F494549

General Info

Members Datasets Scaffolds Average Seq Length
1523 609 1479 179

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10086341|Ga0207683_100863411
Length 210
Sequence MAPNKPLLKSSITLPTSFRAPGVQSRNGRVVFPYSVVPGGVTVSVGTDNVVTVKGPKGELKQSVDRDIKVEVKDGNVEFGRPTDQIRHKALHGLYRSLVNNMVKGVTEGYKKQLELVGVGYKAANQGNTLDLALGFSHNIVFEVPKELKVATATEKGQNPKIFLEGSDKQLLGQVAAKLRSLRKPEPYKGKGVKYSDEVVRRKAGKAAGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2738541278 Niastella sp. CF465 Isolate Unclassified
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541283 Pedobacter sp. OK701 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2739367651 Pedobacter sp. OK291 Isolate Unclassified
12 2739367656 Pedobacter sp. CF523 Isolate Unclassified
13 2739367663 Pedobacter sp. YR510 Isolate Unclassified
14 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
15 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
16 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
17 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
18 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
19 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
20 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
21 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
22 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
23 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
24 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
25 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
26 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
27 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
28 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
29 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
30 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
31 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
32 2914759650 Rhizosphaericola mali Isolate Rhizosphere
33 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
34 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
35 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
36 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
37 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
38 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
39 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
40 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
41 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
42 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
43 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
57 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
70 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
71 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
79 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
80 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
86 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
98 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
99 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
100 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
101 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
102 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
103 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
104 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
108 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
111 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
114 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
115 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
116 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
117 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
118 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
122 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
123 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
134 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
135 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
138 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
139 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
140 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
141 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
142 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
143 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
144 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
145 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
146 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
149 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
150 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
151 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
152 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
153 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
154 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
155 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
156 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
157 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
162 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
163 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
164 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
165 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
180 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
181 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
182 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
183 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
184 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
187 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
188 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
189 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
190 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
191 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
192 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
193 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
194 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
195 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
196 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
197 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
198 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
201 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
203 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
206 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
207 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
208 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
210 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
213 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
215 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
286 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
288 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
302 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
303 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
304 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
305 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
306 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
307 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
308 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
309 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
310 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
311 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
312 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
313 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
314 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
317 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
318 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
319 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
320 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
321 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
322 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
323 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
324 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
329 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
334 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
335 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
338 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
344 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
345 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
346 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
347 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
348 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
349 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
350 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
351 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
352 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
353 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
354 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
355 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
356 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
357 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
358 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
359 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
360 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
361 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
362 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
363 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
364 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
365 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
366 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
367 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
368 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
369 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
370 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
371 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
372 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
373 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
374 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
375 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
376 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
377 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
378 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
379 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
380 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
381 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
382 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
383 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
384 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
385 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
386 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
387 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
388 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
389 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
390 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
391 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
392 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
393 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
394 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
395 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
396 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
397 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
398 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
399 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
400 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
401 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
402 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
403 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
404 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
405 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
406 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
407 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
408 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
409 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
410 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
411 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
412 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
413 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
418 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
419 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
420 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
421 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
424 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
425 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
428 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
440 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
441 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
442 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
443 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
444 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
445 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
446 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
447 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
448 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
449 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
450 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
451 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
452 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
453 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
454 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
455 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
456 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
457 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
458 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
459 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
460 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
461 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
462 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
463 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
464 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
465 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
466 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
467 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
468 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
469 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
470 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
471 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
472 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
473 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
474 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
475 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
476 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
477 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
481 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
482 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
483 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
484 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
494 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
495 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
521 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
522 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
523 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
524 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
525 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
526 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
527 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
528 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
529 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
530 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
531 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
532 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
533 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
534 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
535 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
536 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
537 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
538 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
539 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
540 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
541 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
542 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
543 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
544 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
545 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
546 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
547 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
548 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
549 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
550 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
551 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
552 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
553 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
554 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
555 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
556 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
557 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
558 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
559 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
560 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
561 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
562 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
563 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
564 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
566 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
567 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
568 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
569 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
570 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
571 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
572 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
573 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
574 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
575 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
576 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
577 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
578 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
579 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
580 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
581 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
582 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
583 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
584 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
585 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
586 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
587 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
588 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
589 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
590 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
591 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
592 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
593 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
594 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
595 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
596 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
597 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
598 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
599 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
600 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
601 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
602 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
603 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
606 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
607 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
608 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
609 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.24
Metatranscriptomes 3.87
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0.33
Rhizoplane 2.43
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 LJQas_1012500 3300000549 Bacteria 1004
3 JGI24740J21852_10000106 3300001979 Bacteria 29886
4 JGI24739J22299_10002345 3300001989 Bacteria 7297
5 JGI24739J22299_10036599 3300001989 Bacteria 1657
6 JGI25154J39366_1000001 3300002738 Bacteria 483450
7 JGI25157J39369_1005374 3300002741 Bacteria 2102
8 JGI25152J39213_1000006 3300002773 Bacteria 158516
9 JGI25150J39212_1000005 3300002774 Bacteria 311800
10 JGI25159J45721_1008657 3300002987 Bacteria 2772
11 JGI25151J46595_10000004 3300003187 Bacteria 494006
12 JGI25153J46596_10000004 3300003215 Bacteria 494006
13 JGI25153J46596_10002304 3300003215 Bacteria 11112
14 JGI25153J46596_10009633 3300003215 Bacteria 4456
15 JGI25153J46596_10081054 3300003215 Bacteria 809
16 rootH2_10052858 3300003320 Bacteria 6186
17 rootH2_10069215 3300003320 Bacteria 8580
18 rootH2_10116651 3300003320 Bacteria 2121
19 rootL2_10084253 3300003322 Bacteria 1942
20 rootH1_10008389 3300003323 Bacteria 21562
21 rootH1_10024399 3300003323 Bacteria 9655
22 rootH1_10137015 3300003323 Bacteria 3689
23 JGI26129J50193_1007612 3300003349 Unclassified 783
24 JGI25160J50197_1002424 3300003354 Bacteria 8693
25 JGI25160J50197_1004776 3300003354 Bacteria 5786
26 JGI25160J50197_1032347 3300003354 Bacteria 1330
27 JGI25160J50197_1051232 3300003354 Bacteria 874
28 Ga0006562J51391_1003423 3300003578 Bacteria 13910
29 Ga0055535_1006118 3300003761 Bacteria 2495
30 Ga0055542_1017834 3300003762 Bacteria 1090
31 Ga0055526_1004445 3300003771 Bacteria 8418
32 Ga0055528_1000330 3300003790 Bacteria 39818
33 Ga0055530_10000331 3300003791 Bacteria 42800
34 Ga0055531_10000133 3300003794 Bacteria 84995
35 Ga0055531_10000166 3300003794 Bacteria 74728
36 Ga0055531_10008711 3300003794 Bacteria 5300
37 Ga0058860_10114316 3300004801 Bacteria 13584
38 Ga0065165_1000105 3300005262 Bacteria 140409
39 Ga0065165_1007036 3300005262 Bacteria 5666
40 Ga0065714_10023783 3300005288 Bacteria 1302
41 Ga0065714_10156834 3300005288 Bacteria 1073
42 Ga0065704_10086392 3300005289 Bacteria 3122
43 Ga0065704_10103057 3300005289 Bacteria 2184
44 Ga0065712_10008429 3300005290 Bacteria 3026
45 Ga0065712_10008525 3300005290 Bacteria 2646
46 Ga0065712_10113906 3300005290 Bacteria 1772
47 Ga0065715_10093983 3300005293 Bacteria 4482
48 Ga0065715_10124098 3300005293 Bacteria 2162
49 Ga0065715_10177959 3300005293 Bacteria 1497
50 Ga0065715_10508194 3300005293 Bacteria 766
51 Ga0065715_10581349 3300005293 Bacteria 718
52 Ga0065707_10097311 3300005295 Bacteria 3185
53 Ga0070658_10009019 3300005327 Bacteria 8022
54 Ga0070658_10169704 3300005327 Bacteria 1833
55 Ga0070658_10186882 3300005327 Bacteria 1745
56 Ga0070658_10306771 3300005327 Bacteria 1354
57 Ga0070658_10343531 3300005327 Bacteria 1277
58 Ga0070658_10357028 3300005327 Bacteria 1251
59 Ga0070658_10530426 3300005327 Bacteria 1018
