666_104630331 | 180 |
| 530 | 3300005335 | Ga0070666_10507550 | Ga0070666_105075502 | 180 |
| 531 | 3300005336 | Ga0070680_100064155 | Ga0070680_1000641556 | 180 |
| 532 | 3300005337 | Ga0070682_100016944 | Ga0070682_1000169442 | 180 |
| 533 | 3300005337 | Ga0070682_100126149 | Ga0070682_1001261493 | 180 |
| 534 | 3300005337 | Ga0070682_100686045 | Ga0070682_1006860452 | 180 |
| 535 | 3300005338 | Ga0068868_100344761 | Ga0068868_1003447611 | 180 |
| 536 | 3300005339 | Ga0070660_100334563 | Ga0070660_1003345632 | 180 |
| 537 | 3300005339 | Ga0070660_100384174 | Ga0070660_1003841742 | 180 |
| 538 | 3300005339 | Ga0070660_101030934 | Ga0070660_1010309341 | 180 |
| 539 | 3300005340 | Ga0070689_100053903 | Ga0070689_1000539032 | 180 |
| 540 | 3300005344 | Ga0070661_100579274 | Ga0070661_1005792741 | 180 |
| 541 | 3300005347 | Ga0070668_100658622 | Ga0070668_1006586221 | 180 |
| 542 | 3300005353 | Ga0070669_100125906 | Ga0070669_1001259063 | 180 |
| 543 | 3300005353 | Ga0070669_100132566 | Ga0070669_1001325662 | 180 |
| 544 | 3300005354 | Ga0070675_100070749 | Ga0070675_1000707492 | 180 |
| 545 | 3300005354 | Ga0070675_100148933 | Ga0070675_1001489334 | 180 |
| 546 | 3300005354 | Ga0070675_100289788 | Ga0070675_1002897882 | 180 |
| 547 | 3300005354 | Ga0070675_100361131 | Ga0070675_1003611312 | 180 |
| 548 | 3300005355 | Ga0070671_100190007 | Ga0070671_1001900072 | 180 |
| 549 | 3300005364 | Ga0070673_100160707 | Ga0070673_1001607073 | 180 |
| 550 | 3300005364 | Ga0070673_101564579 | Ga0070673_1015645791 | 180 |
| 551 | 3300005365 | Ga0070688_100005699 | Ga0070688_10000569910 | 180 |
| 552 | 3300005367 | Ga0070667_100170442 | Ga0070667_1001704424 | 180 |
| 553 | 3300005367 | Ga0070667_100215840 | Ga0070667_1002158401 | 180 |
| 554 | 3300005435 | Ga0070714_100166074 | Ga0070714_1001660743 | 180 |
| 555 | 3300005436 | Ga0070713_100072196 | Ga0070713_1000721965 | 180 |
| 556 | 3300005436 | Ga0070713_100715239 | Ga0070713_1007152391 | 180 |
| 557 | 3300005437 | Ga0070710_10193372 | Ga0070710_101933722 | 180 |
| 558 | 3300005438 | Ga0070701_10355167 | Ga0070701_103551672 | 180 |
| 559 | 3300005439 | Ga0070711_100481273 | Ga0070711_1004812732 | 180 |
| 560 | 3300005457 | Ga0070662_100427648 | Ga0070662_1004276483 | 180 |
| 561 | 3300005459 | Ga0068867_100063230 | Ga0068867_1000632304 | 180 |
| 562 | 3300005530 | Ga0070679_100455102 | Ga0070679_1004551022 | 180 |
| 563 | 3300005539 | Ga0068853_100736552 | Ga0068853_1007365521 | 180 |
| 564 | 3300005539 | Ga0068853_100836277 | Ga0068853_1008362772 | 180 |
| 565 | 3300005543 | Ga0070672_100015656 | Ga0070672_1000156562 | 180 |
| 566 | 3300005543 | Ga0070672_100175780 | Ga0070672_1001757804 | 180 |
| 567 | 3300005543 | Ga0070672_100199872 | Ga0070672_1001998724 | 180 |
| 568 | 3300005544 | Ga0070686_100142468 | Ga0070686_1001424681 | 180 |
| 569 | 3300005564 | Ga0070664_101220799 | Ga0070664_1012207992 | 180 |
| 570 | 3300005577 | Ga0068857_100309363 | Ga0068857_1003093633 | 180 |
| 571 | 3300005614 | Ga0068856_100282487 | Ga0068856_1002824872 | 180 |
| 572 | 3300005615 | Ga0070702_100130492 | Ga0070702_1001304924 | 180 |
| 573 | 3300005616 | Ga0068852_100448814 | Ga0068852_1004488143 | 180 |
| 574 | 3300005616 | Ga0068852_100474206 | Ga0068852_1004742061 | 180 |
| 575 | 3300005617 | Ga0068859_100037937 | Ga0068859_1000379378 | 180 |
| 576 | 3300005618 | Ga0068864_100323618 | Ga0068864_1003236182 | 180 |
| 577 | 3300005718 | Ga0068866_10043211 | Ga0068866_100432114 | 180 |
| 578 | 3300005841 | Ga0068863_100292329 | Ga0068863_1002923293 | 180 |
| 579 | 3300006058 | Ga0075432_10196707 | Ga0075432_101967072 | 180 |
| 580 | 3300006175 | Ga0070712_100195740 | Ga0070712_1001957402 | 180 |
| 581 | 3300006177 | Ga0075362_10019709 | Ga0075362_100197094 | 180 |
| 582 | 3300006237 | Ga0097621_100218088 | Ga0097621_1002180882 | 180 |
| 583 | 3300006358 | Ga0068871_100017988 | Ga0068871_1000179885 | 180 |
| 584 | 3300006358 | Ga0068871_100274363 | Ga0068871_1002743632 | 180 |
| 585 | 3300006880 | Ga0075429_100221343 | Ga0075429_1002213433 | 180 |
| 586 | 3300006881 | Ga0068865_100036788 | Ga0068865_1000367883 | 180 |
| 587 | 3300006931 | Ga0097620_100037934 | Ga0097620_1000379342 | 180 |
| 588 | 3300006942 | Ga0099824_1003374 | Ga0099824_100337411 | 180 |
| 589 | 3300006946 | Ga0079104_1060427 | Ga0079104_10604272 | 180 |
| 590 | 3300006948 | Ga0099826_10000125 | Ga0099826_1000012517 | 180 |
| 591 | 3300009036 | Ga0105244_10017933 | Ga0105244_1001793310 | 180 |
| 592 | 3300009036 | Ga0105244_10354646 | Ga0105244_103546461 | 180 |
| 593 | 3300009094 | Ga0111539_11573137 | Ga0111539_115731372 | 180 |
| 594 | 3300009098 | Ga0105245_10274777 | Ga0105245_102747772 | 180 |
| 595 | 3300009101 | Ga0105247_10060663 | Ga0105247_100606634 | 180 |
| 596 | 3300009176 | Ga0105242_10043231 | Ga0105242_100432317 | 180 |
| 597 | 3300009176 | Ga0105242_10066640 | Ga0105242_100666403 | 180 |
| 598 | 3300009177 | Ga0105248_10198497 | Ga0105248_101984972 | 180 |
| 599 | 3300013100 | Ga0157373_10420570 | Ga0157373_104205702 | 180 |
| 600 | 3300013102 | Ga0157371_10001678 | Ga0157371_1000167820 | 180 |
| 601 | 3300013102 | Ga0157371_10468294 | Ga0157371_104682941 | 180 |
| 602 | 3300013104 | Ga0157370_10402029 | Ga0157370_104020293 | 180 |
| 603 | 3300013104 | Ga0157370_10453181 | Ga0157370_104531812 | 180 |
| 604 | 3300013104 | Ga0157370_10509257 | Ga0157370_105092572 | 180 |
| 605 | 3300013104 | Ga0157370_10551623 | Ga0157370_105516232 | 180 |
| 606 | 3300013104 | Ga0157370_10739218 | Ga0157370_107392181 | 180 |
| 607 | 3300013105 | Ga0157369_10000613 | Ga0157369_1000061325 | 180 |
| 608 | 3300013105 | Ga0157369_10071232 | Ga0157369_100712322 | 180 |
| 609 | 3300013105 | Ga0157369_10787754 | Ga0157369_107877541 | 180 |
| 610 | 3300013297 | Ga0157378_10163750 | Ga0157378_101637503 | 180 |
| 611 | 3300013306 | Ga0163162_10022452 | Ga0163162_100224529 | 180 |
| 612 | 3300013306 | Ga0163162_10393923 | Ga0163162_103939233 | 180 |
| 613 | 3300013306 | Ga0163162_10469381 | Ga0163162_104693813 | 180 |
| 614 | 3300013308 | Ga0157375_10434170 | Ga0157375_104341702 | 180 |
| 615 | 3300013308 | Ga0157375_10564583 | Ga0157375_105645833 | 180 |
| 616 | 3300013308 | Ga0157375_10865563 | Ga0157375_108655632 | 180 |
| 617 | 3300014325 | Ga0163163_10139608 | Ga0163163_101396084 | 180 |
| 618 | 3300014326 | Ga0157380_10141735 | Ga0157380_101417353 | 180 |
| 619 | 3300014326 | Ga0157380_10153019 | Ga0157380_101530193 | 180 |
| 620 | 3300014745 | Ga0157377_10070039 | Ga0157377_100700392 | 180 |
| 621 | 3300014968 | Ga0157379_10465606 | Ga0157379_104656062 | 180 |
| 622 | 3300014969 | Ga0157376_10162799 | Ga0157376_101627993 | 180 |
| 623 | 3300017792 | Ga0163161_10000039 | Ga0163161_1000003920 | 180 |
| 624 | 3300017792 | Ga0163161_10085599 | Ga0163161_100855992 | 180 |
| 625 | 3300017792 | Ga0163161_10379068 | Ga0163161_103790682 | 180 |
| 626 | 3300017792 | Ga0163161_10504512 | Ga0163161_105045122 | 180 |
| 627 | 3300020070 | Ga0206356_11673591 | Ga0206356_116735913 | 180 |
| 628 | 3300020077 | Ga0206351_10597380 | Ga0206351_105973802 | 180 |
| 629 | 3300020081 | Ga0206354_11354915 | Ga0206354_113549153 | 180 |
| 630 | 3300025728 | Ga0207655_1000038 | Ga0207655_1000038193 | 180 |
| 631 | 3300025893 | Ga0207682_10029977 | Ga0207682_100299772 | 180 |
| 632 | 3300025893 | Ga0207682_10064402 | Ga0207682_100644022 | 180 |
| 633 | 3300025898 | Ga0207692_10063935 | Ga0207692_100639353 | 180 |
| 634 | 3300025899 | Ga0207642_10023001 | Ga0207642_100230015 | 180 |
| 635 | 3300025904 | Ga0207647_10060143 | Ga0207647_100601434 | 180 |
| 636 | 3300025907 | Ga0207645_10197099 | Ga0207645_101970992 | 180 |
| 637 | 3300025907 | Ga0207645_10636283 | Ga0207645_106362832 | 180 |
| 638 | 3300025909 | Ga0207705_10027457 | Ga0207705_100274576 | 180 |
| 639 | 3300025909 | Ga0207705_10287956 | Ga0207705_102879562 | 180 |
| 640 | 3300025916 | Ga0207663_10272547 | Ga0207663_102725472 | 180 |
| 641 | 3300025917 | Ga0207660_10155047 | Ga0207660_101550472 | 180 |
| 642 | 3300025919 | Ga0207657_10090942 | Ga0207657_100909425 | 180 |
| 643 | 3300025919 | Ga0207657_10141001 | Ga0207657_101410014 | 180 |
| 644 | 3300025920 | Ga0207649_10061543 | Ga0207649_100615433 | 180 |
| 645 | 3300025925 | Ga0207650_10010393 | Ga0207650_1001039313 | 180 |
| 646 | 3300025926 | Ga0207659_10024258 | Ga0207659_100242587 | 180 |
| 647 | 3300025926 | Ga0207659_10342424 | Ga0207659_103424242 | 180 |
| 648 | 3300025926 | Ga0207659_11180188 | Ga0207659_111801881 | 180 |
| 649 | 3300025927 | Ga0207687_10403595 | Ga0207687_104035952 | 180 |
| 650 | 3300025929 | Ga0207664_10068385 | Ga0207664_100683853 | 180 |
| 651 | 3300025931 | Ga0207644_10853110 | Ga0207644_108531102 | 180 |
| 652 | 3300025932 | Ga0207690_10421218 | Ga0207690_104212181 | 180 |
| 653 | 3300025934 | Ga0207686_10180303 | Ga0207686_101803033 | 180 |
| 654 | 3300025935 | Ga0207709_10134731 | Ga0207709_101347313 | 180 |
| 655 | 3300025936 | Ga0207670_10180630 | Ga0207670_101806302 | 180 |
| 656 | 3300025940 | Ga0207691_10037594 | Ga0207691_100375946 | 180 |
| 657 | 3300025941 | Ga0207711_11074903 | Ga0207711_110749032 | 180 |
| 658 | 3300025942 | Ga0207689_10258512 | Ga0207689_102585122 | 180 |
| 659 | 3300025944 | Ga0207661_10021263 | Ga0207661_100212634 | 180 |
| 660 | 3300025944 | Ga0207661_10566291 | Ga0207661_105662912 | 180 |
| 661 | 3300025945 | Ga0207679_10548217 | Ga0207679_105482173 | 180 |
| 662 | 3300025949 | Ga0207667_10183304 | Ga0207667_101833044 | 180 |
| 663 | 3300025960 | Ga0207651_10019970 | Ga0207651_100199703 | 180 |
| 664 | 3300025972 | Ga0207668_10124203 | Ga0207668_101242034 | 180 |
| 665 | 3300025972 | Ga0207668_10685879 | Ga0207668_106858791 | 180 |
| 666 | 3300025981 | Ga0207640_10137420 | Ga0207640_101374201 | 180 |
| 667 | 3300025986 | Ga0207658_10077846 | Ga0207658_100778461 | 180 |
| 668 | 3300025986 | Ga0207658_10454404 | Ga0207658_104544042 | 180 |
| 669 | 3300025986 | Ga0207658_10941263 | Ga0207658_109412632 | 180 |
| 670 | 3300026023 | Ga0207677_10439386 | Ga0207677_104393862 | 180 |
| 671 | 3300026023 | Ga0207677_11133257 | Ga0207677_111332571 | 180 |
| 672 | 3300026041 | Ga0207639_10086818 | Ga0207639_100868183 | 180 |
| 673 | 3300026067 | Ga0207678_10102818 | Ga0207678_101028183 | 180 |
| 674 | 3300026075 | Ga0207708_10061743 | Ga0207708_100617434 | 180 |
| 675 | 3300026078 | Ga0207702_10828111 | Ga0207702_108281111 | 180 |
| 676 | 3300026089 | Ga0207648_10076452 | Ga0207648_100764526 | 180 |
| 677 | 3300026089 | Ga0207648_10437276 | Ga0207648_104372763 | 180 |
| 678 | 3300026116 | Ga0207674_10102267 | Ga0207674_101022674 | 180 |
| 679 | 3300026116 | Ga0207674_10405111 | Ga0207674_104051112 | 180 |
| 680 | 3300026118 | Ga0207675_101218918 | Ga0207675_1012189181 | 180 |
| 681 | 3300026121 | Ga0207683_10225777 | Ga0207683_102257772 | 180 |
| 682 | 3300026121 | Ga0207683_10943649 | Ga0207683_109436492 | 180 |
| 683 | 3300026142 | Ga0207698_10689462 | Ga0207698_106894622 | 180 |
| 684 | 3300027111 | Ga0209281_1050393 | Ga0209281_10503931 | 180 |
| 685 | 3300027361 | Ga0209489_111364 | Ga0209489_11136410 | 180 |
| 686 | 3300027424 | Ga0209984_1016798 | Ga0209984_10167982 | 180 |
| 687 | 3300027526 | Ga0209968_1000671 | Ga0209968_10006716 | 180 |
| 688 | 3300027617 | Ga0210002_1001591 | Ga0210002_10015912 | 180 |
| 689 | 3300027907 | Ga0207428_10241738 | Ga0207428_102417382 | 180 |
| 690 | 3300028381 | Ga0268264_10355798 | Ga0268264_103557982 | 180 |
| 691 | 3300028794 | Ga0307515_10409858 | Ga0307515_104098582 | 180 |
| 692 | 3300030734 | Ga0316179_1109740 | Ga0316179_11097406 | 180 |
| 693 | 3300030744 | Ga0316181_1180820 | Ga0316181_11808202 | 180 |
| 694 | 3300031456 | Ga0307513_10358454 | Ga0307513_103584542 | 180 |
| 695 | 3300031548 | Ga0307408_100056125 | Ga0307408_1000561254 | 180 |
| 696 | 3300031548 | Ga0307408_100478862 | Ga0307408_1004788622 | 180 |
| 697 | 3300031728 | Ga0316578_10025018 | Ga0316578_100250186 | 180 |
| 698 | 3300031731 | Ga0307405_10000005 | Ga0307405_10000005213 | 180 |
| 699 | 3300031824 | Ga0307413_10001307 | Ga0307413_1000130710 | 180 |
| 700 | 3300031824 | Ga0307413_10353719 | Ga0307413_103537192 | 180 |
| 701 | 3300031852 | Ga0307410_10000034 | Ga0307410_1000003422 | 180 |
| 702 | 3300031901 | Ga0307406_10000004 | Ga0307406_10000004122 | 180 |
| 703 | 3300031901 | Ga0307406_10651741 | Ga0307406_106517412 | 180 |
| 704 | 3300031903 | Ga0307407_10000196 | Ga0307407_1000019614 | 180 |
| 705 | 3300031903 | Ga0307407_10014444 | Ga0307407_100144444 | 180 |
| 706 | 3300031911 | Ga0307412_10061465 | Ga0307412_100614653 | 180 |
| 707 | 3300031911 | Ga0307412_10610000 | Ga0307412_106100002 | 180 |
| 708 | 3300032002 | Ga0307416_100010892 | Ga0307416_10001089210 | 180 |
| 709 | 3300032004 | Ga0307414_10000011 | Ga0307414_10000011334 | 180 |
| 710 | 3300032004 | Ga0307414_10000527 | Ga0307414_100005272 | 180 |
| 711 | 3300032004 | Ga0307414_10011571 | Ga0307414_1001157110 | 180 |
| 712 | 3300032004 | Ga0307414_10024140 | Ga0307414_100241405 | 180 |
| 713 | 3300032004 | Ga0307414_10735107 | Ga0307414_107351071 | 180 |
| 714 | 3300032005 | Ga0307411_10000004 | Ga0307411_1000000415 | 180 |
| 715 | 3300032005 | Ga0307411_10126234 | Ga0307411_101262344 | 180 |
| 716 | 3300032126 | Ga0307415_100931172 | Ga0307415_1009311722 | 180 |
| 717 | 3300033180 | Ga0307510_10035700 | Ga0307510_100357007 | 180 |
| 718 | 3300033541 | Ga0316596_1000052 | Ga0316596_100005216 | 180 |
| 719 | 3300035398 | Ga0316574_0007562 | Ga0316574_0007562_299_841 | 180 |
| 720 | 3300035398 | Ga0316574_0045952 | Ga0316574_0045952_1709_2251 | 180 |
| 721 | 3300036401 | Ga0373937_0076521 | Ga0373937_0076521_2501_3043 | 180 |
| 722 | 3300036712 | Ga0316584_0020615 | Ga0316584_0020615_1671_2213 | 180 |
| 723 | 3300036712 | Ga0316584_0065628 | Ga0316584_0065628_815_1357 | 180 |
| 724 | 3300041407 | Ga0439447_000447 | Ga0439447_000447_941_1483 | 180 |
| 725 | 3300041411 | Ga0439466_0004165 | Ga0439466_0004165_4675_5217 | 180 |
| 726 | 3300041451 | Ga0451791_1675939 | Ga0451791_1675939_2064_2606 | 180 |
| 727 | 3300041494 | Ga0451837_1056715 | Ga0451837_1056715_2342_2884 | 180 |
| 728 | 3300041498 | Ga0451841_0588885 | Ga0451841_0588885_326_868 | 180 |
| 729 | 3300041509 | Ga0451843_1326072 | Ga0451843_1326072_313_855 | 180 |
| 730 | 3300044673 | Ga0453683_0318980 | Ga0453683_0318980_87_629 | 180 |
| 731 | 3300046501 | Ga0495607_0014863 | Ga0495607_0014863_3189_3731 | 180 |
| 732 | 3300046507 | Ga0495606_0208853 | Ga0495606_0208853_260_802 | 180 |
| 733 | 3300046507 | Ga0495606_0265398 | Ga0495606_0265398_19_561 | 180 |
| 734 | 3300046515 | Ga0495620_0309598 | Ga0495620_0309598_48_590 | 180 |
| 735 | 3300046525 | Ga0495663_0016116 | Ga0495663_0016116_844_1386 | 180 |
| 736 | 3300046528 | Ga0495642_0069999 | Ga0495642_0069999_507_1049 | 180 |
| 737 | 3300046530 | Ga0495654_0031697 | Ga0495654_0031697_987_1529 | 180 |
| 738 | 3300046539 | Ga0495621_0013304 | Ga0495621_0013304_842_1384 | 180 |
| 739 | 3300046558 | Ga0495633_0236041 | Ga0495633_0236041_130_672 | 180 |
| 740 | 3300046615 | Ga0495656_0516114 | Ga0495656_0516114_17_559 | 180 |
| 741 | 3300046660 | Ga0495625_0089987 | Ga0495625_0089987_586_1128 | 180 |
| 742 | 3300047447 | Ga0495685_117616 | Ga0495685_117616_319_861 | 180 |
| 743 | 3300048090 | Ga0495615_0037513 | Ga0495615_0037513_131_673 | 180 |
| 744 | 3300048903 | Ga0496100_0049531 | Ga0496100_0049531_2145_2687 | 180 |
| 745 | 3300048904 | Ga0496101_0108575 | Ga0496101_0108575_861_1403 | 180 |
| 746 | 3300048905 | Ga0496102_1047154 | Ga0496102_1047154_86_628 | 180 |
| 747 | 3300048907 | Ga0496104_0204889 | Ga0496104_0204889_887_1429 | 180 |
| 748 | 3300048908 | Ga0496105_0140004 | Ga0496105_0140004_1387_1929 | 180 |
| 749 | 3300048911 | Ga0496108_0098307 | Ga0496108_0098307_1444_1986 | 180 |
| 750 | 3300048912 | Ga0496109_0230464 | Ga0496109_0230464_317_859 | 180 |
| 751 | 3300048915 | Ga0496112_0560136 | Ga0496112_0560136_39_581 | 180 |
| 752 | 3300048916 | Ga0496113_0078240 | Ga0496113_0078240_1638_2180 | 180 |
| 753 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_99224_99766 | 180 |
| 754 | 3300048924 | Ga0496121_0062508 | Ga0496121_0062508_1741_2283 | 180 |
| 755 | 3300048927 | Ga0496124_0035036 | Ga0496124_0035036_1770_2312 | 180 |
| 756 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_380428_380970 | 180 |
| 757 | 3300049130 | Ga0501310_000149 | Ga0501310_000149_66_608 | 180 |
| 758 | 3300049131 | Ga0501341_00421 | Ga0501341_00421_1213_1755 | 180 |
| 759 | 3300049530 | Ga0501314_000001 | Ga0501314_000001_6882_7424 | 180 |
| 760 | 3300049536 | Ga0501320_002561 | Ga0501320_002561_863_1405 | 180 |
| 761 | 3300049536 | Ga0501320_002568 | Ga0501320_002568_862_1404 | 180 |
| 762 | 3300049537 | Ga0501321_036530 | Ga0501321_036530_40_582 | 180 |
| 763 | 3300049539 | Ga0501323_000002 | Ga0501323_000002_6791_7333 | 180 |
| 764 | 3300049539 | Ga0501323_001249 | Ga0501323_001249_1205_1747 | 180 |
| 765 | 3300049540 | Ga0501324_000002 | Ga0501324_000002_7023_7565 | 180 |
| 766 | 3300049542 | Ga0501326_00020 | Ga0501326_00020_4800_5342 | 180 |
| 767 | 3300049551 | Ga0501335_006458 | Ga0501335_006458_171_713 | 180 |
| 768 | 3300049572 | Ga0501036_0044298 | Ga0501036_0044298_56_598 | 180 |
| 769 | 3300049671 | Ga0501238_000015 | Ga0501238_000015_4702_5244 | 180 |
| 770 | 3300049679 | Ga0501249_062867 | Ga0501249_062867_192_734 | 180 |
| 771 | 3300049758 | Ga0501241_002523 | Ga0501241_002523_2772_3314 | 180 |
| 772 | 3300049760 | Ga0501263_036753 | Ga0501263_036753_70_612 | 180 |
| 773 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_342264_342806 | 180 |
| 774 | 3300049776 | Ga0501280_000239 | Ga0501280_000239_6223_6765 | 180 |
| 775 | 3300053088 | Ga0500644_0299116 | Ga0500644_0299116_61_603 | 180 |
| 776 | 3300053090 | Ga0500646_0021012 | Ga0500646_0021012_275_817 | 180 |
| 777 | 3300053093 | Ga0500651_0309979 | Ga0500651_0309979_283_825 | 180 |
| 778 | 3300053096 | Ga0500641_0000168 | Ga0500641_0000168_2174_2716 | 180 |
| 779 | 3300053096 | Ga0500641_0006404 | Ga0500641_0006404_2714_3256 | 180 |
| 780 | 3300053118 | Ga0500594_0010092 | Ga0500594_0010092_227_769 | 180 |
| 781 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_197888_198430 | 180 |
| 782 | 3300053136 | Ga0500559_0017721 | Ga0500559_0017721_475_1017 | 180 |
| 783 | iso_pu_bacteria | 2585427687 | 2586210032 | 180 |
| 784 | iso_pu_bacteria | 2738541278 | 2738726214 | 180 |
| 785 | iso_pu_bacteria | 2738541283 | 2738755674 | 180 |