60 Ga0070658_10562857 3300005327 Unclassified 987
61 Ga0070658_11414870 3300005327 Bacteria 603
62 Ga0070676_10004653 3300005328 Bacteria 7249
63 Ga0070676_10024284 3300005328 Bacteria 3414
64 Ga0070676_10062712 3300005328 Bacteria 2212
65 Ga0070676_10313604 3300005328 Bacteria 1067
66 Ga0070676_10621000 3300005328 Bacteria 781
67 Ga0070676_11087944 3300005328 Bacteria 603
68 Ga0070683_100003340 3300005329 Bacteria 12981
69 Ga0070683_100009922 3300005329 Bacteria 8162
70 Ga0070683_100081164 3300005329 Bacteria 3036
71 Ga0070683_100241279 3300005329 Bacteria 1719
72 Ga0070683_100298539 3300005329 Bacteria 1532
73 Ga0070683_101267235 3300005329 Bacteria 708
74 Ga0070690_100233403 3300005330 Bacteria 1294
75 Ga0070690_100589134 3300005330 Bacteria 843
76 Ga0070670_100060731 3300005331 Bacteria 3245
77 Ga0070670_100468747 3300005331 Bacteria 1117
78 Ga0070677_10001593 3300005333 Bacteria 7176
79 Ga0070677_10046785 3300005333 Bacteria 1732
80 Ga0070677_10252608 3300005333 Bacteria 876
81 Ga0068869_100051776 3300005334 Bacteria 2979
82 Ga0068869_100185023 3300005334 Bacteria 1635
83 Ga0068869_100271127 3300005334 Bacteria 1362
84 Ga0068869_100442893 3300005334 Bacteria 1075
85 Ga0070666_10000191 3300005335 Bacteria 42149
86 Ga0070666_10189487 3300005335 Unclassified 1445
87 Ga0070666_10217369 3300005335 Bacteria 1347
88 Ga0070666_10463033 3300005335 Bacteria 916
89 Ga0070666_10507550 3300005335 Bacteria 875
90 Ga0070680_100064155 3300005336 Bacteria 3010
91 Ga0070680_100088507 3300005336 Bacteria 2561
92 Ga0070680_100259279 3300005336 Bacteria 1470
93 Ga0070680_100349840 3300005336 Bacteria 1256
94 Ga0070680_100411529 3300005336 Bacteria 1153
95 Ga0070682_100007172 3300005337 Bacteria 6277
96 Ga0070682_100010066 3300005337 Bacteria 5358
97 Ga0070682_100016944 3300005337 Bacteria 4241
98 Ga0070682_100126149 3300005337 Bacteria 1725
99 Ga0070682_100373008 3300005337 Bacteria 1071
100 Ga0070682_100686045 3300005337 Bacteria 820
101 Ga0070682_101108578 3300005337 Bacteria 663
102 Ga0068868_100004630 3300005338 Bacteria 9650
103 Ga0068868_100013181 3300005338 Bacteria 6055
104 Ga0068868_100344761 3300005338 Bacteria 1274
105 Ga0068868_100478873 3300005338 Bacteria 1087
106 Ga0070660_100180211 3300005339 Bacteria 1709
107 Ga0070660_100334563 3300005339 Bacteria 1245
108 Ga0070660_100384174 3300005339 Bacteria 1159
109 Ga0070660_100401734 3300005339 Bacteria 1133
110 Ga0070660_100652046 3300005339 Bacteria 882
111 Ga0070660_100926298 3300005339 Bacteria 735
112 Ga0070660_101030934 3300005339 Bacteria 695
113 Ga0070689_100053901 3300005340 Bacteria 3113
114 Ga0070689_100053903 3300005340 Bacteria 3113
115 Ga0070689_101177376 3300005340 Unclassified 687
116 Ga0070691_10005091 3300005341 Bacteria 5973
117 Ga0070691_10007739 3300005341 Bacteria 4920
118 Ga0070691_10038620 3300005341 Bacteria 2254
119 Ga0070691_10077262 3300005341 Bacteria 1625
120 Ga0070687_100019156 3300005343 Bacteria 3180
121 Ga0070687_100346159 3300005343 Bacteria 958
122 Ga0070661_100020833 3300005344 Bacteria 4678
123 Ga0070661_100065820 3300005344 Bacteria 2663
124 Ga0070661_100068143 3300005344 Bacteria 2615
125 Ga0070661_100579274 3300005344 Bacteria 905
126 Ga0070668_100004151 3300005347 Bacteria 10731
127 Ga0070668_100038069 3300005347 Bacteria 3674
128 Ga0070668_100271417 3300005347 Bacteria 1414
129 Ga0070668_100658622 3300005347 Bacteria 920
130 Ga0070669_100008677 3300005353 Bacteria 7251
131 Ga0070669_100125906 3300005353 Bacteria 1960
132 Ga0070669_100132566 3300005353 Bacteria 1913
133 Ga0070669_100140043 3300005353 Bacteria 1864
134 Ga0070669_100546586 3300005353 Bacteria 965
135 Ga0070669_100704253 3300005353 Bacteria 853
136 Ga0070675_100022693 3300005354 Bacteria 5014
137 Ga0070675_100070749 3300005354 Bacteria 2892
138 Ga0070675_100148933 3300005354 Bacteria 2005
139 Ga0070675_100149729 3300005354 Bacteria 2000
140 Ga0070675_100254829 3300005354 Bacteria 1537
141 Ga0070675_100266704 3300005354 Bacteria 1502
142 Ga0070675_100289788 3300005354 Bacteria 1440
143 Ga0070675_100361131 3300005354 Bacteria 1289
144 Ga0070671_100036529 3300005355 Bacteria 4074
145 Ga0070671_100190007 3300005355 Bacteria 1740
146 Ga0070674_100002220 3300005356 Bacteria 10679
147 Ga0070674_100087796 3300005356 Bacteria 2237
148 Ga0070673_100006656 3300005364 Bacteria 7534
149 Ga0070673_100011200 3300005364 Bacteria 6115
150 Ga0070673_100055828 3300005364 Bacteria 3113
151 Ga0070673_100160707 3300005364 Bacteria 1910
152 Ga0070673_100679499 3300005364 Bacteria 944
153 Ga0070673_101564579 3300005364 Bacteria 622
154 Ga0070688_100005699 3300005365 Bacteria 6582
155 Ga0070688_100037058 3300005365 Bacteria 2970
156 Ga0070688_100099130 3300005365 Bacteria 1918
157 Ga0070688_100416885 3300005365 Bacteria 997
158 Ga0070659_100265579 3300005366 Bacteria 1425
159 Ga0070659_100426578 3300005366 Bacteria 1122
160 Ga0070659_100541933 3300005366 Bacteria 995
161 Ga0070667_100000248 3300005367 Bacteria 61183
162 Ga0070667_100027949 3300005367 Bacteria 4694
163 Ga0070667_100074036 3300005367 Bacteria 2905
164 Ga0070667_100170442 3300005367 Bacteria 1921
165 Ga0070667_100194249 3300005367 Bacteria 1799
166 Ga0070667_100215840 3300005367 Bacteria 1706
167 Ga0070667_100230033 3300005367 Bacteria 1653
168 Ga0070667_100561217 3300005367 Bacteria 1050
169 Ga0070709_10178408 3300005434 Bacteria 1490
170 Ga0070714_100119027 3300005435 Bacteria 2347
171 Ga0070714_100166074 3300005435 Bacteria 2000
172 Ga0070714_100968588 3300005435 Bacteria 827
173 Ga0070713_100072196 3300005436 Bacteria 2919
174 Ga0070713_100549100 3300005436 Bacteria 1094
175 Ga0070713_100715239 3300005436 Bacteria 957
176 Ga0070710_10193372 3300005437 Bacteria 1281
177 Ga0070710_10244122 3300005437 Bacteria 1152
178 Ga0070701_10022246 3300005438 Bacteria 3037
179 Ga0070701_10355167 3300005438 Bacteria 917
180 Ga0070711_100132105 3300005439 Bacteria 1860
181 Ga0070711_100481273 3300005439 Bacteria 1020
182 Ga0070705_100842829 3300005440 Bacteria 733
183 Ga0070694_100087623 3300005444 Bacteria 2178
184 Ga0070694_100249688 3300005444 Bacteria 1341
185 Ga0070708_100001661 3300005445 Bacteria 17067
186 Ga0070708_100006987 3300005445 Bacteria 9006
187 Ga0070708_100021209 3300005445 Bacteria 5490
188 Ga0070708_100107836 3300005445 Bacteria 2557
189 Ga0070663_100084547 3300005455 Bacteria 2339
190 Ga0070663_100521323 3300005455 Bacteria 989
191 Ga0070678_100003711 3300005456 Bacteria 8544
192 Ga0070678_100064863 3300005456 Bacteria 2709
193 Ga0070678_100277908 3300005456 Bacteria 1415
194 Ga0070662_100007728 3300005457 Bacteria 6979
195 Ga0070662_100066199 3300005457 Bacteria 2650
196 Ga0070662_100094007 3300005457 Bacteria 2256
197 Ga0070662_100427648 3300005457 Bacteria 1096
198 Ga0070662_100485217 3300005457 Bacteria 1029
199 Ga0070662_100499086 3300005457 Bacteria 1015
200 Ga0070662_100637874 3300005457 Bacteria 898
201 Ga0070662_100734367 3300005457 Bacteria 837
202 Ga0070681_10083427 3300005458 Bacteria 3149
203 Ga0070681_10113109 3300005458 Bacteria 2654
204 Ga0070681_10229479 3300005458 Bacteria 1771
205 Ga0070681_10431495 3300005458 Bacteria 1230
206 Ga0068867_100063230 3300005459 Bacteria 2750
207 Ga0068867_100078755 3300005459 Bacteria 2479
208 Ga0068867_100123545 3300005459 Bacteria 2003
209 Ga0068867_100187653 3300005459 Bacteria 1648
210 Ga0070685_10015284 3300005466 Bacteria 4076
211 Ga0070685_10520902 3300005466 Bacteria 844
212 Ga0070706_100001389 3300005467 Bacteria 25655
213 Ga0070706_100031896 3300005467 Bacteria 4858
214 Ga0070706_100317757 3300005467 Bacteria 1452
215 Ga0070707_100000141 3300005468 Bacteria 67927
216 Ga0070707_100008479 3300005468 Bacteria 9549
217 Ga0070707_100020977 3300005468 Bacteria 6169
218 Ga0070707_100697027 3300005468 Bacteria 978
219 Ga0070698_100000139 3300005471 Bacteria 65079
220 Ga0070698_100002247 3300005471 Bacteria 21366
221 Ga0070698_100002802 3300005471 Bacteria 19186
222 Ga0070698_100005143 3300005471 Bacteria 14306
223 Ga0070698_100042072 3300005471 Bacteria 4687
224 Ga0070698_100296642 3300005471 Bacteria 1547
225 Ga0070698_100490060 3300005471 Bacteria 1166
226 Ga0070699_100001695 3300005518 Bacteria 20060
227 Ga0070699_100100649 3300005518 Bacteria 2533
228 Ga0070699_100230854 3300005518 Bacteria 1650
229 Ga0070699_100518074 3300005518 Bacteria 1084
230 Ga0070679_100002167 3300005530 Bacteria 17712
231 Ga0070679_100018421 3300005530 Bacteria 6776
232 Ga0070679_100122192 3300005530 Bacteria 2588
233 Ga0070679_100196306 3300005530 Bacteria 1986
234 Ga0070679_100455102 3300005530 Bacteria 1224
235 Ga0070684_100005718 3300005535 Bacteria 9552
236 Ga0070684_100021469 3300005535 Bacteria 5373
237 Ga0070684_100054023 3300005535 Bacteria 3499
238 Ga0070684_100222706 3300005535 Bacteria 1721
239 Ga0070684_100240060 3300005535 Bacteria 1656
240 Ga0070697_100000181 3300005536 Bacteria 51962
241 Ga0070697_100042276 3300005536 Bacteria 3688
242 Ga0070697_100069683 3300005536 Bacteria 2881
243 Ga0070697_100178920 3300005536 Bacteria 1797
244 Ga0070697_100440906 3300005536 Bacteria 1133
245 Ga0068853_100000250 3300005539 Bacteria 37737
246 Ga0068853_100006139 3300005539 Bacteria 9517
247 Ga0068853_100077661 3300005539 Bacteria 2901
248 Ga0068853_100143789 3300005539 Bacteria 2142
249 Ga0068853_100642229 3300005539 Bacteria 1010
250 Ga0068853_100736552 3300005539 Bacteria 942
251 Ga0068853_100836277 3300005539 Bacteria 882
252 Ga0070672_100001565 3300005543 Bacteria 14168
253 Ga0070672_100015656 3300005543 Bacteria 5410
254 Ga0070672_100038692 3300005543 Bacteria 3647
255 Ga0070672_100045260 3300005543 Bacteria 3403
256 Ga0070672_100175780 3300005543 Bacteria 1782
257 Ga0070672_100199872 3300005543 Bacteria 1671
258 Ga0070686_100042966 3300005544 Bacteria 2833
259 Ga0070686_100142468 3300005544 Bacteria 1670
260 Ga0070695_100136072 3300005545 Bacteria 1698
261 Ga0070696_100728298 3300005546 Bacteria 811
262 Ga0070665_100000641 3300005548 Bacteria 47468
263 Ga0070665_100018617 3300005548 Bacteria 6960
264 Ga0070665_100027047 3300005548 Bacteria 5777
265 Ga0070665_100293202 3300005548 Bacteria 1629
266 Ga0070704_100174793 3300005549 Bacteria 1712
267 Ga0070704_101042778 3300005549 Bacteria 741
268 Ga0068855_100000133 3300005563 Bacteria 94906
269 Ga0068855_100003486 3300005563 Bacteria 19264
270 Ga0068855_100019947 3300005563 Bacteria 8051
271 Ga0068855_100060509 3300005563 Bacteria 4429
272 Ga0068855_100205594 3300005563 Bacteria 2215
273 Ga0068855_100235336 3300005563 Bacteria 2048
274 Ga0068855_100578001 3300005563 Bacteria 1214
275 Ga0068855_100719953 3300005563 Bacteria 1066
276 Ga0068855_101019638 3300005563 Bacteria 869
277 Ga0070664_100008033 3300005564 Bacteria 8527
278 Ga0070664_100009616 3300005564 Bacteria 7841
279 Ga0070664_100020536 3300005564 Bacteria 5439
280 Ga0070664_100359643 3300005564 Bacteria 1325
281 Ga0070664_100387209 3300005564 Bacteria 1277
282 Ga0070664_100412715 3300005564 Bacteria 1236
283 Ga0070664_100436905 3300005564 Bacteria 1200
284 Ga0070664_101143510 3300005564 Bacteria 734
285 Ga0070664_101220799 3300005564 Bacteria 709
286 Ga0068857_100006227 3300005577 Bacteria 10201
287 Ga0068857_100024735 3300005577 Bacteria 5289
288 Ga0068857_100046762 3300005577 Bacteria 3841
289 Ga0068857_100085235 3300005577 Bacteria 2824
290 Ga0068857_100100573 3300005577 Bacteria 2593
291 Ga0068857_100268992 3300005577 Bacteria 1566
292 Ga0068857_100309363 3300005577 Bacteria 1457
293 Ga0068857_100315809 3300005577 Bacteria 1442
294 Ga0068857_100343991 3300005577 Bacteria 1380
295 Ga0068857_100596109 3300005577 Bacteria 1044
296 Ga0068854_100014628 3300005578 Bacteria 5178
297 Ga0068854_100021100 3300005578 Bacteria 4417
298 Ga0068854_100590613 3300005578 Bacteria 947
299 Ga0068854_100749247 3300005578 Bacteria 847
300 Ga0068856_100028869 3300005614 Bacteria 5420
301 Ga0068856_100100151 3300005614 Bacteria 2889
302 Ga0068856_100102289 3300005614 Bacteria 2858
303 Ga0068856_100154352 3300005614 Bacteria 2306
304 Ga0068856_100282487 3300005614 Bacteria 1676
305 Ga0068856_100720216 3300005614 Bacteria 1018
306 Ga0070702_100058590 3300005615 Bacteria 2232
307 Ga0070702_100130492 3300005615 Bacteria 1586
308 Ga0070702_100339189 3300005615 Bacteria 1054
309 Ga0068852_100029891 3300005616 Bacteria 4479
310 Ga0068852_100048492 3300005616 Bacteria 3629
311 Ga0068852_100081986 3300005616 Bacteria 2865
312 Ga0068852_100448814 3300005616 Bacteria 1276
313 Ga0068852_100474206 3300005616 Bacteria 1242
314 Ga0068852_100569972 3300005616 Bacteria 1134
315 Ga0068852_100980316 3300005616 Bacteria 864
316 Ga0068859_100037937 3300005617 Bacteria 4835
317 Ga0068859_100104175 3300005617 Bacteria 2896
318 Ga0068859_100173657 3300005617 Bacteria 2237
319 Ga0068859_100191198 3300005617 Bacteria 2131
320 Ga0068864_100005272 3300005618 Bacteria 10592
321 Ga0068864_100015889 3300005618 Bacteria 6265
322 Ga0068864_100034196 3300005618 Bacteria 4322
323 Ga0068864_100112202 3300005618 Bacteria 2430
324 Ga0068864_100176796 3300005618 Bacteria 1949
325 Ga0068864_100323618 3300005618 Bacteria 1448
326 Ga0068864_100358046 3300005618 Bacteria 1378
327 Ga0068864_100529709 3300005618 Unclassified 1137
328 Ga0068864_101385571 3300005618 Bacteria 705
329 Ga0068866_10043211 3300005718 Bacteria 2248
330 Ga0068866_10215915 3300005718 Bacteria 1154
331 Ga0068861_100028330 3300005719 Bacteria 4086
332 Ga0068851_10001337 3300005834 Bacteria 10765
333 Ga0068870_10321014 3300005840 Bacteria 984
334 Ga0068863_100001373 3300005841 Bacteria 24175
335 Ga0068863_100292329 3300005841 Bacteria 1579
336 Ga0068863_100412768 3300005841 Bacteria 1322
337 Ga0068863_100545888 3300005841 Bacteria 1144
338 Ga0068863_100955446 3300005841 Bacteria 859
339 Ga0068858_100009451 3300005842 Bacteria 9299
340 Ga0068860_100004260 3300005843 Bacteria 14650
341 Ga0068860_100007830 3300005843 Bacteria 10668
342 Ga0068860_100022955 3300005843 Bacteria 6033
343 Ga0068862_100468583 3300005844 Bacteria 1190
344 Ga0068862_101143425 3300005844 Bacteria 775
345 Ga0081539_10002233 3300005985 Bacteria 28209
346 Ga0081539_10096810 3300005985 Bacteria 1512
347 Ga0081539_10115723 3300005985 Bacteria 1341
348 Ga0070717_10027264 3300006028 Bacteria 4565
349 Ga0070717_10088723 3300006028 Bacteria 2607
350 Ga0070717_10572561 3300006028 Bacteria 1024
351 Ga0075432_10196707 3300006058 Bacteria 796
352 Ga0070716_100093082 3300006173 Bacteria 1829
353 Ga0070712_100140461 3300006175 Bacteria 1842
354 Ga0070712_100144992 3300006175 Bacteria 1816
355 Ga0070712_100195740 3300006175 Bacteria 1585
356 Ga0075362_10019709 3300006177 Bacteria 2809
357 Ga0075366_10005546 3300006195 Bacteria 6839
358 Ga0075366_10005748 3300006195 Bacteria 6733
359 Ga0075366_10052705 3300006195 Bacteria 2417
360 Ga0075366_10055884 3300006195 Bacteria 2344
361 Ga0075366_10063553 3300006195 Bacteria 2194
362 Ga0075366_10190067 3300006195 Bacteria 1248
363 Ga0075366_10303361 3300006195 Bacteria 977
364 Ga0075366_10391996 3300006195 Bacteria 854
365 Ga0097621_100015711 3300006237 Bacteria 5704
366 Ga0097621_100218088 3300006237 Bacteria 1661
367 Ga0097621_100362135 3300006237 Bacteria 1292
368 Ga0097621_100702806 3300006237 Bacteria 931
369 Ga0075370_10010465 3300006353 Bacteria 4852
370 Ga0068871_100015089 3300006358 Bacteria 5775
371 Ga0068871_100017988 3300006358 Bacteria 5361
372 Ga0068871_100274363 3300006358 Bacteria 1473
373 Ga0068871_100337625 3300006358 Bacteria 1330
374 Ga0068871_100597142 3300006358 Bacteria 1004
375 Ga0068871_101323254 3300006358 Bacteria 678
376 Ga0075428_100013576 3300006844 Bacteria 9071
377 Ga0075428_100041637 3300006844 Bacteria 5050
378 Ga0075430_100011474 3300006846 Bacteria 7527
379 Ga0075431_100022872 3300006847 Bacteria 6389
380 Ga0075431_100051260 3300006847 Bacteria 4257
381 Ga0075431_100276634 3300006847 Bacteria 1700
382 Ga0075434_100350726 3300006871 Bacteria 1497
383 Ga0075429_100048422 3300006880 Bacteria 3696
384 Ga0075429_100070557 3300006880 Unclassified 3042
385 Ga0075429_100221343 3300006880 Bacteria 1658
386 Ga0068865_100003571 3300006881 Bacteria 9342
387 Ga0068865_100036788 3300006881 Bacteria 3302
388 Ga0068865_100672503 3300006881 Bacteria 882
389 Ga0075436_100077507 3300006914 Bacteria 2302
390 Ga0075436_100768590 3300006914 Bacteria 716
391 Ga0097620_100037934 3300006931 Bacteria 4835
392 Ga0097620_100104177 3300006931 Bacteria 2896
393 Ga0097620_100173665 3300006931 Bacteria 2237
394 Ga0097620_100191198 3300006931 Bacteria 2131
395 Ga0099824_1003374 3300006942 Bacteria 23361
396 Ga0079104_1060427 3300006946 Bacteria 818
397 Ga0099826_10000125 3300006948 Bacteria 34471
398 Ga0075435_100077319 3300007076 Bacteria 2728
399 Ga0105244_10017933 3300009036 Bacteria 3985
400 Ga0105244_10354646 3300009036 Bacteria 676
401 Ga0105240_10000398 3300009093 Bacteria 81045
402 Ga0105240_10011307 3300009093 Bacteria 12434
403 Ga0105240_10016926 3300009093 Bacteria 9853
404 Ga0105240_10050473 3300009093 Bacteria 5244
405 Ga0105240_10059925 3300009093 Bacteria 4747
406 Ga0105240_10194521 3300009093 Bacteria 2382
407 Ga0105240_10254590 3300009093 Bacteria 2028
408 Ga0105240_10366202 3300009093 Bacteria 1631
409 Ga0105240_10443235 3300009093 Bacteria 1455
410 Ga0105240_10609984 3300009093 Bacteria 1200
411 Ga0111539_10042072 3300009094 Bacteria 5489
412 Ga0111539_10236719 3300009094 Bacteria 2125
413 Ga0111539_11024621 3300009094 Unclassified 960
414 Ga0111539_11573137 3300009094 Bacteria 762
415 Ga0105245_10088801 3300009098 Bacteria 2840
416 Ga0105245_10274777 3300009098 Bacteria 1645
417 Ga0105245_10296671 3300009098 Bacteria 1584
418 Ga0105247_10060663 3300009101 Bacteria 2344
419 Ga0105247_10102224 3300009101 Bacteria 1833
420 Ga0114129_10006463 3300009147 Bacteria 16621
421 Ga0114129_10350815 3300009147 Bacteria 1955
422 Ga0114129_10999154 3300009147 Bacteria 1054
423 Ga0105241_10000769 3300009174 Bacteria 24406
424 Ga0105241_10027526 3300009174 Bacteria 4235
425 Ga0105241_10078388 3300009174 Bacteria 2581
426 Ga0105241_10083318 3300009174 Bacteria 2509
427 Ga0105241_10145153 3300009174 Bacteria 1936
428 Ga0105241_10174702 3300009174 Bacteria 1777
429 Ga0105241_10247098 3300009174 Bacteria 1511
430 Ga0105241_10263697 3300009174 Bacteria 1465
431 Ga0105242_10013197 3300009176 Bacteria 6378
432 Ga0105242_10043231 3300009176 Bacteria 3644
433 Ga0105242_10066640 3300009176 Bacteria 2975
434 Ga0105248_10198497 3300009177 Bacteria 2260
435 Ga0105248_10311359 3300009177 Bacteria 1773
436 Ga0105248_11519373 3300009177 Bacteria 758
437 Ga0105237_10002553 3300009545 Bacteria 22488
438 Ga0105237_10002614 3300009545 Bacteria 22176
439 Ga0105237_10026344 3300009545 Bacteria 5942
440 Ga0105237_10033162 3300009545 Bacteria 5232
441 Ga0105237_10037227 3300009545 Bacteria 4919
442 Ga0105237_10427042 3300009545 Bacteria 1331
443 Ga0105238_10008067 3300009551 Bacteria 10530
444 Ga0105238_10439991 3300009551 Bacteria 1300
445 Ga0105249_10000247 3300009553 Bacteria 59908
446 Ga0105249_10182013 3300009553 Bacteria 2045
447 Ga0105239_10000436 3300010375 Bacteria 61031
448 Ga0105239_10010718 3300010375 Bacteria 10239
449 Ga0105239_10086030 3300010375 Bacteria 3465
450 Ga0105239_10212579 3300010375 Bacteria 2168
451 Ga0105239_10253214 3300010375 Bacteria 1978
452 Ga0105239_10320114 3300010375 Bacteria 1749
453 Ga0105239_10959003 3300010375 Bacteria 983
454 Ga0105246_10010740 3300011119 Bacteria 5674
455 Ga0105246_10298781 3300011119 Unclassified 1299
456 Ga0105246_10395794 3300011119 Bacteria 1146
457 Ga0157373_10123735 3300013100 Bacteria 1818
458 Ga0157373_10169698 3300013100 Bacteria 1535
459 Ga0157373_10336033 3300013100 Bacteria 1076
460 Ga0157373_10420570 3300013100 Bacteria 959
461 Ga0157373_10570695 3300013100 Unclassified 822
462 Ga0157371_10001678 3300013102 Bacteria 22612
463 Ga0157371_10016037 3300013102 Bacteria 5602
464 Ga0157371_10019616 3300013102 Bacteria 4981
465 Ga0157371_10087179 3300013102 Bacteria 2211
466 Ga0157371_10308206 3300013102 Bacteria 1147
467 Ga0157371_10334383 3300013102 Bacteria 1101
468 Ga0157371_10468294 3300013102 Bacteria 928
469 Ga0157371_10679687 3300013102 Bacteria 770
470 Ga0157370_10072569 3300013104 Bacteria 3247
471 Ga0157370_10075905 3300013104 Bacteria 3167
472 Ga0157370_10086830 3300013104 Bacteria 2938
473 Ga0157370_10127974 3300013104 Bacteria 2370
474 Ga0157370_10139130 3300013104 Bacteria 2262
475 Ga0157370_10290292 3300013104 Bacteria 1511
476 Ga0157370_10402029 3300013104 Bacteria 1261
477 Ga0157370_10413261 3300013104 Bacteria 1242
478 Ga0157370_10453181 3300013104 Bacteria 1179
479 Ga0157370_10509257 3300013104 Bacteria 1105
480 Ga0157370_10536180 3300013104 Bacteria 1073
481 Ga0157370_10551623 3300013104 Bacteria 1056
482 Ga0157370_10739218 3300013104 Bacteria 897
483 Ga0157370_10890643 3300013104 Bacteria 808
484 Ga0157370_11183978 3300013104 Bacteria 690
485 Ga0157370_11238193 3300013104 Bacteria 673
486 Ga0157369_10000023 3300013105 Bacteria 226955
487 Ga0157369_10000613 3300013105 Bacteria 46357
488 Ga0157369_10032433 3300013105 Bacteria 5745
489 Ga0157369_10071232 3300013105 Bacteria 3732
490 Ga0157369_10135046 3300013105 Bacteria 2612
491 Ga0157369_10346409 3300013105 Bacteria 1543
492 Ga0157369_10541989 3300013105 Bacteria 1203
493 Ga0157369_10777525 3300013105 Bacteria 984
494 Ga0157369_10781971 3300013105 Unclassified 981
495 Ga0157369_10787754 3300013105 Bacteria 977
496 Ga0157369_11055116 3300013105 Bacteria 831
497 Ga0157374_10007705 3300013296 Bacteria 9193
498 Ga0157374_10055359 3300013296 Bacteria 3702
499 Ga0157374_10172431 3300013296 Bacteria 2111
500 Ga0157374_10180882 3300013296 Bacteria 2060
501 Ga0157374_10320385 3300013296 Bacteria 1536
502 Ga0157374_10832188 3300013296 Bacteria 939
503 Ga0157378_10005083 3300013297 Bacteria 11558
504 Ga0157378_10008184 3300013297 Bacteria 9121
505 Ga0157378_10019722 3300013297 Bacteria 5929
506 Ga0157378_10087620 3300013297 Bacteria 2824
507 Ga0157378_10163750 3300013297 Bacteria 2082
508 Ga0157378_10181392 3300013297 Bacteria 1981
509 Ga0157378_10445427 3300013297 Bacteria 1284
510 Ga0157378_10605303 3300013297 Bacteria 1107
511 Ga0163162_10008143 3300013306 Bacteria 10230
512 Ga0163162_10022452 3300013306 Bacteria 6216
513 Ga0163162_10102052 3300013306 Bacteria 2961
514 Ga0163162_10393923 3300013306 Bacteria 1518
515 Ga0163162_10469381 3300013306 Bacteria 1390
516 Ga0163162_10654724 3300013306 Bacteria 1174
517 Ga0163162_10711473 3300013306 Bacteria 1125
518 Ga0163162_11679631 3300013306 Bacteria 725
519 Ga0157372_10003109 3300013307 Bacteria 17892
520 Ga0157372_10017897 3300013307 Bacteria 7614
521 Ga0157372_10027457 3300013307 Bacteria 6200
522 Ga0157372_10032433 3300013307 Bacteria 5728
523 Ga0157372_10048397 3300013307 Bacteria 4726
524 Ga0157372_10053864 3300013307 Bacteria 4485
525 Ga0157372_10054127 3300013307 Bacteria 4475
526 Ga0157372_10093748 3300013307 Bacteria 3418
527 Ga0157372_10110207 3300013307 Bacteria 3153
528 Ga0157372_10120036 3300013307 Bacteria 3018
529 Ga0157372_10160741 3300013307 Bacteria 2596
530 Ga0157372_10163953 3300013307 Bacteria 2569
531 Ga0157372_10468633 3300013307 Bacteria 1468
532 Ga0157372_11026389 3300013307 Bacteria 955
533 Ga0157372_11520980 3300013307 Bacteria 771
534 Ga0157375_10010453 3300013308 Bacteria 8166
535 Ga0157375_10035811 3300013308 Bacteria 4742