| 786 | iso_pu_bacteria | 2739367651 | 2739587956 | 180 |
| 787 | iso_pu_bacteria | 2739367656 | 2739614393 | 180 |
| 788 | iso_pu_bacteria | 2739367663 | 2739646675 | 180 |
| 789 | iso_pu_bacteria | 2818991442 | 2819573345 | 180 |
| 790 | iso_pu_bacteria | 2818991460 | 2819681057 | 180 |
| 791 | iso_pu_bacteria | 2839989709 | 2839990112 | 180 |
| 792 | iso_pu_bacteria | 2842722452 | 2842724275 | 180 |
| 793 | iso_pu_bacteria | 2842909656 | 2842913591 | 180 |
| 794 | iso_pu_bacteria | 2883068021 | 2883072454 | 180 |
| 795 | iso_pu_bacteria | 2884791551 | 2884795832 | 180 |
| 796 | iso_pu_bacteria | 2896109856 | 2896112690 | 180 |
| 797 | iso_pu_bacteria | 2914759650 | 2914763476 | 180 |
| 798 | iso_pu_bacteria | 2929154850 | 2929155023 | 180 |
| 799 | iso_pu_bacteria | 2929177148 | 2929178603 | 180 |
| 800 | iso_pu_bacteria | 2929239360 | 2929240980 | 180 |
| 801 | iso_pu_bacteria | 2929921140 | 2929923004 | 180 |
| 802 | iso_pu_bacteria | 2945977869 | 2945981011 | 180 |
| 803 | iso_pu_bacteria | 2945997725 | 2945998902 | 180 |
| 804 | iso_pu_bacteria | 2946013367 | 2946019586 | 180 |
| 805 | iso_pu_bacteria | 2954016120 | 2954021345 | 180 |
| 806 | iso_pu_bacteria | 8003151029 | 8003152338 | 180 |
| 807 | 3300027526 | Ga0209968_1012248 | Ga0209968_10122482 | 182 |
| 808 | 3300027876 | Ga0209974_10206493 | Ga0209974_102064931 | 182 |
| 809 | 3300031548 | Ga0307408_100060065 | Ga0307408_1000600656 | 182 |
| 810 | 3300041443 | Ga0451789_0687116 | Ga0451789_0687116_206_754 | 182 |
| 811 | 3300041444 | Ga0451790_22988 | Ga0451790_22988_254_802 | 182 |
| 812 | 3300044672 | Ga0466982_0127768 | Ga0466982_0127768_657_1208 | 182 |
| 813 | 3300049129 | Ga0501309_000005 | Ga0501309_000005_3547_4098 | 182 |
| 814 | 3300049161 | Ga0501305_001515 | Ga0501305_001515_207_758 | 182 |
| 815 | 3300049161 | Ga0501305_037209 | Ga0501305_037209_86_640 | 182 |
| 816 | 3300049528 | Ga0501312_000702 | Ga0501312_000702_2080_2631 | 182 |
| 817 | 3300049528 | Ga0501312_017506 | Ga0501312_017506_461_1012 | 182 |
| 818 | 3300049531 | Ga0501315_005172 | Ga0501315_005172_430_981 | 182 |
| 819 | 3300049532 | Ga0501316_000418 | Ga0501316_000418_206_757 | 182 |
| 820 | 3300049539 | Ga0501323_001617 | Ga0501323_001617_994_1545 | 182 |
| 821 | 3300049670 | Ga0501236_002270 | Ga0501236_002270_1046_1597 | 182 |
| 822 | 3300049686 | Ga0501257_005052 | Ga0501257_005052_487_1038 | 182 |
| 823 | 3300049761 | Ga0501264_000971 | Ga0501264_000971_1835_2386 | 182 |
| 824 | 3300053158 | Ga0500627_0075223 | Ga0500627_0075223_290_841 | 182 |
| 825 | 3300031727 | Ga0316576_10598958 | Ga0316576_105989581 | 183 |
| 826 | 3300032168 | Ga0316593_10001741 | Ga0316593_100017416 | 183 |
| 827 | 3300033524 | Ga0316592_1000022 | Ga0316592_10000225 | 183 |
| 828 | 3300033524 | Ga0316592_1000131 | Ga0316592_10001312 | 183 |
| 829 | 3300033527 | Ga0316586_1001816 | Ga0316586_10018164 | 183 |
| 830 | 3300033528 | Ga0316588_1002172 | Ga0316588_10021723 | 183 |
| 831 | 3300033541 | Ga0316596_1005444 | Ga0316596_10054446 | 183 |
| 832 | 3300033541 | Ga0316596_1036039 | Ga0316596_10360393 | 183 |
| 833 | 3300041441 | Ga0451787_419093 | Ga0451787_419093_909_1478 | 183 |
| 834 | 3300041456 | Ga0451795_0165098 | Ga0451795_0165098_40_594 | 183 |
| 835 | 3300041456 | Ga0451795_0802875 | Ga0451795_0802875_206_775 | 183 |
| 836 | 3300041456 | Ga0451795_1231582 | Ga0451795_1231582_18_572 | 183 |
| 837 | 3300041456 | Ga0451795_1330461 | Ga0451795_1330461_168_737 | 183 |
| 838 | 3300041494 | Ga0451837_0716352 | Ga0451837_0716352_919_1488 | 183 |
| 839 | 3300041508 | Ga0451852_13332 | Ga0451852_13332_7200_7754 | 183 |
| 840 | 3300045051 | Ga0451576_0559542 | Ga0451576_0559542_199_753 | 183 |
| 841 | 2162886007 | SwRhRL2b_contig_1663050 | SwRhRL2b_0644.00008490 | 184 |
| 842 | 3300001979 | JGI24740J21852_10000106 | JGI24740J21852_1000010623 | 184 |
| 843 | 3300001989 | JGI24739J22299_10002345 | JGI24739J22299_100023456 | 184 |
| 844 | 3300001989 | JGI24739J22299_10036599 | JGI24739J22299_100365993 | 184 |
| 845 | 3300002738 | JGI25154J39366_1000001 | JGI25154J39366_1000001294 | 184 |
| 846 | 3300002741 | JGI25157J39369_1005374 | JGI25157J39369_10053744 | 184 |
| 847 | 3300002773 | JGI25152J39213_1000006 | JGI25152J39213_100000630 | 184 |
| 848 | 3300002774 | JGI25150J39212_1000005 | JGI25150J39212_1000005203 | 184 |
| 849 | 3300002987 | JGI25159J45721_1008657 | JGI25159J45721_10086573 | 184 |
| 850 | 3300003187 | JGI25151J46595_10000004 | JGI25151J46595_10000004371 | 184 |
| 851 | 3300003215 | JGI25153J46596_10000004 | JGI25153J46596_10000004371 | 184 |
| 852 | 3300003215 | JGI25153J46596_10002304 | JGI25153J46596_100023047 | 184 |
| 853 | 3300003215 | JGI25153J46596_10009633 | JGI25153J46596_100096332 | 184 |
| 854 | 3300003215 | JGI25153J46596_10081054 | JGI25153J46596_100810542 | 184 |
| 855 | 3300003320 | rootH2_10052858 | rootH2_100528582 | 184 |
| 856 | 3300003320 | rootH2_10069215 | rootH2_100692159 | 184 |
| 857 | 3300003320 | rootH2_10116651 | rootH2_101166514 | 184 |
| 858 | 3300003322 | rootL2_10084253 | rootL2_100842531 | 184 |
| 859 | 3300003323 | rootH1_10008389 | rootH1_1000838918 | 184 |
| 860 | 3300003323 | rootH1_10024399 | rootH1_1002439913 | 184 |
| 861 | 3300003323 | rootH1_10137015 | rootH1_101370152 | 184 |
| 862 | 3300003354 | JGI25160J50197_1002424 | JGI25160J50197_100242410 | 184 |
| 863 | 3300003354 | JGI25160J50197_1004776 | JGI25160J50197_10047769 | 184 |
| 864 | 3300003354 | JGI25160J50197_1032347 | JGI25160J50197_10323472 | 184 |
| 865 | 3300003354 | JGI25160J50197_1051232 | JGI25160J50197_10512322 | 184 |
| 866 | 3300003761 | Ga0055535_1006118 | Ga0055535_10061184 | 184 |
| 867 | 3300003762 | Ga0055542_1017834 | Ga0055542_10178341 | 184 |
| 868 | 3300003771 | Ga0055526_1004445 | Ga0055526_10044452 | 184 |
| 869 | 3300003790 | Ga0055528_1000330 | Ga0055528_100033023 | 184 |
| 870 | 3300003791 | Ga0055530_10000331 | Ga0055530_1000033121 | 184 |
| 871 | 3300003794 | Ga0055531_10000133 | Ga0055531_1000013324 | 184 |
| 872 | 3300003794 | Ga0055531_10000166 | Ga0055531_1000016617 | 184 |
| 873 | 3300003794 | Ga0055531_10008711 | Ga0055531_100087116 | 184 |
| 874 | 3300005262 | Ga0065165_1000105 | Ga0065165_100010577 | 184 |
| 875 | 3300005262 | Ga0065165_1007036 | Ga0065165_10070366 | 184 |
| 876 | 3300005288 | Ga0065714_10023783 | Ga0065714_100237831 | 184 |
| 877 | 3300005288 | Ga0065714_10156834 | Ga0065714_101568341 | 184 |
| 878 | 3300005290 | Ga0065712_10008525 | Ga0065712_100085252 | 184 |
| 879 | 3300005295 | Ga0065707_10097311 | Ga0065707_100973116 | 184 |
| 880 | 3300005327 | Ga0070658_10009019 | Ga0070658_1000901910 | 184 |
| 881 | 3300005327 | Ga0070658_10306771 | Ga0070658_103067713 | 184 |
| 882 | 3300005327 | Ga0070658_10343531 | Ga0070658_103435312 | 184 |
| 883 | 3300005327 | Ga0070658_10530426 | Ga0070658_105304261 | 184 |
| 884 | 3300005327 | Ga0070658_10562857 | Ga0070658_105628572 | 184 |
| 885 | 3300005328 | Ga0070676_10004653 | Ga0070676_1000465313 | 184 |
| 886 | 3300005328 | Ga0070676_10024284 | Ga0070676_100242842 | 184 |
| 887 | 3300005328 | Ga0070676_10313604 | Ga0070676_103136042 | 184 |
| 888 | 3300005330 | Ga0070690_100233403 | Ga0070690_1002334032 | 184 |
| 889 | 3300005331 | Ga0070670_100060731 | Ga0070670_1000607315 | 184 |
| 890 | 3300005333 | Ga0070677_10001593 | Ga0070677_100015937 | 184 |
| 891 | 3300005333 | Ga0070677_10046785 | Ga0070677_100467852 | 184 |
| 892 | 3300005333 | Ga0070677_10252608 | Ga0070677_102526081 | 184 |
| 893 | 3300005334 | Ga0068869_100051776 | Ga0068869_1000517764 | 184 |
| 894 | 3300005334 | Ga0068869_100442893 | Ga0068869_1004428931 | 184 |
| 895 | 3300005335 | Ga0070666_10000191 | Ga0070666_1000019144 | 184 |
| 896 | 3300005335 | Ga0070666_10217369 | Ga0070666_102173692 | 184 |
| 897 | 3300005336 | Ga0070680_100088507 | Ga0070680_1000885074 | 184 |
| 898 | 3300005337 | Ga0070682_100373008 | Ga0070682_1003730082 | 184 |
| 899 | 3300005338 | Ga0068868_100004630 | Ga0068868_10000463010 | 184 |
| 900 | 3300005338 | Ga0068868_100013181 | Ga0068868_1000131816 | 184 |
| 901 | 3300005339 | Ga0070660_100401734 | Ga0070660_1004017341 | 184 |
| 902 | 3300005339 | Ga0070660_100926298 | Ga0070660_1009262981 | 184 |
| 903 | 3300005340 | Ga0070689_101177376 | Ga0070689_1011773761 | 184 |
| 904 | 3300005341 | Ga0070691_10005091 | Ga0070691_100050912 | 184 |
| 905 | 3300005341 | Ga0070691_10077262 | Ga0070691_100772623 | 184 |
| 906 | 3300005343 | Ga0070687_100019156 | Ga0070687_1000191562 | 184 |
| 907 | 3300005344 | Ga0070661_100020833 | Ga0070661_1000208337 | 184 |
| 908 | 3300005347 | Ga0070668_100004151 | Ga0070668_1000041519 | 184 |
| 909 | 3300005347 | Ga0070668_100038069 | Ga0070668_1000380695 | 184 |
| 910 | 3300005353 | Ga0070669_100008677 | Ga0070669_10000867710 | 184 |
| 911 | 3300005353 | Ga0070669_100546586 | Ga0070669_1005465862 | 184 |
| 912 | 3300005354 | Ga0070675_100022693 | Ga0070675_1000226935 | 184 |
| 913 | 3300005354 | Ga0070675_100149729 | Ga0070675_1001497292 | 184 |
| 914 | 3300005354 | Ga0070675_100254829 | Ga0070675_1002548292 | 184 |
| 915 | 3300005354 | Ga0070675_100266704 | Ga0070675_1002667041 | 184 |
| 916 | 3300005355 | Ga0070671_100036529 | Ga0070671_1000365299 | 184 |
| 917 | 3300005356 | Ga0070674_100002220 | Ga0070674_10000222011 | 184 |
| 918 | 3300005356 | Ga0070674_100087796 | Ga0070674_1000877962 | 184 |
| 919 | 3300005364 | Ga0070673_100006656 | Ga0070673_1000066568 | 184 |
| 920 | 3300005364 | Ga0070673_100011200 | Ga0070673_1000112006 | 184 |
| 921 | 3300005364 | Ga0070673_100055828 | Ga0070673_1000558284 | 184 |
| 922 | 3300005364 | Ga0070673_100679499 | Ga0070673_1006794992 | 184 |
| 923 | 3300005365 | Ga0070688_100037058 | Ga0070688_1000370581 | 184 |
| 924 | 3300005365 | Ga0070688_100416885 | Ga0070688_1004168851 | 184 |
| 925 | 3300005366 | Ga0070659_100426578 | Ga0070659_1004265782 | 184 |
| 926 | 3300005367 | Ga0070667_100000248 | Ga0070667_1000002489 | 184 |
| 927 | 3300005367 | Ga0070667_100074036 | Ga0070667_1000740361 | 184 |
| 928 | 3300005367 | Ga0070667_100230033 | Ga0070667_1002300334 | 184 |
| 929 | 3300005438 | Ga0070701_10022246 | Ga0070701_100222462 | 184 |
| 930 | 3300005455 | Ga0070663_100521323 | Ga0070663_1005213231 | 184 |
| 931 | 3300005456 | Ga0070678_100003711 | Ga0070678_1000037117 | 184 |
| 932 | 3300005456 | Ga0070678_100064863 | Ga0070678_1000648633 | 184 |
| 933 | 3300005456 | Ga0070678_100277908 | Ga0070678_1002779082 | 184 |
| 934 | 3300005457 | Ga0070662_100007728 | Ga0070662_1000077288 | 184 |
| 935 | 3300005457 | Ga0070662_100066199 | Ga0070662_1000661995 | 184 |
| 936 | 3300005457 | Ga0070662_100485217 | Ga0070662_1004852172 | 184 |
| 937 | 3300005457 | Ga0070662_100734367 | Ga0070662_1007343671 | 184 |
| 938 | 3300005459 | Ga0068867_100078755 | Ga0068867_1000787551 | 184 |
| 939 | 3300005459 | Ga0068867_100123545 | Ga0068867_1001235453 | 184 |
| 940 | 3300005459 | Ga0068867_100187653 | Ga0068867_1001876532 | 184 |
| 941 | 3300005466 | Ga0070685_10520902 | Ga0070685_105209021 | 184 |
| 942 | 3300005471 | Ga0070698_100002802 | Ga0070698_10000280212 | 184 |
| 943 | 3300005518 | Ga0070699_100230854 | Ga0070699_1002308541 | 184 |
| 944 | 3300005530 | Ga0070679_100002167 | Ga0070679_10000216719 | 184 |
| 945 | 3300005530 | Ga0070679_100122192 | Ga0070679_1001221925 | 184 |
| 946 | 3300005535 | Ga0070684_100021469 | Ga0070684_1000214697 | 184 |
| 947 | 3300005539 | Ga0068853_100000250 | Ga0068853_10000025013 | 184 |
| 948 | 3300005539 | Ga0068853_100006139 | Ga0068853_1000061392 | 184 |
| 949 | 3300005539 | Ga0068853_100143789 | Ga0068853_1001437893 | 184 |
| 950 | 3300005539 | Ga0068853_100642229 | Ga0068853_1006422291 | 184 |
| 951 | 3300005543 | Ga0070672_100001565 | Ga0070672_10000156511 | 184 |
| 952 | 3300005543 | Ga0070672_100038692 | Ga0070672_1000386921 | 184 |
| 953 | 3300005543 | Ga0070672_100045260 | Ga0070672_1000452601 | 184 |
| 954 | 3300005544 | Ga0070686_100042966 | Ga0070686_1000429664 | 184 |
| 955 | 3300005548 | Ga0070665_100000641 | Ga0070665_10000064153 | 184 |
| 956 | 3300005548 | Ga0070665_100018617 | Ga0070665_1000186175 | 184 |
| 957 | 3300005548 | Ga0070665_100027047 | Ga0070665_10002704712 | 184 |
| 958 | 3300005563 | Ga0068855_100000133 | Ga0068855_10000013318 | 184 |
| 959 | 3300005563 | Ga0068855_100003486 | Ga0068855_1000034865 | 184 |
| 960 | 3300005563 | Ga0068855_100060509 | Ga0068855_1000605095 | 184 |
| 961 | 3300005563 | Ga0068855_100205594 | Ga0068855_1002055944 | 184 |
| 962 | 3300005563 | Ga0068855_100235336 | Ga0068855_1002353362 | 184 |
| 963 | 3300005563 | Ga0068855_100578001 | Ga0068855_1005780012 | 184 |
| 964 | 3300005564 | Ga0070664_100009616 | Ga0070664_10000961613 | 184 |
| 965 | 3300005564 | Ga0070664_100020536 | Ga0070664_10002053610 | 184 |
| 966 | 3300005564 | Ga0070664_100387209 | Ga0070664_1003872091 | 184 |
| 967 | 3300005564 | Ga0070664_100436905 | Ga0070664_1004369052 | 184 |
| 968 | 3300005577 | Ga0068857_100024735 | Ga0068857_1000247354 | 184 |
| 969 | 3300005577 | Ga0068857_100085235 | Ga0068857_1000852354 | 184 |
| 970 | 3300005577 | Ga0068857_100100573 | Ga0068857_1001005735 | 184 |
| 971 | 3300005577 | Ga0068857_100268992 | Ga0068857_1002689923 | 184 |
| 972 | 3300005577 | Ga0068857_100315809 | Ga0068857_1003158093 | 184 |
| 973 | 3300005577 | Ga0068857_100343991 | Ga0068857_1003439911 | 184 |
| 974 | 3300005577 | Ga0068857_100596109 | Ga0068857_1005961092 | 184 |
| 975 | 3300005578 | Ga0068854_100021100 | Ga0068854_1000211003 | 184 |
| 976 | 3300005578 | Ga0068854_100590613 | Ga0068854_1005906132 | 184 |
| 977 | 3300005578 | Ga0068854_100749247 | Ga0068854_1007492471 | 184 |
| 978 | 3300005614 | Ga0068856_100102289 | Ga0068856_1001022895 | 184 |
| 979 | 3300005614 | Ga0068856_100154352 | Ga0068856_1001543522 | 184 |
| 980 | 3300005615 | Ga0070702_100058590 | Ga0070702_1000585903 | 184 |
| 981 | 3300005616 | Ga0068852_100081986 | Ga0068852_1000819865 | 184 |
| 982 | 3300005616 | Ga0068852_100569972 | Ga0068852_1005699722 | 184 |
| 983 | 3300005617 | Ga0068859_100173657 | Ga0068859_1001736573 | 184 |
| 984 | 3300005617 | Ga0068859_100191198 | Ga0068859_1001911984 | 184 |
| 985 | 3300005618 | Ga0068864_100015889 | Ga0068864_1000158895 | 184 |
| 986 | 3300005618 | Ga0068864_100034196 | Ga0068864_1000341967 | 184 |
| 987 | 3300005618 | Ga0068864_100112202 | Ga0068864_1001122023 | 184 |
| 988 | 3300005618 | Ga0068864_100176796 | Ga0068864_1001767962 | 184 |
| 989 | 3300005618 | Ga0068864_100358046 | Ga0068864_1003580463 | 184 |
| 990 | 3300005618 | Ga0068864_101385571 | Ga0068864_1013855711 | 184 |
| 991 | 3300005718 | Ga0068866_10215915 | Ga0068866_102159152 | 184 |
| 992 | 3300005719 | Ga0068861_100028330 | Ga0068861_1000283306 | 184 |
| 993 | 3300005834 | Ga0068851_10001337 | Ga0068851_100013377 | 184 |
| 994 | 3300005840 | Ga0068870_10321014 | Ga0068870_103210142 | 184 |
| 995 | 3300005841 | Ga0068863_100001373 | Ga0068863_1000013739 | 184 |
| 996 | 3300005841 | Ga0068863_100412768 | Ga0068863_1004127683 | 184 |
| 997 | 3300005841 | Ga0068863_100545888 | Ga0068863_1005458882 | 184 |
| 998 | 3300005842 | Ga0068858_100009451 | Ga0068858_10000945113 | 184 |
| 999 | 3300005843 | Ga0068860_100004260 | Ga0068860_10000426015 | 184 |
| 1000 | 3300005843 | Ga0068860_100007830 | Ga0068860_10000783014 | 184 |
| 1001 | 3300005843 | Ga0068860_100022955 | Ga0068860_1000229554 | 184 |
| 1002 | 3300005844 | Ga0068862_100468583 | Ga0068862_1004685832 | 184 |
| 1003 | 3300005844 | Ga0068862_101143425 | Ga0068862_1011434251 | 184 |
| 1004 | 3300005985 | Ga0081539_10002233 | Ga0081539_1000223328 | 184 |
| 1005 | 3300006195 | Ga0075366_10005546 | Ga0075366_100055467 | 184 |
| 1006 | 3300006195 | Ga0075366_10005748 | Ga0075366_100057488 | 184 |
| 1007 | 3300006195 | Ga0075366_10052705 | Ga0075366_100527055 | 184 |
| 1008 | 3300006195 | Ga0075366_10055884 | Ga0075366_100558842 | 184 |
| 1009 | 3300006195 | Ga0075366_10063553 | Ga0075366_100635533 | 184 |
| 1010 | 3300006195 | Ga0075366_10190067 | Ga0075366_101900672 | 184 |
| 1011 | 3300006195 | Ga0075366_10303361 | Ga0075366_103033612 | 184 |
| 1012 | 3300006195 | Ga0075366_10391996 | Ga0075366_103919962 | 184 |
| 1013 | 3300006237 | Ga0097621_100015711 | Ga0097621_1000157114 | 184 |
| 1014 | 3300006237 | Ga0097621_100702806 | Ga0097621_1007028061 | 184 |
| 1015 | 3300006353 | Ga0075370_10010465 | Ga0075370_100104655 | 184 |
| 1016 | 3300006358 | Ga0068871_100015089 | Ga0068871_1000150897 | 184 |
| 1017 | 3300006358 | Ga0068871_100337625 | Ga0068871_1003376251 | 184 |
| 1018 | 3300006358 | Ga0068871_100597142 | Ga0068871_1005971421 | 184 |
| 1019 | 3300006358 | Ga0068871_101323254 | Ga0068871_1013232542 | 184 |
| 1020 | 3300006844 | Ga0075428_100013576 | Ga0075428_10001357616 | 184 |
| 1021 | 3300006844 | Ga0075428_100041637 | Ga0075428_1000416377 | 184 |
| 1022 | 3300006846 | Ga0075430_100011474 | Ga0075430_10001147411 | 184 |
| 1023 | 3300006847 | Ga0075431_100022872 | Ga0075431_1000228729 | 184 |
| 1024 | 3300006847 | Ga0075431_100051260 | Ga0075431_1000512606 | 184 |
| 1025 | 3300006847 | Ga0075431_100276634 | Ga0075431_1002766341 | 184 |
| 1026 | 3300006871 | Ga0075434_100350726 | Ga0075434_1003507263 | 184 |
| 1027 | 3300006880 | Ga0075429_100048422 | Ga0075429_1000484226 | 184 |
| 1028 | 3300006880 | Ga0075429_100070557 | Ga0075429_1000705572 | 184 |
| 1029 | 3300006881 | Ga0068865_100003571 | Ga0068865_1000035718 | 184 |
| 1030 | 3300006881 | Ga0068865_100672503 | Ga0068865_1006725031 | 184 |
| 1031 | 3300006931 | Ga0097620_100173665 | Ga0097620_1001736652 | 184 |
| 1032 | 3300006931 | Ga0097620_100191198 | Ga0097620_1001911981 | 184 |
| 1033 | 3300009093 | Ga0105240_10000398 | Ga0105240_1000039851 | 184 |
| 1034 | 3300009093 | Ga0105240_10011307 | Ga0105240_100113076 | 184 |
| 1035 | 3300009093 | Ga0105240_10016926 | Ga0105240_100169268 | 184 |
| 1036 | 3300009093 | Ga0105240_10050473 | Ga0105240_100504735 | 184 |
| 1037 | 3300009093 | Ga0105240_10059925 | Ga0105240_100599254 | 184 |
| 1038 | 3300009093 | Ga0105240_10443235 | Ga0105240_104432353 | 184 |
| 1039 | 3300009093 | Ga0105240_10609984 | Ga0105240_106099842 | 184 |
| 1040 | 3300009094 | Ga0111539_10042072 | Ga0111539_100420728 | 184 |
| 1041 | 3300009094 | Ga0111539_10236719 | Ga0111539_102367193 | 184 |
| 1042 | 3300009094 | Ga0111539_11024621 | Ga0111539_110246212 | 184 |
| 1043 | 3300009098 | Ga0105245_10088801 | Ga0105245_100888012 | 184 |
| 1044 | 3300009101 | Ga0105247_10102224 | Ga0105247_101022244 | 184 |