536 Ga0157375_10099282 3300013308 Bacteria 2990
537 Ga0157375_10115562 3300013308 Bacteria 2787
538 Ga0157375_10434170 3300013308 Bacteria 1479
539 Ga0157375_10564583 3300013308 Bacteria 1299
540 Ga0157375_10581980 3300013308 Bacteria 1280
541 Ga0157375_10865563 3300013308 Bacteria 1049
542 Ga0163163_10023493 3300014325 Bacteria 5852
543 Ga0163163_10069920 3300014325 Bacteria 3495
544 Ga0163163_10105619 3300014325 Bacteria 2842
545 Ga0163163_10139608 3300014325 Bacteria 2465
546 Ga0163163_11379332 3300014325 Bacteria 767
547 Ga0157380_10018384 3300014326 Bacteria 5186
548 Ga0157380_10109862 3300014326 Bacteria 2314
549 Ga0157380_10141735 3300014326 Bacteria 2066
550 Ga0157380_10153019 3300014326 Bacteria 1996
551 Ga0157380_10382952 3300014326 Bacteria 1328
552 Ga0157380_10453539 3300014326 Bacteria 1232
553 Ga0157380_10914621 3300014326 Bacteria 904
554 Ga0182008_10003643 3300014497 Bacteria 9192
555 Ga0157377_10023986 3300014745 Bacteria 3240
556 Ga0157377_10070039 3300014745 Bacteria 2025
557 Ga0157379_10000845 3300014968 Bacteria 24814
558 Ga0157379_10258780 3300014968 Bacteria 1581
559 Ga0157379_10465606 3300014968 Bacteria 1168
560 Ga0157379_10675067 3300014968 Bacteria 969
561 Ga0157379_10879361 3300014968 Bacteria 849
562 Ga0157376_10011738 3300014969 Bacteria 6470
563 Ga0157376_10050917 3300014969 Unclassified 3438
564 Ga0157376_10162799 3300014969 Bacteria 2024
565 Ga0157376_10188093 3300014969 Bacteria 1892
566 Ga0157376_10215918 3300014969 Bacteria 1773
567 Ga0157376_10229581 3300014969 Bacteria 1723
568 Ga0182006_1000103 3300015261 Bacteria 93638
569 Ga0182006_1166423 3300015261 Bacteria 740
570 Ga0182007_10000002 3300015262 Bacteria 564661
571 Ga0182007_10084666 3300015262 Bacteria 1041
572 Ga0182005_1000147 3300015265 Bacteria 49428
573 Ga0163161_10000039 3300017792 Bacteria 148130
574 Ga0163161_10011145 3300017792 Bacteria 6229
575 Ga0163161_10079062 3300017792 Bacteria 2417
576 Ga0163161_10085599 3300017792 Bacteria 2325
577 Ga0163161_10139438 3300017792 Bacteria 1835
578 Ga0163161_10379068 3300017792 Bacteria 1130
579 Ga0163161_10460238 3300017792 Bacteria 1030
580 Ga0163161_10504512 3300017792 Bacteria 986
581 Ga0206356_10956043 3300020070 Bacteria 1945
582 Ga0206356_11673591 3300020070 Bacteria 1607
583 Ga0206351_10597380 3300020077 Bacteria 1411
584 Ga0206354_10616054 3300020081 Bacteria 1282
585 Ga0206354_11354915 3300020081 Bacteria 1557
586 Ga0206353_11411444 3300020082 Bacteria 1221
587 Ga0213876_10015549 3300021384 Bacteria 4026
588 Ga0213876_10038947 3300021384 Bacteria 2510
589 Ga0213876_10059966 3300021384 Bacteria 2008
590 Ga0213876_10153069 3300021384 Bacteria 1226
591 Ga0209436_100232 3300025208 Bacteria 25536
592 Ga0209436_103246 3300025208 Bacteria 4411
593 Ga0209258_100041 3300025242 Bacteria 381381
594 Ga0207425_1000008 3300025245 Bacteria 618024
595 Ga0209646_1000002 3300025246 Bacteria 1425781
596 Ga0209026_1000299 3300025250 Bacteria 54147
597 Ga0209148_1000090 3300025254 Bacteria 250982
598 Ga0209129_1000040 3300025258 Bacteria 313043
599 Ga0209673_1000034 3300025273 Bacteria 328788
600 Ga0209130_1001055 3300025284 Bacteria 20897
601 Ga0209025_1000020 3300025294 Bacteria 618024
602 Ga0209564_1011927 3300025295 Bacteria 3840
603 Ga0209564_1031946 3300025295 Bacteria 1595
604 Ga0209758_1000022 3300025297 Bacteria 618024
605 Ga0209758_1001438 3300025297 Bacteria 28062
606 Ga0209758_1022949 3300025297 Bacteria 2839
607 Ga0209758_1030098 3300025297 Bacteria 2255
608 Ga0209050_1000207 3300025298 Bacteria 131328
609 Ga0209050_1002964 3300025298 Bacteria 13262
610 Ga0207426_1000105 3300025302 Bacteria 247269
611 Ga0207426_1000603 3300025302 Bacteria 46872
612 Ga0207426_1000813 3300025302 Bacteria 33506
613 Ga0207426_1001314 3300025302 Bacteria 21207
614 Ga0207426_1012108 3300025302 Bacteria 3255
615 Ga0207426_1045428 3300025302 Bacteria 1336
616 Ga0209257_1000001 3300025304 Bacteria 2274655
617 Ga0209257_1000007 3300025304 Bacteria 1564415
618 Ga0209257_1001824 3300025304 Bacteria 23309
619 Ga0207697_10008991 3300025315 Bacteria 4335
620 Ga0207697_10168485 3300025315 Bacteria 957
621 Ga0207656_10002290 3300025321 Bacteria 6429
622 Ga0207655_1000038 3300025728 Bacteria 348340
623 Ga0207682_10005663 3300025893 Bacteria 5074
624 Ga0207682_10021729 3300025893 Bacteria 2525
625 Ga0207682_10029977 3300025893 Bacteria 2177
626 Ga0207682_10049495 3300025893 Bacteria 1735
627 Ga0207682_10064402 3300025893 Bacteria 1540
628 Ga0207682_10383149 3300025893 Bacteria 664
629 Ga0207692_10063935 3300025898 Bacteria 1914
630 Ga0207692_10283514 3300025898 Bacteria 1003
631 Ga0207692_10341726 3300025898 Bacteria 921
632 Ga0207642_10023001 3300025899 Bacteria 2482
633 Ga0207642_10389518 3300025899 Bacteria 831
634 Ga0207710_10049842 3300025900 Bacteria 1877
635 Ga0207688_10118589 3300025901 Bacteria 1542
636 Ga0207680_10000957 3300025903 Bacteria 13597
637 Ga0207680_10108367 3300025903 Bacteria 1797
638 Ga0207680_10161717 3300025903 Bacteria 1502
639 Ga0207647_10050985 3300025904 Bacteria 2560
640 Ga0207647_10060143 3300025904 Bacteria 2323
641 Ga0207647_10333726 3300025904 Bacteria 860
642 Ga0207685_10319617 3300025905 Bacteria 774
643 Ga0207699_10159810 3300025906 Bacteria 1499
644 Ga0207645_10003925 3300025907 Bacteria 11107
645 Ga0207645_10047294 3300025907 Bacteria 2747
646 Ga0207645_10197099 3300025907 Bacteria 1324
647 Ga0207645_10636283 3300025907 Bacteria 725
648 Ga0207643_10105259 3300025908 Bacteria 1658
649 Ga0207705_10002123 3300025909 Bacteria 15388
650 Ga0207705_10006233 3300025909 Bacteria 8858
651 Ga0207705_10027457 3300025909 Bacteria 4059
652 Ga0207705_10162822 3300025909 Bacteria 1676
653 Ga0207705_10287956 3300025909 Bacteria 1258
654 Ga0207705_10450797 3300025909 Bacteria 997
655 Ga0207705_10610307 3300025909 Bacteria 848
656 Ga0207684_10000188 3300025910 Bacteria 97995
657 Ga0207684_10041535 3300025910 Bacteria 3899
658 Ga0207684_10205446 3300025910 Bacteria 1699
659 Ga0207684_10207259 3300025910 Bacteria 1691
660 Ga0207654_10048247 3300025911 Bacteria 2436
661 Ga0207654_10180937 3300025911 Bacteria 1375
662 Ga0207654_10292629 3300025911 Bacteria 1105
663 Ga0207654_10310569 3300025911 Bacteria 1075
664 Ga0207654_10418340 3300025911 Bacteria 935
665 Ga0207707_10000051 3300025912 Bacteria 117204
666 Ga0207707_10009127 3300025912 Bacteria 8613
667 Ga0207707_10171625 3300025912 Bacteria 1895
668 Ga0207707_10504761 3300025912 Bacteria 1031
669 Ga0207695_10000076 3300025913 Bacteria 307969
670 Ga0207695_10000090 3300025913 Bacteria 272143
671 Ga0207695_10004617 3300025913 Bacteria 18682
672 Ga0207695_10009751 3300025913 Bacteria 11818
673 Ga0207695_10013424 3300025913 Bacteria 9771
674 Ga0207695_10020633 3300025913 Bacteria 7543
675 Ga0207695_10042816 3300025913 Bacteria 4831
676 Ga0207695_10060304 3300025913 Bacteria 3928
677 Ga0207695_10072097 3300025913 Bacteria 3526
678 Ga0207695_10129510 3300025913 Bacteria 2482
679 Ga0207695_10326487 3300025913 Bacteria 1423
680 Ga0207695_10824849 3300025913 Bacteria 807
681 Ga0207671_10000762 3300025914 Bacteria 40951
682 Ga0207671_10003750 3300025914 Bacteria 14958
683 Ga0207671_10005849 3300025914 Bacteria 11173
684 Ga0207671_10022562 3300025914 Bacteria 4756
685 Ga0207671_10029007 3300025914 Bacteria 4134
686 Ga0207671_10197519 3300025914 Bacteria 1570
687 Ga0207663_10272547 3300025916 Bacteria 1254
688 Ga0207660_10155047 3300025917 Bacteria 1763
689 Ga0207660_10172670 3300025917 Bacteria 1674
690 Ga0207660_10318693 3300025917 Bacteria 1241
691 Ga0207662_10007273 3300025918 Bacteria 6019
692 Ga0207657_10001138 3300025919 Bacteria 28229
693 Ga0207657_10090942 3300025919 Bacteria 2546
694 Ga0207657_10122866 3300025919 Bacteria 2135
695 Ga0207657_10141001 3300025919 Bacteria 1969
696 Ga0207657_10729739 3300025919 Bacteria 768
697 Ga0207649_10016202 3300025920 Bacteria 4198
698 Ga0207649_10019877 3300025920 Bacteria 3844
699 Ga0207649_10061543 3300025920 Bacteria 2363
700 Ga0207652_10536478 3300025921 Bacteria 1052
701 Ga0207646_10000238 3300025922 Bacteria 75978
702 Ga0207646_10000258 3300025922 Bacteria 72085
703 Ga0207646_10028761 3300025922 Bacteria 5056
704 Ga0207646_10117918 3300025922 Bacteria 2384
705 Ga0207646_10119383 3300025922 Bacteria 2369
706 Ga0207646_11088683 3300025922 Bacteria 704
707 Ga0207681_10296179 3300025923 Bacteria 1279
708 Ga0207681_10532272 3300025923 Bacteria 965
709 Ga0207681_10696836 3300025923 Bacteria 844
710 Ga0207694_10223798 3300025924 Bacteria 1535
711 Ga0207650_10010393 3300025925 Bacteria 6382
712 Ga0207650_10030217 3300025925 Bacteria 3901
713 Ga0207650_10030666 3300025925 Bacteria 3875
714 Ga0207650_10258272 3300025925 Bacteria 1412
715 Ga0207659_10023967 3300025926 Bacteria 4083
716 Ga0207659_10024258 3300025926 Bacteria 4060
717 Ga0207659_10027831 3300025926 Bacteria 3833
718 Ga0207659_10059948 3300025926 Bacteria 2737
719 Ga0207659_10342424 3300025926 Bacteria 1238
720 Ga0207659_10455869 3300025926 Bacteria 1078
721 Ga0207659_10595457 3300025926 Bacteria 942
722 Ga0207659_11180188 3300025926 Bacteria 658
723 Ga0207687_10403595 3300025927 Bacteria 1124
724 Ga0207700_10040763 3300025928 Bacteria 3391
725 Ga0207700_10220515 3300025928 Bacteria 1607
726 Ga0207700_10520674 3300025928 Bacteria 1054
727 Ga0207664_10035039 3300025929 Bacteria 3870
728 Ga0207664_10068385 3300025929 Bacteria 2853
729 Ga0207664_10554156 3300025929 Bacteria 1031
730 Ga0207644_10019521 3300025931 Bacteria 4599
731 Ga0207644_10562384 3300025931 Bacteria 945
732 Ga0207644_10853110 3300025931 Bacteria 763
733 Ga0207690_10142736 3300025932 Bacteria 1766
734 Ga0207690_10170316 3300025932 Bacteria 1631
735 Ga0207690_10421218 3300025932 Bacteria 1068
736 Ga0207706_10023803 3300025933 Bacteria 5494
737 Ga0207706_10073828 3300025933 Bacteria 2999
738 Ga0207706_10275820 3300025933 Bacteria 1467
739 Ga0207686_10180303 3300025934 Bacteria 1497
740 Ga0207686_10278695 3300025934 Bacteria 1233
741 Ga0207709_10134731 3300025935 Bacteria 1689
742 Ga0207670_10104915 3300025936 Bacteria 2025
743 Ga0207670_10180630 3300025936 Bacteria 1589
744 Ga0207670_10904556 3300025936 Bacteria 739
745 Ga0207669_10015591 3300025937 Bacteria 3836
746 Ga0207669_10028016 3300025937 Bacteria 3093
747 Ga0207704_10018685 3300025938 Bacteria 3625
748 Ga0207704_10800941 3300025938 Bacteria 787
749 Ga0207665_10034509 3300025939 Bacteria 3356
750 Ga0207665_10108119 3300025939 Bacteria 1951
751 Ga0207665_10553953 3300025939 Bacteria 894
752 Ga0207691_10000001 3300025940 Bacteria 220829
753 Ga0207691_10002741 3300025940 Bacteria 17182
754 Ga0207691_10016872 3300025940 Bacteria 6929
755 Ga0207691_10021049 3300025940 Bacteria 6162
756 Ga0207691_10037594 3300025940 Bacteria 4483
757 Ga0207691_10084460 3300025940 Bacteria 2850
758 Ga0207711_10168742 3300025941 Bacteria 1985
759 Ga0207711_11074903 3300025941 Bacteria 745
760 Ga0207689_10007410 3300025942 Bacteria 9621
761 Ga0207689_10108306 3300025942 Bacteria 2283
762 Ga0207689_10108678 3300025942 Bacteria 2279
763 Ga0207689_10258512 3300025942 Bacteria 1440
764 Ga0207661_10001907 3300025944 Bacteria 14301
765 Ga0207661_10008533 3300025944 Bacteria 7322
766 Ga0207661_10018456 3300025944 Bacteria 5181
767 Ga0207661_10021263 3300025944 Bacteria 4860
768 Ga0207661_10064624 3300025944 Bacteria 2967
769 Ga0207661_10304431 3300025944 Bacteria 1430
770 Ga0207661_10566291 3300025944 Bacteria 1041
771 Ga0207661_10600791 3300025944 Bacteria 1010
772 Ga0207679_10002650 3300025945 Bacteria 11044
773 Ga0207679_10053946 3300025945 Bacteria 2957
774 Ga0207679_10082806 3300025945 Bacteria 2457
775 Ga0207679_10103150 3300025945 Bacteria 2235
776 Ga0207679_10122373 3300025945 Bacteria 2074
777 Ga0207679_10407126 3300025945 Bacteria 1198
778 Ga0207679_10494135 3300025945 Bacteria 1091
779 Ga0207679_10548217 3300025945 Bacteria 1037
780 Ga0207667_10000453 3300025949 Bacteria 54929
781 Ga0207667_10009521 3300025949 Bacteria 11431
782 Ga0207667_10063175 3300025949 Bacteria 3869
783 Ga0207667_10106276 3300025949 Bacteria 2895
784 Ga0207667_10183304 3300025949 Bacteria 2149
785 Ga0207667_10401927 3300025949 Bacteria 1395
786 Ga0207667_10407436 3300025949 Bacteria 1384
787 Ga0207667_11385274 3300025949 Unclassified 677
788 Ga0207651_10002109 3300025960 Bacteria 9388
789 Ga0207651_10019970 3300025960 Bacteria 4030
790 Ga0207651_10110064 3300025960 Bacteria 2066
791 Ga0207651_10110238 3300025960 Bacteria 2064
792 Ga0207651_10232903 3300025960 Bacteria 1496
793 Ga0207651_10545173 3300025960 Bacteria 1008
794 Ga0207651_11398247 3300025960 Bacteria 630
795 Ga0207712_10000236 3300025961 Bacteria 54231
796 Ga0207712_10017014 3300025961 Bacteria 4717
797 Ga0207712_10268576 3300025961 Bacteria 1386
798 Ga0207712_10273512 3300025961 Bacteria 1375
799 Ga0207712_10983646 3300025961 Unclassified 748
800 Ga0207668_10000869 3300025972 Bacteria 18234
801 Ga0207668_10124203 3300025972 Bacteria 1959
802 Ga0207668_10676347 3300025972 Bacteria 905
803 Ga0207668_10685879 3300025972 Bacteria 899
804 Ga0207640_10001854 3300025981 Bacteria 11325
805 Ga0207640_10137420 3300025981 Bacteria 1776
806 Ga0207640_10419521 3300025981 Bacteria 1095
807 Ga0207640_10433596 3300025981 Bacteria 1079
808 Ga0207658_10002877 3300025986 Bacteria 12335
809 Ga0207658_10077846 3300025986 Bacteria 2531
810 Ga0207658_10077939 3300025986 Bacteria 2530
811 Ga0207658_10206299 3300025986 Bacteria 1644
812 Ga0207658_10338678 3300025986 Bacteria 1307
813 Ga0207658_10368749 3300025986 Bacteria 1255
814 Ga0207658_10454404 3300025986 Bacteria 1134
815 Ga0207658_10941263 3300025986 Bacteria 787
816 Ga0207658_11469930 3300025986 Bacteria 623
817 Ga0207677_10007143 3300026023 Bacteria 6150
818 Ga0207677_10102756 3300026023 Bacteria 2108
819 Ga0207677_10331030 3300026023 Bacteria 1269
820 Ga0207677_10439386 3300026023 Bacteria 1115
821 Ga0207677_11133257 3300026023 Bacteria 714
822 Ga0207703_10004088 3300026035 Bacteria 12037
823 Ga0207703_10086913 3300026035 Bacteria 2620
824 Ga0207703_10107075 3300026035 Bacteria 2379
825 Ga0207703_11059340 3300026035 Bacteria 778
826 Ga0207639_10002238 3300026041 Bacteria 13008
827 Ga0207639_10086818 3300026041 Bacteria 2492
828 Ga0207639_10144907 3300026041 Bacteria 1983
829 Ga0207639_10206104 3300026041 Bacteria 1690
830 Ga0207639_10553949 3300026041 Bacteria 1056
831 Ga0207678_10001614 3300026067 Bacteria 20747
832 Ga0207678_10102818 3300026067 Bacteria 2439
833 Ga0207678_10125918 3300026067 Bacteria 2186
834 Ga0207678_10318133 3300026067 Bacteria 1339
835 Ga0207678_10564686 3300026067 Bacteria 996
836 Ga0207708_10061743 3300026075 Bacteria 2861
837 Ga0207708_10152014 3300026075 Bacteria 1823
838 Ga0207702_10026759 3300026078 Bacteria 4789
839 Ga0207702_10082065 3300026078 Bacteria 2802
840 Ga0207702_10828111 3300026078 Bacteria 915
841 Ga0207641_10005564 3300026088 Bacteria 10740
842 Ga0207648_10002625 3300026089 Bacteria 19241
843 Ga0207648_10013430 3300026089 Bacteria 7622
844 Ga0207648_10076452 3300026089 Bacteria 2919
845 Ga0207648_10437276 3300026089 Bacteria 1189
846 Ga0207648_10606113 3300026089 Bacteria 1010
847 Ga0207676_10009796 3300026095 Bacteria 6814
848 Ga0207676_10063612 3300026095 Bacteria 2931
849 Ga0207676_10257111 3300026095 Bacteria 1575
850 Ga0207676_10299754 3300026095 Bacteria 1467
851 Ga0207676_10556643 3300026095 Bacteria 1096
852 Ga0207676_10757273 3300026095 Bacteria 945
853 Ga0207674_10007100 3300026116 Bacteria 13087
854 Ga0207674_10008361 3300026116 Bacteria 11971
855 Ga0207674_10031980 3300026116 Bacteria 5521
856 Ga0207674_10051368 3300026116 Bacteria 4207
857 Ga0207674_10102267 3300026116 Bacteria 2846
858 Ga0207674_10160215 3300026116 Bacteria 2205
859 Ga0207674_10298511 3300026116 Bacteria 1560
860 Ga0207674_10374567 3300026116 Bacteria 1376
861 Ga0207674_10405111 3300026116 Bacteria 1318
862 Ga0207675_100011158 3300026118 Bacteria 8416
863 Ga0207675_100023752 3300026118 Bacteria 5704
864 Ga0207675_100029391 3300026118 Bacteria 5122
865 Ga0207675_100053069 3300026118 Bacteria 3783
866 Ga0207675_100746893 3300026118 Bacteria 989
867 Ga0207675_101218918 3300026118 Bacteria 773
868 Ga0207683_10006890 3300026121 Bacteria 9730
869 Ga0207683_10017329 3300026121 Bacteria 6139
870 Ga0207683_10086341 3300026121 Bacteria 2789
871 Ga0207683_10135228 3300026121 Bacteria 2219
872 Ga0207683_10225777 3300026121 Bacteria 1707
873 Ga0207683_10243080 3300026121 Bacteria 1642
874 Ga0207683_10943649 3300026121 Bacteria 801
875 Ga0207698_10089720 3300026142 Bacteria 2512
876 Ga0207698_10252161 3300026142 Bacteria 1616
877 Ga0207698_10602074 3300026142 Bacteria 1084
878 Ga0207698_10605257 3300026142 Bacteria 1081
879 Ga0207698_10689462 3300026142 Bacteria 1015
880 Ga0209281_1050393 3300027111 Bacteria 666
881 Ga0209969_1001951 3300027360 Bacteria 2835
882 Ga0209489_111364 3300027361 Bacteria 9138
883 Ga0209967_1017786 3300027364 Bacteria 1027
884 Ga0209984_1016798 3300027424 Bacteria 979
885 Ga0210000_1006710 3300027462 Bacteria 1678
886 Ga0209995_1012225 3300027471 Bacteria 1400
887 Ga0209968_1000671 3300027526 Bacteria 5278
888 Ga0209968_1001933 3300027526 Bacteria 3149
889 Ga0209968_1012248 3300027526 Bacteria 1335
890 Ga0209970_1038065 3300027614 Bacteria 850
891 Ga0210002_1001591 3300027617 Bacteria 3225
892 Ga0209998_10001251 3300027717 Bacteria 6232
893 Ga0209974_10012090 3300027876 Bacteria 2890
894 Ga0209974_10206493 3300027876 Bacteria 727
895 Ga0207428_10241738 3300027907 Bacteria 1348
896 Ga0268266_10006831 3300028379 Bacteria 10392
897 Ga0268266_10010826 3300028379 Bacteria 7945
898 Ga0268266_10019858 3300028379 Bacteria 5726
899 Ga0268266_10075607 3300028379 Bacteria 2926
900 Ga0268266_10221528 3300028379 Bacteria 1739
901 Ga0268265_10312908 3300028380 Bacteria 1419
902 Ga0268265_10430882 3300028380 Bacteria 1227
903 Ga0268264_10027923 3300028381 Bacteria 4614
904 Ga0268264_10085138 3300028381 Bacteria 2713
905 Ga0268264_10355798 3300028381 Bacteria 1395
906 Ga0307515_10000009 3300028794 Bacteria 653206
907 Ga0307515_10000469 3300028794 Bacteria 96345
908 Ga0307515_10409858 3300028794 Bacteria 978
909 Ga0307515_10411520 3300028794 Bacteria 975
910 Ga0265338_10104635 3300028800 Bacteria 2296
911 Ga0265324_10009470 3300029957 Bacteria 3800
912 Ga0316177_1063448 3300030731 Bacteria 1123
913 Ga0316179_1109740 3300030734 Bacteria 3245
914 Ga0316181_1180820 3300030744 Bacteria 822
915 Ga0265327_10000244 3300031251 Bacteria 108867
916 Ga0265327_10000298 3300031251 Bacteria 96149
917 Ga0265327_10034879 3300031251 Bacteria 2787
918 Ga0265327_10124294 3300031251 Bacteria 1220
919 Ga0307513_10100314 3300031456 Bacteria 2921
920 Ga0307513_10196164 3300031456 Bacteria 1865
921 Ga0307513_10205509 3300031456 Unclassified 1806
922 Ga0307513_10358454 3300031456 Bacteria 1204
923 Ga0307509_10122814 3300031507 Bacteria 2571
924 Ga0307509_10132538 3300031507 Bacteria 2444
925 Ga0307408_100056125 3300031548 Bacteria 2855
926 Ga0307408_100060065 3300031548 Bacteria 2770
927 Ga0307408_100075805 3300031548 Bacteria 2500
928 Ga0307408_100478862 3300031548 Bacteria 1085
929 Ga0307408_100868518 3300031548 Bacteria 823
930 Ga0307408_101355421 3300031548 Bacteria 668
931 Ga0307508_10001613 3300031616 Bacteria 25177
932 Ga0265314_10003664 3300031711 Bacteria 14742
933 Ga0316576_10001081 3300031727 Bacteria 14158
934 Ga0316576_10598958 3300031727 Bacteria 805
935 Ga0316578_10025018 3300031728 Bacteria 3353
936 Ga0316578_10044909 3300031728 Bacteria 2571
937 Ga0307516_10004268 3300031730 Bacteria 17759
938 Ga0307516_10182934 3300031730 Bacteria 1828
939 Ga0307405_10000005 3300031731 Bacteria 376536
940 Ga0307405_10000006 3300031731 Bacteria 361477
941 Ga0307405_10090080 3300031731 Bacteria 2028
942 Ga0307413_10001307 3300031824 Bacteria 9311
943 Ga0307413_10249917 3300031824 Bacteria 1315
944 Ga0307413_10353719 3300031824 Bacteria 1134
945 Ga0307410_10000034 3300031852 Bacteria 48449
946 Ga0307410_10048579 3300031852 Bacteria 2843
947 Ga0307410_10157622 3300031852 Bacteria 1697
948 Ga0307410_10287412 3300031852 Bacteria 1293
949 Ga0307410_10644627 3300031852 Bacteria 888
950 Ga0307406_10000004 3300031901 Bacteria 179772
951 Ga0307406_10033753 3300031901 Bacteria 3134
952 Ga0307406_10651741 3300031901 Bacteria 874
953 Ga0307407_10000003 3300031903 Bacteria 271723
954 Ga0307407_10000196 3300031903 Bacteria 18233
955 Ga0307407_10014444 3300031903 Bacteria 3867
956 Ga0307407_10095116 3300031903 Bacteria 1836
957 Ga0307407_10191846 3300031903 Bacteria 1362
958 Ga0307412_10053164 3300031911 Bacteria 2684
959 Ga0307412_10061465 3300031911 Bacteria 2525
960 Ga0307412_10257328 3300031911 Bacteria 1359
961 Ga0307412_10610000 3300031911 Bacteria 925
962 Ga0307409_100028055 3300031995 Bacteria 4003
963 Ga0307409_100057484 3300031995 Bacteria 3014
964 Ga0307409_100139429 3300031995 Bacteria 2087
965 Ga0307409_100219286 3300031995 Bacteria 1716
966 Ga0307409_100386844 3300031995 Bacteria 1332
967 Ga0307409_100810802 3300031995 Bacteria 944
968 Ga0307416_100000002 3300032002 Bacteria 509907
969 Ga0307416_100008439 3300032002 Bacteria 6650
970 Ga0307416_100010892 3300032002 Bacteria 6031
971 Ga0307416_100087680 3300032002 Bacteria 2658
972 Ga0307416_100188953 3300032002 Bacteria 1940
973 Ga0307416_100411395 3300032002 Bacteria 1393
974 Ga0307414_10000011 3300032004 Bacteria 338253
975 Ga0307414_10000527 3300032004 Bacteria 19931
976 Ga0307414_10009965 3300032004 Bacteria 5484
977 Ga0307414_10011571 3300032004 Bacteria 5180
978 Ga0307414_10024140 3300032004 Bacteria 3871
979 Ga0307414_10098384 3300032004 Bacteria 2195
980 Ga0307414_10178342 3300032004 Bacteria 1706
981 Ga0307414_10663521 3300032004 Bacteria 941
982 Ga0307414_10735107 3300032004 Bacteria 896
983 Ga0307411_10000004 3300032005 Bacteria 460327
984 Ga0307411_10126234 3300032005 Bacteria 1861
985 Ga0307411_10153223 3300032005 Bacteria 1716
986 Ga0307411_10330459 3300032005 Bacteria 1235
987 Ga0307411_10343930 3300032005 Bacteria 1213
988 Ga0307415_100300684 3300032126 Bacteria 1329
989 Ga0307415_100926206 3300032126 Bacteria 805
990 Ga0307415_100931172 3300032126 Bacteria 803
991 Ga0316593_10001741 3300032168 Bacteria 4931
992 Ga0307510_10000380 3300033180 Bacteria 42243
993 Ga0307510_10035700 3300033180 Bacteria 5546
994 Ga0316592_1000022 3300033524 Bacteria 11920
995 Ga0316592_1000131 3300033524 Bacteria 8112
996 Ga0316592_1013307 3300033524 Bacteria 1694
997 Ga0316586_1001816 3300033527 Bacteria 2550
998 Ga0316588_1002172 3300033528 Bacteria 3382
999 Ga0316596_1000052 3300033541 Bacteria 12700
1000 Ga0316596_1002626 3300033541 Bacteria 3852
1001 Ga0316596_1003825 3300033541 Bacteria 3331
1002 Ga0316596_1005444 3300033541 Bacteria 2909
1003 Ga0316596_1016458 3300033541 Bacteria 1853
1004 Ga0316596_1036039 3300033541 Bacteria 1293
1005 Ga0373940_0148248 3300035088 Bacteria 746
1006 Ga0373956_0098722 3300035119 Bacteria 1353
1007 Ga0373960_0152321 3300035121 Bacteria 791
1008 Ga0373955_0329565 3300035172 Bacteria 923
1009 Ga0373955_0854685 3300035172 Bacteria 560
1010 Ga0373962_0095519 3300035242 Bacteria 921
1011 Ga0316574_0007562 3300035398 Bacteria 5965
1012 Ga0316574_0045952 3300035398 Bacteria 2706
1013 Ga0373924_0230165 3300035410 Bacteria 819
1014 Ga0373935_0051868 3300035692 Bacteria 2606
1015 Ga0373935_0473866 3300035692 Unclassified 906
1016 Ga0373933_0303736 3300035724 Bacteria 1033