| 1045 | 3300009147 | Ga0114129_10006463 | Ga0114129_1000646317 | 184 |
| 1046 | 3300009147 | Ga0114129_10350815 | Ga0114129_103508152 | 184 |
| 1047 | 3300009174 | Ga0105241_10000769 | Ga0105241_100007694 | 184 |
| 1048 | 3300009174 | Ga0105241_10027526 | Ga0105241_100275265 | 184 |
| 1049 | 3300009174 | Ga0105241_10078388 | Ga0105241_100783885 | 184 |
| 1050 | 3300009174 | Ga0105241_10145153 | Ga0105241_101451534 | 184 |
| 1051 | 3300009174 | Ga0105241_10247098 | Ga0105241_102470983 | 184 |
| 1052 | 3300009176 | Ga0105242_10013197 | Ga0105242_100131977 | 184 |
| 1053 | 3300009545 | Ga0105237_10002553 | Ga0105237_1000255326 | 184 |
| 1054 | 3300009545 | Ga0105237_10002614 | Ga0105237_100026145 | 184 |
| 1055 | 3300009545 | Ga0105237_10026344 | Ga0105237_100263447 | 184 |
| 1056 | 3300009545 | Ga0105237_10033162 | Ga0105237_100331624 | 184 |
| 1057 | 3300009545 | Ga0105237_10037227 | Ga0105237_100372274 | 184 |
| 1058 | 3300009545 | Ga0105237_10427042 | Ga0105237_104270422 | 184 |
| 1059 | 3300009551 | Ga0105238_10008067 | Ga0105238_1000806710 | 184 |
| 1060 | 3300009553 | Ga0105249_10182013 | Ga0105249_101820133 | 184 |
| 1061 | 3300010375 | Ga0105239_10000436 | Ga0105239_1000043619 | 184 |
| 1062 | 3300010375 | Ga0105239_10010718 | Ga0105239_1001071811 | 184 |
| 1063 | 3300010375 | Ga0105239_10086030 | Ga0105239_100860302 | 184 |
| 1064 | 3300010375 | Ga0105239_10253214 | Ga0105239_102532141 | 184 |
| 1065 | 3300010375 | Ga0105239_10959003 | Ga0105239_109590031 | 184 |
| 1066 | 3300011119 | Ga0105246_10010740 | Ga0105246_100107403 | 184 |
| 1067 | 3300011119 | Ga0105246_10298781 | Ga0105246_102987812 | 184 |
| 1068 | 3300011119 | Ga0105246_10395794 | Ga0105246_103957941 | 184 |
| 1069 | 3300013100 | Ga0157373_10123735 | Ga0157373_101237352 | 184 |
| 1070 | 3300013102 | Ga0157371_10019616 | Ga0157371_100196165 | 184 |
| 1071 | 3300013102 | Ga0157371_10087179 | Ga0157371_100871794 | 184 |
| 1072 | 3300013102 | Ga0157371_10308206 | Ga0157371_103082061 | 184 |
| 1073 | 3300013102 | Ga0157371_10334383 | Ga0157371_103343831 | 184 |
| 1074 | 3300013104 | Ga0157370_10072569 | Ga0157370_100725697 | 184 |
| 1075 | 3300013104 | Ga0157370_10075905 | Ga0157370_100759055 | 184 |
| 1076 | 3300013104 | Ga0157370_10086830 | Ga0157370_100868306 | 184 |
| 1077 | 3300013104 | Ga0157370_10127974 | Ga0157370_101279745 | 184 |
| 1078 | 3300013104 | Ga0157370_10290292 | Ga0157370_102902922 | 184 |
| 1079 | 3300013104 | Ga0157370_10413261 | Ga0157370_104132612 | 184 |
| 1080 | 3300013104 | Ga0157370_10890643 | Ga0157370_108906432 | 184 |
| 1081 | 3300013105 | Ga0157369_10000023 | Ga0157369_100000232 | 184 |
| 1082 | 3300013105 | Ga0157369_10032433 | Ga0157369_100324335 | 184 |
| 1083 | 3300013105 | Ga0157369_10135046 | Ga0157369_101350463 | 184 |
| 1084 | 3300013105 | Ga0157369_10346409 | Ga0157369_103464092 | 184 |
| 1085 | 3300013105 | Ga0157369_10541989 | Ga0157369_105419893 | 184 |
| 1086 | 3300013105 | Ga0157369_10781971 | Ga0157369_107819712 | 184 |
| 1087 | 3300013296 | Ga0157374_10007705 | Ga0157374_100077059 | 184 |
| 1088 | 3300013296 | Ga0157374_10172431 | Ga0157374_101724314 | 184 |
| 1089 | 3300013296 | Ga0157374_10180882 | Ga0157374_101808824 | 184 |
| 1090 | 3300013296 | Ga0157374_10320385 | Ga0157374_103203851 | 184 |
| 1091 | 3300013297 | Ga0157378_10005083 | Ga0157378_100050833 | 184 |
| 1092 | 3300013297 | Ga0157378_10008184 | Ga0157378_100081842 | 184 |
| 1093 | 3300013297 | Ga0157378_10019722 | Ga0157378_1001972210 | 184 |
| 1094 | 3300013297 | Ga0157378_10087620 | Ga0157378_100876203 | 184 |
| 1095 | 3300013297 | Ga0157378_10605303 | Ga0157378_106053032 | 184 |
| 1096 | 3300013306 | Ga0163162_10008143 | Ga0163162_100081437 | 184 |
| 1097 | 3300013306 | Ga0163162_10102052 | Ga0163162_101020523 | 184 |
| 1098 | 3300013306 | Ga0163162_10654724 | Ga0163162_106547241 | 184 |
| 1099 | 3300013306 | Ga0163162_11679631 | Ga0163162_116796311 | 184 |
| 1100 | 3300013307 | Ga0157372_10003109 | Ga0157372_1000310919 | 184 |
| 1101 | 3300013307 | Ga0157372_10048397 | Ga0157372_100483978 | 184 |
| 1102 | 3300013307 | Ga0157372_10053864 | Ga0157372_100538646 | 184 |
| 1103 | 3300013307 | Ga0157372_10093748 | Ga0157372_100937485 | 184 |
| 1104 | 3300013307 | Ga0157372_10120036 | Ga0157372_101200362 | 184 |
| 1105 | 3300013307 | Ga0157372_10160741 | Ga0157372_101607415 | 184 |
| 1106 | 3300013307 | Ga0157372_10163953 | Ga0157372_101639531 | 184 |
| 1107 | 3300013307 | Ga0157372_10468633 | Ga0157372_104686332 | 184 |
| 1108 | 3300013307 | Ga0157372_11026389 | Ga0157372_110263892 | 184 |
| 1109 | 3300013307 | Ga0157372_11520980 | Ga0157372_115209801 | 184 |
| 1110 | 3300013308 | Ga0157375_10010453 | Ga0157375_1001045315 | 184 |
| 1111 | 3300013308 | Ga0157375_10035811 | Ga0157375_100358112 | 184 |
| 1112 | 3300013308 | Ga0157375_10099282 | Ga0157375_100992825 | 184 |
| 1113 | 3300013308 | Ga0157375_10581980 | Ga0157375_105819803 | 184 |
| 1114 | 3300014325 | Ga0163163_10023493 | Ga0163163_100234935 | 184 |
| 1115 | 3300014325 | Ga0163163_10069920 | Ga0163163_100699206 | 184 |
| 1116 | 3300014325 | Ga0163163_10105619 | Ga0163163_101056194 | 184 |
| 1117 | 3300014325 | Ga0163163_11379332 | Ga0163163_113793321 | 184 |
| 1118 | 3300014326 | Ga0157380_10018384 | Ga0157380_100183842 | 184 |
| 1119 | 3300014326 | Ga0157380_10109862 | Ga0157380_101098622 | 184 |
| 1120 | 3300014326 | Ga0157380_10382952 | Ga0157380_103829522 | 184 |
| 1121 | 3300014326 | Ga0157380_10453539 | Ga0157380_104535392 | 184 |
| 1122 | 3300014497 | Ga0182008_10003643 | Ga0182008_100036436 | 184 |
| 1123 | 3300014968 | Ga0157379_10000845 | Ga0157379_1000084529 | 184 |
| 1124 | 3300014968 | Ga0157379_10258780 | Ga0157379_102587803 | 184 |
| 1125 | 3300014968 | Ga0157379_10675067 | Ga0157379_106750671 | 184 |
| 1126 | 3300014969 | Ga0157376_10011738 | Ga0157376_100117387 | 184 |
| 1127 | 3300014969 | Ga0157376_10050917 | Ga0157376_100509176 | 184 |
| 1128 | 3300014969 | Ga0157376_10215918 | Ga0157376_102159183 | 184 |
| 1129 | 3300015261 | Ga0182006_1000103 | Ga0182006_100010382 | 184 |
| 1130 | 3300015261 | Ga0182006_1166423 | Ga0182006_11664232 | 184 |
| 1131 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002430 | 184 |
| 1132 | 3300015265 | Ga0182005_1000147 | Ga0182005_100014722 | 184 |
| 1133 | 3300017792 | Ga0163161_10011145 | Ga0163161_100111456 | 184 |
| 1134 | 3300017792 | Ga0163161_10079062 | Ga0163161_100790624 | 184 |
| 1135 | 3300017792 | Ga0163161_10139438 | Ga0163161_101394383 | 184 |
| 1136 | 3300017792 | Ga0163161_10460238 | Ga0163161_104602382 | 184 |
| 1137 | 3300021384 | Ga0213876_10015549 | Ga0213876_100155496 | 184 |
| 1138 | 3300021384 | Ga0213876_10038947 | Ga0213876_100389475 | 184 |
| 1139 | 3300021384 | Ga0213876_10059966 | Ga0213876_100599664 | 184 |
| 1140 | 3300021384 | Ga0213876_10153069 | Ga0213876_101530692 | 184 |
| 1141 | 3300025208 | Ga0209436_100232 | Ga0209436_10023220 | 184 |
| 1142 | 3300025208 | Ga0209436_103246 | Ga0209436_1032466 | 184 |
| 1143 | 3300025242 | Ga0209258_100041 | Ga0209258_100041183 | 184 |
| 1144 | 3300025245 | Ga0207425_1000008 | Ga0207425_100000867 | 184 |
| 1145 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002293 | 184 |
| 1146 | 3300025250 | Ga0209026_1000299 | Ga0209026_100029941 | 184 |
| 1147 | 3300025254 | Ga0209148_1000090 | Ga0209148_100009052 | 184 |
| 1148 | 3300025258 | Ga0209129_1000040 | Ga0209129_1000040198 | 184 |
| 1149 | 3300025273 | Ga0209673_1000034 | Ga0209673_1000034277 | 184 |
| 1150 | 3300025284 | Ga0209130_1001055 | Ga0209130_100105529 | 184 |
| 1151 | 3300025294 | Ga0209025_1000020 | Ga0209025_100002067 | 184 |
| 1152 | 3300025295 | Ga0209564_1011927 | Ga0209564_10119275 | 184 |
| 1153 | 3300025295 | Ga0209564_1031946 | Ga0209564_10319461 | 184 |
| 1154 | 3300025297 | Ga0209758_1000022 | Ga0209758_100002267 | 184 |
| 1155 | 3300025297 | Ga0209758_1001438 | Ga0209758_10014383 | 184 |
| 1156 | 3300025297 | Ga0209758_1022949 | Ga0209758_10229492 | 184 |
| 1157 | 3300025297 | Ga0209758_1030098 | Ga0209758_10300982 | 184 |
| 1158 | 3300025298 | Ga0209050_1000207 | Ga0209050_100020722 | 184 |
| 1159 | 3300025298 | Ga0209050_1002964 | Ga0209050_100296410 | 184 |
| 1160 | 3300025302 | Ga0207426_1000105 | Ga0207426_100010551 | 184 |
| 1161 | 3300025302 | Ga0207426_1000603 | Ga0207426_100060338 | 184 |
| 1162 | 3300025302 | Ga0207426_1000813 | Ga0207426_100081319 | 184 |
| 1163 | 3300025302 | Ga0207426_1001314 | Ga0207426_100131426 | 184 |
| 1164 | 3300025302 | Ga0207426_1012108 | Ga0207426_10121083 | 184 |
| 1165 | 3300025302 | Ga0207426_1045428 | Ga0207426_10454282 | 184 |
| 1166 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011657 | 184 |
| 1167 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007326 | 184 |
| 1168 | 3300025304 | Ga0209257_1001824 | Ga0209257_100182416 | 184 |
| 1169 | 3300025315 | Ga0207697_10008991 | Ga0207697_100089912 | 184 |
| 1170 | 3300025315 | Ga0207697_10168485 | Ga0207697_101684851 | 184 |
| 1171 | 3300025321 | Ga0207656_10002290 | Ga0207656_100022906 | 184 |
| 1172 | 3300025893 | Ga0207682_10005663 | Ga0207682_100056637 | 184 |
| 1173 | 3300025893 | Ga0207682_10021729 | Ga0207682_100217294 | 184 |
| 1174 | 3300025893 | Ga0207682_10049495 | Ga0207682_100494952 | 184 |
| 1175 | 3300025893 | Ga0207682_10383149 | Ga0207682_103831491 | 184 |
| 1176 | 3300025899 | Ga0207642_10389518 | Ga0207642_103895181 | 184 |
| 1177 | 3300025900 | Ga0207710_10049842 | Ga0207710_100498421 | 184 |
| 1178 | 3300025901 | Ga0207688_10118589 | Ga0207688_101185891 | 184 |
| 1179 | 3300025903 | Ga0207680_10000957 | Ga0207680_1000095711 | 184 |
| 1180 | 3300025903 | Ga0207680_10108367 | Ga0207680_101083671 | 184 |
| 1181 | 3300025903 | Ga0207680_10161717 | Ga0207680_101617173 | 184 |
| 1182 | 3300025904 | Ga0207647_10050985 | Ga0207647_100509854 | 184 |
| 1183 | 3300025904 | Ga0207647_10333726 | Ga0207647_103337261 | 184 |
| 1184 | 3300025907 | Ga0207645_10003925 | Ga0207645_1000392511 | 184 |
| 1185 | 3300025907 | Ga0207645_10047294 | Ga0207645_100472944 | 184 |
| 1186 | 3300025908 | Ga0207643_10105259 | Ga0207643_101052591 | 184 |
| 1187 | 3300025909 | Ga0207705_10006233 | Ga0207705_1000623311 | 184 |
| 1188 | 3300025909 | Ga0207705_10450797 | Ga0207705_104507972 | 184 |
| 1189 | 3300025909 | Ga0207705_10610307 | Ga0207705_106103071 | 184 |
| 1190 | 3300025911 | Ga0207654_10180937 | Ga0207654_101809372 | 184 |
| 1191 | 3300025911 | Ga0207654_10310569 | Ga0207654_103105692 | 184 |
| 1192 | 3300025911 | Ga0207654_10418340 | Ga0207654_104183402 | 184 |
| 1193 | 3300025912 | Ga0207707_10000051 | Ga0207707_1000005191 | 184 |
| 1194 | 3300025913 | Ga0207695_10000076 | Ga0207695_1000007655 | 184 |
| 1195 | 3300025913 | Ga0207695_10000090 | Ga0207695_1000009055 | 184 |
| 1196 | 3300025913 | Ga0207695_10009751 | Ga0207695_1000975111 | 184 |
| 1197 | 3300025913 | Ga0207695_10042816 | Ga0207695_100428164 | 184 |
| 1198 | 3300025913 | Ga0207695_10060304 | Ga0207695_100603042 | 184 |
| 1199 | 3300025913 | Ga0207695_10072097 | Ga0207695_100720974 | 184 |
| 1200 | 3300025913 | Ga0207695_10326487 | Ga0207695_103264871 | 184 |
| 1201 | 3300025913 | Ga0207695_10824849 | Ga0207695_108248491 | 184 |
| 1202 | 3300025914 | Ga0207671_10000762 | Ga0207671_1000076252 | 184 |
| 1203 | 3300025914 | Ga0207671_10003750 | Ga0207671_1000375019 | 184 |
| 1204 | 3300025914 | Ga0207671_10005849 | Ga0207671_1000584910 | 184 |
| 1205 | 3300025914 | Ga0207671_10022562 | Ga0207671_100225623 | 184 |
| 1206 | 3300025914 | Ga0207671_10029007 | Ga0207671_100290076 | 184 |
| 1207 | 3300025914 | Ga0207671_10197519 | Ga0207671_101975191 | 184 |
| 1208 | 3300025917 | Ga0207660_10318693 | Ga0207660_103186931 | 184 |
| 1209 | 3300025918 | Ga0207662_10007273 | Ga0207662_1000727310 | 184 |
| 1210 | 3300025919 | Ga0207657_10122866 | Ga0207657_101228663 | 184 |
| 1211 | 3300025919 | Ga0207657_10729739 | Ga0207657_107297391 | 184 |
| 1212 | 3300025923 | Ga0207681_10532272 | Ga0207681_105322721 | 184 |
| 1213 | 3300025923 | Ga0207681_10696836 | Ga0207681_106968362 | 184 |
| 1214 | 3300025925 | Ga0207650_10030217 | Ga0207650_100302175 | 184 |
| 1215 | 3300025925 | Ga0207650_10030666 | Ga0207650_100306664 | 184 |
| 1216 | 3300025925 | Ga0207650_10258272 | Ga0207650_102582722 | 184 |
| 1217 | 3300025926 | Ga0207659_10023967 | Ga0207659_100239672 | 184 |
| 1218 | 3300025926 | Ga0207659_10027831 | Ga0207659_100278314 | 184 |
| 1219 | 3300025926 | Ga0207659_10059948 | Ga0207659_100599485 | 184 |
| 1220 | 3300025926 | Ga0207659_10455869 | Ga0207659_104558692 | 184 |
| 1221 | 3300025926 | Ga0207659_10595457 | Ga0207659_105954572 | 184 |
| 1222 | 3300025931 | Ga0207644_10019521 | Ga0207644_100195211 | 184 |
| 1223 | 3300025931 | Ga0207644_10562384 | Ga0207644_105623841 | 184 |
| 1224 | 3300025933 | Ga0207706_10023803 | Ga0207706_100238038 | 184 |
| 1225 | 3300025933 | Ga0207706_10275820 | Ga0207706_102758201 | 184 |
| 1226 | 3300025934 | Ga0207686_10278695 | Ga0207686_102786951 | 184 |
| 1227 | 3300025937 | Ga0207669_10015591 | Ga0207669_100155914 | 184 |
| 1228 | 3300025937 | Ga0207669_10028016 | Ga0207669_100280166 | 184 |
| 1229 | 3300025938 | Ga0207704_10018685 | Ga0207704_100186854 | 184 |
| 1230 | 3300025938 | Ga0207704_10800941 | Ga0207704_108009411 | 184 |
| 1231 | 3300025940 | Ga0207691_10000001 | Ga0207691_1000000123 | 184 |
| 1232 | 3300025940 | Ga0207691_10002741 | Ga0207691_1000274111 | 184 |
| 1233 | 3300025940 | Ga0207691_10016872 | Ga0207691_100168724 | 184 |
| 1234 | 3300025940 | Ga0207691_10021049 | Ga0207691_100210494 | 184 |
| 1235 | 3300025940 | Ga0207691_10084460 | Ga0207691_100844606 | 184 |
| 1236 | 3300025942 | Ga0207689_10007410 | Ga0207689_100074109 | 184 |
| 1237 | 3300025942 | Ga0207689_10108306 | Ga0207689_101083062 | 184 |
| 1238 | 3300025944 | Ga0207661_10018456 | Ga0207661_100184567 | 184 |
| 1239 | 3300025944 | Ga0207661_10600791 | Ga0207661_106007912 | 184 |
| 1240 | 3300025945 | Ga0207679_10053946 | Ga0207679_100539461 | 184 |
| 1241 | 3300025945 | Ga0207679_10082806 | Ga0207679_100828064 | 184 |
| 1242 | 3300025945 | Ga0207679_10103150 | Ga0207679_101031503 | 184 |
| 1243 | 3300025945 | Ga0207679_10407126 | Ga0207679_104071262 | 184 |
| 1244 | 3300025945 | Ga0207679_10494135 | Ga0207679_104941352 | 184 |
| 1245 | 3300025949 | Ga0207667_10000453 | Ga0207667_1000045338 | 184 |
| 1246 | 3300025949 | Ga0207667_10009521 | Ga0207667_100095212 | 184 |
| 1247 | 3300025949 | Ga0207667_10106276 | Ga0207667_101062765 | 184 |
| 1248 | 3300025949 | Ga0207667_10401927 | Ga0207667_104019272 | 184 |
| 1249 | 3300025949 | Ga0207667_10407436 | Ga0207667_104074362 | 184 |
| 1250 | 3300025960 | Ga0207651_10002109 | Ga0207651_100021097 | 184 |
| 1251 | 3300025960 | Ga0207651_10110064 | Ga0207651_101100643 | 184 |
| 1252 | 3300025960 | Ga0207651_10232903 | Ga0207651_102329031 | 184 |
| 1253 | 3300025960 | Ga0207651_11398247 | Ga0207651_113982471 | 184 |
| 1254 | 3300025961 | Ga0207712_10017014 | Ga0207712_100170143 | 184 |
| 1255 | 3300025961 | Ga0207712_10268576 | Ga0207712_102685762 | 184 |
| 1256 | 3300025961 | Ga0207712_10273512 | Ga0207712_102735123 | 184 |
| 1257 | 3300025961 | Ga0207712_10983646 | Ga0207712_109836461 | 184 |
| 1258 | 3300025972 | Ga0207668_10000869 | Ga0207668_1000086921 | 184 |
| 1259 | 3300025981 | Ga0207640_10419521 | Ga0207640_104195212 | 184 |
| 1260 | 3300025981 | Ga0207640_10433596 | Ga0207640_104335961 | 184 |
| 1261 | 3300025986 | Ga0207658_10002877 | Ga0207658_1000287715 | 184 |
| 1262 | 3300025986 | Ga0207658_10206299 | Ga0207658_102062993 | 184 |
| 1263 | 3300025986 | Ga0207658_10338678 | Ga0207658_103386783 | 184 |
| 1264 | 3300025986 | Ga0207658_10368749 | Ga0207658_103687492 | 184 |
| 1265 | 3300025986 | Ga0207658_11469930 | Ga0207658_114699301 | 184 |
| 1266 | 3300026023 | Ga0207677_10007143 | Ga0207677_1000714310 | 184 |
| 1267 | 3300026023 | Ga0207677_10331030 | Ga0207677_103310301 | 184 |
| 1268 | 3300026035 | Ga0207703_10004088 | Ga0207703_1000408815 | 184 |
| 1269 | 3300026035 | Ga0207703_10086913 | Ga0207703_100869133 | 184 |
| 1270 | 3300026035 | Ga0207703_11059340 | Ga0207703_110593401 | 184 |
| 1271 | 3300026041 | Ga0207639_10002238 | Ga0207639_1000223810 | 184 |
| 1272 | 3300026041 | Ga0207639_10144907 | Ga0207639_101449073 | 184 |
| 1273 | 3300026041 | Ga0207639_10206104 | Ga0207639_102061042 | 184 |
| 1274 | 3300026041 | Ga0207639_10553949 | Ga0207639_105539492 | 184 |
| 1275 | 3300026067 | Ga0207678_10125918 | Ga0207678_101259182 | 184 |
| 1276 | 3300026088 | Ga0207641_10005564 | Ga0207641_100055647 | 184 |
| 1277 | 3300026089 | Ga0207648_10002625 | Ga0207648_1000262517 | 184 |
| 1278 | 3300026089 | Ga0207648_10013430 | Ga0207648_100134303 | 184 |
| 1279 | 3300026089 | Ga0207648_10606113 | Ga0207648_106061132 | 184 |
| 1280 | 3300026095 | Ga0207676_10009796 | Ga0207676_100097967 | 184 |
| 1281 | 3300026095 | Ga0207676_10063612 | Ga0207676_100636122 | 184 |
| 1282 | 3300026095 | Ga0207676_10257111 | Ga0207676_102571112 | 184 |
| 1283 | 3300026095 | Ga0207676_10299754 | Ga0207676_102997542 | 184 |
| 1284 | 3300026095 | Ga0207676_10757273 | Ga0207676_107572732 | 184 |
| 1285 | 3300026116 | Ga0207674_10007100 | Ga0207674_1000710012 | 184 |
| 1286 | 3300026116 | Ga0207674_10051368 | Ga0207674_100513686 | 184 |
| 1287 | 3300026116 | Ga0207674_10160215 | Ga0207674_101602152 | 184 |
| 1288 | 3300026116 | Ga0207674_10298511 | Ga0207674_102985113 | 184 |
| 1289 | 3300026118 | Ga0207675_100011158 | Ga0207675_1000111585 | 184 |
| 1290 | 3300026118 | Ga0207675_100023752 | Ga0207675_10002375212 | 184 |
| 1291 | 3300026118 | Ga0207675_100029391 | Ga0207675_1000293917 | 184 |
| 1292 | 3300026118 | Ga0207675_100746893 | Ga0207675_1007468931 | 184 |
| 1293 | 3300026121 | Ga0207683_10006890 | Ga0207683_1000689018 | 184 |
| 1294 | 3300026121 | Ga0207683_10017329 | Ga0207683_100173298 | 184 |
| 1295 | 3300026121 | Ga0207683_10086341 | Ga0207683_100863411 | 184 |
| 1296 | 3300026121 | Ga0207683_10135228 | Ga0207683_101352283 | 184 |
| 1297 | 3300026121 | Ga0207683_10243080 | Ga0207683_102430803 | 184 |
| 1298 | 3300026142 | Ga0207698_10089720 | Ga0207698_100897204 | 184 |
| 1299 | 3300026142 | Ga0207698_10605257 | Ga0207698_106052571 | 184 |
| 1300 | 3300028379 | Ga0268266_10006831 | Ga0268266_100068319 | 184 |
| 1301 | 3300028379 | Ga0268266_10010826 | Ga0268266_100108266 | 184 |
| 1302 | 3300028379 | Ga0268266_10019858 | Ga0268266_100198586 | 184 |
| 1303 | 3300028380 | Ga0268265_10312908 | Ga0268265_103129082 | 184 |