1017 Ga0373937_0036462 3300036401 Bacteria 4481
1018 Ga0373937_0048653 3300036401 Bacteria 3882
1019 Ga0373937_0076521 3300036401 Bacteria 3091
1020 Ga0373937_0140348 3300036401 Bacteria 2260
1021 Ga0373937_0547176 3300036401 Bacteria 1099
1022 Ga0373937_1340874 3300036401 Bacteria 663
1023 Ga0316582_0022702 3300036647 Bacteria 3729
1024 Ga0316584_0020181 3300036712 Bacteria 4827
1025 Ga0316584_0020615 3300036712 Bacteria 4783
1026 Ga0316584_0065628 3300036712 Bacteria 2719
1027 Ga0373925_0165850 3300037068 Unclassified 1742
1028 Ga0395899_0378083 3300037312 Bacteria 942
1029 Ga0395900_0193418 3300037418 Bacteria 2062
1030 Ga0395905_1167085 3300037471 Bacteria 673
1031 Ga0436365_0781227 3300039437 Bacteria 11182
1032 Ga0436365_1208365 3300039437 Bacteria 1296
1033 Ga0436365_1690067 3300039437 Bacteria 10061
1034 Ga0439436_0010012 3300041404 Bacteria 2899
1035 Ga0439436_0054621 3300041404 Bacteria 1123
1036 Ga0439439_0015663 3300041406 Bacteria 1853
1037 Ga0439439_0099531 3300041406 Bacteria 799
1038 Ga0439447_000447 3300041407 Bacteria 15369
1039 Ga0439466_0004165 3300041411 Bacteria 5582
1040 Ga0439465_0006490 3300041413 Bacteria 3718
1041 Ga0451787_419093 3300041441 Bacteria 1894
1042 Ga0451789_0687116 3300041443 Bacteria 807
1043 Ga0451790_22988 3300041444 Bacteria 1085
1044 Ga0451794_56897 3300041446 Bacteria 638
1045 Ga0451791_1675939 3300041451 Bacteria 2636
1046 Ga0451797_0519695 3300041453 Bacteria 753
1047 Ga0451795_0165098 3300041456 Bacteria 893
1048 Ga0451795_0802875 3300041456 Bacteria 829
1049 Ga0451795_1231582 3300041456 Bacteria 734
1050 Ga0451795_1330461 3300041456 Bacteria 1148
1051 Ga0451802_2169794 3300041460 Bacteria 1023
1052 Ga0451807_1248443 3300041486 Bacteria 675
1053 Ga0451837_0716352 3300041494 Bacteria 4319
1054 Ga0451837_1056715 3300041494 Bacteria 8321
1055 Ga0451841_0588885 3300041498 Bacteria 1229
1056 Ga0451841_0610576 3300041498 Bacteria 615
1057 Ga0451852_13332 3300041508 Bacteria 9060
1058 Ga0451843_1326072 3300041509 Bacteria 2370
1059 Ga0451855_0576277 3300041511 Bacteria 594
1060 Ga0451853_0701685 3300041512 Bacteria 2711
1061 Ga0439431_0000148 3300041997 Bacteria 12795
1062 Ga0439431_0006932 3300041997 Bacteria 2520
1063 Ga0439445_0006554 3300042004 Bacteria 2678
1064 Ga0439449_0003312 3300042007 Bacteria 6287
1065 Ga0439449_0159683 3300042007 Bacteria 841
1066 Ga0439452_017641 3300042010 Bacteria 1914
1067 Ga0439457_001021 3300042014 Bacteria 8445
1068 Ga0439457_012873 3300042014 Bacteria 1883
1069 Ga0439457_018331 3300042014 Bacteria 1555
1070 Ga0450922_004074 3300042124 Bacteria 1343
1071 Ga0450898_001130 3300042134 Bacteria 3418
1072 Ga0450898_013724 3300042134 Bacteria 1354
1073 Ga0439446_0066036 3300042156 Bacteria 1100
1074 Ga0439446_0207057 3300042156 Bacteria 664
1075 Ga0439434_0005882 3300042435 Bacteria 3583
1076 Ga0439464_0140095 3300042439 Unclassified 753
1077 Ga0451577_0004463 3300042876 Bacteria 14775
1078 Ga0451577_0054888 3300042876 Bacteria 3556
1079 Ga0451577_0242501 3300042876 Bacteria 1631
1080 Ga0451577_0348490 3300042876 Bacteria 1343
1081 Ga0466969_0000246 3300044656 Bacteria 29777
1082 Ga0466982_0127768 3300044672 Bacteria 1565
1083 Ga0453683_0009005 3300044673 Bacteria 6671
1084 Ga0453683_0011208 3300044673 Bacteria 5922
1085 Ga0453683_0044004 3300044673 Bacteria 2801
1086 Ga0453683_0083828 3300044673 Unclassified 1997
1087 Ga0453683_0151769 3300044673 Bacteria 1464
1088 Ga0453683_0189848 3300044673 Bacteria 1303
1089 Ga0453683_0318980 3300044673 Bacteria 996
1090 Ga0453683_0430917 3300044673 Bacteria 852
1091 Ga0453683_0462118 3300044673 Bacteria 821
1092 Ga0466965_0041805 3300044683 Bacteria 2259
1093 Ga0466965_0358535 3300044683 Bacteria 800
1094 Ga0466966_0018671 3300044684 Bacteria 4570
1095 Ga0466961_0125059 3300044693 Bacteria 1614
1096 Ga0466963_0820038 3300044694 Bacteria 656
1097 Ga0453684_0000413 3300044712 Bacteria 174924
1098 Ga0453684_0012544 3300044712 Bacteria 13952
1099 Ga0453684_0031999 3300044712 Bacteria 7376
1100 Ga0453684_0038585 3300044712 Bacteria 6526
1101 Ga0453684_0068294 3300044712 Bacteria 4514
1102 Ga0453684_0081028 3300044712 Bacteria 4050
1103 Ga0453684_0109499 3300044712 Bacteria 3360
1104 Ga0453684_0174513 3300044712 Bacteria 2530
1105 Ga0453684_0217161 3300044712 Bacteria 2218
1106 Ga0453684_0446341 3300044712 Bacteria 1441
1107 Ga0453684_0453389 3300044712 Bacteria 1427
1108 Ga0453684_0546517 3300044712 Bacteria 1276
1109 Ga0453684_0950475 3300044712 Bacteria 917
1110 Ga0466968_0042386 3300044735 Bacteria 1924
1111 Ga0466970_0380832 3300044765 Bacteria 803
1112 Ga0466957_0001187 3300044842 Bacteria 13537
1113 Ga0466959_0000017 3300045049 Bacteria 143170
1114 Ga0466959_0027432 3300045049 Bacteria 4225
1115 Ga0451576_0012395 3300045051 Bacteria 9577
1116 Ga0451576_0027225 3300045051 Bacteria 6142
1117 Ga0451576_0042307 3300045051 Bacteria 4810
1118 Ga0451576_0062199 3300045051 Bacteria 3892
1119 Ga0451576_0062248 3300045051 Bacteria 3890
1120 Ga0451576_0370146 3300045051 Bacteria 1501
1121 Ga0451576_0559542 3300045051 Bacteria 1201
1122 Ga0466958_0422315 3300045836 Bacteria 862
1123 Ga0466967_0036213 3300045976 Bacteria 4211
1124 Ga0466967_0213816 3300045976 Bacteria 1830
1125 Ga0495627_001896 3300046453 Bacteria 10966
1126 Ga0495627_050922 3300046453 Bacteria 1246
1127 Ga0495592_0199036 3300046454 Bacteria 1353
1128 Ga0495603_0018332 3300046455 Bacteria 4234
1129 Ga0495603_0347795 3300046455 Bacteria 851
1130 Ga0495629_0019985 3300046459 Bacteria 4779
1131 Ga0495629_0146129 3300046459 Bacteria 1644
1132 Ga0495629_0194689 3300046459 Bacteria 1402
1133 Ga0495629_0348777 3300046459 Bacteria 1010
1134 Ga0495638_0000040 3300046460 Bacteria 241883
1135 Ga0495638_0043942 3300046460 Bacteria 2817
1136 Ga0495638_0072019 3300046460 Bacteria 2113
1137 Ga0495651_0224316 3300046462 Bacteria 1298
1138 Ga0495651_0233321 3300046462 Bacteria 1266
1139 Ga0495653_0127165 3300046463 Bacteria 1808
1140 Ga0495580_0015211 3300046472 Bacteria 5816
1141 Ga0495580_0057113 3300046472 Bacteria 2747
1142 Ga0495580_0160474 3300046472 Bacteria 1556
1143 Ga0495582_0004780 3300046473 Bacteria 7611
1144 Ga0495582_0302421 3300046473 Unclassified 919
1145 Ga0495582_0312016 3300046473 Unclassified 905
1146 Ga0495639_0002494 3300046475 Bacteria 8031
1147 Ga0495639_0009573 3300046475 Bacteria 4158
1148 Ga0495639_0134983 3300046475 Bacteria 1183
1149 Ga0495639_0148496 3300046475 Bacteria 1130
1150 Ga0495662_0023228 3300046476 Bacteria 2994
1151 Ga0495662_0121873 3300046476 Bacteria 1280
1152 Ga0495664_0004041 3300046477 Bacteria 8003
1153 Ga0495664_0051857 3300046477 Bacteria 2436
1154 Ga0495594_0002236 3300046499 Bacteria 10074
1155 Ga0495594_0012720 3300046499 Bacteria 4391
1156 Ga0495594_0017843 3300046499 Bacteria 3754
1157 Ga0495607_0014863 3300046501 Bacteria 5059
1158 Ga0495606_0006493 3300046507 Bacteria 10759
1159 Ga0495606_0010457 3300046507 Bacteria 7698
1160 Ga0495606_0208853 3300046507 Bacteria 1107
1161 Ga0495606_0265398 3300046507 Bacteria 945
1162 Ga0495608_0111772 3300046511 Bacteria 1756
1163 Ga0495618_0019866 3300046514 Bacteria 4135
1164 Ga0495618_0058209 3300046514 Bacteria 2447
1165 Ga0495618_0059831 3300046514 Bacteria 2415
1166 Ga0495620_0309598 3300046515 Bacteria 600
1167 Ga0495628_0063967 3300046516 Bacteria 2881
1168 Ga0495628_0112366 3300046516 Bacteria 2094
1169 Ga0495630_0003672 3300046517 Bacteria 10702
1170 Ga0495630_0068879 3300046517 Bacteria 2661
1171 Ga0495630_0079270 3300046517 Bacteria 2477
1172 Ga0495632_0088893 3300046519 Bacteria 1467
1173 Ga0495643_0000294 3300046522 Bacteria 70329
1174 Ga0495643_0009099 3300046522 Bacteria 6221
1175 Ga0495663_0016116 3300046525 Bacteria 2111
1176 Ga0495666_0007984 3300046526 Bacteria 5299
1177 Ga0495666_0022515 3300046526 Bacteria 3121
1178 Ga0495642_0069999 3300046528 Bacteria 1466
1179 Ga0495642_0148655 3300046528 Bacteria 1013
1180 Ga0495652_0098996 3300046529 Bacteria 2368
1181 Ga0495652_0170490 3300046529 Bacteria 1680
1182 Ga0495652_0279721 3300046529 Bacteria 1222
1183 Ga0495654_0031697 3300046530 Bacteria 2683
1184 Ga0495665_0016600 3300046531 Bacteria 3966
1185 Ga0495665_0066629 3300046531 Bacteria 1900
1186 Ga0495665_0075756 3300046531 Bacteria 1771
1187 Ga0495640_0013380 3300046533 Bacteria 6233
1188 Ga0495640_0045154 3300046533 Bacteria 3058
1189 Ga0495640_0071948 3300046533 Bacteria 2318
1190 Ga0495586_0005406 3300046535 Bacteria 6831
1191 Ga0495587_0017860 3300046536 Bacteria 4401
1192 Ga0495587_0027547 3300046536 Bacteria 3460
1193 Ga0495598_0097956 3300046537 Bacteria 966
1194 Ga0495621_0013304 3300046539 Bacteria 2582
1195 Ga0495645_0293881 3300046543 Bacteria 1064
1196 Ga0495645_0433006 3300046543 Unclassified 833
1197 Ga0495622_0413731 3300046557 Bacteria 580
1198 Ga0495633_0000049 3300046558 Bacteria 156684
1199 Ga0495633_0061152 3300046558 Bacteria 1764
1200 Ga0495633_0153686 3300046558 Bacteria 1062
1201 Ga0495633_0236041 3300046558 Bacteria 835
1202 Ga0495667_0001513 3300046559 Bacteria 15343
1203 Ga0495667_0054956 3300046559 Bacteria 2618
1204 Ga0495667_0068058 3300046559 Bacteria 2326
1205 Ga0495656_0516114 3300046615 Bacteria 635
1206 Ga0495668_0161287 3300046616 Bacteria 1228
1207 Ga0495634_0001123 3300046642 Bacteria 24774
1208 Ga0495634_0074722 3300046642 Bacteria 2227
1209 Ga0495611_0003370 3300046648 Bacteria 7051
1210 Ga0495625_0001933 3300046660 Bacteria 23424
1211 Ga0495625_0089987 3300046660 Bacteria 2124
1212 Ga0495625_0346569 3300046660 Bacteria 940
1213 Ga0495635_0028641 3300046663 Bacteria 3871
1214 Ga0495635_0041441 3300046663 Bacteria 3180
1215 Ga0495588_0017168 3300046674 Bacteria 3509
1216 Ga0495588_0321334 3300046674 Unclassified 814
1217 Ga0495657_0017987 3300046675 Bacteria 5123
1218 Ga0495623_0044936 3300046679 Bacteria 2806
1219 Ga0495623_0173557 3300046679 Bacteria 1258
1220 Ga0495623_0326114 3300046679 Bacteria 842
1221 Ga0495646_0052770 3300046680 Bacteria 2454
1222 Ga0495658_0003330 3300046683 Bacteria 7973
1223 Ga0495658_0097935 3300046683 Bacteria 1746
1224 Ga0495669_0406772 3300046684 Bacteria 660
1225 Ga0495613_0021242 3300046689 Unclassified 4841
1226 Ga0495613_0073700 3300046689 Bacteria 2487
1227 Ga0495613_0130705 3300046689 Bacteria 1798
1228 Ga0495613_0134788 3300046689 Bacteria 1767
1229 Ga0495624_0187737 3300046690 Bacteria 1258
1230 Ga0495624_0190316 3300046690 Bacteria 1248
1231 Ga0495649_0078773 3300046694 Bacteria 1763
1232 Ga0495600_0008219 3300046809 Bacteria 6406
1233 Ga0495600_0034516 3300046809 Bacteria 3284
1234 Ga0495600_0064475 3300046809 Bacteria 2395
1235 Ga0495581_0061450 3300047315 Bacteria 2171
1236 Ga0495581_0093525 3300047315 Bacteria 1745
1237 Ga0495581_0165347 3300047315 Bacteria 1294
1238 Ga0495581_0171961 3300047315 Bacteria 1267
1239 Ga0495604_0215319 3300047317 Bacteria 1325
1240 Ga0495636_0000012 3300047318 Bacteria 85270
1241 Ga0495636_0274795 3300047318 Bacteria 784
1242 Ga0495674_0006511 3300047319 Bacteria 11206
1243 Ga0495674_0057314 3300047319 Bacteria 3409
1244 Ga0495674_0269977 3300047319 Bacteria 1396
1245 Ga0495672_0256583 3300047320 Bacteria 846
1246 Ga0495676_0108551 3300047321 Bacteria 2041
1247 Ga0495676_0127835 3300047321 Bacteria 1839
1248 Ga0495680_0012216 3300047322 Bacteria 7573
1249 Ga0495680_0013035 3300047322 Bacteria 7271
1250 Ga0495680_0082584 3300047322 Bacteria 2424
1251 Ga0495675_0017264 3300047444 Bacteria 4573
1252 Ga0495675_0212592 3300047444 Bacteria 1173
1253 Ga0495675_0397031 3300047444 Bacteria 804
1254 Ga0495685_117616 3300047447 Bacteria 873
1255 Ga0495684_0014936 3300047471 Bacteria 5981
1256 Ga0495684_0075992 3300047471 Bacteria 2551
1257 Ga0495684_0246355 3300047471 Bacteria 1301
1258 Ga0495684_0321795 3300047471 Bacteria 1105
1259 Ga0495686_0000004 3300047472 Bacteria 869019
1260 Ga0495686_0025653 3300047472 Bacteria 3863
1261 Ga0495593_0090810 3300047673 Bacteria 1573
1262 Ga0495593_0125487 3300047673 Bacteria 1305
1263 Ga0495602_0080010 3300048088 Bacteria 2754
1264 Ga0495615_0037513 3300048090 Bacteria 1194
1265 Ga0496100_0049531 3300048903 Bacteria 2717
1266 Ga0496101_0108575 3300048904 Bacteria 2086
1267 Ga0496102_1047154 3300048905 Bacteria 736
1268 Ga0496104_0097105 3300048907 Bacteria 2820
1269 Ga0496104_0098047 3300048907 Bacteria 2806
1270 Ga0496104_0204889 3300048907 Bacteria 1884
1271 Ga0496104_0300644 3300048907 Bacteria 1517
1272 Ga0496105_0140004 3300048908 Bacteria 1992
1273 Ga0496105_0435725 3300048908 Unclassified 1036
1274 Ga0496107_0727748 3300048910 Bacteria 729
1275 Ga0496108_0098307 3300048911 Bacteria 2494
1276 Ga0496109_0051846 3300048912 Bacteria 3738
1277 Ga0496109_0230464 3300048912 Bacteria 1742
1278 Ga0496110_0955274 3300048913 Bacteria 764
1279 Ga0496111_0184697 3300048914 Bacteria 1550
1280 Ga0496112_0039773 3300048915 Bacteria 4596
1281 Ga0496112_0560136 3300048915 Bacteria 1076
1282 Ga0496112_0733194 3300048915 Bacteria 915
1283 Ga0496113_0033990 3300048916 Bacteria 3717
1284 Ga0496113_0078240 3300048916 Bacteria 2530
1285 Ga0496113_0782428 3300048916 Bacteria 759
1286 Ga0496114_0001912 3300048917 Bacteria 15852
1287 Ga0496114_1137310 3300048917 Bacteria 666
1288 Ga0496115_0094411 3300048918 Bacteria 2447
1289 Ga0496115_0141131 3300048918 Bacteria 1988
1290 Ga0496116_0000024 3300048919 Bacteria 471420
1291 Ga0496121_0062508 3300048924 Bacteria 3049
1292 Ga0496122_0000862 3300048925 Bacteria 57049
1293 Ga0496123_0029231 3300048926 Bacteria 4064
1294 Ga0496124_0035036 3300048927 Bacteria 4396
1295 Ga0496125_0000018 3300048928 Bacteria 482390
1296 Ga0496125_0105937 3300048928 Bacteria 2054
1297 Ga0496126_0089554 3300048929 Bacteria 2708
1298 Ga0501306_019863 3300049127 Bacteria 929
1299 Ga0501308_037880 3300049128 Bacteria 670
1300 Ga0501308_052130 3300049128 Bacteria 601
1301 Ga0501309_000005 3300049129 Bacteria 11119
1302 Ga0501310_000149 3300049130 Bacteria 6887
1303 Ga0501341_00421 3300049131 Bacteria 1765
1304 Ga0501343_002364 3300049132 Bacteria 1341
1305 Ga0501345_01514 3300049134 Bacteria 898
1306 Ga0501305_001515 3300049161 Bacteria 2293
1307 Ga0501305_009592 3300049161 Bacteria 1276
1308 Ga0501305_037209 3300049161 Bacteria 780
1309 Ga0501307_014525 3300049162 Bacteria 963
1310 Ga0501298_015704 3300049521 Bacteria 1366
1311 Ga0501299_017189 3300049522 Bacteria 1288
1312 Ga0501311_003947 3300049527 Bacteria 1550
1313 Ga0501312_000702 3300049528 Bacteria 2872
1314 Ga0501312_017506 3300049528 Bacteria 1035
1315 Ga0501314_000001 3300049530 Bacteria 13837
1316 Ga0501314_005402 3300049530 Bacteria 1087
1317 Ga0501315_005172 3300049531 Bacteria 1403
1318 Ga0501315_013721 3300049531 Bacteria 1018
1319 Ga0501316_000418 3300049532 Bacteria 2880
1320 Ga0501317_013917 3300049533 Bacteria 1012
1321 Ga0501319_000018 3300049535 Bacteria 6166
1322 Ga0501320_000042 3300049536 Bacteria 6003
1323 Ga0501320_002561 3300049536 Bacteria 1465
1324 Ga0501320_002568 3300049536 Bacteria 1464
1325 Ga0501321_036530 3300049537 Bacteria 676
1326 Ga0501323_000002 3300049539 Bacteria 14311
1327 Ga0501323_001249 3300049539 Bacteria 2198
1328 Ga0501323_001617 3300049539 Bacteria 2046
1329 Ga0501324_000002 3300049540 Bacteria 14212
1330 Ga0501324_000446 3300049540 Bacteria 2211
1331 Ga0501326_00020 3300049542 Bacteria 5374
1332 Ga0501329_00025 3300049545 Bacteria 3428
1333 Ga0501335_006458 3300049551 Bacteria 1069
1334 Ga0501033_0125267 3300049570 Bacteria 1863
1335 Ga0501034_0068864 3300049571 Bacteria 3549
1336 Ga0501034_0156774 3300049571 Bacteria 2250
1337 Ga0501034_0506147 3300049571 Bacteria 1121
1338 Ga0501034_0753057 3300049571 Bacteria 869
1339 Ga0501036_0044298 3300049572 Bacteria 3769
1340 Ga0501036_0469331 3300049572 Bacteria 1048
1341 Ga0501037_0336815 3300049573 Bacteria 1043
1342 Ga0501038_0011902 3300049574 Bacteria 7941
1343 Ga0501039_0278926 3300049575 Bacteria 1314
1344 Ga0501040_0023723 3300049576 Bacteria 4114
1345 Ga0501041_0022629 3300049577 Bacteria 3764
1346 Ga0501042_0111407 3300049578 Bacteria 1971
1347 Ga0501043_0014339 3300049579 Bacteria 6203
1348 Ga0501043_0252400 3300049579 Unclassified 1358
1349 Ga0501043_0347853 3300049579 Unclassified 1127
1350 Ga0501043_0412068 3300049579 Bacteria 1020
1351 Ga0501043_0840598 3300049579 Bacteria 662
1352 Ga0501047_0028661 3300049581 Bacteria 5370
1353 Ga0501047_0154966 3300049581 Bacteria 2165
1354 Ga0501047_0645969 3300049581 Bacteria 878
1355 Ga0501067_0132877 3300049583 Bacteria 1385
1356 Ga0501069_0360955 3300049585 Bacteria 857
1357 Ga0501070_0177473 3300049586 Bacteria 1753
1358 Ga0501070_0597127 3300049586 Bacteria 880
1359 Ga0501071_0342927 3300049587 Bacteria 1136
1360 Ga0501072_0702432 3300049588 Bacteria 795
1361 Ga0501073_0067112 3300049589 Bacteria 2501
1362 Ga0501073_0568293 3300049589 Bacteria 783
1363 Ga0501075_0331579 3300049591 Bacteria 1160
1364 Ga0501076_0311540 3300049592 Bacteria 1291
1365 Ga0501077_0037660 3300049593 Bacteria 3080
1366 Ga0501202_001841 3300049652 Bacteria 3476
1367 Ga0501207_004686 3300049654 Bacteria 1870
1368 Ga0501207_063034 3300049654 Bacteria 683
1369 Ga0501209_069646 3300049656 Bacteria 998
1370 Ga0501222_004291 3300049662 Bacteria 1937
1371 Ga0501223_012279 3300049663 Bacteria 1713
1372 Ga0501224_032102 3300049664 Bacteria 787
1373 Ga0501227_049108 3300049665 Bacteria 1061
1374 Ga0501233_015944 3300049668 Bacteria 1553
1375 Ga0501235_011426 3300049669 Bacteria 1948
1376 Ga0501236_002270 3300049670 Bacteria 2204
1377 Ga0501238_000015 3300049671 Bacteria 31964
1378 Ga0501239_014102 3300049672 Bacteria 921
1379 Ga0501242_020336 3300049674 Bacteria 852
1380 Ga0501246_006229 3300049676 Bacteria 1018
1381 Ga0501248_011597 3300049678 Bacteria 798
1382 Ga0501249_011337 3300049679 Bacteria 1870
1383 Ga0501249_037489 3300049679 Bacteria 1094
1384 Ga0501249_062867 3300049679 Bacteria 861
1385 Ga0501251_007216 3300049681 Bacteria 1231
1386 Ga0501251_044664 3300049681 Bacteria 683
1387 Ga0501256_016105 3300049685 Bacteria 754
1388 Ga0501257_005052 3300049686 Bacteria 2896
1389 Ga0501257_057909 3300049686 Bacteria 975
1390 Ga0501259_004749 3300049688 Bacteria 2155
1391 Ga0501225_0003051 3300049705 Bacteria 5115
1392 Ga0501225_0049385 3300049705 Bacteria 1170
1393 Ga0501225_0095137 3300049705 Bacteria 866
1394 Ga0501234_005497 3300049707 Bacteria 1983
1395 Ga0501245_055162 3300049708 Bacteria 713
1396 Ga0501079_0269060 3300049741 Bacteria 1332
1397 Ga0501079_0363211 3300049741 Bacteria 1135
1398 Ga0501080_0995597 3300049742 Bacteria 727
1399 Ga0501241_002523 3300049758 Bacteria 3531
1400 Ga0501263_003314 3300049760 Bacteria 1712
1401 Ga0501263_036753 3300049760 Bacteria 708
1402 Ga0501264_000971 3300049761 Bacteria 3525
1403 Ga0501266_000002 3300049763 Bacteria 459947
1404 Ga0501268_000392 3300049765 Bacteria 4659
1405 Ga0501269_027813 3300049766 Bacteria 719
1406 Ga0501270_000461 3300049767 Bacteria 3478
1407 Ga0501274_008220 3300049771 Bacteria 932
1408 Ga0501280_000239 3300049776 Bacteria 13899
1409 Ga0501280_038589 3300049776 Bacteria 768
1410 Ga0501283_018119 3300049779 Bacteria 1106
1411 Ga0501035_0493382 3300049822 Bacteria 1009
1412 Ga0501045_0778464 3300049824 Unclassified 705
1413 Ga0501226_018378 3300049853 Bacteria 770
1414 nmdc:mga0k408_106616_c1 3300050493 Bacteria 1655
1415 nmdc:mga0k408_17232_c1 3300050493 Bacteria 4021
1416 nmdc:mga0k408_176521_c1 3300050493 Bacteria 1274
1417 nmdc:mga0k408_20199_c1 3300050493 Bacteria 3729
1418 nmdc:mga0k408_41944_c2 3300050493 Bacteria 2051
1419 nmdc:mga0k408_43078_c1 3300050493 Bacteria 2600
1420 nmdc:mga0k408_62301_c2 3300050493 Bacteria 1583
1421 nmdc:mga07m45_26725_c1 3300050496 Bacteria 3173
1422 nmdc:mga05p37_3944_c1 3300050507 Bacteria 17380
1423 nmdc:mga05p37_396256_c1 3300050507 Bacteria 1613
1424 nmdc:mga05p37_886407_c1 3300050507 Bacteria 964
1425 nmdc:mga09592_65841_c1 3300050508 Unclassified 3070
1426 nmdc:mga09592_828015_c1 3300050508 Bacteria 782
1427 nmdc:mga0qj67_333638_c1 3300050509 Bacteria 1227
1428 nmdc:mga0qj67_644073_c1 3300050509 Bacteria 846
1429 nmdc:mga06r32_157920_c1 3300050510 Bacteria 2250
1430 nmdc:mga06r32_260089_c1 3300050510 Bacteria 1723
1431 nmdc:mga06r32_600359_c1 3300050510 Bacteria 1072
1432 nmdc:mga0n895_346964_c1 3300050512 Bacteria 1503
1433 nmdc:mga08x19_41680_c1 3300050514 Bacteria 2924
1434 nmdc:mga08x19_9157_c1 3300050514 Bacteria 5911
1435 Ga0495601_0347318 3300053077 Bacteria 965
1436 Ga0495601_0963338 3300053077 Bacteria 537
1437 Ga0495612_0153909 3300053078 Bacteria 1002
1438 Ga0495619_0238679 3300053085 Bacteria 1260
1439 Ga0495619_0263150 3300053085 Bacteria 1195
1440 Ga0500644_0012343 3300053088 Bacteria 2359
1441 Ga0500644_0012427 3300053088 Bacteria 2354
1442 Ga0500644_0299116 3300053088 Bacteria 688
1443 Ga0500646_0021012 3300053090 Bacteria 1737
1444 Ga0500646_0093703 3300053090 Bacteria 933
1445 Ga0500583_0037830 3300053092 Bacteria 2169
1446 Ga0500651_0207492 3300053093 Bacteria 1153
1447 Ga0500651_0309979 3300053093 Bacteria 904
1448 Ga0500641_0000168 3300053096 Bacteria 24462
1449 Ga0500641_0006404 3300053096 Bacteria 4180
1450 Ga0500650_0159914 3300053098 Bacteria 1039
1451 Ga0500556_0109981 3300053104 Bacteria 1068
1452 Ga0500569_000284 3300053109 Bacteria 8035
1453 Ga0500594_0010092 3300053118 Bacteria 2185
1454 Ga0500652_003935 3300053131 Bacteria 4539
1455 Ga0500652_181177 3300053131 Bacteria 863
1456 Ga0500658_0000002 3300053134 Bacteria 548440
1457 Ga0500658_0001077 3300053134 Bacteria 11171
1458 Ga0500559_0017721 3300053136 Bacteria 3010
1459 Ga0500568_0053162 3300053139 Bacteria 1588
1460 Ga0500577_0000711 3300053142 Bacteria 8518
1461 Ga0500588_0148287 3300053146 Bacteria 847
1462 Ga0500590_052622 3300053148 Bacteria 2066
1463 Ga0500616_0000013 3300053153 Bacteria 674172
1464 Ga0500616_0108629 3300053153 Bacteria 1343
1465 Ga0500622_0000655 3300053156 Bacteria 30835
1466 Ga0500622_0022828 3300053156 Bacteria 3313
1467 Ga0500622_0278125 3300053156 Bacteria 722
1468 Ga0500627_0019206 3300053158 Bacteria 2719
1469 Ga0500627_0075223 3300053158 Bacteria 1501
1470 Ga0500633_0007899 3300053160 Bacteria 2710
1471 Ga0500634_0210131 3300053161 Bacteria 846
1472 Ga0500636_0005509 3300053177 Bacteria 7233
1473 Ga0500656_018218 3300053732 Bacteria 847
1474 Ga0501084_0573462 3300054114 Bacteria 953
1475 Ga0590074_023625 3300059423 Bacteria 1067
1476 Ga0587077_000157 3300059493 Bacteria 4488
1477 Ga0587068_001506 3300059641 Bacteria 2637
1478 Ga0466962_0058532 3300061719 Bacteria 1839
1479 Ga0530510_0086201 3300061734 Bacteria 2288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100132105 Ga0070711_1001321053 144
2 3300006028 Ga0070717_10027264 Ga0070717_100272643 144
3 3300006175 Ga0070712_100140461 Ga0070712_1001404613 144
4 3300005347 Ga0070668_100271417 Ga0070668_1002714172 145
5 3300005436 Ga0070713_100549100 Ga0070713_1005491002 145
6 3300005437 Ga0070710_10244122 Ga0070710_102441222 145
7 3300006028 Ga0070717_10572561 Ga0070717_105725612 145
8 3300025898 Ga0207692_10283514 Ga0207692_102835142 145
9 3300025898 Ga0207692_10341726 Ga0207692_103417262 145
10 3300025928 Ga0207700_10040763 Ga0207700_100407633 145
11 3300025928 Ga0207700_10220515 Ga0207700_102205151 145
12 3300025928 Ga0207700_10520674 Ga0207700_105206742 145
13 3300025972 Ga0207668_10676347 Ga0207668_106763472 145
14 3300031548 Ga0307408_101355421 Ga0307408_1013554211 145
15 3300031995 Ga0307409_100139429 Ga0307409_1001394294 145
16 3300032126 Ga0307415_100926206 Ga0307415_1009262062 145
17 3300045976 Ga0466967_0036213 Ga0466967_0036213_2469_3008 145
18 3300049522 Ga0501299_017189 Ga0501299_017189_336_875 145
19 3300049654 Ga0501207_004686 Ga0501207_004686_468_1007 145
20 3300049705 Ga0501225_0049385 Ga0501225_0049385_562_1101 145
21 3300005985 Ga0081539_10096810 Ga0081539_100968102 146
22 3300031852 Ga0307410_10644627 Ga0307410_106446271 146
23 3300032005 Ga0307411_10343930 Ga0307411_103439302 146
24 3300035121 Ga0373960_0152321 Ga0373960_0152321_89_586 147
25 3300041486 Ga0451807_1248443 Ga0451807_1248443_34_510 147
26 3300046459 Ga0495629_0019985 Ga0495629_0019985_3947_4438 147
27 3300046683 Ga0495658_0097935 Ga0495658_0097935_298_789 147
28 3300048916 Ga0496113_0782428 Ga0496113_0782428_272_748 147
29 3300049679 Ga0501249_037489 Ga0501249_037489_487_930 147
30 3300026075 Ga0207708_10152014 Ga0207708_101520143 150
31 3300006175 Ga0070712_100144992 Ga0070712_1001449922 151
32 3300049583 Ga0501067_0132877 Ga0501067_0132877_67_606 151
33 3300005327 Ga0070658_10186882 Ga0070658_101868824 152
34 3300025909 Ga0207705_10162822 Ga0207705_101628224 152
35 3300020082 Ga0206353_11411444 Ga0206353_114114442 153
36 3300032002 Ga0307416_100411395 Ga0307416_1004113952 154
37 3300036401 Ga0373937_1340874 Ga0373937_1340874_182_646 154
38 3300044673 Ga0453683_0462118 Ga0453683_0462118_117_671 154
39 3300047315 Ga0495581_0165347 Ga0495581_0165347_130_594 154
40 3300005293 Ga0065715_10508194 Ga0065715_105081942 155
41 3300005457 Ga0070662_100499086 Ga0070662_1004990861 155
42 3300005457 Ga0070662_100637874 Ga0070662_1006378742 155
43 3300009177 Ga0105248_11519373 Ga0105248_115193732 155
44 3300025944 Ga0207661_10304431 Ga0207661_103044314 155
45 3300046529 Ga0495652_0098996 Ga0495652_0098996_1672_2211 155
46 3300048915 Ga0496112_0733194 Ga0496112_0733194_428_898 156
47 3300053085 Ga0495619_0263150 Ga0495619_0263150_99_569 156
48 3300014326 Ga0157380_10914621 Ga0157380_109146212 157
49 3300005367 Ga0070667_100561217 Ga0070667_1005612172 160
50 3300014969 Ga0157376_10229581 Ga0157376_102295812 160
51 3300005577 Ga0068857_100006227 Ga0068857_1000062279 161
52 3300005618 Ga0068864_100005272 Ga0068864_10000527210 161
53 3300020081 Ga0206354_10616054 Ga0206354_106160543 161
54 3300032002 Ga0307416_100188953 Ga0307416_1001889532 161
55 3300035172 Ga0373955_0854685 Ga0373955_0854685_55_540 161
56 3300049672 Ga0501239_014102 Ga0501239_014102_344_883 161
57 3300049705 Ga0501225_0095137 Ga0501225_0095137_221_760 161
58 3300053077 Ga0495601_0963338 Ga0495601_0963338_20_505 161
59 3300005616 Ga0068852_100980316 Ga0068852_1009803162 162
60 3300026142 Ga0207698_10602074 Ga0207698_106020742 162
61 3300005434 Ga0070709_10178408 Ga0070709_101784083 163
62 3300005548 Ga0070665_100293202 Ga0070665_1002932022 163
63 3300006237 Ga0097621_100362135 Ga0097621_1003621352 163
64 3300028379 Ga0268266_10221528 Ga0268266_102215282 163
65 3300035692 Ga0373935_0051868 Ga0373935_0051868_307_846 163
66 3300046472 Ga0495580_0057113 Ga0495580_0057113_593_1132 163
67 3300046475 Ga0495639_0134983 Ga0495639_0134983_81_620 163
68 3300046499 Ga0495594_0012720 Ga0495594_0012720_296_835 163
69 3300046514 Ga0495618_0058209 Ga0495618_0058209_1147_1686 163
70 3300046517 Ga0495630_0079270 Ga0495630_0079270_510_1049 163
71 3300046526 Ga0495666_0022515 Ga0495666_0022515_993_1532 163
72 3300046531 Ga0495665_0016600 Ga0495665_0016600_2043_2582 163
73 3300046533 Ga0495640_0071948 Ga0495640_0071948_378_917 163
74 3300046557 Ga0495622_0413731 Ga0495622_0413731_73_564 163
75 3300046642 Ga0495634_0074722 Ga0495634_0074722_791_1330 163
76 3300046674 Ga0495588_0321334 Ga0495588_0321334_310_801 163
77 3300046689 Ga0495613_0134788 Ga0495613_0134788_648_1187 163
78 3300046690 Ga0495624_0187737 Ga0495624_0187737_269_808 163
79 3300047315 Ga0495581_0171961 Ga0495581_0171961_194_733 163
80 3300047471 Ga0495684_0075992 Ga0495684_0075992_394_933 163
81 3300047673 Ga0495593_0090810 Ga0495593_0090810_678_1217 163
82 3300048907 Ga0496104_0098047 Ga0496104_0098047_1206_1697 163
83 3300048908 Ga0496105_0435725 Ga0496105_0435725_501_992 163
84 3300048913 Ga0496110_0955274 Ga0496110_0955274_213_752 163
85 3300048915 Ga0496112_0039773 Ga0496112_0039773_486_977 163
86 3300048916 Ga0496113_0033990 Ga0496113_0033990_2628_3119 163
87 3300005329 Ga0070683_100003340 Ga0070683_10000334018 164
88 3300005336 Ga0070680_100259279 Ga0070680_1002592791 164
89 3300005337 Ga0070682_100010066 Ga0070682_1000100665 164
90 3300005344 Ga0070661_100065820 Ga0070661_1000658205 164
91 3300005366 Ga0070659_100265579 Ga0070659_1002655793 164
92 3300005458 Ga0070681_10083427 Ga0070681_100834272 164
93 3300005535 Ga0070684_100005718 Ga0070684_10000571818 164
94 3300005564 Ga0070664_100008033 Ga0070664_10000803315 164
95 3300013100 Ga0157373_10169698 Ga0157373_101696982 164
96 3300013307 Ga0157372_10017897 Ga0157372_100178972 164
97 3300025912 Ga0207707_10171625 Ga0207707_101716253 164
98 3300025920 Ga0207649_10019877 Ga0207649_100198772 164
99 3300025921 Ga0207652_10536478 Ga0207652_105364781 164
100 3300025932 Ga0207690_10170316 Ga0207690_101703162 164
101 3300025944 Ga0207661_10001907 Ga0207661_1000190718 164
102 3300025945 Ga0207679_10002650 Ga0207679_1000265013 164
103 3300026116 Ga0207674_10008361 Ga0207674_1000836111 164
104 3300036401 Ga0373937_0036462 Ga0373937_0036462_1013_1552 164
105 3300046459 Ga0495629_0348777 Ga0495629_0348777_303_845 164
106 3300046475 Ga0495639_0002494 Ga0495639_0002494_4220_4762 164
107 3300046476 Ga0495662_0121873 Ga0495662_0121873_411_953 164
108 3300046499 Ga0495594_0017843 Ga0495594_0017843_2443_2985 164
109 3300046531 Ga0495665_0066629 Ga0495665_0066629_793_1335 164
110 3300046689 Ga0495613_0021242 Ga0495613_0021242_3751_4293 164
111 3300046809 Ga0495600_0034516 Ga0495600_0034516_2429_2971 164
112 3300047315 Ga0495581_0061450 Ga0495581_0061450_1005_1547 164
113 3300047319 Ga0495674_0269977 Ga0495674_0269977_378_920 164
114 3300047444 Ga0495675_0397031 Ga0495675_0397031_13_552 164
115 3300047673 Ga0495593_0125487 Ga0495593_0125487_469_1011 164
116 3300031903 Ga0307407_10191846 Ga0307407_101918463 165
117 3300049708 Ga0501245_055162 Ga0501245_055162_206_703 165
118 3300005336 Ga0070680_100349840 Ga0070680_1003498402 166
119 3300005341 Ga0070691_10038620 Ga0070691_100386203 166
120 3300005455 Ga0070663_100084547 Ga0070663_1000845473 166
121 3300005458 Ga0070681_10113109 Ga0070681_101131094 166
122 3300005458 Ga0070681_10229479 Ga0070681_102294792 166
123 3300005578 Ga0068854_100014628 Ga0068854_1000146283 166
124 3300005614 Ga0068856_100028869 Ga0068856_1000288693 166
125 3300009093 Ga0105240_10366202 Ga0105240_103662021 166
126 3300009174 Ga0105241_10083318 Ga0105241_100833184 166
127 3300009551 Ga0105238_10439991 Ga0105238_104399913 166
128 3300013102 Ga0157371_10016037 Ga0157371_100160379 166
129 3300013307 Ga0157372_10032433 Ga0157372_100324339 166
130 3300025905 Ga0207685_10319617 Ga0207685_103196172 166
131 3300025909 Ga0207705_10002123 Ga0207705_1000212318 166
132 3300025912 Ga0207707_10009127 Ga0207707_100091279 166
133 3300025913 Ga0207695_10004617 Ga0207695_1000461718 166
134 3300025919 Ga0207657_10001138 Ga0207657_1000113821 166
135 3300025924 Ga0207694_10223798 Ga0207694_102237983 166
136 3300025949 Ga0207667_10063175 Ga0207667_100631759 166
137 3300025981 Ga0207640_10001854 Ga0207640_1000185418 166
138 3300026067 Ga0207678_10001614 Ga0207678_1000161421 166
139 3300026078 Ga0207702_10082065 Ga0207702_100820654 166
140 3300047318 Ga0495636_0274795 Ga0495636_0274795_74_613 167
141 3300009174 Ga0105241_10174702 Ga0105241_101747022 168
142 3300013307 Ga0157372_10110207 Ga0157372_101102073 168
143 3300048917 Ga0496114_1137310 Ga0496114_1137310_15_521 168
144 3300005327 Ga0070658_11414870 Ga0070658_114148701 169
145 3300005329 Ga0070683_100009922 Ga0070683_1000099222 169
146 3300005329 Ga0070683_100081164 Ga0070683_1000811643 169
147 3300005336 Ga0070680_100411529 Ga0070680_1004115292 169
148 3300005339 Ga0070660_100652046 Ga0070660_1006520462 169
149 3300005366 Ga0070659_100541933 Ga0070659_1005419331 169
150 3300005530 Ga0070679_100196306 Ga0070679_1001963063 169
151 3300005535 Ga0070684_100054023 Ga0070684_1000540236 169
152 3300005563 Ga0068855_100719953 Ga0068855_1007199532 169
153 3300013100 Ga0157373_10336033 Ga0157373_103360332 169
154 3300013104 Ga0157370_11238193 Ga0157370_112381932 169
155 3300013105 Ga0157369_10777525 Ga0157369_107775252 169
156 3300025932 Ga0207690_10142736 Ga0207690_101427362 169
157 3300025944 Ga0207661_10008533 Ga0207661_100085333 169
158 3300025944 Ga0207661_10064624 Ga0207661_100646243 169
159 3300044694 Ga0466963_0820038 Ga0466963_0820038_16_555 169
160 3300046528 Ga0495642_0148655 Ga0495642_0148655_11_553 169
161 3300049571 Ga0501034_0156774 Ga0501034_0156774_629_1171 169
162 3300049574 Ga0501038_0011902 Ga0501038_0011902_1674_2216 169
163 3300049575 Ga0501039_0278926 Ga0501039_0278926_330_872 169
164 3300049579 Ga0501043_0014339 Ga0501043_0014339_3988_4530 169
165 3300049581 Ga0501047_0028661 Ga0501047_0028661_347_889 169
166 3300049586 Ga0501070_0177473 Ga0501070_0177473_481_1023 169
167 3300050509 nmdc:mga0qj67_644073_c1 nmdc:mga0qj67_644073_c1_318_827 169
168 3300025913 Ga0207695_10129510 Ga0207695_101295105 170
169 3300031995 Ga0307409_100386844 Ga0307409_1003868443 170
170 3300044735 Ga0466968_0042386 Ga0466968_0042386_14_526 170
171 3300026067 Ga0207678_10564686 Ga0207678_105646862 171
172 3300048918 Ga0496115_0141131 Ga0496115_0141131_664_1203 172
173 3300005329 Ga0070683_100241279 Ga0070683_1002412792 173
174 3300005334 Ga0068869_100185023 Ga0068869_1001850233 173
175 3300005335 Ga0070666_10189487 Ga0070666_101894873 173
176 3300005340 Ga0070689_100053901 Ga0070689_1000539015 173
177 3300005365 Ga0070688_100099130 Ga0070688_1000991303 173
178 3300005367 Ga0070667_100027949 Ga0070667_1000279491 173
179 3300005457 Ga0070662_100094007 Ga0070662_1000940074 173
180 3300005564 Ga0070664_100412715 Ga0070664_1004127152 173
181 3300005616 Ga0068852_100048492 Ga0068852_1000484923 173
182 3300005841 Ga0068863_100955446 Ga0068863_1009554461 173
183 3300009174 Ga0105241_10263697 Ga0105241_102636972 173
184 3300013296 Ga0157374_10055359 Ga0157374_100553597 173
185 3300013297 Ga0157378_10181392 Ga0157378_101813921 173
186 3300013308 Ga0157375_10115562 Ga0157375_101155622 173
187 3300014968 Ga0157379_10879361 Ga0157379_108793611 173
188 3300014969 Ga0157376_10188093 Ga0157376_101880933 173
189 3300025936 Ga0207670_10104915 Ga0207670_101049154 173
190 3300025942 Ga0207689_10108678 Ga0207689_101086783 173
191 3300025986 Ga0207658_10077939 Ga0207658_100779392 173
192 3300026142 Ga0207698_10252161 Ga0207698_102521613 173
193 3300028379 Ga0268266_10075607 Ga0268266_100756072 173
194 3300032002 Ga0307416_100087680 Ga0307416_1000876805 173
195 3300046522 Ga0495643_0000294 Ga0495643_0000294_49323_49865 173
196 3300046660 Ga0495625_0001933 Ga0495625_0001933_11512_12054 173
197 3300025906 Ga0207699_10159810 Ga0207699_101598102 174
198 3300041997 Ga0439431_0000148 Ga0439431_0000148_3073_3597 174
199 3300042004 Ga0439445_0006554 Ga0439445_0006554_1839_2363 174
200 3300044712 Ga0453684_0174513 Ga0453684_0174513_673_1197 174
201 3300046462 Ga0495651_0233321 Ga0495651_0233321_683_1225 174
202 3300046536 Ga0495587_0017860 Ga0495587_0017860_1429_1971 174
203 3300046679 Ga0495623_0326114 Ga0495623_0326114_118_660 174
204 3300047444 Ga0495675_0212592 Ga0495675_0212592_350_892 174
205 3300049570 Ga0501033_0125267 Ga0501033_0125267_353_877 174
206 3300049571 Ga0501034_0753057 Ga0501034_0753057_76_600 174
207 3300049581 Ga0501047_0645969 Ga0501047_0645969_291_815 174
208 3300049742 Ga0501080_0995597 Ga0501080_0995597_110_634 174
209 3300005290 Ga0065712_10008429 Ga0065712_100084296 176
210 3300005293 Ga0065715_10093983 Ga0065715_100939833 176
211 3300005337 Ga0070682_100007172 Ga0070682_1000071724 176
212 3300005338 Ga0068868_100478873 Ga0068868_1004788732 176
213 3300005435 Ga0070714_100968588 Ga0070714_1009685882 176
214 3300005440 Ga0070705_100842829 Ga0070705_1008428291 176
215 3300005444 Ga0070694_100249688 Ga0070694_1002496882 176
216 3300005445 Ga0070708_100001661 Ga0070708_10000166118 176
217 3300005445 Ga0070708_100006987 Ga0070708_1000069878 176
218 3300005445 Ga0070708_100107836 Ga0070708_1001078364 176
219 3300005458 Ga0070681_10431495 Ga0070681_104314952 176
220 3300005467 Ga0070706_100031896 Ga0070706_1000318966 176
221 3300005467 Ga0070706_100317757 Ga0070706_1003177573 176
222 3300005468 Ga0070707_100020977 Ga0070707_1000209776 176
223 3300005468 Ga0070707_100697027 Ga0070707_1006970272 176
224 3300005471 Ga0070698_100296642 Ga0070698_1002966421 176
225 3300005471 Ga0070698_100490060 Ga0070698_1004900603 176
226 3300005518 Ga0070699_100001695 Ga0070699_10000169511 176
227 3300005518 Ga0070699_100518074 Ga0070699_1005180742 176
228 3300005536 Ga0070697_100042276 Ga0070697_1000422766 176
229 3300005536 Ga0070697_100069683 Ga0070697_1000696832 176
230 3300005536 Ga0070697_100440906 Ga0070697_1004409062 176
231 3300005539 Ga0068853_100077661 Ga0068853_1000776611 176
232 3300005545 Ga0070695_100136072 Ga0070695_1001360722 176
233 3300005546 Ga0070696_100728298 Ga0070696_1007282982 176
234 3300005549 Ga0070704_100174793 Ga0070704_1001747934 176
235 3300005563 Ga0068855_100019947 Ga0068855_10001994710 176
236 3300005614 Ga0068856_100720216 Ga0068856_1007202162 176
237 3300005615 Ga0070702_100339189 Ga0070702_1003391892 176
238 3300006028 Ga0070717_10088723 Ga0070717_100887235 176
239 3300006914 Ga0075436_100768590 Ga0075436_1007685902 176
240 3300007076 Ga0075435_100077319 Ga0075435_1000773191 176
241 3300009093 Ga0105240_10194521 Ga0105240_101945213 176
242 3300009098 Ga0105245_10296671 Ga0105245_102966713 176
243 3300010375 Ga0105239_10320114 Ga0105239_103201142 176
244 3300013105 Ga0157369_11055116 Ga0157369_110551161 176
245 3300013297 Ga0157378_10445427 Ga0157378_104454271 176
246 3300013307 Ga0157372_10027457 Ga0157372_100274573 176
247 3300025910 Ga0207684_10041535 Ga0207684_100415356 176
248 3300025910 Ga0207684_10205446 Ga0207684_102054463 176
249 3300025910 Ga0207684_10207259 Ga0207684_102072593 176
250 3300025922 Ga0207646_10028761 Ga0207646_100287612 176
251 3300025922 Ga0207646_10117918 Ga0207646_101179183 176
252 3300025922 Ga0207646_10119383 Ga0207646_101193835 176
253 3300025939 Ga0207665_10553953 Ga0207665_105539531 176
254 3300025960 Ga0207651_10110238 Ga0207651_101102382 176
255 3300026023 Ga0207677_10102756 Ga0207677_101027563 176
256 3300041460 Ga0451802_2169794 Ga0451802_2169794_288_836 176
257 3300046674 Ga0495588_0017168 Ga0495588_0017168_2419_2967 176
258 3300046684 Ga0495669_0406772 Ga0495669_0406772_94_642 176
259 3300050514 nmdc:mga08x19_41680_c1 nmdc:mga08x19_41680_c1_1528_2076 176
260 iso_pu_bacteria 2513020052 2513232379 176
261 iso_pu_bacteria 2519899754 2520879543 176
262 iso_pu_bacteria 2643221667 2644373942 176
263 iso_pu_bacteria 2738541279 2738733056 176
264 iso_pu_bacteria 2738541285 2738765594 176
265 iso_pu_bacteria 2738543007 2739214637 176
266 iso_pu_bacteria 2739367857 2740002847 176
267 iso_pu_bacteria 2739367858 2740007664 176
268 iso_pu_bacteria 2816332280 2817413537 176
269 iso_pu_bacteria 2833640130 2833640611 176
270 iso_pu_bacteria 2857613821 2857617060 176
271 iso_pu_bacteria 2857618242 2857619729 176
272 iso_pu_bacteria 2881359912 2881364113 176
273 iso_pu_bacteria 2903895155 2903898672 176
274 iso_pu_bacteria 2904419702 2904422388 176
275 iso_pu_bacteria 2904555929 2904558506 176
276 iso_pu_bacteria 2929150217 2929150593 176
277 iso_pu_bacteria 2958458903 2958461990 176
278 iso_pu_bacteria 8036736890 8036739254 176
279 iso_pu_bacteria 8056440228 8056443507 176
280 3300005343 Ga0070687_100346159 Ga0070687_1003461592 177
281 3300009177 Ga0105248_10311359 Ga0105248_103113594 177
282 3300026118 Ga0207675_100053069 Ga0207675_1000530692 177
283 3300042134 Ga0450898_013724 Ga0450898_013724_684_1217 177
284 3300044673 Ga0453683_0044004 Ga0453683_0044004_1583_2134 177
285 3300044712 Ga0453684_0217161 Ga0453684_0217161_1024_1575 177
286 3300049588 Ga0501072_0702432 Ga0501072_0702432_41_574 177
287 3300049589 Ga0501073_0568293 Ga0501073_0568293_205_738 177
288 3300049591 Ga0501075_0331579 Ga0501075_0331579_396_929 177
289 3300049592 Ga0501076_0311540 Ga0501076_0311540_418_951 177
290 3300049741 Ga0501079_0363211 Ga0501079_0363211_453_986 177
291 3300049134 Ga0501345_01514 Ga0501345_01514_15_551 178
292 3300003349 JGI26129J50193_1007612 JGI26129J50193_10076121 179
293 3300005293 Ga0065715_10124098 Ga0065715_101240983 179
294 3300005337 Ga0070682_101108578 Ga0070682_1011085781 179
295 3300005339 Ga0070660_100180211 Ga0070660_1001802114 179
296 3300005341 Ga0070691_10007739 Ga0070691_1000773910 179
297 3300005344 Ga0070661_100068143 Ga0070661_1000681434 179
298 3300005353 Ga0070669_100140043 Ga0070669_1001400433 179
299 3300005353 Ga0070669_100704253 Ga0070669_1007042531 179
300 3300005367 Ga0070667_100194249 Ga0070667_1001942492 179
301 3300005435 Ga0070714_100119027 Ga0070714_1001190273 179
302 3300005444 Ga0070694_100087623 Ga0070694_1000876232 179
303 3300005445 Ga0070708_100021209 Ga0070708_1000212096 179
304 3300005466 Ga0070685_10015284 Ga0070685_100152846 179
305 3300005467 Ga0070706_100001389 Ga0070706_10000138918 179
306 3300005468 Ga0070707_100000141 Ga0070707_10000014159 179
307 3300005468 Ga0070707_100008479 Ga0070707_1000084792 179
308 3300005471 Ga0070698_100000139 Ga0070698_10000013955 179
309 3300005471 Ga0070698_100002247 Ga0070698_10000224721 179
310 3300005471 Ga0070698_100005143 Ga0070698_10000514317 179
311 3300005471 Ga0070698_100042072 Ga0070698_1000420726 179
312 3300005518 Ga0070699_100100649 Ga0070699_1001006492 179
313 3300005530 Ga0070679_100018421 Ga0070679_1000184217 179
314 3300005535 Ga0070684_100222706 Ga0070684_1002227063 179
315 3300005535 Ga0070684_100240060 Ga0070684_1002400601 179
316 3300005536 Ga0070697_100000181 Ga0070697_10000018126 179
317 3300005536 Ga0070697_100178920 Ga0070697_1001789202 179
318 3300005549 Ga0070704_101042778 Ga0070704_1010427782 179
319 3300005563 Ga0068855_101019638 Ga0068855_1010196381 179
320 3300005564 Ga0070664_100359643 Ga0070664_1003596432 179
321 3300005564 Ga0070664_101143510 Ga0070664_1011435101 179
322 3300005577 Ga0068857_100046762 Ga0068857_1000467627 179
323 3300005614 Ga0068856_100100151 Ga0068856_1001001512 179
324 3300005616 Ga0068852_100029891 Ga0068852_1000298912 179
325 3300005617 Ga0068859_100104175 Ga0068859_1001041755 179
326 3300005618 Ga0068864_100529709 Ga0068864_1005297092 179
327 3300005985 Ga0081539_10115723 Ga0081539_101157232 179
328 3300006173 Ga0070716_100093082 Ga0070716_1000930823 179
329 3300006914 Ga0075436_100077507 Ga0075436_1000775073 179
330 3300006931 Ga0097620_100104177 Ga0097620_1001041775 179
331 3300009093 Ga0105240_10254590 Ga0105240_102545902 179
332 3300009147 Ga0114129_10999154 Ga0114129_109991542 179
333 3300009553 Ga0105249_10000247 Ga0105249_1000024753 179
334 3300010375 Ga0105239_10212579 Ga0105239_102125794 179
335 3300013100 Ga0157373_10570695 Ga0157373_105706952 179
336 3300013102 Ga0157371_10679687 Ga0157371_106796872 179
337 3300013104 Ga0157370_10139130 Ga0157370_101391302 179
338 3300013104 Ga0157370_10536180 Ga0157370_105361802 179
339 3300013104 Ga0157370_11183978 Ga0157370_111839782 179
340 3300013296 Ga0157374_10832188 Ga0157374_108321882 179
341 3300013306 Ga0163162_10711473 Ga0163162_107114732 179
342 3300013307 Ga0157372_10054127 Ga0157372_100541274 179
343 3300014745 Ga0157377_10023986 Ga0157377_100239867 179
344 3300015262 Ga0182007_10084666 Ga0182007_100846662 179
345 3300020070 Ga0206356_10956043 Ga0206356_109560434 179
346 3300025910 Ga0207684_10000188 Ga0207684_1000018860 179
347 3300025911 Ga0207654_10048247 Ga0207654_100482472 179
348 3300025911 Ga0207654_10292629 Ga0207654_102926292 179
349 3300025912 Ga0207707_10504761 Ga0207707_105047611 179
350 3300025913 Ga0207695_10013424 Ga0207695_1001342418 179
351 3300025913 Ga0207695_10020633 Ga0207695_100206336 179
352 3300025917 Ga0207660_10172670 Ga0207660_101726702 179
353 3300025920 Ga0207649_10016202 Ga0207649_100162026 179
354 3300025922 Ga0207646_10000238 Ga0207646_1000023819 179
355 3300025922 Ga0207646_10000258 Ga0207646_1000025863 179
356 3300025922 Ga0207646_11088683 Ga0207646_110886831 179
357 3300025923 Ga0207681_10296179 Ga0207681_102961792 179
358 3300025929 Ga0207664_10035039 Ga0207664_100350394 179
359 3300025929 Ga0207664_10554156 Ga0207664_105541561 179
360 3300025933 Ga0207706_10073828 Ga0207706_100738283 179
361 3300025936 Ga0207670_10904556 Ga0207670_109045561 179
362 3300025939 Ga0207665_10034509 Ga0207665_100345096 179
363 3300025939 Ga0207665_10108119 Ga0207665_101081192 179
364 3300025941 Ga0207711_10168742 Ga0207711_101687422 179
365 3300025945 Ga0207679_10122373 Ga0207679_101223734 179
366 3300025949 Ga0207667_11385274 Ga0207667_113852741 179
367 3300025960 Ga0207651_10545173 Ga0207651_105451733 179
368 3300025961 Ga0207712_10000236 Ga0207712_1000023618 179
369 3300026035 Ga0207703_10107075 Ga0207703_101070752 179
370 3300026067 Ga0207678_10318133 Ga0207678_103181333 179
371 3300026078 Ga0207702_10026759 Ga0207702_100267596 179
372 3300026095 Ga0207676_10556643 Ga0207676_105566432 179
373 3300026116 Ga0207674_10031980 Ga0207674_100319809 179
374 3300026116 Ga0207674_10374567 Ga0207674_103745673 179
375 3300027360 Ga0209969_1001951 Ga0209969_10019513 179
376 3300027364 Ga0209967_1017786 Ga0209967_10177861 179
377 3300027462 Ga0210000_1006710 Ga0210000_10067103 179
378 3300027471 Ga0209995_1012225 Ga0209995_10122252 179
379 3300027526 Ga0209968_1001933 Ga0209968_10019336 179
380 3300027614 Ga0209970_1038065 Ga0209970_10380652 179
381 3300027717 Ga0209998_10001251 Ga0209998_100012513 179
382 3300027876 Ga0209974_10012090 Ga0209974_100120906 179
383 3300028380 Ga0268265_10430882 Ga0268265_104308822 179
384 3300031548 Ga0307408_100075805 Ga0307408_1000758052 179
385 3300031548 Ga0307408_100868518 Ga0307408_1008685182 179
386 3300031731 Ga0307405_10090080 Ga0307405_100900803 179
387 3300031824 Ga0307413_10249917 Ga0307413_102499172 179
388 3300031852 Ga0307410_10048579 Ga0307410_100485796 179
389 3300031852 Ga0307410_10157622 Ga0307410_101576222 179
390 3300031852 Ga0307410_10287412 Ga0307410_102874123 179
391 3300031901 Ga0307406_10033753 Ga0307406_100337535 179
392 3300031903 Ga0307407_10095116 Ga0307407_100951164 179
393 3300031995 Ga0307409_100057484 Ga0307409_1000574843 179
394 3300031995 Ga0307409_100219286 Ga0307409_1002192864 179
395 3300031995 Ga0307409_100810802 Ga0307409_1008108022 179
396 3300032002 Ga0307416_100008439 Ga0307416_10000843912 179
397 3300032004 Ga0307414_10178342 Ga0307414_101783422 179
398 3300032005 Ga0307411_10330459 Ga0307411_103304592 179
399 3300032126 Ga0307415_100300684 Ga0307415_1003006843 179
400 3300035088 Ga0373940_0148248 Ga0373940_0148248_47_586 179
401 3300035242 Ga0373962_0095519 Ga0373962_0095519_30_569 179
402 3300035410 Ga0373924_0230165 Ga0373924_0230165_257_796 179
403 3300035724 Ga0373933_0303736 Ga0373933_0303736_48_587 179
404 3300036401 Ga0373937_0048653 Ga0373937_0048653_2035_2574 179
405 3300036401 Ga0373937_0547176 Ga0373937_0547176_163_702 179
406 3300044712 Ga0453684_0950475 Ga0453684_0950475_338_877 179
407 3300046454 Ga0495592_0199036 Ga0495592_0199036_610_1149 179
408 3300046455 Ga0495603_0018332 Ga0495603_0018332_428_967 179
409 3300046455 Ga0495603_0347795 Ga0495603_0347795_212_751 179
410 3300046459 Ga0495629_0146129 Ga0495629_0146129_634_1173 179
411 3300046459 Ga0495629_0194689 Ga0495629_0194689_64_603 179
412 3300046462 Ga0495651_0224316 Ga0495651_0224316_217_756 179
413 3300046463 Ga0495653_0127165 Ga0495653_0127165_550_1089 179
414 3300046472 Ga0495580_0015211 Ga0495580_0015211_1467_2006 179
415 3300046472 Ga0495580_0160474 Ga0495580_0160474_490_1029 179
416 3300046473 Ga0495582_0004780 Ga0495582_0004780_3311_3850 179
417 3300046473 Ga0495582_0302421 Ga0495582_0302421_157_696 179
418 3300046475 Ga0495639_0009573 Ga0495639_0009573_2075_2614 179
419 3300046475 Ga0495639_0148496 Ga0495639_0148496_92_631 179
420 3300046476 Ga0495662_0023228 Ga0495662_0023228_994_1533 179
421 3300046477 Ga0495664_0004041 Ga0495664_0004041_6516_7055 179
422 3300046477 Ga0495664_0051857 Ga0495664_0051857_264_803 179
423 3300046499 Ga0495594_0002236 Ga0495594_0002236_3586_4125 179
424 3300046511 Ga0495608_0111772 Ga0495608_0111772_670_1209 179
425 3300046514 Ga0495618_0019866 Ga0495618_0019866_3586_4125 179
426 3300046514 Ga0495618_0059831 Ga0495618_0059831_396_935 179
427 3300046516 Ga0495628_0063967 Ga0495628_0063967_1129_1668 179
428 3300046516 Ga0495628_0112366 Ga0495628_0112366_751_1290 179
429 3300046517 Ga0495630_0003672 Ga0495630_0003672_2306_2845 179
430 3300046517 Ga0495630_0068879 Ga0495630_0068879_517_1056 179
431 3300046526 Ga0495666_0007984 Ga0495666_0007984_791_1330 179
432 3300046529 Ga0495652_0170490 Ga0495652_0170490_519_1058 179
433 3300046529 Ga0495652_0279721 Ga0495652_0279721_66_605 179
434 3300046531 Ga0495665_0075756 Ga0495665_0075756_460_999 179
435 3300046533 Ga0495640_0013380 Ga0495640_0013380_3011_3550 179
436 3300046533 Ga0495640_0045154 Ga0495640_0045154_1199_1738 179
437 3300046535 Ga0495586_0005406 Ga0495586_0005406_4201_4740 179
438 3300046536 Ga0495587_0027547 Ga0495587_0027547_519_1058 179
439 3300046559 Ga0495667_0001513 Ga0495667_0001513_2408_2947 179
440 3300046559 Ga0495667_0054956 Ga0495667_0054956_425_964 179
441 3300046559 Ga0495667_0068058 Ga0495667_0068058_1128_1667 179
442 3300046642 Ga0495634_0001123 Ga0495634_0001123_7503_8042 179
443 3300046663 Ga0495635_0028641 Ga0495635_0028641_2787_3326 179
444 3300046663 Ga0495635_0041441 Ga0495635_0041441_501_1040 179
445 3300046675 Ga0495657_0017987 Ga0495657_0017987_4505_5044 179
446 3300046679 Ga0495623_0044936 Ga0495623_0044936_1507_2046 179
447 3300046680 Ga0495646_0052770 Ga0495646_0052770_23_562 179
448 3300046683 Ga0495658_0003330 Ga0495658_0003330_74_613 179
449 3300046689 Ga0495613_0073700 Ga0495613_0073700_79_618 179
450 3300046689 Ga0495613_0130705 Ga0495613_0130705_16_555 179
451 3300046690 Ga0495624_0190316 Ga0495624_0190316_451_990 179
452 3300046809 Ga0495600_0008219 Ga0495600_0008219_4575_5114 179
453 3300046809 Ga0495600_0064475 Ga0495600_0064475_1587_2126 179
454 3300047315 Ga0495581_0093525 Ga0495581_0093525_798_1337 179
455 3300047317 Ga0495604_0215319 Ga0495604_0215319_707_1246 179
456 3300047319 Ga0495674_0006511 Ga0495674_0006511_1840_2379 179
457 3300047319 Ga0495674_0057314 Ga0495674_0057314_2257_2796 179
458 3300047321 Ga0495676_0108551 Ga0495676_0108551_1055_1594 179
459 3300047321 Ga0495676_0127835 Ga0495676_0127835_73_612 179
460 3300047322 Ga0495680_0012216 Ga0495680_0012216_3943_4482 179
461 3300047322 Ga0495680_0013035 Ga0495680_0013035_6398_6937 179
462 3300047322 Ga0495680_0082584 Ga0495680_0082584_309_848 179
463 3300047444 Ga0495675_0017264 Ga0495675_0017264_1245_1784 179
464 3300047471 Ga0495684_0014936 Ga0495684_0014936_1666_2205 179
465 3300047471 Ga0495684_0246355 Ga0495684_0246355_398_937 179
466 3300047471 Ga0495684_0321795 Ga0495684_0321795_146_685 179
467 3300048088 Ga0495602_0080010 Ga0495602_0080010_1932_2471 179
468 3300048914 Ga0496111_0184697 Ga0496111_0184697_409_963 179
469 3300049521 Ga0501298_015704 Ga0501298_015704_415_954 179
470 3300049576 Ga0501040_0023723 Ga0501040_0023723_2598_3137 179
471 3300049577 Ga0501041_0022629 Ga0501041_0022629_969_1508 179
472 3300049578 Ga0501042_0111407 Ga0501042_0111407_973_1512 179
473 3300049587 Ga0501071_0342927 Ga0501071_0342927_372_911 179
474 3300049593 Ga0501077_0037660 Ga0501077_0037660_782_1321 179
475 3300049652 Ga0501202_001841 Ga0501202_001841_2515_3054 179
476 3300049654 Ga0501207_063034 Ga0501207_063034_43_582 179
477 3300049656 Ga0501209_069646 Ga0501209_069646_449_988 179
478 3300049662 Ga0501222_004291 Ga0501222_004291_855_1394 179
479 3300049663 Ga0501223_012279 Ga0501223_012279_297_836 179
480 3300049664 Ga0501224_032102 Ga0501224_032102_177_716 179
481 3300049665 Ga0501227_049108 Ga0501227_049108_282_821 179
482 3300049668 Ga0501233_015944 Ga0501233_015944_407_946 179
483 3300049669 Ga0501235_011426 Ga0501235_011426_1020_1559 179
484 3300049674 Ga0501242_020336 Ga0501242_020336_152_691 179
485 3300049676 Ga0501246_006229 Ga0501246_006229_68_607 179
486 3300049678 Ga0501248_011597 Ga0501248_011597_191_730 179
487 3300049679 Ga0501249_011337 Ga0501249_011337_865_1404 179
488 3300049681 Ga0501251_007216 Ga0501251_007216_272_811 179
489 3300049685 Ga0501256_016105 Ga0501256_016105_165_704 179
490 3300049686 Ga0501257_057909 Ga0501257_057909_140_679 179
491 3300049688 Ga0501259_004749 Ga0501259_004749_1257_1796 179
492 3300049705 Ga0501225_0003051 Ga0501225_0003051_532_1071 179
493 3300049707 Ga0501234_005497 Ga0501234_005497_1006_1545 179
494 3300049741 Ga0501079_0269060 Ga0501079_0269060_628_1167 179
495 3300049760 Ga0501263_003314 Ga0501263_003314_438_977 179
496 3300049765 Ga0501268_000392 Ga0501268_000392_3228_3767 179
497 3300049766 Ga0501269_027813 Ga0501269_027813_163_702 179
498 3300049767 Ga0501270_000461 Ga0501270_000461_1086_1625 179
499 3300049771 Ga0501274_008220 Ga0501274_008220_381_920 179
500 3300049779 Ga0501283_018119 Ga0501283_018119_524_1063 179
501 3300049824 Ga0501045_0778464 Ga0501045_0778464_132_671 179
502 3300049853 Ga0501226_018378 Ga0501226_018378_179_718 179
503 3300050509 nmdc:mga0qj67_333638_c1 nmdc:mga0qj67_333638_c1_264_803 179
504 3300050514 nmdc:mga08x19_9157_c1 nmdc:mga08x19_9157_c1_1778_2317 179
505 3300053077 Ga0495601_0347318 Ga0495601_0347318_290_829 179
506 3300053078 Ga0495612_0153909 Ga0495612_0153909_177_716 179
507 3300053085 Ga0495619_0238679 Ga0495619_0238679_276_815 179
508 3300054114 Ga0501084_0573462 Ga0501084_0573462_227_766 179
509 3300059423 Ga0590074_023625 Ga0590074_023625_447_986 179
510 3300061734 Ga0530510_0086201 Ga0530510_0086201_299_838 179
511 3300000549 LJQas_1012500 LJQas_10125002 180
512 3300003578 Ga0006562J51391_1003423 Ga0006562J51391_100342316 180
513 3300004801 Ga0058860_10114316 Ga0058860_1011431612 180
514 3300005289 Ga0065704_10086392 Ga0065704_100863923 180
515 3300005289 Ga0065704_10103057 Ga0065704_101030575 180
516 3300005290 Ga0065712_10113906 Ga0065712_101139062 180
517 3300005293 Ga0065715_10177959 Ga0065715_101779592 180
518 3300005293 Ga0065715_10581349 Ga0065715_105813491 180
519 3300005327 Ga0070658_10169704 Ga0070658_101697042 180
520 3300005327 Ga0070658_10357028 Ga0070658_103570283 180
521 3300005328 Ga0070676_10062712 Ga0070676_100627125 180
522 3300005328 Ga0070676_10621000 Ga0070676_106210001 180
523 3300005328 Ga0070676_11087944 Ga0070676_110879441 180
524 3300005329 Ga0070683_100298539 Ga0070683_1002985393 180
525 3300005329 Ga0070683_101267235 Ga0070683_1012672351 180
526 3300005330 Ga0070690_100589134 Ga0070690_1005891341 180
527 3300005331 Ga0070670_100468747 Ga0070670_1004687471 180
528 3300005334 Ga0068869_100271127 Ga0068869_1002711272 180
529 3300005335 Ga0070666_10463033 Ga0070666_104630331 180
530 3300005335 Ga0070666_10507550 Ga0070666_105075502 180
531 3300005336 Ga0070680_100064155 Ga0070680_1000641556 180
532 3300005337 Ga0070682_100016944 Ga0070682_1000169442 180
533 3300005337 Ga0070682_100126149 Ga0070682_1001261493 180
534 3300005337 Ga0070682_100686045 Ga0070682_1006860452 180
535 3300005338 Ga0068868_100344761 Ga0068868_1003447611 180
536 3300005339 Ga0070660_100334563 Ga0070660_1003345632 180
537 3300005339 Ga0070660_100384174 Ga0070660_1003841742 180
538 3300005339 Ga0070660_101030934 Ga0070660_1010309341 180
539 3300005340 Ga0070689_100053903 Ga0070689_1000539032 180
540 3300005344 Ga0070661_100579274 Ga0070661_1005792741 180
541 3300005347 Ga0070668_100658622 Ga0070668_1006586221 180
542 3300005353 Ga0070669_100125906 Ga0070669_1001259063 180
543 3300005353 Ga0070669_100132566 Ga0070669_1001325662 180
544 3300005354 Ga0070675_100070749 Ga0070675_1000707492 180
545 3300005354 Ga0070675_100148933 Ga0070675_1001489334 180
546 3300005354 Ga0070675_100289788 Ga0070675_1002897882 180
547 3300005354 Ga0070675_100361131 Ga0070675_1003611312 180
548 3300005355 Ga0070671_100190007 Ga0070671_1001900072 180
549 3300005364 Ga0070673_100160707 Ga0070673_1001607073 180
550 3300005364 Ga0070673_101564579 Ga0070673_1015645791 180
551 3300005365 Ga0070688_100005699 Ga0070688_10000569910 180
552 3300005367 Ga0070667_100170442 Ga0070667_1001704424 180
553 3300005367 Ga0070667_100215840 Ga0070667_1002158401 180
554 3300005435 Ga0070714_100166074 Ga0070714_1001660743 180
555 3300005436 Ga0070713_100072196 Ga0070713_1000721965 180
556 3300005436 Ga0070713_100715239 Ga0070713_1007152391 180
557 3300005437 Ga0070710_10193372 Ga0070710_101933722 180
558 3300005438 Ga0070701_10355167 Ga0070701_103551672 180
559 3300005439 Ga0070711_100481273 Ga0070711_1004812732 180
560 3300005457 Ga0070662_100427648 Ga0070662_1004276483 180
561 3300005459 Ga0068867_100063230 Ga0068867_1000632304 180
562 3300005530 Ga0070679_100455102 Ga0070679_1004551022 180
563 3300005539 Ga0068853_100736552 Ga0068853_1007365521 180
564 3300005539 Ga0068853_100836277 Ga0068853_1008362772 180
565 3300005543 Ga0070672_100015656 Ga0070672_1000156562 180
566 3300005543 Ga0070672_100175780 Ga0070672_1001757804 180
567 3300005543 Ga0070672_100199872 Ga0070672_1001998724 180
568 3300005544 Ga0070686_100142468 Ga0070686_1001424681 180
569 3300005564 Ga0070664_101220799 Ga0070664_1012207992 180
570 3300005577 Ga0068857_100309363 Ga0068857_1003093633 180
571 3300005614 Ga0068856_100282487 Ga0068856_1002824872 180
572 3300005615 Ga0070702_100130492 Ga0070702_1001304924 180
573 3300005616 Ga0068852_100448814 Ga0068852_1004488143 180
574 3300005616 Ga0068852_100474206 Ga0068852_1004742061 180
575 3300005617 Ga0068859_100037937 Ga0068859_1000379378 180
576 3300005618 Ga0068864_100323618 Ga0068864_1003236182 180
577 3300005718 Ga0068866_10043211 Ga0068866_100432114 180
578 3300005841 Ga0068863_100292329 Ga0068863_1002923293 180
579 3300006058 Ga0075432_10196707 Ga0075432_101967072 180
580 3300006175 Ga0070712_100195740 Ga0070712_1001957402 180
581 3300006177 Ga0075362_10019709 Ga0075362_100197094 180
582 3300006237 Ga0097621_100218088 Ga0097621_1002180882 180
583 3300006358 Ga0068871_100017988 Ga0068871_1000179885 180
584 3300006358 Ga0068871_100274363 Ga0068871_1002743632 180
585 3300006880 Ga0075429_100221343 Ga0075429_1002213433 180
586 3300006881 Ga0068865_100036788 Ga0068865_1000367883 180
587 3300006931 Ga0097620_100037934 Ga0097620_1000379342 180
588 3300006942 Ga0099824_1003374 Ga0099824_100337411 180
589 3300006946 Ga0079104_1060427 Ga0079104_10604272 180
590 3300006948 Ga0099826_10000125 Ga0099826_1000012517 180
591 3300009036 Ga0105244_10017933 Ga0105244_1001793310 180
592 3300009036 Ga0105244_10354646 Ga0105244_103546461 180
593 3300009094 Ga0111539_11573137 Ga0111539_115731372 180
594 3300009098 Ga0105245_10274777 Ga0105245_102747772 180
595 3300009101 Ga0105247_10060663 Ga0105247_100606634 180
596 3300009176 Ga0105242_10043231 Ga0105242_100432317 180
597 3300009176 Ga0105242_10066640 Ga0105242_100666403 180
598 3300009177 Ga0105248_10198497 Ga0105248_101984972 180
599 3300013100 Ga0157373_10420570 Ga0157373_104205702 180
600 3300013102 Ga0157371_10001678 Ga0157371_1000167820 180
601 3300013102 Ga0157371_10468294 Ga0157371_104682941 180
602 3300013104 Ga0157370_10402029 Ga0157370_104020293 180
603 3300013104 Ga0157370_10453181 Ga0157370_104531812 180
604 3300013104 Ga0157370_10509257 Ga0157370_105092572 180
605 3300013104 Ga0157370_10551623 Ga0157370_105516232 180
606 3300013104 Ga0157370_10739218 Ga0157370_107392181 180
607 3300013105 Ga0157369_10000613 Ga0157369_1000061325 180
608 3300013105 Ga0157369_10071232 Ga0157369_100712322 180
609 3300013105 Ga0157369_10787754 Ga0157369_107877541 180
610 3300013297 Ga0157378_10163750 Ga0157378_101637503 180
611 3300013306 Ga0163162_10022452 Ga0163162_100224529 180
612 3300013306 Ga0163162_10393923 Ga0163162_103939233 180
613 3300013306 Ga0163162_10469381 Ga0163162_104693813 180
614 3300013308 Ga0157375_10434170 Ga0157375_104341702 180
615 3300013308 Ga0157375_10564583 Ga0157375_105645833 180
616 3300013308 Ga0157375_10865563 Ga0157375_108655632 180
617 3300014325 Ga0163163_10139608 Ga0163163_101396084 180
618 3300014326 Ga0157380_10141735 Ga0157380_101417353 180
619 3300014326 Ga0157380_10153019 Ga0157380_101530193 180
620 3300014745 Ga0157377_10070039 Ga0157377_100700392 180
621 3300014968 Ga0157379_10465606 Ga0157379_104656062 180
622 3300014969 Ga0157376_10162799 Ga0157376_101627993 180
623 3300017792 Ga0163161_10000039 Ga0163161_1000003920 180
624 3300017792 Ga0163161_10085599 Ga0163161_100855992 180
625 3300017792 Ga0163161_10379068 Ga0163161_103790682 180
626 3300017792 Ga0163161_10504512 Ga0163161_105045122 180
627 3300020070 Ga0206356_11673591 Ga0206356_116735913 180
628 3300020077 Ga0206351_10597380 Ga0206351_105973802 180
629 3300020081 Ga0206354_11354915 Ga0206354_113549153 180
630 3300025728 Ga0207655_1000038 Ga0207655_1000038193 180
631 3300025893 Ga0207682_10029977 Ga0207682_100299772 180
632 3300025893 Ga0207682_10064402 Ga0207682_100644022 180
633 3300025898 Ga0207692_10063935 Ga0207692_100639353 180
634 3300025899 Ga0207642_10023001 Ga0207642_100230015 180
635 3300025904 Ga0207647_10060143 Ga0207647_100601434 180
636 3300025907 Ga0207645_10197099 Ga0207645_101970992 180
637 3300025907 Ga0207645_10636283 Ga0207645_106362832 180
638 3300025909 Ga0207705_10027457 Ga0207705_100274576 180
639 3300025909 Ga0207705_10287956 Ga0207705_102879562 180
640 3300025916 Ga0207663_10272547 Ga0207663_102725472 180
641 3300025917 Ga0207660_10155047 Ga0207660_101550472 180
642 3300025919 Ga0207657_10090942 Ga0207657_100909425 180
643 3300025919 Ga0207657_10141001 Ga0207657_101410014 180
644 3300025920 Ga0207649_10061543 Ga0207649_100615433 180
645 3300025925 Ga0207650_10010393 Ga0207650_1001039313 180
646 3300025926 Ga0207659_10024258 Ga0207659_100242587 180
647 3300025926 Ga0207659_10342424 Ga0207659_103424242 180
648 3300025926 Ga0207659_11180188 Ga0207659_111801881 180
649 3300025927 Ga0207687_10403595 Ga0207687_104035952 180
650 3300025929 Ga0207664_10068385 Ga0207664_100683853 180
651 3300025931 Ga0207644_10853110 Ga0207644_108531102 180
652 3300025932 Ga0207690_10421218 Ga0207690_104212181 180
653 3300025934 Ga0207686_10180303 Ga0207686_101803033 180
654 3300025935 Ga0207709_10134731 Ga0207709_101347313 180
655 3300025936 Ga0207670_10180630 Ga0207670_101806302 180
656 3300025940 Ga0207691_10037594 Ga0207691_100375946 180
657 3300025941 Ga0207711_11074903 Ga0207711_110749032 180
658 3300025942 Ga0207689_10258512 Ga0207689_102585122 180
659 3300025944 Ga0207661_10021263 Ga0207661_100212634 180
660 3300025944 Ga0207661_10566291 Ga0207661_105662912 180
661 3300025945 Ga0207679_10548217 Ga0207679_105482173 180
662 3300025949 Ga0207667_10183304 Ga0207667_101833044 180
663 3300025960 Ga0207651_10019970 Ga0207651_100199703 180
664 3300025972 Ga0207668_10124203 Ga0207668_101242034 180
665 3300025972 Ga0207668_10685879 Ga0207668_106858791 180
666 3300025981 Ga0207640_10137420 Ga0207640_101374201 180
667 3300025986 Ga0207658_10077846 Ga0207658_100778461 180
668 3300025986 Ga0207658_10454404 Ga0207658_104544042 180
669 3300025986 Ga0207658_10941263 Ga0207658_109412632 180
670 3300026023 Ga0207677_10439386 Ga0207677_104393862 180
671 3300026023 Ga0207677_11133257 Ga0207677_111332571 180
672 3300026041 Ga0207639_10086818 Ga0207639_100868183 180
673 3300026067 Ga0207678_10102818 Ga0207678_101028183 180
674 3300026075 Ga0207708_10061743 Ga0207708_100617434 180
675 3300026078 Ga0207702_10828111 Ga0207702_108281111 180
676 3300026089 Ga0207648_10076452 Ga0207648_100764526 180
677 3300026089 Ga0207648_10437276 Ga0207648_104372763 180
678 3300026116 Ga0207674_10102267 Ga0207674_101022674 180
679 3300026116 Ga0207674_10405111 Ga0207674_104051112 180
680 3300026118 Ga0207675_101218918 Ga0207675_1012189181 180
681 3300026121 Ga0207683_10225777 Ga0207683_102257772 180
682 3300026121 Ga0207683_10943649 Ga0207683_109436492 180
683 3300026142 Ga0207698_10689462 Ga0207698_106894622 180
684 3300027111 Ga0209281_1050393 Ga0209281_10503931 180
685 3300027361 Ga0209489_111364 Ga0209489_11136410 180
686 3300027424 Ga0209984_1016798 Ga0209984_10167982 180
687 3300027526 Ga0209968_1000671 Ga0209968_10006716 180
688 3300027617 Ga0210002_1001591 Ga0210002_10015912 180
689 3300027907 Ga0207428_10241738 Ga0207428_102417382 180
690 3300028381 Ga0268264_10355798 Ga0268264_103557982 180
691 3300028794 Ga0307515_10409858 Ga0307515_104098582 180
692 3300030734 Ga0316179_1109740 Ga0316179_11097406 180
693 3300030744 Ga0316181_1180820 Ga0316181_11808202 180
694 3300031456 Ga0307513_10358454 Ga0307513_103584542 180
695 3300031548 Ga0307408_100056125 Ga0307408_1000561254 180
696 3300031548 Ga0307408_100478862 Ga0307408_1004788622 180
697 3300031728 Ga0316578_10025018 Ga0316578_100250186 180
698 3300031731 Ga0307405_10000005 Ga0307405_10000005213 180
699 3300031824 Ga0307413_10001307 Ga0307413_1000130710 180
700 3300031824 Ga0307413_10353719 Ga0307413_103537192 180
701 3300031852 Ga0307410_10000034 Ga0307410_1000003422 180
702 3300031901 Ga0307406_10000004 Ga0307406_10000004122 180
703 3300031901 Ga0307406_10651741 Ga0307406_106517412 180
704 3300031903 Ga0307407_10000196 Ga0307407_1000019614 180
705 3300031903 Ga0307407_10014444 Ga0307407_100144444 180
706 3300031911 Ga0307412_10061465 Ga0307412_100614653 180
707 3300031911 Ga0307412_10610000 Ga0307412_106100002 180
708 3300032002 Ga0307416_100010892 Ga0307416_10001089210 180
709 3300032004 Ga0307414_10000011 Ga0307414_10000011334 180
710 3300032004 Ga0307414_10000527 Ga0307414_100005272 180
711 3300032004 Ga0307414_10011571 Ga0307414_1001157110 180
712 3300032004 Ga0307414_10024140 Ga0307414_100241405 180
713 3300032004 Ga0307414_10735107 Ga0307414_107351071 180
714 3300032005 Ga0307411_10000004 Ga0307411_1000000415 180
715 3300032005 Ga0307411_10126234 Ga0307411_101262344 180
716 3300032126 Ga0307415_100931172 Ga0307415_1009311722 180
717 3300033180 Ga0307510_10035700 Ga0307510_100357007 180
718 3300033541 Ga0316596_1000052 Ga0316596_100005216 180
719 3300035398 Ga0316574_0007562 Ga0316574_0007562_299_841 180
720 3300035398 Ga0316574_0045952 Ga0316574_0045952_1709_2251 180
721 3300036401 Ga0373937_0076521 Ga0373937_0076521_2501_3043 180
722 3300036712 Ga0316584_0020615 Ga0316584_0020615_1671_2213 180
723 3300036712 Ga0316584_0065628 Ga0316584_0065628_815_1357 180
724 3300041407 Ga0439447_000447 Ga0439447_000447_941_1483 180
725 3300041411 Ga0439466_0004165 Ga0439466_0004165_4675_5217 180
726 3300041451 Ga0451791_1675939 Ga0451791_1675939_2064_2606 180
727 3300041494 Ga0451837_1056715 Ga0451837_1056715_2342_2884 180
728 3300041498 Ga0451841_0588885 Ga0451841_0588885_326_868 180
729 3300041509 Ga0451843_1326072 Ga0451843_1326072_313_855 180
730 3300044673 Ga0453683_0318980 Ga0453683_0318980_87_629 180
731 3300046501 Ga0495607_0014863 Ga0495607_0014863_3189_3731 180
732 3300046507 Ga0495606_0208853 Ga0495606_0208853_260_802 180
733 3300046507 Ga0495606_0265398 Ga0495606_0265398_19_561 180
734 3300046515 Ga0495620_0309598 Ga0495620_0309598_48_590 180
735 3300046525 Ga0495663_0016116 Ga0495663_0016116_844_1386 180
736 3300046528 Ga0495642_0069999 Ga0495642_0069999_507_1049 180
737 3300046530 Ga0495654_0031697 Ga0495654_0031697_987_1529 180
738 3300046539 Ga0495621_0013304 Ga0495621_0013304_842_1384 180
739 3300046558 Ga0495633_0236041 Ga0495633_0236041_130_672 180
740 3300046615 Ga0495656_0516114 Ga0495656_0516114_17_559 180
741 3300046660 Ga0495625_0089987 Ga0495625_0089987_586_1128 180
742 3300047447 Ga0495685_117616 Ga0495685_117616_319_861 180
743 3300048090 Ga0495615_0037513 Ga0495615_0037513_131_673 180
744 3300048903 Ga0496100_0049531 Ga0496100_0049531_2145_2687 180
745 3300048904 Ga0496101_0108575 Ga0496101_0108575_861_1403 180
746 3300048905 Ga0496102_1047154 Ga0496102_1047154_86_628 180
747 3300048907 Ga0496104_0204889 Ga0496104_0204889_887_1429 180
748 3300048908 Ga0496105_0140004 Ga0496105_0140004_1387_1929 180
749 3300048911 Ga0496108_0098307 Ga0496108_0098307_1444_1986 180
750 3300048912 Ga0496109_0230464 Ga0496109_0230464_317_859 180
751 3300048915 Ga0496112_0560136 Ga0496112_0560136_39_581 180
752 3300048916 Ga0496113_0078240 Ga0496113_0078240_1638_2180 180
753 3300048919 Ga0496116_0000024 Ga0496116_0000024_99224_99766 180
754 3300048924 Ga0496121_0062508 Ga0496121_0062508_1741_2283 180
755 3300048927 Ga0496124_0035036 Ga0496124_0035036_1770_2312 180
756 3300048928 Ga0496125_0000018 Ga0496125_0000018_380428_380970 180
757 3300049130 Ga0501310_000149 Ga0501310_000149_66_608 180
758 3300049131 Ga0501341_00421 Ga0501341_00421_1213_1755 180
759 3300049530 Ga0501314_000001 Ga0501314_000001_6882_7424 180
760 3300049536 Ga0501320_002561 Ga0501320_002561_863_1405 180
761 3300049536 Ga0501320_002568 Ga0501320_002568_862_1404 180
762 3300049537 Ga0501321_036530 Ga0501321_036530_40_582 180
763 3300049539 Ga0501323_000002 Ga0501323_000002_6791_7333 180
764 3300049539 Ga0501323_001249 Ga0501323_001249_1205_1747 180
765 3300049540 Ga0501324_000002 Ga0501324_000002_7023_7565 180
766 3300049542 Ga0501326_00020 Ga0501326_00020_4800_5342 180
767 3300049551 Ga0501335_006458 Ga0501335_006458_171_713 180
768 3300049572 Ga0501036_0044298 Ga0501036_0044298_56_598 180
769 3300049671 Ga0501238_000015 Ga0501238_000015_4702_5244 180
770 3300049679 Ga0501249_062867 Ga0501249_062867_192_734 180
771 3300049758 Ga0501241_002523 Ga0501241_002523_2772_3314 180
772 3300049760 Ga0501263_036753 Ga0501263_036753_70_612 180
773 3300049763 Ga0501266_000002 Ga0501266_000002_342264_342806 180
774 3300049776 Ga0501280_000239 Ga0501280_000239_6223_6765 180
775 3300053088 Ga0500644_0299116 Ga0500644_0299116_61_603 180
776 3300053090 Ga0500646_0021012 Ga0500646_0021012_275_817 180
777 3300053093 Ga0500651_0309979 Ga0500651_0309979_283_825 180
778 3300053096 Ga0500641_0000168 Ga0500641_0000168_2174_2716 180
779 3300053096 Ga0500641_0006404 Ga0500641_0006404_2714_3256 180
780 3300053118 Ga0500594_0010092 Ga0500594_0010092_227_769 180
781 3300053134 Ga0500658_0000002 Ga0500658_0000002_197888_198430 180
782 3300053136 Ga0500559_0017721 Ga0500559_0017721_475_1017 180
783 iso_pu_bacteria 2585427687 2586210032 180
784 iso_pu_bacteria 2738541278 2738726214 180
785 iso_pu_bacteria 2738541283 2738755674 180
786 iso_pu_bacteria 2739367651 2739587956 180
787 iso_pu_bacteria 2739367656 2739614393 180
788 iso_pu_bacteria 2739367663 2739646675 180
789 iso_pu_bacteria 2818991442 2819573345 180
790 iso_pu_bacteria 2818991460 2819681057 180
791 iso_pu_bacteria 2839989709 2839990112 180
792 iso_pu_bacteria 2842722452 2842724275 180
793 iso_pu_bacteria 2842909656 2842913591 180
794 iso_pu_bacteria 2883068021 2883072454 180
795 iso_pu_bacteria 2884791551 2884795832 180
796 iso_pu_bacteria 2896109856 2896112690 180
797 iso_pu_bacteria 2914759650 2914763476 180
798 iso_pu_bacteria 2929154850 2929155023 180
799 iso_pu_bacteria 2929177148 2929178603 180
800 iso_pu_bacteria 2929239360 2929240980 180
801 iso_pu_bacteria 2929921140 2929923004 180
802 iso_pu_bacteria 2945977869 2945981011 180
803 iso_pu_bacteria 2945997725 2945998902 180
804 iso_pu_bacteria 2946013367 2946019586 180
805 iso_pu_bacteria 2954016120 2954021345 180
806 iso_pu_bacteria 8003151029 8003152338 180
807 3300027526 Ga0209968_1012248 Ga0209968_10122482 182
808 3300027876 Ga0209974_10206493 Ga0209974_102064931 182
809 3300031548 Ga0307408_100060065 Ga0307408_1000600656 182
810 3300041443 Ga0451789_0687116 Ga0451789_0687116_206_754 182
811 3300041444 Ga0451790_22988 Ga0451790_22988_254_802 182
812 3300044672 Ga0466982_0127768 Ga0466982_0127768_657_1208 182
813 3300049129 Ga0501309_000005 Ga0501309_000005_3547_4098 182
814 3300049161 Ga0501305_001515 Ga0501305_001515_207_758 182
815 3300049161 Ga0501305_037209 Ga0501305_037209_86_640 182
816 3300049528 Ga0501312_000702 Ga0501312_000702_2080_2631 182
817 3300049528 Ga0501312_017506 Ga0501312_017506_461_1012 182
818 3300049531 Ga0501315_005172 Ga0501315_005172_430_981 182
819 3300049532 Ga0501316_000418 Ga0501316_000418_206_757 182
820 3300049539 Ga0501323_001617 Ga0501323_001617_994_1545 182
821 3300049670 Ga0501236_002270 Ga0501236_002270_1046_1597 182
822 3300049686 Ga0501257_005052 Ga0501257_005052_487_1038 182
823 3300049761 Ga0501264_000971 Ga0501264_000971_1835_2386 182
824 3300053158 Ga0500627_0075223 Ga0500627_0075223_290_841 182
825 3300031727 Ga0316576_10598958 Ga0316576_105989581 183
826 3300032168 Ga0316593_10001741 Ga0316593_100017416 183
827 3300033524 Ga0316592_1000022 Ga0316592_10000225 183
828 3300033524 Ga0316592_1000131 Ga0316592_10001312 183
829 3300033527 Ga0316586_1001816 Ga0316586_10018164 183
830 3300033528 Ga0316588_1002172 Ga0316588_10021723 183
831 3300033541 Ga0316596_1005444 Ga0316596_10054446 183
832 3300033541 Ga0316596_1036039 Ga0316596_10360393 183
833 3300041441 Ga0451787_419093 Ga0451787_419093_909_1478 183
834 3300041456 Ga0451795_0165098 Ga0451795_0165098_40_594 183
835 3300041456 Ga0451795_0802875 Ga0451795_0802875_206_775 183
836 3300041456 Ga0451795_1231582 Ga0451795_1231582_18_572 183
837 3300041456 Ga0451795_1330461 Ga0451795_1330461_168_737 183
838 3300041494 Ga0451837_0716352 Ga0451837_0716352_919_1488 183
839 3300041508 Ga0451852_13332 Ga0451852_13332_7200_7754 183
840 3300045051 Ga0451576_0559542 Ga0451576_0559542_199_753 183
841 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00008490 184
842 3300001979 JGI24740J21852_10000106 JGI24740J21852_1000010623 184
843 3300001989 JGI24739J22299_10002345 JGI24739J22299_100023456 184
844 3300001989 JGI24739J22299_10036599 JGI24739J22299_100365993 184
845 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001294 184
846 3300002741 JGI25157J39369_1005374 JGI25157J39369_10053744 184
847 3300002773 JGI25152J39213_1000006 JGI25152J39213_100000630 184
848 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005203 184
849 3300002987 JGI25159J45721_1008657 JGI25159J45721_10086573 184
850 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004371 184
851 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004371 184
852 3300003215 JGI25153J46596_10002304 JGI25153J46596_100023047 184
853 3300003215 JGI25153J46596_10009633 JGI25153J46596_100096332 184
854 3300003215 JGI25153J46596_10081054 JGI25153J46596_100810542 184
855 3300003320 rootH2_10052858 rootH2_100528582 184
856 3300003320 rootH2_10069215 rootH2_100692159 184
857 3300003320 rootH2_10116651 rootH2_101166514 184
858 3300003322 rootL2_10084253 rootL2_100842531 184
859 3300003323 rootH1_10008389 rootH1_1000838918 184
860 3300003323 rootH1_10024399 rootH1_1002439913 184
861 3300003323 rootH1_10137015 rootH1_101370152 184
862 3300003354 JGI25160J50197_1002424 JGI25160J50197_100242410 184
863 3300003354 JGI25160J50197_1004776 JGI25160J50197_10047769 184
864 3300003354 JGI25160J50197_1032347 JGI25160J50197_10323472 184
865 3300003354 JGI25160J50197_1051232 JGI25160J50197_10512322 184
866 3300003761 Ga0055535_1006118 Ga0055535_10061184 184
867 3300003762 Ga0055542_1017834 Ga0055542_10178341 184
868 3300003771 Ga0055526_1004445 Ga0055526_10044452 184
869 3300003790 Ga0055528_1000330 Ga0055528_100033023 184
870 3300003791 Ga0055530_10000331 Ga0055530_1000033121 184
871 3300003794 Ga0055531_10000133 Ga0055531_1000013324 184
872 3300003794 Ga0055531_10000166 Ga0055531_1000016617 184
873 3300003794 Ga0055531_10008711 Ga0055531_100087116 184
874 3300005262 Ga0065165_1000105 Ga0065165_100010577 184
875 3300005262 Ga0065165_1007036 Ga0065165_10070366 184
876 3300005288 Ga0065714_10023783 Ga0065714_100237831 184
877 3300005288 Ga0065714_10156834 Ga0065714_101568341 184
878 3300005290 Ga0065712_10008525 Ga0065712_100085252 184
879 3300005295 Ga0065707_10097311 Ga0065707_100973116 184
880 3300005327 Ga0070658_10009019 Ga0070658_1000901910 184
881 3300005327 Ga0070658_10306771 Ga0070658_103067713 184
882 3300005327 Ga0070658_10343531 Ga0070658_103435312 184
883 3300005327 Ga0070658_10530426 Ga0070658_105304261 184
884 3300005327 Ga0070658_10562857 Ga0070658_105628572 184
885 3300005328 Ga0070676_10004653 Ga0070676_1000465313 184
886 3300005328 Ga0070676_10024284 Ga0070676_100242842 184
887 3300005328 Ga0070676_10313604 Ga0070676_103136042 184
888 3300005330 Ga0070690_100233403 Ga0070690_1002334032 184
889 3300005331 Ga0070670_100060731 Ga0070670_1000607315 184
890 3300005333 Ga0070677_10001593 Ga0070677_100015937 184
891 3300005333 Ga0070677_10046785 Ga0070677_100467852 184
892 3300005333 Ga0070677_10252608 Ga0070677_102526081 184
893 3300005334 Ga0068869_100051776 Ga0068869_1000517764 184
894 3300005334 Ga0068869_100442893 Ga0068869_1004428931 184
895 3300005335 Ga0070666_10000191 Ga0070666_1000019144 184
896 3300005335 Ga0070666_10217369 Ga0070666_102173692 184
897 3300005336 Ga0070680_100088507 Ga0070680_1000885074 184
898 3300005337 Ga0070682_100373008 Ga0070682_1003730082 184
899 3300005338 Ga0068868_100004630 Ga0068868_10000463010 184
900 3300005338 Ga0068868_100013181 Ga0068868_1000131816 184
901 3300005339 Ga0070660_100401734 Ga0070660_1004017341 184
902 3300005339 Ga0070660_100926298 Ga0070660_1009262981 184
903 3300005340 Ga0070689_101177376 Ga0070689_1011773761 184
904 3300005341 Ga0070691_10005091 Ga0070691_100050912 184
905 3300005341 Ga0070691_10077262 Ga0070691_100772623 184
906 3300005343 Ga0070687_100019156 Ga0070687_1000191562 184
907 3300005344 Ga0070661_100020833 Ga0070661_1000208337 184
908 3300005347 Ga0070668_100004151 Ga0070668_1000041519 184
909 3300005347 Ga0070668_100038069 Ga0070668_1000380695 184
910 3300005353 Ga0070669_100008677 Ga0070669_10000867710 184
911 3300005353 Ga0070669_100546586 Ga0070669_1005465862 184
912 3300005354 Ga0070675_100022693 Ga0070675_1000226935 184
913 3300005354 Ga0070675_100149729 Ga0070675_1001497292 184
914 3300005354 Ga0070675_100254829 Ga0070675_1002548292 184
915 3300005354 Ga0070675_100266704 Ga0070675_1002667041 184
916 3300005355 Ga0070671_100036529 Ga0070671_1000365299 184
917 3300005356 Ga0070674_100002220 Ga0070674_10000222011 184
918 3300005356 Ga0070674_100087796 Ga0070674_1000877962 184
919 3300005364 Ga0070673_100006656 Ga0070673_1000066568 184
920 3300005364 Ga0070673_100011200 Ga0070673_1000112006 184
921 3300005364 Ga0070673_100055828 Ga0070673_1000558284 184
922 3300005364 Ga0070673_100679499 Ga0070673_1006794992 184
923 3300005365 Ga0070688_100037058 Ga0070688_1000370581 184
924 3300005365 Ga0070688_100416885 Ga0070688_1004168851 184
925 3300005366 Ga0070659_100426578 Ga0070659_1004265782 184
926 3300005367 Ga0070667_100000248 Ga0070667_1000002489 184
927 3300005367 Ga0070667_100074036 Ga0070667_1000740361 184
928 3300005367 Ga0070667_100230033 Ga0070667_1002300334 184
929 3300005438 Ga0070701_10022246 Ga0070701_100222462 184
930 3300005455 Ga0070663_100521323 Ga0070663_1005213231 184
931 3300005456 Ga0070678_100003711 Ga0070678_1000037117 184
932 3300005456 Ga0070678_100064863 Ga0070678_1000648633 184
933 3300005456 Ga0070678_100277908 Ga0070678_1002779082 184
934 3300005457 Ga0070662_100007728 Ga0070662_1000077288 184
935 3300005457 Ga0070662_100066199 Ga0070662_1000661995 184
936 3300005457 Ga0070662_100485217 Ga0070662_1004852172 184
937 3300005457 Ga0070662_100734367 Ga0070662_1007343671 184
938 3300005459 Ga0068867_100078755 Ga0068867_1000787551 184
939 3300005459 Ga0068867_100123545 Ga0068867_1001235453 184
940 3300005459 Ga0068867_100187653 Ga0068867_1001876532 184
941 3300005466 Ga0070685_10520902 Ga0070685_105209021 184
942 3300005471 Ga0070698_100002802 Ga0070698_10000280212 184
943 3300005518 Ga0070699_100230854 Ga0070699_1002308541 184
944 3300005530 Ga0070679_100002167 Ga0070679_10000216719 184
945 3300005530 Ga0070679_100122192 Ga0070679_1001221925 184
946 3300005535 Ga0070684_100021469 Ga0070684_1000214697 184
947 3300005539 Ga0068853_100000250 Ga0068853_10000025013 184
948 3300005539 Ga0068853_100006139 Ga0068853_1000061392 184
949 3300005539 Ga0068853_100143789 Ga0068853_1001437893 184
950 3300005539 Ga0068853_100642229 Ga0068853_1006422291 184
951 3300005543 Ga0070672_100001565 Ga0070672_10000156511 184
952 3300005543 Ga0070672_100038692 Ga0070672_1000386921 184
953 3300005543 Ga0070672_100045260 Ga0070672_1000452601 184
954 3300005544 Ga0070686_100042966 Ga0070686_1000429664 184
955 3300005548 Ga0070665_100000641 Ga0070665_10000064153 184
956 3300005548 Ga0070665_100018617 Ga0070665_1000186175 184
957 3300005548 Ga0070665_100027047 Ga0070665_10002704712 184
958 3300005563 Ga0068855_100000133 Ga0068855_10000013318 184
959 3300005563 Ga0068855_100003486 Ga0068855_1000034865 184
960 3300005563 Ga0068855_100060509 Ga0068855_1000605095 184
961 3300005563 Ga0068855_100205594 Ga0068855_1002055944 184
962 3300005563 Ga0068855_100235336 Ga0068855_1002353362 184
963 3300005563 Ga0068855_100578001 Ga0068855_1005780012 184
964 3300005564 Ga0070664_100009616 Ga0070664_10000961613 184
965 3300005564 Ga0070664_100020536 Ga0070664_10002053610 184
966 3300005564 Ga0070664_100387209 Ga0070664_1003872091 184
967 3300005564 Ga0070664_100436905 Ga0070664_1004369052 184
968 3300005577 Ga0068857_100024735 Ga0068857_1000247354 184
969 3300005577 Ga0068857_100085235 Ga0068857_1000852354 184
970 3300005577 Ga0068857_100100573 Ga0068857_1001005735 184
971 3300005577 Ga0068857_100268992 Ga0068857_1002689923 184
972 3300005577 Ga0068857_100315809 Ga0068857_1003158093 184
973 3300005577 Ga0068857_100343991 Ga0068857_1003439911 184
974 3300005577 Ga0068857_100596109 Ga0068857_1005961092 184
975 3300005578 Ga0068854_100021100 Ga0068854_1000211003 184
976 3300005578 Ga0068854_100590613 Ga0068854_1005906132 184
977 3300005578 Ga0068854_100749247 Ga0068854_1007492471 184
978 3300005614 Ga0068856_100102289 Ga0068856_1001022895 184
979 3300005614 Ga0068856_100154352 Ga0068856_1001543522 184
980 3300005615 Ga0070702_100058590 Ga0070702_1000585903 184
981 3300005616 Ga0068852_100081986 Ga0068852_1000819865 184
982 3300005616 Ga0068852_100569972 Ga0068852_1005699722 184
983 3300005617 Ga0068859_100173657 Ga0068859_1001736573 184
984 3300005617 Ga0068859_100191198 Ga0068859_1001911984 184
985 3300005618 Ga0068864_100015889 Ga0068864_1000158895 184
986 3300005618 Ga0068864_100034196 Ga0068864_1000341967 184
987 3300005618 Ga0068864_100112202 Ga0068864_1001122023 184
988 3300005618 Ga0068864_100176796 Ga0068864_1001767962 184
989 3300005618 Ga0068864_100358046 Ga0068864_1003580463 184
990 3300005618 Ga0068864_101385571 Ga0068864_1013855711 184
991 3300005718 Ga0068866_10215915 Ga0068866_102159152 184
992 3300005719 Ga0068861_100028330 Ga0068861_1000283306 184
993 3300005834 Ga0068851_10001337 Ga0068851_100013377 184
994 3300005840 Ga0068870_10321014 Ga0068870_103210142 184
995 3300005841 Ga0068863_100001373 Ga0068863_1000013739 184
996 3300005841 Ga0068863_100412768 Ga0068863_1004127683 184
997 3300005841 Ga0068863_100545888 Ga0068863_1005458882 184
998 3300005842 Ga0068858_100009451 Ga0068858_10000945113 184
999 3300005843 Ga0068860_100004260 Ga0068860_10000426015 184
1000 3300005843 Ga0068860_100007830 Ga0068860_10000783014 184
1001 3300005843 Ga0068860_100022955 Ga0068860_1000229554 184
1002 3300005844 Ga0068862_100468583 Ga0068862_1004685832 184
1003 3300005844 Ga0068862_101143425 Ga0068862_1011434251 184
1004 3300005985 Ga0081539_10002233 Ga0081539_1000223328 184
1005 3300006195 Ga0075366_10005546 Ga0075366_100055467 184
1006 3300006195 Ga0075366_10005748 Ga0075366_100057488 184
1007 3300006195 Ga0075366_10052705 Ga0075366_100527055 184
1008 3300006195 Ga0075366_10055884 Ga0075366_100558842 184
1009 3300006195 Ga0075366_10063553 Ga0075366_100635533 184
1010 3300006195 Ga0075366_10190067 Ga0075366_101900672 184
1011 3300006195 Ga0075366_10303361 Ga0075366_103033612 184
1012 3300006195 Ga0075366_10391996 Ga0075366_103919962 184
1013 3300006237 Ga0097621_100015711 Ga0097621_1000157114 184
1014 3300006237 Ga0097621_100702806 Ga0097621_1007028061 184
1015 3300006353 Ga0075370_10010465 Ga0075370_100104655 184
1016 3300006358 Ga0068871_100015089 Ga0068871_1000150897 184
1017 3300006358 Ga0068871_100337625 Ga0068871_1003376251 184
1018 3300006358 Ga0068871_100597142 Ga0068871_1005971421 184
1019 3300006358 Ga0068871_101323254 Ga0068871_1013232542 184
1020 3300006844 Ga0075428_100013576 Ga0075428_10001357616 184
1021 3300006844 Ga0075428_100041637 Ga0075428_1000416377 184
1022 3300006846 Ga0075430_100011474 Ga0075430_10001147411 184
1023 3300006847 Ga0075431_100022872 Ga0075431_1000228729 184
1024 3300006847 Ga0075431_100051260 Ga0075431_1000512606 184
1025 3300006847 Ga0075431_100276634 Ga0075431_1002766341 184
1026 3300006871 Ga0075434_100350726 Ga0075434_1003507263 184
1027 3300006880 Ga0075429_100048422 Ga0075429_1000484226 184
1028 3300006880 Ga0075429_100070557 Ga0075429_1000705572 184
1029 3300006881 Ga0068865_100003571 Ga0068865_1000035718 184
1030 3300006881 Ga0068865_100672503 Ga0068865_1006725031 184
1031 3300006931 Ga0097620_100173665 Ga0097620_1001736652 184
1032 3300006931 Ga0097620_100191198 Ga0097620_1001911981 184
1033 3300009093 Ga0105240_10000398 Ga0105240_1000039851 184
1034 3300009093 Ga0105240_10011307 Ga0105240_100113076 184
1035 3300009093 Ga0105240_10016926 Ga0105240_100169268 184
1036 3300009093 Ga0105240_10050473 Ga0105240_100504735 184
1037 3300009093 Ga0105240_10059925 Ga0105240_100599254 184
1038 3300009093 Ga0105240_10443235 Ga0105240_104432353 184
1039 3300009093 Ga0105240_10609984 Ga0105240_106099842 184
1040 3300009094 Ga0111539_10042072 Ga0111539_100420728 184
1041 3300009094 Ga0111539_10236719 Ga0111539_102367193 184
1042 3300009094 Ga0111539_11024621 Ga0111539_110246212 184
1043 3300009098 Ga0105245_10088801 Ga0105245_100888012 184
1044 3300009101 Ga0105247_10102224 Ga0105247_101022244 184
1045 3300009147 Ga0114129_10006463 Ga0114129_1000646317 184
1046 3300009147 Ga0114129_10350815 Ga0114129_103508152 184
1047 3300009174 Ga0105241_10000769 Ga0105241_100007694 184
1048 3300009174 Ga0105241_10027526 Ga0105241_100275265 184
1049 3300009174 Ga0105241_10078388 Ga0105241_100783885 184
1050 3300009174 Ga0105241_10145153 Ga0105241_101451534 184
1051 3300009174 Ga0105241_10247098 Ga0105241_102470983 184
1052 3300009176 Ga0105242_10013197 Ga0105242_100131977 184
1053 3300009545 Ga0105237_10002553 Ga0105237_1000255326 184
1054 3300009545 Ga0105237_10002614 Ga0105237_100026145 184
1055 3300009545 Ga0105237_10026344 Ga0105237_100263447 184
1056 3300009545 Ga0105237_10033162 Ga0105237_100331624 184
1057 3300009545 Ga0105237_10037227 Ga0105237_100372274 184
1058 3300009545 Ga0105237_10427042 Ga0105237_104270422 184
1059 3300009551 Ga0105238_10008067 Ga0105238_1000806710 184
1060 3300009553 Ga0105249_10182013 Ga0105249_101820133 184
1061 3300010375 Ga0105239_10000436 Ga0105239_1000043619 184
1062 3300010375 Ga0105239_10010718 Ga0105239_1001071811 184
1063 3300010375 Ga0105239_10086030 Ga0105239_100860302 184
1064 3300010375 Ga0105239_10253214 Ga0105239_102532141 184
1065 3300010375 Ga0105239_10959003 Ga0105239_109590031 184
1066 3300011119 Ga0105246_10010740 Ga0105246_100107403 184
1067 3300011119 Ga0105246_10298781 Ga0105246_102987812 184
1068 3300011119 Ga0105246_10395794 Ga0105246_103957941 184
1069 3300013100 Ga0157373_10123735 Ga0157373_101237352 184
1070 3300013102 Ga0157371_10019616 Ga0157371_100196165 184
1071 3300013102 Ga0157371_10087179 Ga0157371_100871794 184
1072 3300013102 Ga0157371_10308206 Ga0157371_103082061 184
1073 3300013102 Ga0157371_10334383 Ga0157371_103343831 184
1074 3300013104 Ga0157370_10072569 Ga0157370_100725697 184
1075 3300013104 Ga0157370_10075905 Ga0157370_100759055 184
1076 3300013104 Ga0157370_10086830 Ga0157370_100868306 184
1077 3300013104 Ga0157370_10127974 Ga0157370_101279745 184
1078 3300013104 Ga0157370_10290292 Ga0157370_102902922 184
1079 3300013104 Ga0157370_10413261 Ga0157370_104132612 184
1080 3300013104 Ga0157370_10890643 Ga0157370_108906432 184
1081 3300013105 Ga0157369_10000023 Ga0157369_100000232 184
1082 3300013105 Ga0157369_10032433 Ga0157369_100324335 184
1083 3300013105 Ga0157369_10135046 Ga0157369_101350463 184
1084 3300013105 Ga0157369_10346409 Ga0157369_103464092 184
1085 3300013105 Ga0157369_10541989 Ga0157369_105419893 184
1086 3300013105 Ga0157369_10781971 Ga0157369_107819712 184
1087 3300013296 Ga0157374_10007705 Ga0157374_100077059 184
1088 3300013296 Ga0157374_10172431 Ga0157374_101724314 184
1089 3300013296 Ga0157374_10180882 Ga0157374_101808824 184
1090 3300013296 Ga0157374_10320385 Ga0157374_103203851 184
1091 3300013297 Ga0157378_10005083 Ga0157378_100050833 184
1092 3300013297 Ga0157378_10008184 Ga0157378_100081842 184
1093 3300013297 Ga0157378_10019722 Ga0157378_1001972210 184
1094 3300013297 Ga0157378_10087620 Ga0157378_100876203 184
1095 3300013297 Ga0157378_10605303 Ga0157378_106053032 184
1096 3300013306 Ga0163162_10008143 Ga0163162_100081437 184
1097 3300013306 Ga0163162_10102052 Ga0163162_101020523 184
1098 3300013306 Ga0163162_10654724 Ga0163162_106547241 184
1099 3300013306 Ga0163162_11679631 Ga0163162_116796311 184
1100 3300013307 Ga0157372_10003109 Ga0157372_1000310919 184
1101 3300013307 Ga0157372_10048397 Ga0157372_100483978 184
1102 3300013307 Ga0157372_10053864 Ga0157372_100538646 184
1103 3300013307 Ga0157372_10093748 Ga0157372_100937485 184
1104 3300013307 Ga0157372_10120036 Ga0157372_101200362 184
1105 3300013307 Ga0157372_10160741 Ga0157372_101607415 184
1106 3300013307 Ga0157372_10163953 Ga0157372_101639531 184
1107 3300013307 Ga0157372_10468633 Ga0157372_104686332 184
1108 3300013307 Ga0157372_11026389 Ga0157372_110263892 184
1109 3300013307 Ga0157372_11520980 Ga0157372_115209801 184
1110 3300013308 Ga0157375_10010453 Ga0157375_1001045315 184
1111 3300013308 Ga0157375_10035811 Ga0157375_100358112 184
1112 3300013308 Ga0157375_10099282 Ga0157375_100992825 184
1113 3300013308 Ga0157375_10581980 Ga0157375_105819803 184
1114 3300014325 Ga0163163_10023493 Ga0163163_100234935 184
1115 3300014325 Ga0163163_10069920 Ga0163163_100699206 184
1116 3300014325 Ga0163163_10105619 Ga0163163_101056194 184
1117 3300014325 Ga0163163_11379332 Ga0163163_113793321 184
1118 3300014326 Ga0157380_10018384 Ga0157380_100183842 184
1119 3300014326 Ga0157380_10109862 Ga0157380_101098622 184
1120 3300014326 Ga0157380_10382952 Ga0157380_103829522 184
1121 3300014326 Ga0157380_10453539 Ga0157380_104535392 184
1122 3300014497 Ga0182008_10003643 Ga0182008_100036436 184
1123 3300014968 Ga0157379_10000845 Ga0157379_1000084529 184
1124 3300014968 Ga0157379_10258780 Ga0157379_102587803 184
1125 3300014968 Ga0157379_10675067 Ga0157379_106750671 184
1126 3300014969 Ga0157376_10011738 Ga0157376_100117387 184
1127 3300014969 Ga0157376_10050917 Ga0157376_100509176 184
1128 3300014969 Ga0157376_10215918 Ga0157376_102159183 184
1129 3300015261 Ga0182006_1000103 Ga0182006_100010382 184
1130 3300015261 Ga0182006_1166423 Ga0182006_11664232 184
1131 3300015262 Ga0182007_10000002 Ga0182007_10000002430 184
1132 3300015265 Ga0182005_1000147 Ga0182005_100014722 184
1133 3300017792 Ga0163161_10011145 Ga0163161_100111456 184
1134 3300017792 Ga0163161_10079062 Ga0163161_100790624 184
1135 3300017792 Ga0163161_10139438 Ga0163161_101394383 184
1136 3300017792 Ga0163161_10460238 Ga0163161_104602382 184
1137 3300021384 Ga0213876_10015549 Ga0213876_100155496 184
1138 3300021384 Ga0213876_10038947 Ga0213876_100389475 184
1139 3300021384 Ga0213876_10059966 Ga0213876_100599664 184
1140 3300021384 Ga0213876_10153069 Ga0213876_101530692 184
1141 3300025208 Ga0209436_100232 Ga0209436_10023220 184
1142 3300025208 Ga0209436_103246 Ga0209436_1032466 184
1143 3300025242 Ga0209258_100041 Ga0209258_100041183 184
1144 3300025245 Ga0207425_1000008 Ga0207425_100000867 184
1145 3300025246 Ga0209646_1000002 Ga0209646_1000002293 184
1146 3300025250 Ga0209026_1000299 Ga0209026_100029941 184
1147 3300025254 Ga0209148_1000090 Ga0209148_100009052 184
1148 3300025258 Ga0209129_1000040 Ga0209129_1000040198 184
1149 3300025273 Ga0209673_1000034 Ga0209673_1000034277 184
1150 3300025284 Ga0209130_1001055 Ga0209130_100105529 184
1151 3300025294 Ga0209025_1000020 Ga0209025_100002067 184
1152 3300025295 Ga0209564_1011927 Ga0209564_10119275 184
1153 3300025295 Ga0209564_1031946 Ga0209564_10319461 184
1154 3300025297 Ga0209758_1000022 Ga0209758_100002267 184
1155 3300025297 Ga0209758_1001438 Ga0209758_10014383 184
1156 3300025297 Ga0209758_1022949 Ga0209758_10229492 184
1157 3300025297 Ga0209758_1030098 Ga0209758_10300982 184
1158 3300025298 Ga0209050_1000207 Ga0209050_100020722 184
1159 3300025298 Ga0209050_1002964 Ga0209050_100296410 184
1160 3300025302 Ga0207426_1000105 Ga0207426_100010551 184
1161 3300025302 Ga0207426_1000603 Ga0207426_100060338 184
1162 3300025302 Ga0207426_1000813 Ga0207426_100081319 184
1163 3300025302 Ga0207426_1001314 Ga0207426_100131426 184
1164 3300025302 Ga0207426_1012108 Ga0207426_10121083 184
1165 3300025302 Ga0207426_1045428 Ga0207426_10454282 184
1166 3300025304 Ga0209257_1000001 Ga0209257_10000011657 184
1167 3300025304 Ga0209257_1000007 Ga0209257_1000007326 184
1168 3300025304 Ga0209257_1001824 Ga0209257_100182416 184
1169 3300025315 Ga0207697_10008991 Ga0207697_100089912 184
1170 3300025315 Ga0207697_10168485 Ga0207697_101684851 184
1171 3300025321 Ga0207656_10002290 Ga0207656_100022906 184
1172 3300025893 Ga0207682_10005663 Ga0207682_100056637 184
1173 3300025893 Ga0207682_10021729 Ga0207682_100217294 184
1174 3300025893 Ga0207682_10049495 Ga0207682_100494952 184
1175 3300025893 Ga0207682_10383149 Ga0207682_103831491 184
1176 3300025899 Ga0207642_10389518 Ga0207642_103895181 184
1177 3300025900 Ga0207710_10049842 Ga0207710_100498421 184
1178 3300025901 Ga0207688_10118589 Ga0207688_101185891 184
1179 3300025903 Ga0207680_10000957 Ga0207680_1000095711 184
1180 3300025903 Ga0207680_10108367 Ga0207680_101083671 184
1181 3300025903 Ga0207680_10161717 Ga0207680_101617173 184
1182 3300025904 Ga0207647_10050985 Ga0207647_100509854 184
1183 3300025904 Ga0207647_10333726 Ga0207647_103337261 184
1184 3300025907 Ga0207645_10003925 Ga0207645_1000392511 184
1185 3300025907 Ga0207645_10047294 Ga0207645_100472944 184
1186 3300025908 Ga0207643_10105259 Ga0207643_101052591 184
1187 3300025909 Ga0207705_10006233 Ga0207705_1000623311 184
1188 3300025909 Ga0207705_10450797 Ga0207705_104507972 184
1189 3300025909 Ga0207705_10610307 Ga0207705_106103071 184
1190 3300025911 Ga0207654_10180937 Ga0207654_101809372 184
1191 3300025911 Ga0207654_10310569 Ga0207654_103105692 184
1192 3300025911 Ga0207654_10418340 Ga0207654_104183402 184
1193 3300025912 Ga0207707_10000051 Ga0207707_1000005191 184
1194 3300025913 Ga0207695_10000076 Ga0207695_1000007655 184
1195 3300025913 Ga0207695_10000090 Ga0207695_1000009055 184
1196 3300025913 Ga0207695_10009751 Ga0207695_1000975111 184
1197 3300025913 Ga0207695_10042816 Ga0207695_100428164 184
1198 3300025913 Ga0207695_10060304 Ga0207695_100603042 184
1199 3300025913 Ga0207695_10072097 Ga0207695_100720974 184
1200 3300025913 Ga0207695_10326487 Ga0207695_103264871 184
1201 3300025913 Ga0207695_10824849 Ga0207695_108248491 184
1202 3300025914 Ga0207671_10000762 Ga0207671_1000076252 184
1203 3300025914 Ga0207671_10003750 Ga0207671_1000375019 184
1204 3300025914 Ga0207671_10005849 Ga0207671_1000584910 184
1205 3300025914 Ga0207671_10022562 Ga0207671_100225623 184
1206 3300025914 Ga0207671_10029007 Ga0207671_100290076 184
1207 3300025914 Ga0207671_10197519 Ga0207671_101975191 184
1208 3300025917 Ga0207660_10318693 Ga0207660_103186931 184
1209 3300025918 Ga0207662_10007273 Ga0207662_1000727310 184
1210 3300025919 Ga0207657_10122866 Ga0207657_101228663 184
1211 3300025919 Ga0207657_10729739 Ga0207657_107297391 184
1212 3300025923 Ga0207681_10532272 Ga0207681_105322721 184
1213 3300025923 Ga0207681_10696836 Ga0207681_106968362 184
1214 3300025925 Ga0207650_10030217 Ga0207650_100302175 184
1215 3300025925 Ga0207650_10030666 Ga0207650_100306664 184
1216 3300025925 Ga0207650_10258272 Ga0207650_102582722 184
1217 3300025926 Ga0207659_10023967 Ga0207659_100239672 184
1218 3300025926 Ga0207659_10027831 Ga0207659_100278314 184
1219 3300025926 Ga0207659_10059948 Ga0207659_100599485 184
1220 3300025926 Ga0207659_10455869 Ga0207659_104558692 184
1221 3300025926 Ga0207659_10595457 Ga0207659_105954572 184
1222 3300025931 Ga0207644_10019521 Ga0207644_100195211 184
1223 3300025931 Ga0207644_10562384 Ga0207644_105623841 184
1224 3300025933 Ga0207706_10023803 Ga0207706_100238038 184
1225 3300025933 Ga0207706_10275820 Ga0207706_102758201 184
1226 3300025934 Ga0207686_10278695 Ga0207686_102786951 184
1227 3300025937 Ga0207669_10015591 Ga0207669_100155914 184
1228 3300025937 Ga0207669_10028016 Ga0207669_100280166 184
1229 3300025938 Ga0207704_10018685 Ga0207704_100186854 184
1230 3300025938 Ga0207704_10800941 Ga0207704_108009411 184
1231 3300025940 Ga0207691_10000001 Ga0207691_1000000123 184
1232 3300025940 Ga0207691_10002741 Ga0207691_1000274111 184
1233 3300025940 Ga0207691_10016872 Ga0207691_100168724 184
1234 3300025940 Ga0207691_10021049 Ga0207691_100210494 184
1235 3300025940 Ga0207691_10084460 Ga0207691_100844606 184
1236 3300025942 Ga0207689_10007410 Ga0207689_100074109 184
1237 3300025942 Ga0207689_10108306 Ga0207689_101083062 184
1238 3300025944 Ga0207661_10018456 Ga0207661_100184567 184
1239 3300025944 Ga0207661_10600791 Ga0207661_106007912 184
1240 3300025945 Ga0207679_10053946 Ga0207679_100539461 184
1241 3300025945 Ga0207679_10082806 Ga0207679_100828064 184
1242 3300025945 Ga0207679_10103150 Ga0207679_101031503 184
1243 3300025945 Ga0207679_10407126 Ga0207679_104071262 184
1244 3300025945 Ga0207679_10494135 Ga0207679_104941352 184
1245 3300025949 Ga0207667_10000453 Ga0207667_1000045338 184
1246 3300025949 Ga0207667_10009521 Ga0207667_100095212 184
1247 3300025949 Ga0207667_10106276 Ga0207667_101062765 184
1248 3300025949 Ga0207667_10401927 Ga0207667_104019272 184
1249 3300025949 Ga0207667_10407436 Ga0207667_104074362 184
1250 3300025960 Ga0207651_10002109 Ga0207651_100021097 184
1251 3300025960 Ga0207651_10110064 Ga0207651_101100643 184
1252 3300025960 Ga0207651_10232903 Ga0207651_102329031 184
1253 3300025960 Ga0207651_11398247 Ga0207651_113982471 184
1254 3300025961 Ga0207712_10017014 Ga0207712_100170143 184
1255 3300025961 Ga0207712_10268576 Ga0207712_102685762 184
1256 3300025961 Ga0207712_10273512 Ga0207712_102735123 184
1257 3300025961 Ga0207712_10983646 Ga0207712_109836461 184
1258 3300025972 Ga0207668_10000869 Ga0207668_1000086921 184
1259 3300025981 Ga0207640_10419521 Ga0207640_104195212 184
1260 3300025981 Ga0207640_10433596 Ga0207640_104335961 184
1261 3300025986 Ga0207658_10002877 Ga0207658_1000287715 184
1262 3300025986 Ga0207658_10206299 Ga0207658_102062993 184
1263 3300025986 Ga0207658_10338678 Ga0207658_103386783 184
1264 3300025986 Ga0207658_10368749 Ga0207658_103687492 184
1265 3300025986 Ga0207658_11469930 Ga0207658_114699301 184
1266 3300026023 Ga0207677_10007143 Ga0207677_1000714310 184
1267 3300026023 Ga0207677_10331030 Ga0207677_103310301 184
1268 3300026035 Ga0207703_10004088 Ga0207703_1000408815 184
1269 3300026035 Ga0207703_10086913 Ga0207703_100869133 184
1270 3300026035 Ga0207703_11059340 Ga0207703_110593401 184
1271 3300026041 Ga0207639_10002238 Ga0207639_1000223810 184
1272 3300026041 Ga0207639_10144907 Ga0207639_101449073 184
1273 3300026041 Ga0207639_10206104 Ga0207639_102061042 184
1274 3300026041 Ga0207639_10553949 Ga0207639_105539492 184
1275 3300026067 Ga0207678_10125918 Ga0207678_101259182 184
1276 3300026088 Ga0207641_10005564 Ga0207641_100055647 184
1277 3300026089 Ga0207648_10002625 Ga0207648_1000262517 184
1278 3300026089 Ga0207648_10013430 Ga0207648_100134303 184
1279 3300026089 Ga0207648_10606113 Ga0207648_106061132 184
1280 3300026095 Ga0207676_10009796 Ga0207676_100097967 184
1281 3300026095 Ga0207676_10063612 Ga0207676_100636122 184
1282 3300026095 Ga0207676_10257111 Ga0207676_102571112 184
1283 3300026095 Ga0207676_10299754 Ga0207676_102997542 184
1284 3300026095 Ga0207676_10757273 Ga0207676_107572732 184
1285 3300026116 Ga0207674_10007100 Ga0207674_1000710012 184
1286 3300026116 Ga0207674_10051368 Ga0207674_100513686 184
1287 3300026116 Ga0207674_10160215 Ga0207674_101602152 184
1288 3300026116 Ga0207674_10298511 Ga0207674_102985113 184
1289 3300026118 Ga0207675_100011158 Ga0207675_1000111585 184
1290 3300026118 Ga0207675_100023752 Ga0207675_10002375212 184
1291 3300026118 Ga0207675_100029391 Ga0207675_1000293917 184
1292 3300026118 Ga0207675_100746893 Ga0207675_1007468931 184
1293 3300026121 Ga0207683_10006890 Ga0207683_1000689018 184
1294 3300026121 Ga0207683_10017329 Ga0207683_100173298 184
1295 3300026121 Ga0207683_10086341 Ga0207683_100863411 184
1296 3300026121 Ga0207683_10135228 Ga0207683_101352283 184
1297 3300026121 Ga0207683_10243080 Ga0207683_102430803 184
1298 3300026142 Ga0207698_10089720 Ga0207698_100897204 184
1299 3300026142 Ga0207698_10605257 Ga0207698_106052571 184
1300 3300028379 Ga0268266_10006831 Ga0268266_100068319 184
1301 3300028379 Ga0268266_10010826 Ga0268266_100108266 184
1302 3300028379 Ga0268266_10019858 Ga0268266_100198586 184
1303 3300028380 Ga0268265_10312908 Ga0268265_103129082 184
1304 3300028381 Ga0268264_10027923 Ga0268264_100279236 184
1305 3300028381 Ga0268264_10085138 Ga0268264_100851385 184
1306 3300028794 Ga0307515_10000009 Ga0307515_10000009372 184
1307 3300028794 Ga0307515_10000469 Ga0307515_1000046973 184
1308 3300028794 Ga0307515_10411520 Ga0307515_104115201 184
1309 3300028800 Ga0265338_10104635 Ga0265338_101046352 184
1310 3300029957 Ga0265324_10009470 Ga0265324_100094702 184
1311 3300030731 Ga0316177_1063448 Ga0316177_10634482 184
1312 3300031251 Ga0265327_10000244 Ga0265327_10000244117 184
1313 3300031251 Ga0265327_10000298 Ga0265327_1000029820 184
1314 3300031251 Ga0265327_10034879 Ga0265327_100348794 184
1315 3300031251 Ga0265327_10124294 Ga0265327_101242942 184
1316 3300031456 Ga0307513_10100314 Ga0307513_101003143 184
1317 3300031456 Ga0307513_10196164 Ga0307513_101961641 184
1318 3300031456 Ga0307513_10205509 Ga0307513_102055093 184
1319 3300031507 Ga0307509_10122814 Ga0307509_101228145 184
1320 3300031507 Ga0307509_10132538 Ga0307509_101325385 184
1321 3300031616 Ga0307508_10001613 Ga0307508_100016135 184
1322 3300031711 Ga0265314_10003664 Ga0265314_1000366411 184
1323 3300031727 Ga0316576_10001081 Ga0316576_1000108118 184
1324 3300031728 Ga0316578_10044909 Ga0316578_100449094 184
1325 3300031730 Ga0307516_10004268 Ga0307516_100042688 184
1326 3300031730 Ga0307516_10182934 Ga0307516_101829343 184
1327 3300031731 Ga0307405_10000006 Ga0307405_1000000663 184
1328 3300031903 Ga0307407_10000003 Ga0307407_10000003185 184
1329 3300031911 Ga0307412_10053164 Ga0307412_100531644 184
1330 3300031911 Ga0307412_10257328 Ga0307412_102573282 184
1331 3300031995 Ga0307409_100028055 Ga0307409_10002805510 184
1332 3300032002 Ga0307416_100000002 Ga0307416_100000002429 184
1333 3300032004 Ga0307414_10009965 Ga0307414_100099655 184
1334 3300032004 Ga0307414_10098384 Ga0307414_100983844 184
1335 3300032004 Ga0307414_10663521 Ga0307414_106635211 184
1336 3300032005 Ga0307411_10153223 Ga0307411_101532234 184
1337 3300033180 Ga0307510_10000380 Ga0307510_1000038016 184
1338 3300033524 Ga0316592_1013307 Ga0316592_10133073 184
1339 3300033541 Ga0316596_1002626 Ga0316596_10026264 184
1340 3300033541 Ga0316596_1003825 Ga0316596_10038256 184
1341 3300033541 Ga0316596_1016458 Ga0316596_10164584 184
1342 3300035119 Ga0373956_0098722 Ga0373956_0098722_341_895 184
1343 3300035172 Ga0373955_0329565 Ga0373955_0329565_100_654 184
1344 3300035692 Ga0373935_0473866 Ga0373935_0473866_212_766 184
1345 3300036401 Ga0373937_0140348 Ga0373937_0140348_173_727 184
1346 3300036647 Ga0316582_0022702 Ga0316582_0022702_2119_2673 184
1347 3300036712 Ga0316584_0020181 Ga0316584_0020181_3401_3955 184
1348 3300037068 Ga0373925_0165850 Ga0373925_0165850_1102_1656 184
1349 3300037312 Ga0395899_0378083 Ga0395899_0378083_90_644 184
1350 3300037418 Ga0395900_0193418 Ga0395900_0193418_702_1256 184
1351 3300037471 Ga0395905_1167085 Ga0395905_1167085_12_566 184
1352 3300039437 Ga0436365_0781227 Ga0436365_0781227_537_1091 184
1353 3300039437 Ga0436365_1208365 Ga0436365_1208365_504_1058 184
1354 3300039437 Ga0436365_1690067 Ga0436365_1690067_6307_6861 184
1355 3300041404 Ga0439436_0010012 Ga0439436_0010012_2051_2605 184
1356 3300041404 Ga0439436_0054621 Ga0439436_0054621_334_888 184
1357 3300041406 Ga0439439_0015663 Ga0439439_0015663_231_785 184
1358 3300041406 Ga0439439_0099531 Ga0439439_0099531_97_651 184
1359 3300041413 Ga0439465_0006490 Ga0439465_0006490_332_886 184
1360 3300041446 Ga0451794_56897 Ga0451794_56897_21_578 184
1361 3300041453 Ga0451797_0519695 Ga0451797_0519695_172_726 184
1362 3300041498 Ga0451841_0610576 Ga0451841_0610576_22_576 184
1363 3300041511 Ga0451855_0576277 Ga0451855_0576277_11_580 184
1364 3300041512 Ga0451853_0701685 Ga0451853_0701685_1157_1711 184
1365 3300041997 Ga0439431_0006932 Ga0439431_0006932_1166_1720 184
1366 3300042007 Ga0439449_0003312 Ga0439449_0003312_3291_3845 184
1367 3300042007 Ga0439449_0159683 Ga0439449_0159683_254_808 184
1368 3300042010 Ga0439452_017641 Ga0439452_017641_518_1072 184
1369 3300042014 Ga0439457_001021 Ga0439457_001021_5381_5935 184
1370 3300042014 Ga0439457_012873 Ga0439457_012873_104_658 184
1371 3300042014 Ga0439457_018331 Ga0439457_018331_398_952 184
1372 3300042124 Ga0450922_004074 Ga0450922_004074_707_1261 184
1373 3300042134 Ga0450898_001130 Ga0450898_001130_194_748 184
1374 3300042156 Ga0439446_0066036 Ga0439446_0066036_107_661 184
1375 3300042156 Ga0439446_0207057 Ga0439446_0207057_12_566 184
1376 3300042435 Ga0439434_0005882 Ga0439434_0005882_1455_2009 184
1377 3300042439 Ga0439464_0140095 Ga0439464_0140095_121_678 184
1378 3300042876 Ga0451577_0004463 Ga0451577_0004463_10769_11326 184
1379 3300042876 Ga0451577_0054888 Ga0451577_0054888_249_803 184
1380 3300042876 Ga0451577_0242501 Ga0451577_0242501_878_1432 184
1381 3300042876 Ga0451577_0348490 Ga0451577_0348490_120_674 184
1382 3300044656 Ga0466969_0000246 Ga0466969_0000246_20532_21086 184
1383 3300044673 Ga0453683_0009005 Ga0453683_0009005_3990_4544 184
1384 3300044673 Ga0453683_0011208 Ga0453683_0011208_4459_5016 184
1385 3300044673 Ga0453683_0083828 Ga0453683_0083828_1279_1833 184
1386 3300044673 Ga0453683_0151769 Ga0453683_0151769_175_732 184
1387 3300044673 Ga0453683_0189848 Ga0453683_0189848_537_1094 184
1388 3300044673 Ga0453683_0430917 Ga0453683_0430917_233_787 184
1389 3300044683 Ga0466965_0041805 Ga0466965_0041805_1147_1701 184
1390 3300044683 Ga0466965_0358535 Ga0466965_0358535_25_579 184
1391 3300044684 Ga0466966_0018671 Ga0466966_0018671_1857_2411 184
1392 3300044693 Ga0466961_0125059 Ga0466961_0125059_365_919 184
1393 3300044712 Ga0453684_0000413 Ga0453684_0000413_78321_78878 184
1394 3300044712 Ga0453684_0012544 Ga0453684_0012544_2323_2880 184
1395 3300044712 Ga0453684_0031999 Ga0453684_0031999_1082_1636 184
1396 3300044712 Ga0453684_0038585 Ga0453684_0038585_1451_2005 184
1397 3300044712 Ga0453684_0068294 Ga0453684_0068294_1924_2478 184
1398 3300044712 Ga0453684_0081028 Ga0453684_0081028_1352_1906 184
1399 3300044712 Ga0453684_0109499 Ga0453684_0109499_2470_3024 184
1400 3300044712 Ga0453684_0446341 Ga0453684_0446341_221_775 184
1401 3300044712 Ga0453684_0453389 Ga0453684_0453389_556_1113 184
1402 3300044712 Ga0453684_0546517 Ga0453684_0546517_72_626 184
1403 3300044765 Ga0466970_0380832 Ga0466970_0380832_105_659 184
1404 3300044842 Ga0466957_0001187 Ga0466957_0001187_3216_3770 184
1405 3300045049 Ga0466959_0000017 Ga0466959_0000017_73483_74037 184
1406 3300045049 Ga0466959_0027432 Ga0466959_0027432_3038_3592 184
1407 3300045051 Ga0451576_0012395 Ga0451576_0012395_373_930 184
1408 3300045051 Ga0451576_0027225 Ga0451576_0027225_1380_1934 184
1409 3300045051 Ga0451576_0042307 Ga0451576_0042307_3461_4018 184
1410 3300045051 Ga0451576_0062199 Ga0451576_0062199_2846_3403 184
1411 3300045051 Ga0451576_0062248 Ga0451576_0062248_1864_2418 184
1412 3300045051 Ga0451576_0370146 Ga0451576_0370146_703_1260 184
1413 3300045836 Ga0466958_0422315 Ga0466958_0422315_60_614 184
1414 3300045976 Ga0466967_0213816 Ga0466967_0213816_364_918 184
1415 3300046453 Ga0495627_001896 Ga0495627_001896_1386_1940 184
1416 3300046453 Ga0495627_050922 Ga0495627_050922_447_1004 184
1417 3300046460 Ga0495638_0000040 Ga0495638_0000040_131755_132312 184
1418 3300046460 Ga0495638_0043942 Ga0495638_0043942_221_775 184
1419 3300046460 Ga0495638_0072019 Ga0495638_0072019_757_1311 184
1420 3300046473 Ga0495582_0312016 Ga0495582_0312016_156_710 184
1421 3300046507 Ga0495606_0006493 Ga0495606_0006493_9146_9700 184
1422 3300046507 Ga0495606_0010457 Ga0495606_0010457_3919_4476 184
1423 3300046519 Ga0495632_0088893 Ga0495632_0088893_105_662 184
1424 3300046522 Ga0495643_0009099 Ga0495643_0009099_2229_2783 184
1425 3300046537 Ga0495598_0097956 Ga0495598_0097956_345_899 184
1426 3300046543 Ga0495645_0293881 Ga0495645_0293881_400_954 184
1427 3300046543 Ga0495645_0433006 Ga0495645_0433006_111_665 184
1428 3300046558 Ga0495633_0000049 Ga0495633_0000049_82808_83362 184
1429 3300046558 Ga0495633_0061152 Ga0495633_0061152_908_1462 184
1430 3300046558 Ga0495633_0153686 Ga0495633_0153686_416_973 184
1431 3300046616 Ga0495668_0161287 Ga0495668_0161287_139_693 184
1432 3300046648 Ga0495611_0003370 Ga0495611_0003370_1620_2174 184
1433 3300046660 Ga0495625_0346569 Ga0495625_0346569_282_839 184
1434 3300046679 Ga0495623_0173557 Ga0495623_0173557_330_884 184
1435 3300046694 Ga0495649_0078773 Ga0495649_0078773_409_963 184
1436 3300047318 Ga0495636_0000012 Ga0495636_0000012_42413_42967 184
1437 3300047320 Ga0495672_0256583 Ga0495672_0256583_278_832 184
1438 3300047472 Ga0495686_0000004 Ga0495686_0000004_257162_257716 184
1439 3300047472 Ga0495686_0025653 Ga0495686_0025653_1361_1915 184
1440 3300048907 Ga0496104_0097105 Ga0496104_0097105_760_1314 184
1441 3300048907 Ga0496104_0300644 Ga0496104_0300644_83_637 184
1442 3300048910 Ga0496107_0727748 Ga0496107_0727748_101_655 184
1443 3300048912 Ga0496109_0051846 Ga0496109_0051846_2221_2775 184
1444 3300048917 Ga0496114_0001912 Ga0496114_0001912_10686_11240 184
1445 3300048918 Ga0496115_0094411 Ga0496115_0094411_692_1246 184
1446 3300048925 Ga0496122_0000862 Ga0496122_0000862_31060_31617 184
1447 3300048926 Ga0496123_0029231 Ga0496123_0029231_2319_2876 184
1448 3300048928 Ga0496125_0105937 Ga0496125_0105937_587_1144 184
1449 3300048929 Ga0496126_0089554 Ga0496126_0089554_1491_2045 184
1450 3300049127 Ga0501306_019863 Ga0501306_019863_155_709 184
1451 3300049128 Ga0501308_037880 Ga0501308_037880_14_571 184
1452 3300049128 Ga0501308_052130 Ga0501308_052130_33_590 184
1453 3300049132 Ga0501343_002364 Ga0501343_002364_446_1000 184
1454 3300049161 Ga0501305_009592 Ga0501305_009592_655_1212 184
1455 3300049162 Ga0501307_014525 Ga0501307_014525_314_868 184
1456 3300049527 Ga0501311_003947 Ga0501311_003947_374_928 184
1457 3300049530 Ga0501314_005402 Ga0501314_005402_260_814 184
1458 3300049531 Ga0501315_013721 Ga0501315_013721_437_994 184
1459 3300049533 Ga0501317_013917 Ga0501317_013917_124_678 184
1460 3300049535 Ga0501319_000018 Ga0501319_000018_2097_2651 184
1461 3300049536 Ga0501320_000042 Ga0501320_000042_2620_3174 184
1462 3300049540 Ga0501324_000446 Ga0501324_000446_825_1379 184
1463 3300049545 Ga0501329_00025 Ga0501329_00025_2692_3246 184
1464 3300049571 Ga0501034_0068864 Ga0501034_0068864_89_643 184
1465 3300049571 Ga0501034_0506147 Ga0501034_0506147_165_719 184
1466 3300049572 Ga0501036_0469331 Ga0501036_0469331_142_696 184
1467 3300049573 Ga0501037_0336815 Ga0501037_0336815_468_1022 184
1468 3300049579 Ga0501043_0252400 Ga0501043_0252400_553_1107 184
1469 3300049579 Ga0501043_0347853 Ga0501043_0347853_55_609 184
1470 3300049579 Ga0501043_0412068 Ga0501043_0412068_384_938 184
1471 3300049579 Ga0501043_0840598 Ga0501043_0840598_62_616 184
1472 3300049581 Ga0501047_0154966 Ga0501047_0154966_160_714 184
1473 3300049585 Ga0501069_0360955 Ga0501069_0360955_125_679 184
1474 3300049586 Ga0501070_0597127 Ga0501070_0597127_215_769 184
1475 3300049589 Ga0501073_0067112 Ga0501073_0067112_234_788 184
1476 3300049681 Ga0501251_044664 Ga0501251_044664_84_638 184
1477 3300049776 Ga0501280_038589 Ga0501280_038589_11_565 184
1478 3300049822 Ga0501035_0493382 Ga0501035_0493382_240_794 184
1479 3300050493 nmdc:mga0k408_106616_c1 nmdc:mga0k408_106616_c1_55_612 184
1480 3300050493 nmdc:mga0k408_17232_c1 nmdc:mga0k408_17232_c1_775_1329 184
1481 3300050493 nmdc:mga0k408_176521_c1 nmdc:mga0k408_176521_c1_386_940 184
1482 3300050493 nmdc:mga0k408_20199_c1 nmdc:mga0k408_20199_c1_1452_2006 184
1483 3300050493 nmdc:mga0k408_41944_c2 nmdc:mga0k408_41944_c2_410_964 184
1484 3300050493 nmdc:mga0k408_43078_c1 nmdc:mga0k408_43078_c1_1946_2500 184
1485 3300050493 nmdc:mga0k408_62301_c2 nmdc:mga0k408_62301_c2_796_1350 184
1486 3300050496 nmdc:mga07m45_26725_c1 nmdc:mga07m45_26725_c1_480_1034 184
1487 3300050507 nmdc:mga05p37_3944_c1 nmdc:mga05p37_3944_c1_7348_7902 184
1488 3300050507 nmdc:mga05p37_396256_c1 nmdc:mga05p37_396256_c1_526_1080 184
1489 3300050507 nmdc:mga05p37_886407_c1 nmdc:mga05p37_886407_c1_83_637 184
1490 3300050508 nmdc:mga09592_65841_c1 nmdc:mga09592_65841_c1_238_792 184
1491 3300050508 nmdc:mga09592_828015_c1 nmdc:mga09592_828015_c1_34_588 184
1492 3300050510 nmdc:mga06r32_157920_c1 nmdc:mga06r32_157920_c1_499_1053 184
1493 3300050510 nmdc:mga06r32_260089_c1 nmdc:mga06r32_260089_c1_1103_1660 184
1494 3300050510 nmdc:mga06r32_600359_c1 nmdc:mga06r32_600359_c1_468_1022 184
1495 3300050512 nmdc:mga0n895_346964_c1 nmdc:mga0n895_346964_c1_903_1457 184
1496 3300053088 Ga0500644_0012343 Ga0500644_0012343_1350_1907 184
1497 3300053088 Ga0500644_0012427 Ga0500644_0012427_1157_1714 184
1498 3300053090 Ga0500646_0093703 Ga0500646_0093703_34_591 184
1499 3300053092 Ga0500583_0037830 Ga0500583_0037830_438_995 184
1500 3300053093 Ga0500651_0207492 Ga0500651_0207492_406_960 184
1501 3300053098 Ga0500650_0159914 Ga0500650_0159914_411_968 184
1502 3300053104 Ga0500556_0109981 Ga0500556_0109981_54_611 184
1503 3300053109 Ga0500569_000284 Ga0500569_000284_530_1087 184
1504 3300053131 Ga0500652_003935 Ga0500652_003935_2313_2867 184
1505 3300053131 Ga0500652_181177 Ga0500652_181177_194_751 184
1506 3300053134 Ga0500658_0001077 Ga0500658_0001077_140_697 184
1507 3300053139 Ga0500568_0053162 Ga0500568_0053162_16_570 184
1508 3300053142 Ga0500577_0000711 Ga0500577_0000711_1355_1912 184
1509 3300053146 Ga0500588_0148287 Ga0500588_0148287_215_769 184
1510 3300053148 Ga0500590_052622 Ga0500590_052622_1218_1775 184
1511 3300053153 Ga0500616_0000013 Ga0500616_0000013_180311_180868 184
1512 3300053153 Ga0500616_0108629 Ga0500616_0108629_748_1305 184
1513 3300053156 Ga0500622_0000655 Ga0500622_0000655_14936_15490 184
1514 3300053156 Ga0500622_0022828 Ga0500622_0022828_936_1493 184
1515 3300053156 Ga0500622_0278125 Ga0500622_0278125_49_603 184
1516 3300053158 Ga0500627_0019206 Ga0500627_0019206_1076_1630 184
1517 3300053160 Ga0500633_0007899 Ga0500633_0007899_797_1354 184
1518 3300053161 Ga0500634_0210131 Ga0500634_0210131_242_799 184
1519 3300053177 Ga0500636_0005509 Ga0500636_0005509_927_1484 184
1520 3300053732 Ga0500656_018218 Ga0500656_018218_23_580 184
1521 3300059493 Ga0587077_000157 Ga0587077_000157_502_1056 184
1522 3300059641 Ga0587068_001506 Ga0587068_001506_294_851 184
1523 3300061719 Ga0466962_0058532 Ga0466962_0058532_731_1285 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

117

196

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

37

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.9559 2 179
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.9507 2 179
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9362 1 180
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9297 9 176
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9284 2 177
ID Description Score Start End Superfamily
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9537 2 83 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9449 1 83 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9425 2 83 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.934 1 83 3.90.930.12
4io9E01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9304 6 83 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A7J5WP81-F1-model_v4 Large subunit ribosomal protein 0.9818 1 81 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A3D1BU16-F1-model_v4 50S ribosomal protein L6 0.9817 1 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A848UXI5-F1-model_v4 50S ribosomal protein L6 0.9793 26 184 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2T2UG23-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL18; Large ribosomal subunit protein uL6] 0.9783 1 172 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A355UDM7-F1-model_v4 50S ribosomal protein L6 0.9769 1 162 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
81.31 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map