| 1304 | 3300028381 | Ga0268264_10027923 | Ga0268264_100279236 | 184 |
| 1305 | 3300028381 | Ga0268264_10085138 | Ga0268264_100851385 | 184 |
| 1306 | 3300028794 | Ga0307515_10000009 | Ga0307515_10000009372 | 184 |
| 1307 | 3300028794 | Ga0307515_10000469 | Ga0307515_1000046973 | 184 |
| 1308 | 3300028794 | Ga0307515_10411520 | Ga0307515_104115201 | 184 |
| 1309 | 3300028800 | Ga0265338_10104635 | Ga0265338_101046352 | 184 |
| 1310 | 3300029957 | Ga0265324_10009470 | Ga0265324_100094702 | 184 |
| 1311 | 3300030731 | Ga0316177_1063448 | Ga0316177_10634482 | 184 |
| 1312 | 3300031251 | Ga0265327_10000244 | Ga0265327_10000244117 | 184 |
| 1313 | 3300031251 | Ga0265327_10000298 | Ga0265327_1000029820 | 184 |
| 1314 | 3300031251 | Ga0265327_10034879 | Ga0265327_100348794 | 184 |
| 1315 | 3300031251 | Ga0265327_10124294 | Ga0265327_101242942 | 184 |
| 1316 | 3300031456 | Ga0307513_10100314 | Ga0307513_101003143 | 184 |
| 1317 | 3300031456 | Ga0307513_10196164 | Ga0307513_101961641 | 184 |
| 1318 | 3300031456 | Ga0307513_10205509 | Ga0307513_102055093 | 184 |
| 1319 | 3300031507 | Ga0307509_10122814 | Ga0307509_101228145 | 184 |
| 1320 | 3300031507 | Ga0307509_10132538 | Ga0307509_101325385 | 184 |
| 1321 | 3300031616 | Ga0307508_10001613 | Ga0307508_100016135 | 184 |
| 1322 | 3300031711 | Ga0265314_10003664 | Ga0265314_1000366411 | 184 |
| 1323 | 3300031727 | Ga0316576_10001081 | Ga0316576_1000108118 | 184 |
| 1324 | 3300031728 | Ga0316578_10044909 | Ga0316578_100449094 | 184 |
| 1325 | 3300031730 | Ga0307516_10004268 | Ga0307516_100042688 | 184 |
| 1326 | 3300031730 | Ga0307516_10182934 | Ga0307516_101829343 | 184 |
| 1327 | 3300031731 | Ga0307405_10000006 | Ga0307405_1000000663 | 184 |
| 1328 | 3300031903 | Ga0307407_10000003 | Ga0307407_10000003185 | 184 |
| 1329 | 3300031911 | Ga0307412_10053164 | Ga0307412_100531644 | 184 |
| 1330 | 3300031911 | Ga0307412_10257328 | Ga0307412_102573282 | 184 |
| 1331 | 3300031995 | Ga0307409_100028055 | Ga0307409_10002805510 | 184 |
| 1332 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002429 | 184 |
| 1333 | 3300032004 | Ga0307414_10009965 | Ga0307414_100099655 | 184 |
| 1334 | 3300032004 | Ga0307414_10098384 | Ga0307414_100983844 | 184 |
| 1335 | 3300032004 | Ga0307414_10663521 | Ga0307414_106635211 | 184 |
| 1336 | 3300032005 | Ga0307411_10153223 | Ga0307411_101532234 | 184 |
| 1337 | 3300033180 | Ga0307510_10000380 | Ga0307510_1000038016 | 184 |
| 1338 | 3300033524 | Ga0316592_1013307 | Ga0316592_10133073 | 184 |
| 1339 | 3300033541 | Ga0316596_1002626 | Ga0316596_10026264 | 184 |
| 1340 | 3300033541 | Ga0316596_1003825 | Ga0316596_10038256 | 184 |
| 1341 | 3300033541 | Ga0316596_1016458 | Ga0316596_10164584 | 184 |
| 1342 | 3300035119 | Ga0373956_0098722 | Ga0373956_0098722_341_895 | 184 |
| 1343 | 3300035172 | Ga0373955_0329565 | Ga0373955_0329565_100_654 | 184 |
| 1344 | 3300035692 | Ga0373935_0473866 | Ga0373935_0473866_212_766 | 184 |
| 1345 | 3300036401 | Ga0373937_0140348 | Ga0373937_0140348_173_727 | 184 |
| 1346 | 3300036647 | Ga0316582_0022702 | Ga0316582_0022702_2119_2673 | 184 |
| 1347 | 3300036712 | Ga0316584_0020181 | Ga0316584_0020181_3401_3955 | 184 |
| 1348 | 3300037068 | Ga0373925_0165850 | Ga0373925_0165850_1102_1656 | 184 |
| 1349 | 3300037312 | Ga0395899_0378083 | Ga0395899_0378083_90_644 | 184 |
| 1350 | 3300037418 | Ga0395900_0193418 | Ga0395900_0193418_702_1256 | 184 |
| 1351 | 3300037471 | Ga0395905_1167085 | Ga0395905_1167085_12_566 | 184 |
| 1352 | 3300039437 | Ga0436365_0781227 | Ga0436365_0781227_537_1091 | 184 |
| 1353 | 3300039437 | Ga0436365_1208365 | Ga0436365_1208365_504_1058 | 184 |
| 1354 | 3300039437 | Ga0436365_1690067 | Ga0436365_1690067_6307_6861 | 184 |
| 1355 | 3300041404 | Ga0439436_0010012 | Ga0439436_0010012_2051_2605 | 184 |
| 1356 | 3300041404 | Ga0439436_0054621 | Ga0439436_0054621_334_888 | 184 |
| 1357 | 3300041406 | Ga0439439_0015663 | Ga0439439_0015663_231_785 | 184 |
| 1358 | 3300041406 | Ga0439439_0099531 | Ga0439439_0099531_97_651 | 184 |
| 1359 | 3300041413 | Ga0439465_0006490 | Ga0439465_0006490_332_886 | 184 |
| 1360 | 3300041446 | Ga0451794_56897 | Ga0451794_56897_21_578 | 184 |
| 1361 | 3300041453 | Ga0451797_0519695 | Ga0451797_0519695_172_726 | 184 |
| 1362 | 3300041498 | Ga0451841_0610576 | Ga0451841_0610576_22_576 | 184 |
| 1363 | 3300041511 | Ga0451855_0576277 | Ga0451855_0576277_11_580 | 184 |
| 1364 | 3300041512 | Ga0451853_0701685 | Ga0451853_0701685_1157_1711 | 184 |
| 1365 | 3300041997 | Ga0439431_0006932 | Ga0439431_0006932_1166_1720 | 184 |
| 1366 | 3300042007 | Ga0439449_0003312 | Ga0439449_0003312_3291_3845 | 184 |
| 1367 | 3300042007 | Ga0439449_0159683 | Ga0439449_0159683_254_808 | 184 |
| 1368 | 3300042010 | Ga0439452_017641 | Ga0439452_017641_518_1072 | 184 |
| 1369 | 3300042014 | Ga0439457_001021 | Ga0439457_001021_5381_5935 | 184 |
| 1370 | 3300042014 | Ga0439457_012873 | Ga0439457_012873_104_658 | 184 |
| 1371 | 3300042014 | Ga0439457_018331 | Ga0439457_018331_398_952 | 184 |
| 1372 | 3300042124 | Ga0450922_004074 | Ga0450922_004074_707_1261 | 184 |
| 1373 | 3300042134 | Ga0450898_001130 | Ga0450898_001130_194_748 | 184 |
| 1374 | 3300042156 | Ga0439446_0066036 | Ga0439446_0066036_107_661 | 184 |
| 1375 | 3300042156 | Ga0439446_0207057 | Ga0439446_0207057_12_566 | 184 |
| 1376 | 3300042435 | Ga0439434_0005882 | Ga0439434_0005882_1455_2009 | 184 |
| 1377 | 3300042439 | Ga0439464_0140095 | Ga0439464_0140095_121_678 | 184 |
| 1378 | 3300042876 | Ga0451577_0004463 | Ga0451577_0004463_10769_11326 | 184 |
| 1379 | 3300042876 | Ga0451577_0054888 | Ga0451577_0054888_249_803 | 184 |
| 1380 | 3300042876 | Ga0451577_0242501 | Ga0451577_0242501_878_1432 | 184 |
| 1381 | 3300042876 | Ga0451577_0348490 | Ga0451577_0348490_120_674 | 184 |
| 1382 | 3300044656 | Ga0466969_0000246 | Ga0466969_0000246_20532_21086 | 184 |
| 1383 | 3300044673 | Ga0453683_0009005 | Ga0453683_0009005_3990_4544 | 184 |
| 1384 | 3300044673 | Ga0453683_0011208 | Ga0453683_0011208_4459_5016 | 184 |
| 1385 | 3300044673 | Ga0453683_0083828 | Ga0453683_0083828_1279_1833 | 184 |
| 1386 | 3300044673 | Ga0453683_0151769 | Ga0453683_0151769_175_732 | 184 |
| 1387 | 3300044673 | Ga0453683_0189848 | Ga0453683_0189848_537_1094 | 184 |
| 1388 | 3300044673 | Ga0453683_0430917 | Ga0453683_0430917_233_787 | 184 |
| 1389 | 3300044683 | Ga0466965_0041805 | Ga0466965_0041805_1147_1701 | 184 |
| 1390 | 3300044683 | Ga0466965_0358535 | Ga0466965_0358535_25_579 | 184 |
| 1391 | 3300044684 | Ga0466966_0018671 | Ga0466966_0018671_1857_2411 | 184 |
| 1392 | 3300044693 | Ga0466961_0125059 | Ga0466961_0125059_365_919 | 184 |
| 1393 | 3300044712 | Ga0453684_0000413 | Ga0453684_0000413_78321_78878 | 184 |
| 1394 | 3300044712 | Ga0453684_0012544 | Ga0453684_0012544_2323_2880 | 184 |
| 1395 | 3300044712 | Ga0453684_0031999 | Ga0453684_0031999_1082_1636 | 184 |
| 1396 | 3300044712 | Ga0453684_0038585 | Ga0453684_0038585_1451_2005 | 184 |
| 1397 | 3300044712 | Ga0453684_0068294 | Ga0453684_0068294_1924_2478 | 184 |
| 1398 | 3300044712 | Ga0453684_0081028 | Ga0453684_0081028_1352_1906 | 184 |
| 1399 | 3300044712 | Ga0453684_0109499 | Ga0453684_0109499_2470_3024 | 184 |
| 1400 | 3300044712 | Ga0453684_0446341 | Ga0453684_0446341_221_775 | 184 |
| 1401 | 3300044712 | Ga0453684_0453389 | Ga0453684_0453389_556_1113 | 184 |
| 1402 | 3300044712 | Ga0453684_0546517 | Ga0453684_0546517_72_626 | 184 |
| 1403 | 3300044765 | Ga0466970_0380832 | Ga0466970_0380832_105_659 | 184 |
| 1404 | 3300044842 | Ga0466957_0001187 | Ga0466957_0001187_3216_3770 | 184 |
| 1405 | 3300045049 | Ga0466959_0000017 | Ga0466959_0000017_73483_74037 | 184 |
| 1406 | 3300045049 | Ga0466959_0027432 | Ga0466959_0027432_3038_3592 | 184 |
| 1407 | 3300045051 | Ga0451576_0012395 | Ga0451576_0012395_373_930 | 184 |
| 1408 | 3300045051 | Ga0451576_0027225 | Ga0451576_0027225_1380_1934 | 184 |
| 1409 | 3300045051 | Ga0451576_0042307 | Ga0451576_0042307_3461_4018 | 184 |
| 1410 | 3300045051 | Ga0451576_0062199 | Ga0451576_0062199_2846_3403 | 184 |
| 1411 | 3300045051 | Ga0451576_0062248 | Ga0451576_0062248_1864_2418 | 184 |
| 1412 | 3300045051 | Ga0451576_0370146 | Ga0451576_0370146_703_1260 | 184 |
| 1413 | 3300045836 | Ga0466958_0422315 | Ga0466958_0422315_60_614 | 184 |
| 1414 | 3300045976 | Ga0466967_0213816 | Ga0466967_0213816_364_918 | 184 |
| 1415 | 3300046453 | Ga0495627_001896 | Ga0495627_001896_1386_1940 | 184 |
| 1416 | 3300046453 | Ga0495627_050922 | Ga0495627_050922_447_1004 | 184 |
| 1417 | 3300046460 | Ga0495638_0000040 | Ga0495638_0000040_131755_132312 | 184 |
| 1418 | 3300046460 | Ga0495638_0043942 | Ga0495638_0043942_221_775 | 184 |
| 1419 | 3300046460 | Ga0495638_0072019 | Ga0495638_0072019_757_1311 | 184 |
| 1420 | 3300046473 | Ga0495582_0312016 | Ga0495582_0312016_156_710 | 184 |
| 1421 | 3300046507 | Ga0495606_0006493 | Ga0495606_0006493_9146_9700 | 184 |
| 1422 | 3300046507 | Ga0495606_0010457 | Ga0495606_0010457_3919_4476 | 184 |
| 1423 | 3300046519 | Ga0495632_0088893 | Ga0495632_0088893_105_662 | 184 |
| 1424 | 3300046522 | Ga0495643_0009099 | Ga0495643_0009099_2229_2783 | 184 |
| 1425 | 3300046537 | Ga0495598_0097956 | Ga0495598_0097956_345_899 | 184 |
| 1426 | 3300046543 | Ga0495645_0293881 | Ga0495645_0293881_400_954 | 184 |
| 1427 | 3300046543 | Ga0495645_0433006 | Ga0495645_0433006_111_665 | 184 |
| 1428 | 3300046558 | Ga0495633_0000049 | Ga0495633_0000049_82808_83362 | 184 |
| 1429 | 3300046558 | Ga0495633_0061152 | Ga0495633_0061152_908_1462 | 184 |
| 1430 | 3300046558 | Ga0495633_0153686 | Ga0495633_0153686_416_973 | 184 |
| 1431 | 3300046616 | Ga0495668_0161287 | Ga0495668_0161287_139_693 | 184 |
| 1432 | 3300046648 | Ga0495611_0003370 | Ga0495611_0003370_1620_2174 | 184 |
| 1433 | 3300046660 | Ga0495625_0346569 | Ga0495625_0346569_282_839 | 184 |
| 1434 | 3300046679 | Ga0495623_0173557 | Ga0495623_0173557_330_884 | 184 |
| 1435 | 3300046694 | Ga0495649_0078773 | Ga0495649_0078773_409_963 | 184 |
| 1436 | 3300047318 | Ga0495636_0000012 | Ga0495636_0000012_42413_42967 | 184 |
| 1437 | 3300047320 | Ga0495672_0256583 | Ga0495672_0256583_278_832 | 184 |
| 1438 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_257162_257716 | 184 |
| 1439 | 3300047472 | Ga0495686_0025653 | Ga0495686_0025653_1361_1915 | 184 |
| 1440 | 3300048907 | Ga0496104_0097105 | Ga0496104_0097105_760_1314 | 184 |
| 1441 | 3300048907 | Ga0496104_0300644 | Ga0496104_0300644_83_637 | 184 |
| 1442 | 3300048910 | Ga0496107_0727748 | Ga0496107_0727748_101_655 | 184 |
| 1443 | 3300048912 | Ga0496109_0051846 | Ga0496109_0051846_2221_2775 | 184 |
| 1444 | 3300048917 | Ga0496114_0001912 | Ga0496114_0001912_10686_11240 | 184 |
| 1445 | 3300048918 | Ga0496115_0094411 | Ga0496115_0094411_692_1246 | 184 |
| 1446 | 3300048925 | Ga0496122_0000862 | Ga0496122_0000862_31060_31617 | 184 |
| 1447 | 3300048926 | Ga0496123_0029231 | Ga0496123_0029231_2319_2876 | 184 |
| 1448 | 3300048928 | Ga0496125_0105937 | Ga0496125_0105937_587_1144 | 184 |
| 1449 | 3300048929 | Ga0496126_0089554 | Ga0496126_0089554_1491_2045 | 184 |
| 1450 | 3300049127 | Ga0501306_019863 | Ga0501306_019863_155_709 | 184 |
| 1451 | 3300049128 | Ga0501308_037880 | Ga0501308_037880_14_571 | 184 |
| 1452 | 3300049128 | Ga0501308_052130 | Ga0501308_052130_33_590 | 184 |
| 1453 | 3300049132 | Ga0501343_002364 | Ga0501343_002364_446_1000 | 184 |
| 1454 | 3300049161 | Ga0501305_009592 | Ga0501305_009592_655_1212 | 184 |
| 1455 | 3300049162 | Ga0501307_014525 | Ga0501307_014525_314_868 | 184 |
| 1456 | 3300049527 | Ga0501311_003947 | Ga0501311_003947_374_928 | 184 |
| 1457 | 3300049530 | Ga0501314_005402 | Ga0501314_005402_260_814 | 184 |
| 1458 | 3300049531 | Ga0501315_013721 | Ga0501315_013721_437_994 | 184 |
| 1459 | 3300049533 | Ga0501317_013917 | Ga0501317_013917_124_678 | 184 |
| 1460 | 3300049535 | Ga0501319_000018 | Ga0501319_000018_2097_2651 | 184 |
| 1461 | 3300049536 | Ga0501320_000042 | Ga0501320_000042_2620_3174 | 184 |
| 1462 | 3300049540 | Ga0501324_000446 | Ga0501324_000446_825_1379 | 184 |
| 1463 | 3300049545 | Ga0501329_00025 | Ga0501329_00025_2692_3246 | 184 |
| 1464 | 3300049571 | Ga0501034_0068864 | Ga0501034_0068864_89_643 | 184 |
| 1465 | 3300049571 | Ga0501034_0506147 | Ga0501034_0506147_165_719 | 184 |
| 1466 | 3300049572 | Ga0501036_0469331 | Ga0501036_0469331_142_696 | 184 |
| 1467 | 3300049573 | Ga0501037_0336815 | Ga0501037_0336815_468_1022 | 184 |
| 1468 | 3300049579 | Ga0501043_0252400 | Ga0501043_0252400_553_1107 | 184 |
| 1469 | 3300049579 | Ga0501043_0347853 | Ga0501043_0347853_55_609 | 184 |
| 1470 | 3300049579 | Ga0501043_0412068 | Ga0501043_0412068_384_938 | 184 |
| 1471 | 3300049579 | Ga0501043_0840598 | Ga0501043_0840598_62_616 | 184 |
| 1472 | 3300049581 | Ga0501047_0154966 | Ga0501047_0154966_160_714 | 184 |
| 1473 | 3300049585 | Ga0501069_0360955 | Ga0501069_0360955_125_679 | 184 |
| 1474 | 3300049586 | Ga0501070_0597127 | Ga0501070_0597127_215_769 | 184 |
| 1475 | 3300049589 | Ga0501073_0067112 | Ga0501073_0067112_234_788 | 184 |
| 1476 | 3300049681 | Ga0501251_044664 | Ga0501251_044664_84_638 | 184 |
| 1477 | 3300049776 | Ga0501280_038589 | Ga0501280_038589_11_565 | 184 |
| 1478 | 3300049822 | Ga0501035_0493382 | Ga0501035_0493382_240_794 | 184 |
| 1479 | 3300050493 | nmdc:mga0k408_106616_c1 | nmdc:mga0k408_106616_c1_55_612 | 184 |
| 1480 | 3300050493 | nmdc:mga0k408_17232_c1 | nmdc:mga0k408_17232_c1_775_1329 | 184 |
| 1481 | 3300050493 | nmdc:mga0k408_176521_c1 | nmdc:mga0k408_176521_c1_386_940 | 184 |
| 1482 | 3300050493 | nmdc:mga0k408_20199_c1 | nmdc:mga0k408_20199_c1_1452_2006 | 184 |
| 1483 | 3300050493 | nmdc:mga0k408_41944_c2 | nmdc:mga0k408_41944_c2_410_964 | 184 |
| 1484 | 3300050493 | nmdc:mga0k408_43078_c1 | nmdc:mga0k408_43078_c1_1946_2500 | 184 |
| 1485 | 3300050493 | nmdc:mga0k408_62301_c2 | nmdc:mga0k408_62301_c2_796_1350 | 184 |
| 1486 | 3300050496 | nmdc:mga07m45_26725_c1 | nmdc:mga07m45_26725_c1_480_1034 | 184 |
| 1487 | 3300050507 | nmdc:mga05p37_3944_c1 | nmdc:mga05p37_3944_c1_7348_7902 | 184 |
| 1488 | 3300050507 | nmdc:mga05p37_396256_c1 | nmdc:mga05p37_396256_c1_526_1080 | 184 |
| 1489 | 3300050507 | nmdc:mga05p37_886407_c1 | nmdc:mga05p37_886407_c1_83_637 | 184 |
| 1490 | 3300050508 | nmdc:mga09592_65841_c1 | nmdc:mga09592_65841_c1_238_792 | 184 |
| 1491 | 3300050508 | nmdc:mga09592_828015_c1 | nmdc:mga09592_828015_c1_34_588 | 184 |
| 1492 | 3300050510 | nmdc:mga06r32_157920_c1 | nmdc:mga06r32_157920_c1_499_1053 | 184 |
| 1493 | 3300050510 | nmdc:mga06r32_260089_c1 | nmdc:mga06r32_260089_c1_1103_1660 | 184 |
| 1494 | 3300050510 | nmdc:mga06r32_600359_c1 | nmdc:mga06r32_600359_c1_468_1022 | 184 |
| 1495 | 3300050512 | nmdc:mga0n895_346964_c1 | nmdc:mga0n895_346964_c1_903_1457 | 184 |
| 1496 | 3300053088 | Ga0500644_0012343 | Ga0500644_0012343_1350_1907 | 184 |
| 1497 | 3300053088 | Ga0500644_0012427 | Ga0500644_0012427_1157_1714 | 184 |
| 1498 | 3300053090 | Ga0500646_0093703 | Ga0500646_0093703_34_591 | 184 |
| 1499 | 3300053092 | Ga0500583_0037830 | Ga0500583_0037830_438_995 | 184 |
| 1500 | 3300053093 | Ga0500651_0207492 | Ga0500651_0207492_406_960 | 184 |
| 1501 | 3300053098 | Ga0500650_0159914 | Ga0500650_0159914_411_968 | 184 |
| 1502 | 3300053104 | Ga0500556_0109981 | Ga0500556_0109981_54_611 | 184 |
| 1503 | 3300053109 | Ga0500569_000284 | Ga0500569_000284_530_1087 | 184 |
| 1504 | 3300053131 | Ga0500652_003935 | Ga0500652_003935_2313_2867 | 184 |
| 1505 | 3300053131 | Ga0500652_181177 | Ga0500652_181177_194_751 | 184 |
| 1506 | 3300053134 | Ga0500658_0001077 | Ga0500658_0001077_140_697 | 184 |
| 1507 | 3300053139 | Ga0500568_0053162 | Ga0500568_0053162_16_570 | 184 |
| 1508 | 3300053142 | Ga0500577_0000711 | Ga0500577_0000711_1355_1912 | 184 |
| 1509 | 3300053146 | Ga0500588_0148287 | Ga0500588_0148287_215_769 | 184 |
| 1510 | 3300053148 | Ga0500590_052622 | Ga0500590_052622_1218_1775 | 184 |
| 1511 | 3300053153 | Ga0500616_0000013 | Ga0500616_0000013_180311_180868 | 184 |
| 1512 | 3300053153 | Ga0500616_0108629 | Ga0500616_0108629_748_1305 | 184 |
| 1513 | 3300053156 | Ga0500622_0000655 | Ga0500622_0000655_14936_15490 | 184 |
| 1514 | 3300053156 | Ga0500622_0022828 | Ga0500622_0022828_936_1493 | 184 |
| 1515 | 3300053156 | Ga0500622_0278125 | Ga0500622_0278125_49_603 | 184 |
| 1516 | 3300053158 | Ga0500627_0019206 | Ga0500627_0019206_1076_1630 | 184 |
| 1517 | 3300053160 | Ga0500633_0007899 | Ga0500633_0007899_797_1354 | 184 |
| 1518 | 3300053161 | Ga0500634_0210131 | Ga0500634_0210131_242_799 | 184 |
| 1519 | 3300053177 | Ga0500636_0005509 | Ga0500636_0005509_927_1484 | 184 |
| 1520 | 3300053732 | Ga0500656_018218 | Ga0500656_018218_23_580 | 184 |
| 1521 | 3300059493 | Ga0587077_000157 | Ga0587077_000157_502_1056 | 184 |
| 1522 | 3300059641 | Ga0587068_001506 | Ga0587068_001506_294_851 | 184 |
| 1523 | 3300061719 | Ga0466962_0058532 | Ga0466962_0058532_731_1285 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jil-assembly1.cif.gz_F | 70s ribosome flavobacterium johnsoniae | 0.9559 | 2 | 179 |
| 7jil-assembly1.cif.gz_F | 70s ribosome flavobacterium johnsoniae | 0.9507 | 2 | 179 |
| 8fn2-assembly1.cif.gz_H | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9362 | 1 | 180 |
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9297 | 9 | 176 |
| 8cgk-assembly1.cif.gz_g | lincomycin and avilamycin bound to the 50s subunit | 0.9284 | 2 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9537 | 2 | 83 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9449 | 1 | 83 | 3.90.930.12 |
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9425 | 2 | 83 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.934 | 1 | 83 | 3.90.930.12 |
| 4io9E01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9304 | 6 | 83 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5WP81-F1-model_v4 | Large subunit ribosomal protein | 0.9818 | 1 | 81 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A3D1BU16-F1-model_v4 | 50S ribosomal protein L6 | 0.9817 | 1 | 161 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A848UXI5-F1-model_v4 | 50S ribosomal protein L6 | 0.9793 | 26 | 184 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A2T2UG23-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL18; Large ribosomal subunit protein uL6] | 0.9783 | 1 | 172 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A355UDM7-F1-model_v4 | 50S ribosomal protein L6 | 0.9769 | 1 | 162 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar