F494471
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1511 | 534 | 3022 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10016716|Ga0105239_100167167 |
| Length | 188 |
| Sequence | VKGVVMARLHEIYRNEIVPKLKKEFGYTSVMQVPHIEKITINMGVGEAAADKKILMNAIADLEKITGQKVVSTISRKSIAGFKIREGWPIGCKVTLRRAKMYEFLDRLVTIALPRVRDFRGISAKSFDGRGNYSLGIKEQIVFPEIEYDKIDALRGMDITITTSAATNKEAFALLRAFNFPFREKEVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 37 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 123 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 124 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 125 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 126 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 127 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 128 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 129 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 130 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 131 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 149 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 154 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 161 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 242 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 245 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 246 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 254 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 255 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 256 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 257 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 258 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 260 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 261 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 265 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 266 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 267 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 268 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 269 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 271 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 272 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 278 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 284 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 285 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 293 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 294 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 295 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 296 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 297 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 298 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 299 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 300 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 301 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 305 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 306 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 311 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 312 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 313 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 314 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 315 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 316 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 317 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 318 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 319 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 320 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 321 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 322 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 323 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 324 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 325 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 326 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 327 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 328 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 329 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 330 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 331 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 332 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 333 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 334 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 335 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 336 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 337 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 340 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 341 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 342 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 388 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 389 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 390 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 391 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 392 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 394 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 395 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 396 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 397 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 398 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 399 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 400 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 401 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 402 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 403 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 404 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 405 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 406 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 407 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 408 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 414 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 415 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 442 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 443 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 449 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 450 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 451 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 452 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 453 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 454 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 461 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 463 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 464 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 466 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 468 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 498 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 499 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 500 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 501 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 502 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 503 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 504 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 505 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 506 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 507 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 508 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 509 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 510 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 511 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 512 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 513 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 514 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 515 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 516 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 517 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 518 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 519 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 520 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 521 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 522 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 523 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 524 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 525 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 526 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 527 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 528 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 529 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 530 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 531 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 532 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 533 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 534 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.59 |
| Metatranscriptomes | 14.96 |
| Isolates | 2.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.13 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 80.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10016716 | 3300010375 | Bacteria | 8110 |
| 2 | JGI24736J21556_1000834 | 3300001904 | Bacteria | 5687 |
| 3 | JGI24736J21556_1011766 | 3300001904 | Bacteria | 1421 |
| 4 | JGI24741J21665_1002594 | 3300001915 | Bacteria | 4630 |
| 5 | JGI24741J21665_1003527 | 3300001915 | Bacteria | 3707 |
| 6 | JGI24741J21665_1016908 | 3300001915 | Bacteria | 1185 |
| 7 | JGI24740J21852_10000021 | 3300001979 | Bacteria | 53145 |
| 8 | JGI24740J21852_10008167 | 3300001979 | Bacteria | 4195 |
| 9 | JGI24739J22299_10000118 | 3300001989 | Bacteria | 24899 |
| 10 | JGI24739J22299_10006773 | 3300001989 | Bacteria | 4313 |
| 11 | JGI24737J22298_10000685 | 3300001990 | Bacteria | 11898 |
| 12 | JGI24737J22298_10009379 | 3300001990 | Bacteria | 3259 |
| 13 | JGI24735J21928_10001587 | 3300002067 | Bacteria | 8065 |
| 14 | JGI24735J21928_10003017 | 3300002067 | Bacteria | 5789 |
| 15 | JGI24735J21928_10004966 | 3300002067 | Bacteria | 4432 |
| 16 | JGI24735J21928_10077607 | 3300002067 | Bacteria | 951 |
| 17 | JGI24738J21930_10000244 | 3300002075 | Bacteria | 14787 |
| 18 | JGI25156J39149_1022995 | 3300002705 | Bacteria | 1049 |
| 19 | JGI25162J39368_1002823 | 3300002737 | Bacteria | 6070 |
| 20 | JGI25162J39368_1004851 | 3300002737 | Bacteria | 2907 |
| 21 | JGI25162J39368_1007633 | 3300002737 | Bacteria | 1655 |
| 22 | JGI25162J39368_1009713 | 3300002737 | Bacteria | 1265 |
| 23 | JGI25162J39368_1009724 | 3300002737 | Bacteria | 1264 |
| 24 | JGI25154J39366_1004667 | 3300002738 | Bacteria | 2387 |
| 25 | JGI25154J39366_1009597 | 3300002738 | Bacteria | 1183 |
| 26 | JGI25157J39369_1001153 | 3300002741 | Bacteria | 11428 |
| 27 | JGI25157J39369_1002257 | 3300002741 | Bacteria | 5167 |
| 28 | JGI25157J39369_1002562 | 3300002741 | Bacteria | 4366 |
| 29 | JGI25163J39215_1001625 | 3300002771 | Bacteria | 3351 |
| 30 | JGI25164J39214_1000312 | 3300002772 | Bacteria | 31934 |
| 31 | JGI25164J39214_1000781 | 3300002772 | Bacteria | 11524 |
| 32 | JGI25152J39213_1020082 | 3300002773 | Bacteria | 1202 |
| 33 | JGI25152J39213_1023998 | 3300002773 | Bacteria | 1030 |
| 34 | JGI25165J46597_1000586 | 3300003214 | Bacteria | 31905 |
| 35 | JGI25165J46597_1001532 | 3300003214 | Bacteria | 11524 |
| 36 | JGI25165J46597_1010465 | 3300003214 | Bacteria | 1352 |
| 37 | JGI25153J46596_10044279 | 3300003215 | Bacteria | 1339 |
| 38 | rootH2_10053540 | 3300003320 | Bacteria | 3889 |
| 39 | Ga0006556J51387_1018520 | 3300003479 | Bacteria | 14040 |
| 40 | Ga0006556J51387_1029536 | 3300003479 | Bacteria | 4901 |
| 41 | Ga0006558J51389_1018313 | 3300003558 | Bacteria | 6898 |
| 42 | Ga0006560J51390_1017170 | 3300003565 | Bacteria | 14049 |
| 43 | Ga0006560J51390_1022654 | 3300003565 | Bacteria | 4061 |
| 44 | Ga0006554J51385_1017088 | 3300003567 | Bacteria | 14046 |
| 45 | Ga0006554J51385_1020490 | 3300003567 | Bacteria | 10124 |
| 46 | Ga0007409J51694_1052656 | 3300003575 | Bacteria | 4258 |
| 47 | Ga0006562J51391_1006869 | 3300003578 | Bacteria | 31335 |
| 48 | Ga0006562J51391_1018587 | 3300003578 | Bacteria | 6552 |
| 49 | Ga0007429J51699_1074699 | 3300003579 | Bacteria | 1495 |
| 50 | Ga0055538_1000680 | 3300003751 | Bacteria | 10513 |
| 51 | Ga0055539_1000456 | 3300003752 | Bacteria | 13948 |
| 52 | Ga0055533_1000432 | 3300003756 | Bacteria | 15970 |
| 53 | Ga0055533_1001562 | 3300003756 | Bacteria | 5959 |
| 54 | Ga0055525_1000111 | 3300003759 | Bacteria | 127836 |
| 55 | Ga0055527_1001990 | 3300003760 | Bacteria | 3724 |
| 56 | Ga0055527_1005431 | 3300003760 | Bacteria | 1658 |
| 57 | Ga0055527_1005551 | 3300003760 | Bacteria | 1633 |
| 58 | Ga0055535_1004607 | 3300003761 | Bacteria | 3288 |
| 59 | Ga0055535_1006497 | 3300003761 | Bacteria | 2356 |
| 60 | Ga0055535_1009753 | 3300003761 | Bacteria | 1629 |
| 61 | Ga0055542_1002415 | 3300003762 | Bacteria | 6253 |
| 62 | Ga0055542_1002419 | 3300003762 | Bacteria | 6220 |
| 63 | Ga0055542_1010749 | 3300003762 | Bacteria | 1658 |
| 64 | Ga0055542_1010940 | 3300003762 | Bacteria | 1633 |
| 65 | Ga0055542_1014856 | 3300003762 | Bacteria | 1265 |
| 66 | Ga0055542_1014872 | 3300003762 | Bacteria | 1264 |
| 67 | Ga0055529_1000211 | 3300003763 | Bacteria | 76826 |
| 68 | Ga0055529_1001427 | 3300003763 | Bacteria | 7514 |
| 69 | Ga0055529_1006343 | 3300003763 | Bacteria | 1658 |
| 70 | Ga0055529_1006494 | 3300003763 | Bacteria | 1633 |
| 71 | Ga0055529_1007498 | 3300003763 | Bacteria | 1481 |
| 72 | Ga0055531_10010210 | 3300003794 | Bacteria | 4695 |
| 73 | Ga0055531_10026295 | 3300003794 | Bacteria | 2081 |
| 74 | Ga0058863_11854684 | 3300004799 | Bacteria | 2846 |
| 75 | Ga0058860_10173151 | 3300004801 | Bacteria | 3095 |
| 76 | Ga0065165_1000598 | 3300005262 | Bacteria | 52772 |
| 77 | Ga0065165_1014398 | 3300005262 | Bacteria | 3074 |
| 78 | Ga0065704_10014668 | 3300005289 | Bacteria | 1670 |
| 79 | Ga0065712_10045478 | 3300005290 | Bacteria | 901 |
| 80 | Ga0065715_10387468 | 3300005293 | Bacteria | 882 |
| 81 | Ga0065707_10525630 | 3300005295 | Bacteria | 739 |
| 82 | Ga0070658_10079794 | 3300005327 | Bacteria | 2688 |
| 83 | Ga0070658_10116570 | 3300005327 | Bacteria | 2216 |
| 84 | Ga0070658_10173032 | 3300005327 | Bacteria | 1814 |
| 85 | Ga0070658_10808705 | 3300005327 | Bacteria | 814 |
| 86 | Ga0070658_10849479 | 3300005327 | Bacteria | 793 |
| 87 | Ga0070676_10073677 | 3300005328 | Bacteria | 2055 |
| 88 | Ga0070683_100157216 | 3300005329 | Bacteria | 2156 |
| 89 | Ga0070683_100397330 | 3300005329 | Bacteria | 1314 |
| 90 | Ga0070690_100520364 | 3300005330 | Bacteria | 893 |
| 91 | Ga0070670_100000015 | 3300005331 | Bacteria | 228819 |
| 92 | Ga0070670_100114614 | 3300005331 | Bacteria | 2323 |
| 93 | Ga0070670_100128667 | 3300005331 | Bacteria | 2186 |
| 94 | Ga0070670_100671425 | 3300005331 | Bacteria | 930 |
| 95 | Ga0070677_10047856 | 3300005333 | Bacteria | 1716 |
| 96 | Ga0070666_10000012 | 3300005335 | Bacteria | 244720 |
| 97 | Ga0070666_10004872 | 3300005335 | Bacteria | 8205 |
| 98 | Ga0070666_10005025 | 3300005335 | Bacteria | 8088 |
| 99 | Ga0070666_10192157 | 3300005335 | Bacteria | 1435 |
| 100 | Ga0070680_100038408 | 3300005336 | Bacteria | 3872 |
| 101 | Ga0070680_100120993 | 3300005336 | Bacteria | 2185 |
| 102 | Ga0070680_100126385 | 3300005336 | Bacteria | 2136 |
| 103 | Ga0070680_100137925 | 3300005336 | Bacteria | 2044 |
| 104 | Ga0070680_100332029 | 3300005336 | Bacteria | 1291 |
| 105 | Ga0070680_100836378 | 3300005336 | Bacteria | 793 |
| 106 | Ga0070682_100005710 | 3300005337 | Bacteria | 6936 |
| 107 | Ga0070682_100014033 | 3300005337 | Bacteria | 4623 |
| 108 | Ga0070682_100067467 | 3300005337 | Bacteria | 2278 |
| 109 | Ga0070682_100071520 | 3300005337 | Bacteria | 2220 |
| 110 | Ga0070682_100102914 | 3300005337 | Bacteria | 1888 |
| 111 | Ga0068868_100113147 | 3300005338 | Bacteria | 2206 |
| 112 | Ga0068868_100166417 | 3300005338 | Bacteria | 1824 |
| 113 | Ga0070660_100112812 | 3300005339 | Bacteria | 2164 |
| 114 | Ga0070660_100113633 | 3300005339 | Bacteria | 2156 |
| 115 | Ga0070660_100148886 | 3300005339 | Bacteria | 1881 |
| 116 | Ga0070660_100180219 | 3300005339 | Bacteria | 1709 |
| 117 | Ga0070689_100013126 | 3300005340 | Bacteria | 5987 |
| 118 | Ga0070691_10014961 | 3300005341 | Bacteria | 3562 |
| 119 | Ga0070691_10075743 | 3300005341 | Bacteria | 1639 |
| 120 | Ga0070691_10080247 | 3300005341 | Bacteria | 1596 |
| 121 | Ga0070691_10170469 | 3300005341 | Bacteria | 1127 |
| 122 | Ga0070661_100035059 | 3300005344 | Bacteria | 3642 |
| 123 | Ga0070661_100041400 | 3300005344 | Bacteria | 3362 |
| 124 | Ga0070661_100049277 | 3300005344 | Bacteria | 3083 |
| 125 | Ga0070661_100082561 | 3300005344 | Bacteria | 2373 |
| 126 | Ga0070661_100084529 | 3300005344 | Bacteria | 2344 |
| 127 | Ga0070661_100196512 | 3300005344 | Bacteria | 1540 |
| 128 | Ga0070661_100938734 | 3300005344 | Bacteria | 715 |
| 129 | Ga0070692_10037868 | 3300005345 | Bacteria | 2454 |
| 130 | Ga0070692_10069511 | 3300005345 | Bacteria | 1873 |
| 131 | Ga0070692_10089534 | 3300005345 | Bacteria | 1670 |
| 132 | Ga0070692_10625681 | 3300005345 | Bacteria | 715 |
| 133 | Ga0070668_100015678 | 3300005347 | Bacteria | 5667 |
| 134 | Ga0070668_100021079 | 3300005347 | Bacteria | 4925 |
| 135 | Ga0070668_100446007 | 3300005347 | Bacteria | 1112 |
| 136 | Ga0070668_100967250 | 3300005347 | Bacteria | 764 |
| 137 | Ga0070668_101134250 | 3300005347 | Bacteria | 707 |
| 138 | Ga0070669_100004607 | 3300005353 | Bacteria | 9957 |
| 139 | Ga0070669_100063003 | 3300005353 | Bacteria | 2728 |
| 140 | Ga0070669_100068175 | 3300005353 | Bacteria | 2626 |
| 141 | Ga0070669_100621250 | 3300005353 | Bacteria | 907 |
| 142 | Ga0070675_100062636 | 3300005354 | Bacteria | 3073 |
| 143 | Ga0070675_100354451 | 3300005354 | Bacteria | 1302 |
| 144 | Ga0070675_100370200 | 3300005354 | Bacteria | 1274 |
| 145 | Ga0070671_100000013 | 3300005355 | Bacteria | 173287 |
| 146 | Ga0070671_100204483 | 3300005355 | Bacteria | 1675 |
| 147 | Ga0070674_100441951 | 3300005356 | Bacteria | 1071 |
| 148 | Ga0070673_100218257 | 3300005364 | Bacteria | 1649 |
| 149 | Ga0070688_100001170 | 3300005365 | Bacteria | 13058 |
| 150 | Ga0070659_100193733 | 3300005366 | Bacteria | 1671 |
| 151 | Ga0070659_100204926 | 3300005366 | Bacteria | 1624 |
| 152 | Ga0070659_100239692 | 3300005366 | Bacteria | 1500 |
| 153 | Ga0070659_100249519 | 3300005366 | Bacteria | 1470 |
| 154 | Ga0070667_100000015 | 3300005367 | Bacteria | 238203 |
| 155 | Ga0070667_100307002 | 3300005367 | Bacteria | 1429 |
| 156 | Ga0070667_100456785 | 3300005367 | Bacteria | 1167 |
| 157 | Ga0070667_100548428 | 3300005367 | Bacteria | 1062 |
| 158 | Ga0070709_10547879 | 3300005434 | Bacteria | 885 |
| 159 | Ga0070714_100436318 | 3300005435 | Bacteria | 1242 |
| 160 | Ga0070714_100439110 | 3300005435 | Bacteria | 1238 |
| 161 | Ga0070714_100443383 | 3300005435 | Bacteria | 1232 |
| 162 | Ga0070713_100008401 | 3300005436 | Bacteria | 7319 |
| 163 | Ga0070713_101285498 | 3300005436 | Bacteria | 709 |
| 164 | Ga0070710_10018563 | 3300005437 | Bacteria | 3580 |
| 165 | Ga0070711_100133362 | 3300005439 | Bacteria | 1853 |
| 166 | Ga0070700_100202755 | 3300005441 | Bacteria | 1394 |
| 167 | Ga0070663_100063416 | 3300005455 | Bacteria | 2668 |
| 168 | Ga0070663_100094181 | 3300005455 | Bacteria | 2223 |
| 169 | Ga0070663_100096100 | 3300005455 | Bacteria | 2203 |
| 170 | Ga0070663_100099814 | 3300005455 | Bacteria | 2165 |
| 171 | Ga0070663_100104002 | 3300005455 | Bacteria | 2123 |
| 172 | Ga0070663_100714871 | 3300005455 | Bacteria | 853 |
| 173 | Ga0070663_100998143 | 3300005455 | Bacteria | 728 |
| 174 | Ga0070678_100003045 | 3300005456 | Bacteria | 9285 |
| 175 | Ga0070662_100025886 | 3300005457 | Bacteria | 4056 |
| 176 | Ga0070662_100163663 | 3300005457 | Bacteria | 1742 |
| 177 | Ga0070662_100208325 | 3300005457 | Bacteria | 1554 |
| 178 | Ga0070662_100330820 | 3300005457 | Bacteria | 1245 |
| 179 | Ga0070662_100525028 | 3300005457 | Bacteria | 990 |
| 180 | Ga0070681_10000250 | 3300005458 | Bacteria | 42625 |
| 181 | Ga0070681_10037765 | 3300005458 | Bacteria | 4844 |
| 182 | Ga0070681_10046978 | 3300005458 | Bacteria | 4316 |
| 183 | Ga0070681_10162597 | 3300005458 | Bacteria | 2156 |
| 184 | Ga0070681_10178476 | 3300005458 | Bacteria | 2045 |
| 185 | Ga0070681_10215106 | 3300005458 | Bacteria | 1838 |
| 186 | Ga0070681_10473218 | 3300005458 | Bacteria | 1165 |
| 187 | Ga0070681_10919424 | 3300005458 | Bacteria | 793 |
| 188 | Ga0070685_10000104 | 3300005466 | Bacteria | 53528 |
| 189 | Ga0070685_10002255 | 3300005466 | Bacteria | 9947 |
| 190 | Ga0070685_10046788 | 3300005466 | Bacteria | 2485 |
| 191 | Ga0070685_10063320 | 3300005466 | Bacteria | 2171 |
| 192 | Ga0070706_101274781 | 3300005467 | Bacteria | 674 |
| 193 | Ga0070698_100047038 | 3300005471 | Bacteria | 4411 |
| 194 | Ga0070679_100046691 | 3300005530 | Bacteria | 4317 |
| 195 | Ga0070679_100057568 | 3300005530 | Bacteria | 3874 |
| 196 | Ga0070679_100092348 | 3300005530 | Bacteria | 3014 |
| 197 | Ga0070679_100214300 | 3300005530 | Bacteria | 1888 |
| 198 | Ga0070679_100214704 | 3300005530 | Bacteria | 1886 |
| 199 | Ga0070679_100464393 | 3300005530 | Bacteria | 1210 |
| 200 | Ga0070684_100082507 | 3300005535 | Bacteria | 2846 |
| 201 | Ga0070684_100126859 | 3300005535 | Bacteria | 2299 |
| 202 | Ga0070684_100551531 | 3300005535 | Bacteria | 1070 |
| 203 | Ga0070684_100567810 | 3300005535 | Bacteria | 1053 |
| 204 | Ga0068853_100093919 | 3300005539 | Bacteria | 2641 |
| 205 | Ga0068853_100190825 | 3300005539 | Bacteria | 1861 |
| 206 | Ga0068853_100204102 | 3300005539 | Bacteria | 1799 |
| 207 | Ga0068853_100226394 | 3300005539 | Bacteria | 1709 |
| 208 | Ga0068853_100395040 | 3300005539 | Bacteria | 1293 |
| 209 | Ga0070672_100284254 | 3300005543 | Bacteria | 1399 |
| 210 | Ga0070672_100457028 | 3300005543 | Bacteria | 1100 |
| 211 | Ga0070672_100661488 | 3300005543 | Bacteria | 913 |
| 212 | Ga0070696_100006375 | 3300005546 | Bacteria | 7892 |
| 213 | Ga0070696_100008697 | 3300005546 | Bacteria | 6794 |
| 214 | Ga0070696_100010164 | 3300005546 | Bacteria | 6301 |
| 215 | Ga0070696_100120127 | 3300005546 | Bacteria | 1901 |
| 216 | Ga0070696_100407907 | 3300005546 | Bacteria | 1064 |
| 217 | Ga0070696_100713001 | 3300005546 | Bacteria | 819 |
| 218 | Ga0070693_100007266 | 3300005547 | Bacteria | 5408 |
| 219 | Ga0070693_100009800 | 3300005547 | Bacteria | 4777 |
| 220 | Ga0070693_100010949 | 3300005547 | Bacteria | 4558 |
| 221 | Ga0070693_100011890 | 3300005547 | Bacteria | 4392 |
| 222 | Ga0070693_100278154 | 3300005547 | Bacteria | 1120 |
| 223 | Ga0070665_100003465 | 3300005548 | Bacteria | 16812 |
| 224 | Ga0070665_100004322 | 3300005548 | Bacteria | 14941 |
| 225 | Ga0070665_100004348 | 3300005548 | Bacteria | 14902 |
| 226 | Ga0070665_100008860 | 3300005548 | Bacteria | 10186 |
| 227 | Ga0068855_100027951 | 3300005563 | Bacteria | 6746 |
| 228 | Ga0068855_100148373 | 3300005563 | Bacteria | 2668 |
| 229 | Ga0068855_100182261 | 3300005563 | Bacteria | 2374 |
| 230 | Ga0068855_100214346 | 3300005563 | Bacteria | 2162 |
| 231 | Ga0068855_100218882 | 3300005563 | Bacteria | 2136 |
| 232 | Ga0068855_100358623 | 3300005563 | Bacteria | 1605 |
| 233 | Ga0068855_100459535 | 3300005563 | Bacteria | 1388 |
| 234 | Ga0068855_100542745 | 3300005563 | Bacteria | 1259 |
| 235 | Ga0068855_101096358 | 3300005563 | Bacteria | 832 |
| 236 | Ga0070664_100134459 | 3300005564 | Bacteria | 2173 |
| 237 | Ga0070664_100207178 | 3300005564 | Bacteria | 1751 |
| 238 | Ga0070664_100320168 | 3300005564 | Bacteria | 1405 |
| 239 | Ga0068857_100000998 | 3300005577 | Bacteria | 21742 |
| 240 | Ga0068857_100113748 | 3300005577 | Bacteria | 2434 |
| 241 | Ga0068857_100145109 | 3300005577 | Bacteria | 2147 |
| 242 | Ga0068857_100315285 | 3300005577 | Bacteria | 1443 |
| 243 | Ga0068857_100476463 | 3300005577 | Bacteria | 1169 |
| 244 | Ga0068857_100889505 | 3300005577 | Bacteria | 854 |
| 245 | Ga0068854_100002422 | 3300005578 | Bacteria | 11519 |
| 246 | Ga0068854_100008257 | 3300005578 | Bacteria | 6684 |
| 247 | Ga0068854_100024883 | 3300005578 | Bacteria | 4104 |
| 248 | Ga0068854_100047152 | 3300005578 | Bacteria | 3070 |
| 249 | Ga0068854_100100630 | 3300005578 | Bacteria | 2166 |
| 250 | Ga0068854_100327377 | 3300005578 | Bacteria | 1247 |
| 251 | Ga0068854_100683010 | 3300005578 | Bacteria | 885 |
| 252 | Ga0068856_100004630 | 3300005614 | Bacteria | 13662 |
| 253 | Ga0068856_100004797 | 3300005614 | Bacteria | 13405 |
| 254 | Ga0068856_100014197 | 3300005614 | Bacteria | 7699 |
| 255 | Ga0068856_100016200 | 3300005614 | Bacteria | 7211 |
| 256 | Ga0068856_100176917 | 3300005614 | Bacteria | 2146 |
| 257 | Ga0068856_100182072 | 3300005614 | Bacteria | 2114 |
| 258 | Ga0068856_100317454 | 3300005614 | Bacteria | 1575 |
| 259 | Ga0068856_100377121 | 3300005614 | Bacteria | 1437 |
| 260 | Ga0068856_100506201 | 3300005614 | Bacteria | 1229 |
| 261 | Ga0068856_100912965 | 3300005614 | Bacteria | 897 |
| 262 | Ga0068856_101148750 | 3300005614 | Bacteria | 793 |
| 263 | Ga0068852_100020534 | 3300005616 | Bacteria | 5254 |
| 264 | Ga0068852_100028025 | 3300005616 | Bacteria | 4603 |
| 265 | Ga0068852_100039943 | 3300005616 | Bacteria | 3954 |
| 266 | Ga0068852_100185001 | 3300005616 | Bacteria | 1961 |
| 267 | Ga0068852_100278253 | 3300005616 | Bacteria | 1612 |
| 268 | Ga0068852_100583728 | 3300005616 | Bacteria | 1121 |
| 269 | Ga0068852_101383946 | 3300005616 | Bacteria | 725 |
| 270 | Ga0068859_100005854 | 3300005617 | Bacteria | 12474 |
| 271 | Ga0068859_100077312 | 3300005617 | Bacteria | 3369 |
| 272 | Ga0068859_100254682 | 3300005617 | Bacteria | 1846 |
| 273 | Ga0068864_100000056 | 3300005618 | Bacteria | 127891 |
| 274 | Ga0068864_100176397 | 3300005618 | Bacteria | 1951 |
| 275 | Ga0068866_10059552 | 3300005718 | Bacteria | 1976 |
| 276 | Ga0068851_10007152 | 3300005834 | Bacteria | 5115 |
| 277 | Ga0068851_10008970 | 3300005834 | Bacteria | 4639 |
| 278 | Ga0068851_10062443 | 3300005834 | Bacteria | 1911 |
| 279 | Ga0068851_10277326 | 3300005834 | Bacteria | 958 |
| 280 | Ga0068851_10470494 | 3300005834 | Bacteria | 750 |
| 281 | Ga0068870_10001674 | 3300005840 | Bacteria | 9068 |
| 282 | Ga0068870_10754905 | 3300005840 | Bacteria | 676 |
| 283 | Ga0068863_100108830 | 3300005841 | Bacteria | 2638 |
| 284 | Ga0068858_100006088 | 3300005842 | Bacteria | 11769 |
| 285 | Ga0068858_100031324 | 3300005842 | Bacteria | 4939 |
| 286 | Ga0068858_100100650 | 3300005842 | Bacteria | 2695 |
| 287 | Ga0068858_100496666 | 3300005842 | Bacteria | 1178 |
| 288 | Ga0068860_100069308 | 3300005843 | Bacteria | 3352 |
| 289 | Ga0068862_100008335 | 3300005844 | Bacteria | 8578 |
| 290 | Ga0068862_100010918 | 3300005844 | Bacteria | 7499 |
| 291 | Ga0075365_10000030 | 3300006038 | Bacteria | 56932 |
| 292 | Ga0075365_10916867 | 3300006038 | Bacteria | 618 |
| 293 | Ga0075368_10075335 | 3300006042 | Unclassified | 1368 |
| 294 | Ga0075363_100001020 | 3300006048 | Bacteria | 10057 |
| 295 | Ga0075364_10000068 | 3300006051 | Bacteria | 39877 |
| 296 | Ga0075364_10006019 | 3300006051 | Bacteria | 7094 |
| 297 | Ga0075364_10024136 | 3300006051 | Bacteria | 3857 |
| 298 | Ga0075364_10045776 | 3300006051 | Bacteria | 2847 |
| 299 | Ga0075364_10150145 | 3300006051 | Bacteria | 1570 |
| 300 | Ga0075364_10689074 | 3300006051 | Bacteria | 697 |
| 301 | Ga0070716_100034277 | 3300006173 | Bacteria | 2782 |
| 302 | Ga0075367_10018355 | 3300006178 | Bacteria | 3858 |
| 303 | Ga0075367_10083925 | 3300006178 | Bacteria | 1931 |
| 304 | Ga0075369_10000030 | 3300006186 | Bacteria | 39211 |
| 305 | Ga0075369_10090158 | 3300006186 | Bacteria | 1367 |
| 306 | Ga0075427_10000015 | 3300006194 | Bacteria | 11234 |
| 307 | Ga0075370_10000042 | 3300006353 | Bacteria | 39566 |
| 308 | Ga0075434_100029763 | 3300006871 | Bacteria | 5375 |
| 309 | Ga0068865_100010514 | 3300006881 | Bacteria | 5763 |
| 310 | Ga0068865_100037315 | 3300006881 | Bacteria | 3281 |
| 311 | Ga0068865_100174338 | 3300006881 | Bacteria | 1651 |
| 312 | Ga0097620_100005854 | 3300006931 | Bacteria | 12474 |
| 313 | Ga0097620_100077315 | 3300006931 | Bacteria | 3369 |
| 314 | Ga0097620_100254709 | 3300006931 | Bacteria | 1846 |
| 315 | Ga0105240_10001149 | 3300009093 | Bacteria | 46318 |
| 316 | Ga0105240_10155079 | 3300009093 | Bacteria | 2724 |
| 317 | Ga0105240_10160771 | 3300009093 | Bacteria | 2667 |
| 318 | Ga0105240_10279921 | 3300009093 | Bacteria | 1917 |
| 319 | Ga0105240_10575911 | 3300009093 | Bacteria | 1242 |
| 320 | Ga0105240_10585481 | 3300009093 | Bacteria | 1230 |
| 321 | Ga0105240_10659400 | 3300009093 | Bacteria | 1146 |
| 322 | Ga0105240_10767205 | 3300009093 | Bacteria | 1047 |
| 323 | Ga0105240_10842223 | 3300009093 | Bacteria | 990 |
| 324 | Ga0105240_11373058 | 3300009093 | Bacteria | 743 |
| 325 | Ga0111539_11376173 | 3300009094 | Bacteria | 819 |
| 326 | Ga0105247_10001324 | 3300009101 | Bacteria | 18074 |
| 327 | Ga0105247_10034259 | 3300009101 | Bacteria | 3093 |
| 328 | Ga0105241_10073856 | 3300009174 | Bacteria | 2654 |
| 329 | Ga0105241_10170821 | 3300009174 | Bacteria | 1796 |
| 330 | Ga0105241_10180245 | 3300009174 | Bacteria | 1752 |
| 331 | Ga0105241_10414041 | 3300009174 | Bacteria | 1185 |
| 332 | Ga0105241_10607832 | 3300009174 | Bacteria | 988 |
| 333 | Ga0105242_10003026 | 3300009176 | Bacteria | 13137 |
| 334 | Ga0105248_10023564 | 3300009177 | Bacteria | 6838 |
| 335 | Ga0105248_10117754 | 3300009177 | Bacteria | 2996 |
| 336 | Ga0105237_10005040 | 3300009545 | Bacteria | 15039 |
| 337 | Ga0105237_10005934 | 3300009545 | Bacteria | 13696 |
| 338 | Ga0105237_10068309 | 3300009545 | Bacteria | 3548 |
| 339 | Ga0105237_10140547 | 3300009545 | Bacteria | 2409 |
| 340 | Ga0105237_10417725 | 3300009545 | Bacteria | 1347 |
| 341 | Ga0105238_10002505 | 3300009551 | Bacteria | 18378 |
| 342 | Ga0105238_10014023 | 3300009551 | Bacteria | 8105 |
| 343 | Ga0105238_10022836 | 3300009551 | Bacteria | 6377 |
| 344 | Ga0105238_10178754 | 3300009551 | Bacteria | 2099 |
| 345 | Ga0105238_10235288 | 3300009551 | Bacteria | 1809 |
| 346 | Ga0105238_10398970 | 3300009551 | Bacteria | 1368 |
| 347 | Ga0105238_10643489 | 3300009551 | Bacteria | 1070 |
| 348 | Ga0105238_10719234 | 3300009551 | Bacteria | 1011 |
| 349 | Ga0105238_10762215 | 3300009551 | Bacteria | 982 |
| 350 | Ga0105249_10012650 | 3300009553 | Bacteria | 7441 |
| 351 | Ga0105249_10062574 | 3300009553 | Bacteria | 3417 |
| 352 | Ga0105249_10090427 | 3300009553 | Bacteria | 2862 |
| 353 | Ga0105249_10703723 | 3300009553 | Bacteria | 1070 |
| 354 | Ga0105249_10830935 | 3300009553 | Bacteria | 989 |
| 355 | Ga0105148_101335 | 3300009978 | Bacteria | 1728 |
| 356 | Ga0105239_10004445 | 3300010375 | Bacteria | 16760 |
| 357 | Ga0105239_10006660 | 3300010375 | Bacteria | 13359 |
| 358 | Ga0105239_10018940 | 3300010375 | Bacteria | 7607 |
| 359 | Ga0105239_10051327 | 3300010375 | Bacteria | 4521 |
| 360 | Ga0105239_10120664 | 3300010375 | Bacteria | 2911 |
| 361 | Ga0105239_10121728 | 3300010375 | Bacteria | 2898 |
| 362 | Ga0157317_1001760 | 3300012475 | Bacteria | 1208 |
| 363 | Ga0157318_1002276 | 3300012482 | Bacteria | 1033 |
| 364 | Ga0157319_1000654 | 3300012497 | Bacteria | 1603 |
| 365 | Ga0157345_1006431 | 3300012498 | Bacteria | 936 |
| 366 | Ga0157345_1013483 | 3300012498 | Bacteria | 752 |
| 367 | Ga0157314_1000264 | 3300012500 | Bacteria | 5638 |
| 368 | Ga0157314_1002788 | 3300012500 | Bacteria | 1215 |
| 369 | Ga0157324_1000130 | 3300012506 | Bacteria | 3371 |
| 370 | Ga0157316_1001768 | 3300012510 | Bacteria | 1392 |
| 371 | Ga0157327_1007855 | 3300012512 | Bacteria | 941 |
| 372 | Ga0157326_1007991 | 3300012513 | Bacteria | 1149 |
| 373 | Ga0157373_10097490 | 3300013100 | Bacteria | 2070 |
| 374 | Ga0157373_10162009 | 3300013100 | Bacteria | 1574 |
| 375 | Ga0157373_10281434 | 3300013100 | Bacteria | 1179 |
| 376 | Ga0157371_10057568 | 3300013102 | Bacteria | 2757 |
| 377 | Ga0157371_10062803 | 3300013102 | Bacteria | 2632 |
| 378 | Ga0157371_10094267 | 3300013102 | Bacteria | 2121 |
| 379 | Ga0157371_10095337 | 3300013102 | Bacteria | 2109 |
| 380 | Ga0157371_10105493 | 3300013102 | Bacteria | 2000 |
| 381 | Ga0157371_10129719 | 3300013102 | Bacteria | 1793 |
| 382 | Ga0157371_10213771 | 3300013102 | Bacteria | 1384 |
| 383 | Ga0157371_10278786 | 3300013102 | Bacteria | 1207 |
| 384 | Ga0157371_10515360 | 3300013102 | Bacteria | 884 |
| 385 | Ga0157371_10754053 | 3300013102 | Bacteria | 731 |
| 386 | Ga0157370_10039480 | 3300013104 | Bacteria | 4562 |
| 387 | Ga0157370_10060742 | 3300013104 | Bacteria | 3587 |
| 388 | Ga0157370_10080667 | 3300013104 | Bacteria | 3063 |
| 389 | Ga0157370_10152581 | 3300013104 | Bacteria | 2149 |
| 390 | Ga0157370_10239737 | 3300013104 | Bacteria | 1678 |
| 391 | Ga0157370_10416647 | 3300013104 | Bacteria | 1236 |
| 392 | Ga0157370_10656243 | 3300013104 | Bacteria | 959 |
| 393 | Ga0157370_10915202 | 3300013104 | Bacteria | 796 |
| 394 | Ga0157369_10000125 | 3300013105 | Bacteria | 110481 |
| 395 | Ga0157369_10004613 | 3300013105 | Bacteria | 16198 |
| 396 | Ga0157369_10025057 | 3300013105 | Bacteria | 6626 |
| 397 | Ga0157369_10043551 | 3300013105 | Bacteria | 4892 |
| 398 | Ga0157369_10044682 | 3300013105 | Bacteria | 4820 |
| 399 | Ga0157369_10053594 | 3300013105 | Bacteria | 4358 |
| 400 | Ga0157369_10066443 | 3300013105 | Bacteria | 3879 |
| 401 | Ga0157369_10149485 | 3300013105 | Bacteria | 2469 |
| 402 | Ga0157369_10218558 | 3300013105 | Bacteria | 1995 |
| 403 | Ga0157369_10497236 | 3300013105 | Bacteria | 1262 |
| 404 | Ga0157374_10294683 | 3300013296 | Bacteria | 1604 |
| 405 | Ga0157378_10525821 | 3300013297 | Bacteria | 1185 |
| 406 | Ga0157378_12190874 | 3300013297 | Bacteria | 604 |
| 407 | Ga0163162_10001854 | 3300013306 | Bacteria | 19906 |
| 408 | Ga0163162_10008705 | 3300013306 | Bacteria | 9877 |
| 409 | Ga0163162_10039619 | 3300013306 | Bacteria | 4710 |
| 410 | Ga0163162_10056316 | 3300013306 | Bacteria | 3960 |
| 411 | Ga0163162_10569747 | 3300013306 | Bacteria | 1260 |
| 412 | Ga0163162_10906806 | 3300013306 | Bacteria | 994 |
| 413 | Ga0157372_10022741 | 3300013307 | Bacteria | 6786 |
| 414 | Ga0157372_10153500 | 3300013307 | Bacteria | 2659 |
| 415 | Ga0157372_10220465 | 3300013307 | Bacteria | 2199 |
| 416 | Ga0157372_10252088 | 3300013307 | Bacteria | 2049 |
| 417 | Ga0157372_10262875 | 3300013307 | Bacteria | 2004 |
| 418 | Ga0157372_10308959 | 3300013307 | Bacteria | 1840 |
| 419 | Ga0157372_10327961 | 3300013307 | Bacteria | 1782 |
| 420 | Ga0157372_10398502 | 3300013307 | Bacteria | 1604 |
| 421 | Ga0157372_10447730 | 3300013307 | Bacteria | 1505 |
| 422 | Ga0157372_10460998 | 3300013307 | Bacteria | 1481 |
| 423 | Ga0157372_10539463 | 3300013307 | Bacteria | 1360 |
| 424 | Ga0157372_10579907 | 3300013307 | Bacteria | 1307 |
| 425 | Ga0157375_10000319 | 3300013308 | Bacteria | 43172 |
| 426 | Ga0157375_10288067 | 3300013308 | Bacteria | 1805 |
| 427 | Ga0163163_10000199 | 3300014325 | Bacteria | 62045 |
| 428 | Ga0182008_10003539 | 3300014497 | Bacteria | 9385 |
| 429 | Ga0182008_10003930 | 3300014497 | Bacteria | 8796 |
| 430 | Ga0157379_10195720 | 3300014968 | Bacteria | 1827 |
| 431 | Ga0157379_10294675 | 3300014968 | Bacteria | 1478 |
| 432 | Ga0157376_10009877 | 3300014969 | Bacteria | 6959 |
| 433 | Ga0157376_10237233 | 3300014969 | Bacteria | 1697 |
| 434 | Ga0182006_1002396 | 3300015261 | Bacteria | 10274 |
| 435 | Ga0182006_1052122 | 3300015261 | Bacteria | 1573 |
| 436 | Ga0182007_10001054 | 3300015262 | Bacteria | 15057 |
| 437 | Ga0182005_1003380 | 3300015265 | Bacteria | 5432 |
| 438 | Ga0182005_1004843 | 3300015265 | Bacteria | 4279 |
| 439 | Ga0182005_1025793 | 3300015265 | Bacteria | 1604 |
| 440 | Ga0183369_1007 | 3300015685 | Bacteria | 414878 |
| 441 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 442 | Ga0163161_10280668 | 3300017792 | Bacteria | 1306 |
| 443 | Ga0197907_10084022 | 3300020069 | Bacteria | 2821 |
| 444 | Ga0197907_10443089 | 3300020069 | Bacteria | 4382 |
| 445 | Ga0206356_10024670 | 3300020070 | Bacteria | 2608 |
| 446 | Ga0206356_10639948 | 3300020070 | Bacteria | 1943 |
| 447 | Ga0206356_10655197 | 3300020070 | Bacteria | 715 |
| 448 | Ga0206356_11779262 | 3300020070 | Bacteria | 5478 |
| 449 | Ga0206356_11818570 | 3300020070 | Bacteria | 1285 |
| 450 | Ga0206355_1541314 | 3300020076 | Bacteria | 1913 |
| 451 | Ga0206355_1560542 | 3300020076 | Bacteria | 3125 |
| 452 | Ga0206355_1639836 | 3300020076 | Bacteria | 706 |
| 453 | Ga0206351_10247550 | 3300020077 | Bacteria | 8297 |
| 454 | Ga0206351_10506122 | 3300020077 | Bacteria | 2882 |
| 455 | Ga0206351_10693657 | 3300020077 | Bacteria | 1599 |
| 456 | Ga0206352_10308657 | 3300020078 | Bacteria | 4543 |
| 457 | Ga0206352_10574827 | 3300020078 | Bacteria | 5420 |
| 458 | Ga0206352_11092907 | 3300020078 | Bacteria | 7966 |
| 459 | Ga0206350_10086102 | 3300020080 | Bacteria | 1796 |
| 460 | Ga0206350_10683875 | 3300020080 | Bacteria | 2041 |
| 461 | Ga0206350_10853760 | 3300020080 | Bacteria | 2011 |
| 462 | Ga0206354_10159778 | 3300020081 | Bacteria | 7584 |
| 463 | Ga0206354_10285212 | 3300020081 | Bacteria | 2038 |
| 464 | Ga0206354_11321677 | 3300020081 | Bacteria | 4513 |
| 465 | Ga0206353_10107238 | 3300020082 | Bacteria | 1261 |
| 466 | Ga0206353_10129542 | 3300020082 | Bacteria | 10452 |
| 467 | Ga0206353_10520420 | 3300020082 | Bacteria | 1360 |
| 468 | Ga0206353_11816607 | 3300020082 | Bacteria | 1971 |
| 469 | Ga0154015_1297936 | 3300020610 | Bacteria | 2015 |
| 470 | Ga0154015_1473023 | 3300020610 | Bacteria | 1243 |
| 471 | Ga0213876_10074788 | 3300021384 | Bacteria | 1789 |
| 472 | Ga0224712_10000264 | 3300022467 | Bacteria | 9608 |
| 473 | Ga0224712_10002283 | 3300022467 | Bacteria | 4695 |
| 474 | Ga0224712_10065857 | 3300022467 | Bacteria | 1457 |
| 475 | Ga0209760_100502 | 3300025207 | Bacteria | 8253 |
| 476 | Ga0209784_100167 | 3300025224 | Bacteria | 56563 |
| 477 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 478 | Ga0209674_100381 | 3300025226 | Bacteria | 23509 |
| 479 | Ga0209674_100632 | 3300025226 | Bacteria | 12783 |
| 480 | Ga0209674_101912 | 3300025226 | Bacteria | 4896 |
| 481 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 482 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 483 | Ga0209672_101110 | 3300025228 | Bacteria | 11367 |
| 484 | Ga0209672_101977 | 3300025228 | Bacteria | 5753 |
| 485 | Ga0209672_103560 | 3300025228 | Bacteria | 3172 |
| 486 | Ga0209147_109375 | 3300025229 | Bacteria | 1168 |
| 487 | Ga0209563_100103 | 3300025230 | Bacteria | 151835 |
| 488 | Ga0207427_100144 | 3300025231 | Bacteria | 82742 |
| 489 | Ga0207427_100209 | 3300025231 | Bacteria | 53322 |
| 490 | Ga0207427_100327 | 3300025231 | Bacteria | 31981 |
| 491 | Ga0207427_106521 | 3300025231 | Bacteria | 1470 |
| 492 | Ga0207427_108186 | 3300025231 | Bacteria | 1179 |
| 493 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 494 | Ga0209437_100193 | 3300025233 | Bacteria | 122027 |
| 495 | Ga0209437_100256 | 3300025233 | Bacteria | 82734 |
| 496 | Ga0209437_100465 | 3300025233 | Bacteria | 31828 |
| 497 | Ga0209437_101616 | 3300025233 | Bacteria | 5175 |
| 498 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 499 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 500 | Ga0209258_100149 | 3300025242 | Bacteria | 162184 |
| 501 | Ga0209258_100329 | 3300025242 | Bacteria | 71786 |
| 502 | Ga0209258_101240 | 3300025242 | Bacteria | 9825 |
| 503 | Ga0209258_105981 | 3300025242 | Bacteria | 1967 |
| 504 | Ga0209646_1000796 | 3300025246 | Bacteria | 10762 |
| 505 | Ga0209646_1002559 | 3300025246 | Bacteria | 3958 |
| 506 | Ga0209646_1009412 | 3300025246 | Bacteria | 1551 |
| 507 | Ga0209026_1000060 | 3300025250 | Bacteria | 220052 |
| 508 | Ga0209026_1000274 | 3300025250 | Bacteria | 61312 |
| 509 | Ga0209026_1000293 | 3300025250 | Bacteria | 55650 |
| 510 | Ga0209026_1000516 | 3300025250 | Bacteria | 27200 |
| 511 | Ga0209026_1001271 | 3300025250 | Bacteria | 11502 |
| 512 | Ga0209677_101383 | 3300025253 | Bacteria | 10556 |
| 513 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 514 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 515 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 516 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 517 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 518 | Ga0209148_1000143 | 3300025254 | Bacteria | 162184 |
| 519 | Ga0209148_1005039 | 3300025254 | Bacteria | 3098 |
| 520 | Ga0209759_1000658 | 3300025256 | Bacteria | 32027 |
| 521 | Ga0209759_1001361 | 3300025256 | Bacteria | 14147 |
| 522 | Ga0209759_1001919 | 3300025256 | Bacteria | 10178 |
| 523 | Ga0209759_1002020 | 3300025256 | Bacteria | 9629 |
| 524 | Ga0209759_1007648 | 3300025256 | Bacteria | 3450 |
| 525 | Ga0209759_1013219 | 3300025256 | Bacteria | 2245 |
| 526 | Ga0209129_1000835 | 3300025258 | Bacteria | 19351 |
| 527 | Ga0209129_1007534 | 3300025258 | Bacteria | 3218 |
| 528 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 529 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 530 | Ga0209233_1000151 | 3300025261 | Bacteria | 176515 |
| 531 | Ga0209233_1000920 | 3300025261 | Bacteria | 12852 |
| 532 | Ga0209233_1002051 | 3300025261 | Bacteria | 7633 |
| 533 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 534 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 535 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 536 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 537 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 538 | Ga0209676_1000156 | 3300025292 | Bacteria | 163255 |
| 539 | Ga0209758_1005974 | 3300025297 | Bacteria | 9015 |
| 540 | Ga0209758_1018540 | 3300025297 | Bacteria | 3403 |
| 541 | Ga0209758_1063731 | 3300025297 | Bacteria | 1199 |
| 542 | Ga0209256_1002932 | 3300025299 | Bacteria | 12813 |
| 543 | Ga0207426_1003716 | 3300025302 | Bacteria | 7977 |
| 544 | Ga0209051_1009647 | 3300025303 | Bacteria | 4953 |
| 545 | Ga0209257_1002665 | 3300025304 | Bacteria | 17133 |
| 546 | Ga0209257_1005259 | 3300025304 | Bacteria | 9234 |
| 547 | Ga0207656_10002597 | 3300025321 | Bacteria | 6106 |
| 548 | Ga0207710_10012607 | 3300025900 | Bacteria | 3557 |
| 549 | Ga0207680_10000013 | 3300025903 | Bacteria | 244716 |
| 550 | Ga0207680_10017400 | 3300025903 | Bacteria | 3798 |
| 551 | Ga0207680_10047575 | 3300025903 | Bacteria | 2542 |
| 552 | Ga0207680_10121264 | 3300025903 | Bacteria | 1710 |
| 553 | Ga0207647_10000287 | 3300025904 | Bacteria | 41379 |
| 554 | Ga0207647_10001185 | 3300025904 | Bacteria | 20073 |
| 555 | Ga0207647_10036662 | 3300025904 | Bacteria | 3114 |
| 556 | Ga0207647_10142461 | 3300025904 | Bacteria | 1404 |
| 557 | Ga0207647_10153788 | 3300025904 | Bacteria | 1344 |
| 558 | Ga0207645_10015789 | 3300025907 | Bacteria | 5006 |
| 559 | Ga0207643_10002762 | 3300025908 | Bacteria | 9490 |
| 560 | Ga0207705_10004273 | 3300025909 | Bacteria | 10819 |
| 561 | Ga0207705_10006472 | 3300025909 | Bacteria | 8676 |
| 562 | Ga0207705_10008046 | 3300025909 | Bacteria | 7728 |
| 563 | Ga0207705_10011179 | 3300025909 | Bacteria | 6507 |
| 564 | Ga0207705_10016228 | 3300025909 | Bacteria | 5342 |
| 565 | Ga0207705_10021621 | 3300025909 | Bacteria | 4591 |
| 566 | Ga0207705_10140190 | 3300025909 | Bacteria | 1805 |
| 567 | Ga0207654_10015953 | 3300025911 | Bacteria | 3907 |
| 568 | Ga0207654_10167430 | 3300025911 | Bacteria | 1424 |
| 569 | Ga0207654_10241064 | 3300025911 | Bacteria | 1208 |
| 570 | Ga0207654_10242254 | 3300025911 | Bacteria | 1206 |
| 571 | Ga0207654_10406694 | 3300025911 | Bacteria | 947 |
| 572 | Ga0207707_10000201 | 3300025912 | Bacteria | 63617 |
| 573 | Ga0207707_10000210 | 3300025912 | Bacteria | 62292 |
| 574 | Ga0207707_10001339 | 3300025912 | Bacteria | 22957 |
| 575 | Ga0207707_10006555 | 3300025912 | Bacteria | 10160 |
| 576 | Ga0207707_10007311 | 3300025912 | Bacteria | 9616 |
| 577 | Ga0207707_10007312 | 3300025912 | Bacteria | 9616 |
| 578 | Ga0207707_10010320 | 3300025912 | Bacteria | 8104 |
| 579 | Ga0207707_10044623 | 3300025912 | Bacteria | 3865 |
| 580 | Ga0207707_10134574 | 3300025912 | Bacteria | 2161 |
| 581 | Ga0207707_10162109 | 3300025912 | Bacteria | 1955 |
| 582 | Ga0207707_10236395 | 3300025912 | Bacteria | 1589 |
| 583 | Ga0207707_10306654 | 3300025912 | Bacteria | 1372 |
| 584 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 585 | Ga0207695_10000929 | 3300025913 | Bacteria | 52349 |
| 586 | Ga0207695_10004915 | 3300025913 | Bacteria | 18010 |
| 587 | Ga0207695_10006299 | 3300025913 | Bacteria | 15447 |
| 588 | Ga0207695_10007681 | 3300025913 | Bacteria | 13658 |
| 589 | Ga0207695_10016662 | 3300025913 | Bacteria | 8588 |
| 590 | Ga0207695_10022941 | 3300025913 | Bacteria | 7069 |
| 591 | Ga0207695_10030817 | 3300025913 | Bacteria | 5900 |
| 592 | Ga0207695_10033761 | 3300025913 | Bacteria | 5575 |
| 593 | Ga0207695_10061446 | 3300025913 | Bacteria | 3883 |
| 594 | Ga0207695_10197455 | 3300025913 | Bacteria | 1928 |
| 595 | Ga0207671_10000021 | 3300025914 | Bacteria | 300409 |
| 596 | Ga0207671_10001518 | 3300025914 | Bacteria | 26689 |
| 597 | Ga0207671_10002946 | 3300025914 | Bacteria | 17539 |
| 598 | Ga0207671_10006022 | 3300025914 | Bacteria | 10957 |
| 599 | Ga0207663_10290291 | 3300025916 | Bacteria | 1218 |
| 600 | Ga0207660_10000360 | 3300025917 | Bacteria | 29709 |
| 601 | Ga0207660_10009553 | 3300025917 | Bacteria | 6278 |
| 602 | Ga0207660_10034473 | 3300025917 | Bacteria | 3509 |
| 603 | Ga0207660_10060242 | 3300025917 | Bacteria | 2728 |
| 604 | Ga0207660_10116424 | 3300025917 | Bacteria | 2019 |
| 605 | Ga0207660_10337796 | 3300025917 | Bacteria | 1205 |
| 606 | Ga0207657_10006384 | 3300025919 | Bacteria | 12243 |
| 607 | Ga0207657_10057043 | 3300025919 | Bacteria | 3368 |
| 608 | Ga0207657_10074690 | 3300025919 | Bacteria | 2862 |
| 609 | Ga0207657_10343007 | 3300025919 | Bacteria | 1179 |
| 610 | Ga0207649_10002213 | 3300025920 | Bacteria | 10987 |
| 611 | Ga0207649_10026295 | 3300025920 | Bacteria | 3403 |
| 612 | Ga0207649_10062358 | 3300025920 | Bacteria | 2350 |
| 613 | Ga0207649_10071942 | 3300025920 | Bacteria | 2211 |
| 614 | Ga0207649_10077310 | 3300025920 | Bacteria | 2144 |
| 615 | Ga0207649_10084893 | 3300025920 | Bacteria | 2059 |
| 616 | Ga0207649_10131195 | 3300025920 | Bacteria | 1702 |
| 617 | Ga0207652_10002222 | 3300025921 | Bacteria | 16561 |
| 618 | Ga0207652_10004193 | 3300025921 | Bacteria | 11761 |
| 619 | Ga0207652_10005745 | 3300025921 | Bacteria | 10069 |
| 620 | Ga0207652_10011010 | 3300025921 | Bacteria | 7292 |
| 621 | Ga0207652_10013571 | 3300025921 | Bacteria | 6590 |
| 622 | Ga0207652_10083627 | 3300025921 | Bacteria | 2795 |
| 623 | Ga0207652_10088092 | 3300025921 | Bacteria | 2723 |
| 624 | Ga0207652_10139058 | 3300025921 | Bacteria | 2170 |
| 625 | Ga0207652_10348434 | 3300025921 | Bacteria | 1337 |
| 626 | Ga0207681_10003213 | 3300025923 | Bacteria | 10254 |
| 627 | Ga0207681_10019048 | 3300025923 | Bacteria | 4332 |
| 628 | Ga0207681_10237385 | 3300025923 | Bacteria | 1417 |
| 629 | Ga0207694_10002856 | 3300025924 | Bacteria | 13931 |
| 630 | Ga0207694_10007041 | 3300025924 | Bacteria | 8537 |
| 631 | Ga0207694_10007300 | 3300025924 | Bacteria | 8385 |
| 632 | Ga0207694_10007361 | 3300025924 | Bacteria | 8349 |
| 633 | Ga0207694_10017922 | 3300025924 | Bacteria | 5353 |
| 634 | Ga0207694_10024129 | 3300025924 | Bacteria | 4618 |
| 635 | Ga0207694_10025532 | 3300025924 | Bacteria | 4490 |
| 636 | Ga0207694_10136700 | 3300025924 | Bacteria | 1969 |
| 637 | Ga0207694_10356162 | 3300025924 | Bacteria | 1212 |
| 638 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 639 | Ga0207650_10017618 | 3300025925 | Bacteria | 5002 |
| 640 | Ga0207650_10364379 | 3300025925 | Bacteria | 1191 |
| 641 | Ga0207650_11498080 | 3300025925 | Bacteria | 573 |
| 642 | Ga0207659_10668538 | 3300025926 | Bacteria | 888 |
| 643 | Ga0207700_10029599 | 3300025928 | Bacteria | 3866 |
| 644 | Ga0207664_10001884 | 3300025929 | Bacteria | 13792 |
| 645 | Ga0207664_10384621 | 3300025929 | Bacteria | 1246 |
| 646 | Ga0207644_10000407 | 3300025931 | Bacteria | 28083 |
| 647 | Ga0207644_10339419 | 3300025931 | Bacteria | 1218 |
| 648 | Ga0207690_10000291 | 3300025932 | Bacteria | 35587 |
| 649 | Ga0207690_10003289 | 3300025932 | Bacteria | 9676 |
| 650 | Ga0207690_10003907 | 3300025932 | Bacteria | 8813 |
| 651 | Ga0207690_10024945 | 3300025932 | Bacteria | 3748 |
| 652 | Ga0207690_10202513 | 3300025932 | Bacteria | 1508 |
| 653 | Ga0207690_10283601 | 3300025932 | Bacteria | 1291 |
| 654 | Ga0207690_10351539 | 3300025932 | Bacteria | 1165 |
| 655 | Ga0207706_10006252 | 3300025933 | Bacteria | 11069 |
| 656 | Ga0207706_10015708 | 3300025933 | Bacteria | 6844 |
| 657 | Ga0207706_10048500 | 3300025933 | Bacteria | 3756 |
| 658 | Ga0207706_10445569 | 3300025933 | Bacteria | 1120 |
| 659 | Ga0207686_10005014 | 3300025934 | Bacteria | 7128 |
| 660 | Ga0207686_10168209 | 3300025934 | Bacteria | 1543 |
| 661 | Ga0207686_10533979 | 3300025934 | Bacteria | 915 |
| 662 | Ga0207686_10637041 | 3300025934 | Bacteria | 842 |
| 663 | Ga0207670_10008334 | 3300025936 | Bacteria | 5845 |
| 664 | Ga0207670_10080551 | 3300025936 | Bacteria | 2276 |
| 665 | Ga0207669_10121793 | 3300025937 | Bacteria | 1773 |
| 666 | Ga0207704_10014528 | 3300025938 | Bacteria | 3978 |
| 667 | Ga0207704_10139958 | 3300025938 | Bacteria | 1691 |
| 668 | Ga0207704_10736119 | 3300025938 | Bacteria | 819 |
| 669 | Ga0207665_10044771 | 3300025939 | Bacteria | 2961 |
| 670 | Ga0207691_10046504 | 3300025940 | Bacteria | 3988 |
| 671 | Ga0207691_10247272 | 3300025940 | Bacteria | 1540 |
| 672 | Ga0207691_10418010 | 3300025940 | Bacteria | 1143 |
| 673 | Ga0207711_10000194 | 3300025941 | Bacteria | 65127 |
| 674 | Ga0207711_10239286 | 3300025941 | Bacteria | 1664 |
| 675 | Ga0207689_10139586 | 3300025942 | Bacteria | 1996 |
| 676 | Ga0207689_10227291 | 3300025942 | Bacteria | 1542 |
| 677 | Ga0207689_10339989 | 3300025942 | Bacteria | 1247 |
| 678 | Ga0207661_10004252 | 3300025944 | Bacteria | 10024 |
| 679 | Ga0207661_10416042 | 3300025944 | Bacteria | 1220 |
| 680 | Ga0207679_10007471 | 3300025945 | Bacteria | 6936 |
| 681 | Ga0207679_10372719 | 3300025945 | Bacteria | 1250 |
| 682 | Ga0207667_10008135 | 3300025949 | Bacteria | 12489 |
| 683 | Ga0207667_10008758 | 3300025949 | Bacteria | 11990 |
| 684 | Ga0207667_10009904 | 3300025949 | Bacteria | 11181 |
| 685 | Ga0207667_10010803 | 3300025949 | Bacteria | 10649 |
| 686 | Ga0207667_10012000 | 3300025949 | Bacteria | 10029 |
| 687 | Ga0207667_10054383 | 3300025949 | Bacteria | 4211 |
| 688 | Ga0207667_10056014 | 3300025949 | Bacteria | 4143 |
| 689 | Ga0207667_10084170 | 3300025949 | Bacteria | 3293 |
| 690 | Ga0207667_10085023 | 3300025949 | Bacteria | 3275 |
| 691 | Ga0207667_10088884 | 3300025949 | Bacteria | 3194 |
| 692 | Ga0207667_10155106 | 3300025949 | Bacteria | 2356 |
| 693 | Ga0207667_10179967 | 3300025949 | Bacteria | 2171 |
| 694 | Ga0207667_10444848 | 3300025949 | Bacteria | 1317 |
| 695 | Ga0207667_10491212 | 3300025949 | Bacteria | 1246 |
| 696 | Ga0207712_10002403 | 3300025961 | Bacteria | 12126 |
| 697 | Ga0207712_10480063 | 3300025961 | Bacteria | 1059 |
| 698 | Ga0207712_10672862 | 3300025961 | Bacteria | 901 |
| 699 | Ga0207668_10008346 | 3300025972 | Bacteria | 6168 |
| 700 | Ga0207668_10014483 | 3300025972 | Bacteria | 4881 |
| 701 | Ga0207640_10002025 | 3300025981 | Bacteria | 10946 |
| 702 | Ga0207640_10003058 | 3300025981 | Bacteria | 9010 |
| 703 | Ga0207640_10004259 | 3300025981 | Bacteria | 7741 |
| 704 | Ga0207640_10014285 | 3300025981 | Bacteria | 4568 |
| 705 | Ga0207640_10045068 | 3300025981 | Bacteria | 2830 |
| 706 | Ga0207640_10650367 | 3300025981 | Bacteria | 898 |
| 707 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 708 | Ga0207658_10012048 | 3300025986 | Bacteria | 5899 |
| 709 | Ga0207658_10176384 | 3300025986 | Bacteria | 1765 |
| 710 | Ga0207677_10020677 | 3300026023 | Bacteria | 4002 |
| 711 | Ga0207677_10046562 | 3300026023 | Bacteria | 2905 |
| 712 | Ga0207677_11696389 | 3300026023 | Bacteria | 586 |
| 713 | Ga0207703_10001653 | 3300026035 | Bacteria | 20041 |
| 714 | Ga0207703_10020068 | 3300026035 | Bacteria | 5223 |
| 715 | Ga0207703_10050143 | 3300026035 | Bacteria | 3377 |
| 716 | Ga0207703_10064862 | 3300026035 | Bacteria | 2999 |
| 717 | Ga0207703_10616510 | 3300026035 | Bacteria | 1027 |
| 718 | Ga0207639_10000231 | 3300026041 | Bacteria | 41634 |
| 719 | Ga0207639_10000682 | 3300026041 | Bacteria | 23440 |
| 720 | Ga0207639_10008268 | 3300026041 | Bacteria | 7129 |
| 721 | Ga0207639_10018424 | 3300026041 | Bacteria | 4960 |
| 722 | Ga0207639_10064484 | 3300026041 | Bacteria | 2840 |
| 723 | Ga0207639_10084682 | 3300026041 | Bacteria | 2519 |
| 724 | Ga0207639_10179218 | 3300026041 | Bacteria | 1801 |
| 725 | Ga0207639_10314789 | 3300026041 | Bacteria | 1388 |
| 726 | Ga0207639_10733139 | 3300026041 | Bacteria | 918 |
| 727 | Ga0207678_10018442 | 3300026067 | Bacteria | 6128 |
| 728 | Ga0207678_10020001 | 3300026067 | Bacteria | 5884 |
| 729 | Ga0207678_10030274 | 3300026067 | Bacteria | 4725 |
| 730 | Ga0207678_10056807 | 3300026067 | Bacteria | 3368 |
| 731 | Ga0207678_10067734 | 3300026067 | Bacteria | 3064 |
| 732 | Ga0207678_10267753 | 3300026067 | Bacteria | 1465 |
| 733 | Ga0207678_10278107 | 3300026067 | Bacteria | 1436 |
| 734 | Ga0207708_10416837 | 3300026075 | Bacteria | 1113 |
| 735 | Ga0207702_10000517 | 3300026078 | Bacteria | 43478 |
| 736 | Ga0207702_10000852 | 3300026078 | Bacteria | 31897 |
| 737 | Ga0207702_10004420 | 3300026078 | Bacteria | 12499 |
| 738 | Ga0207702_10007160 | 3300026078 | Bacteria | 9546 |
| 739 | Ga0207702_10011901 | 3300026078 | Bacteria | 7239 |
| 740 | Ga0207702_10012283 | 3300026078 | Bacteria | 7129 |
| 741 | Ga0207702_10022553 | 3300026078 | Bacteria | 5220 |
| 742 | Ga0207702_10061145 | 3300026078 | Bacteria | 3212 |
| 743 | Ga0207702_10289094 | 3300026078 | Bacteria | 1552 |
| 744 | Ga0207641_10003553 | 3300026088 | Bacteria | 13779 |
| 745 | Ga0207641_10092132 | 3300026088 | Bacteria | 2654 |
| 746 | Ga0207648_10027626 | 3300026089 | Bacteria | 5037 |
| 747 | Ga0207648_10648182 | 3300026089 | Bacteria | 976 |
| 748 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 749 | Ga0207674_10017287 | 3300026116 | Bacteria | 7869 |
| 750 | Ga0207674_10077617 | 3300026116 | Bacteria | 3327 |
| 751 | Ga0207674_10160707 | 3300026116 | Bacteria | 2201 |
| 752 | Ga0207675_100561141 | 3300026118 | Bacteria | 1142 |
| 753 | Ga0207683_10022992 | 3300026121 | Bacteria | 5358 |
| 754 | Ga0207683_10167755 | 3300026121 | Bacteria | 1987 |
| 755 | Ga0207698_10003169 | 3300026142 | Bacteria | 9865 |
| 756 | Ga0207698_10003897 | 3300026142 | Bacteria | 9037 |
| 757 | Ga0207698_10007267 | 3300026142 | Bacteria | 6940 |
| 758 | Ga0207698_10433276 | 3300026142 | Bacteria | 1265 |
| 759 | Ga0207698_10572761 | 3300026142 | Bacteria | 1110 |
| 760 | Ga0209968_1003164 | 3300027526 | Bacteria | 2469 |
| 761 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 762 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 763 | Ga0268266_10002538 | 3300028379 | Bacteria | 19391 |
| 764 | Ga0268266_10019459 | 3300028379 | Bacteria | 5783 |
| 765 | Ga0268266_10091837 | 3300028379 | Bacteria | 2663 |
| 766 | Ga0268264_10000036 | 3300028381 | Bacteria | 392994 |
| 767 | Ga0268264_10027927 | 3300028381 | Bacteria | 4613 |
| 768 | Ga0268264_10063633 | 3300028381 | Bacteria | 3102 |
| 769 | Ga0268264_10133979 | 3300028381 | Bacteria | 2200 |
| 770 | Ga0268264_10727706 | 3300028381 | Bacteria | 987 |
| 771 | Ga0307517_10316954 | 3300028786 | Bacteria | 865 |
| 772 | Ga0307515_10335996 | 3300028794 | Bacteria | 1166 |
| 773 | Ga0265338_10503888 | 3300028800 | Bacteria | 852 |
| 774 | Ga0314311_1173220 | 3300030733 | Bacteria | 1625 |
| 775 | Ga0316181_1145493 | 3300030744 | Bacteria | 1410 |
| 776 | Ga0265769_100367 | 3300030888 | Bacteria | 1795 |
| 777 | Ga0265774_100129 | 3300031011 | Bacteria | 1976 |
| 778 | Ga0265327_10001935 | 3300031251 | Bacteria | 23890 |
| 779 | Ga0307513_10184360 | 3300031456 | Bacteria | 1946 |
| 780 | Ga0307509_10056806 | 3300031507 | Bacteria | 4153 |
| 781 | Ga0307408_100777522 | 3300031548 | Bacteria | 867 |
| 782 | Ga0307508_10021298 | 3300031616 | Bacteria | 5893 |
| 783 | Ga0316575_10001471 | 3300031665 | Bacteria | 7589 |
| 784 | Ga0316575_10001575 | 3300031665 | Bacteria | 7413 |
| 785 | Ga0316575_10022019 | 3300031665 | Bacteria | 2457 |
| 786 | Ga0316575_10110112 | 3300031665 | Bacteria | 1123 |
| 787 | Ga0316575_10173510 | 3300031665 | Bacteria | 894 |
| 788 | Ga0316575_10223552 | 3300031665 | Bacteria | 786 |
| 789 | Ga0316575_10259099 | 3300031665 | Bacteria | 730 |
| 790 | Ga0316579_10000104 | 3300031691 | Bacteria | 22526 |
| 791 | Ga0316579_10001358 | 3300031691 | Bacteria | 8860 |
| 792 | Ga0316579_10007523 | 3300031691 | Bacteria | 4503 |
| 793 | Ga0316579_10021848 | 3300031691 | Bacteria | 2856 |
| 794 | Ga0316579_10033831 | 3300031691 | Bacteria | 2349 |
| 795 | Ga0316579_10073131 | 3300031691 | Bacteria | 1626 |
| 796 | Ga0316579_10099546 | 3300031691 | Bacteria | 1392 |
| 797 | Ga0316579_10123468 | 3300031691 | Bacteria | 1245 |
| 798 | Ga0316579_10126602 | 3300031691 | Bacteria | 1229 |
| 799 | Ga0316579_10168312 | 3300031691 | Bacteria | 1059 |
| 800 | Ga0316579_10199082 | 3300031691 | Bacteria | 969 |
| 801 | Ga0316579_10222222 | 3300031691 | Bacteria | 913 |
| 802 | Ga0316579_10334875 | 3300031691 | Bacteria | 732 |
| 803 | Ga0316579_10442230 | 3300031691 | Bacteria | 629 |
| 804 | Ga0316576_10000067 | 3300031727 | Bacteria | 34602 |
| 805 | Ga0316576_10000685 | 3300031727 | Bacteria | 16585 |
| 806 | Ga0316576_10002694 | 3300031727 | Bacteria | 10159 |
| 807 | Ga0316576_10008136 | 3300031727 | Bacteria | 6658 |
| 808 | Ga0316576_10009807 | 3300031727 | Bacteria | 6198 |
| 809 | Ga0316576_10012044 | 3300031727 | Bacteria | 5699 |
| 810 | Ga0316576_10046086 | 3300031727 | Bacteria | 3155 |
| 811 | Ga0316576_10057546 | 3300031727 | Bacteria | 2841 |
| 812 | Ga0316576_10058855 | 3300031727 | Bacteria | 2811 |
| 813 | Ga0316576_10073603 | 3300031727 | Bacteria | 2524 |
| 814 | Ga0316576_10080384 | 3300031727 | Bacteria | 2417 |
| 815 | Ga0316576_10153651 | 3300031727 | Bacteria | 1734 |
| 816 | Ga0316576_10250068 | 3300031727 | Bacteria | 1331 |
| 817 | Ga0316576_10739190 | 3300031727 | Bacteria | 711 |
| 818 | Ga0316578_10000046 | 3300031728 | Bacteria | 25015 |
| 819 | Ga0316578_10000445 | 3300031728 | Bacteria | 13704 |
| 820 | Ga0316578_10001214 | 3300031728 | Bacteria | 10228 |
| 821 | Ga0316578_10005380 | 3300031728 | Bacteria | 6199 |
| 822 | Ga0316578_10010128 | 3300031728 | Bacteria | 4880 |
| 823 | Ga0316578_10014712 | 3300031728 | Bacteria | 4188 |
| 824 | Ga0316578_10030514 | 3300031728 | Bacteria | 3065 |
| 825 | Ga0316578_10035854 | 3300031728 | Bacteria | 2853 |
| 826 | Ga0316578_10039294 | 3300031728 | Bacteria | 2733 |
| 827 | Ga0316578_10096296 | 3300031728 | Bacteria | 1771 |
| 828 | Ga0316578_10105330 | 3300031728 | Bacteria | 1692 |
| 829 | Ga0316578_10278143 | 3300031728 | Bacteria | 1002 |
| 830 | Ga0316578_10281959 | 3300031728 | Bacteria | 995 |
| 831 | Ga0316578_10331755 | 3300031728 | Bacteria | 907 |
| 832 | Ga0316578_10354127 | 3300031728 | Bacteria | 873 |
| 833 | Ga0316578_10497458 | 3300031728 | Bacteria | 718 |
| 834 | Ga0307516_10039946 | 3300031730 | Bacteria | 4673 |
| 835 | Ga0307405_10201273 | 3300031731 | Bacteria | 1446 |
| 836 | Ga0307405_10341485 | 3300031731 | Bacteria | 1151 |
| 837 | Ga0316577_10000967 | 3300031733 | Bacteria | 12817 |
| 838 | Ga0316577_10001071 | 3300031733 | Bacteria | 12388 |
| 839 | Ga0316577_10001498 | 3300031733 | Bacteria | 11066 |
| 840 | Ga0316577_10043034 | 3300031733 | Bacteria | 2527 |
| 841 | Ga0316577_10048675 | 3300031733 | Bacteria | 2367 |
| 842 | Ga0316577_10166102 | 3300031733 | Bacteria | 1245 |
| 843 | Ga0316577_10289226 | 3300031733 | Bacteria | 928 |
| 844 | Ga0307413_10160065 | 3300031824 | Bacteria | 1580 |
| 845 | Ga0307413_10324325 | 3300031824 | Bacteria | 1178 |
| 846 | Ga0307413_10433074 | 3300031824 | Bacteria | 1039 |
| 847 | Ga0307410_10100991 | 3300031852 | Bacteria | 2067 |
| 848 | Ga0307406_10648989 | 3300031901 | Bacteria | 876 |
| 849 | Ga0307406_11018893 | 3300031901 | Bacteria | 711 |
| 850 | Ga0307412_10006594 | 3300031911 | Bacteria | 6572 |
| 851 | Ga0307412_10048919 | 3300031911 | Bacteria | 2783 |
| 852 | Ga0307412_10387198 | 3300031911 | Bacteria | 1134 |
| 853 | Ga0307412_10457968 | 3300031911 | Bacteria | 1052 |
| 854 | Ga0307412_10500367 | 3300031911 | Bacteria | 1012 |
| 855 | Ga0307414_10002120 | 3300032004 | Bacteria | 10346 |
| 856 | Ga0307414_10107201 | 3300032004 | Bacteria | 2116 |
| 857 | Ga0307414_10117264 | 3300032004 | Bacteria | 2039 |
| 858 | Ga0307414_10185571 | 3300032004 | Bacteria | 1677 |
| 859 | Ga0307414_10198263 | 3300032004 | Bacteria | 1630 |
| 860 | Ga0307414_10542215 | 3300032004 | Bacteria | 1035 |
| 861 | Ga0307411_10026673 | 3300032005 | Bacteria | 3482 |
| 862 | Ga0307411_10250818 | 3300032005 | Bacteria | 1391 |
| 863 | Ga0316583_10013754 | 3300032133 | Bacteria | 2920 |
| 864 | Ga0316583_10033434 | 3300032133 | Bacteria | 1826 |
| 865 | Ga0316583_10126770 | 3300032133 | Bacteria | 890 |
| 866 | Ga0316585_10000029 | 3300032137 | Bacteria | 21513 |
| 867 | Ga0316585_10030248 | 3300032137 | Bacteria | 1698 |
| 868 | Ga0316585_10056692 | 3300032137 | Bacteria | 1261 |
| 869 | Ga0316580_10000016 | 3300032139 | Bacteria | 26098 |
| 870 | Ga0316580_10000485 | 3300032139 | Bacteria | 9163 |
| 871 | Ga0316580_10001102 | 3300032139 | Bacteria | 6814 |
| 872 | Ga0316580_10002303 | 3300032139 | Bacteria | 5235 |
| 873 | Ga0316580_10015143 | 3300032139 | Bacteria | 2357 |
| 874 | Ga0316580_10020143 | 3300032139 | Bacteria | 2053 |
| 875 | Ga0316580_10023239 | 3300032139 | Bacteria | 1914 |
| 876 | Ga0316593_10000027 | 3300032168 | Bacteria | 15426 |
| 877 | Ga0316593_10000041 | 3300032168 | Bacteria | 14110 |
| 878 | Ga0316593_10000090 | 3300032168 | Bacteria | 11405 |
| 879 | Ga0316593_10000096 | 3300032168 | Bacteria | 11298 |
| 880 | Ga0316593_10000111 | 3300032168 | Bacteria | 10694 |
| 881 | Ga0316593_10000164 | 3300032168 | Bacteria | 9718 |
| 882 | Ga0316593_10000167 | 3300032168 | Bacteria | 9674 |
| 883 | Ga0316593_10000198 | 3300032168 | Bacteria | 9333 |
| 884 | Ga0316593_10000257 | 3300032168 | Bacteria | 8797 |
| 885 | Ga0316593_10000387 | 3300032168 | Bacteria | 7860 |
| 886 | Ga0316593_10000468 | 3300032168 | Bacteria | 7436 |
| 887 | Ga0316593_10000658 | 3300032168 | Bacteria | 6651 |
| 888 | Ga0316593_10001014 | 3300032168 | Bacteria | 5811 |
| 889 | Ga0316593_10001237 | 3300032168 | Bacteria | 5509 |
| 890 | Ga0316593_10001899 | 3300032168 | Bacteria | 4793 |
| 891 | Ga0316593_10002120 | 3300032168 | Bacteria | 4614 |
| 892 | Ga0316593_10002233 | 3300032168 | Bacteria | 4536 |
| 893 | Ga0316593_10003521 | 3300032168 | Bacteria | 3902 |
| 894 | Ga0316593_10004460 | 3300032168 | Bacteria | 3596 |
| 895 | Ga0316593_10004774 | 3300032168 | Bacteria | 3515 |
| 896 | Ga0316593_10004838 | 3300032168 | Bacteria | 3500 |
| 897 | Ga0316593_10005257 | 3300032168 | Bacteria | 3398 |
| 898 | Ga0316593_10007634 | 3300032168 | Bacteria | 2976 |
| 899 | Ga0316593_10009083 | 3300032168 | Bacteria | 2795 |
| 900 | Ga0316593_10010662 | 3300032168 | Bacteria | 2645 |
| 901 | Ga0316593_10012641 | 3300032168 | Bacteria | 2482 |
| 902 | Ga0316593_10020416 | 3300032168 | Bacteria | 2060 |
| 903 | Ga0316593_10021147 | 3300032168 | Bacteria | 2031 |
| 904 | Ga0316593_10033972 | 3300032168 | Bacteria | 1672 |
| 905 | Ga0316593_10036608 | 3300032168 | Bacteria | 1619 |
| 906 | Ga0316593_10038503 | 3300032168 | Bacteria | 1583 |
| 907 | Ga0316593_10058087 | 3300032168 | Bacteria | 1318 |
| 908 | Ga0316593_10058691 | 3300032168 | Bacteria | 1312 |
| 909 | Ga0316593_10069942 | 3300032168 | Bacteria | 1213 |
| 910 | Ga0316593_10074396 | 3300032168 | Unclassified | 1178 |
| 911 | Ga0316593_10076354 | 3300032168 | Bacteria | 1164 |
| 912 | Ga0316593_10094633 | 3300032168 | Bacteria | 1054 |
| 913 | Ga0316593_10096431 | 3300032168 | Bacteria | 1045 |
| 914 | Ga0316593_10104508 | 3300032168 | Bacteria | 1007 |
| 915 | Ga0307507_10039101 | 3300033179 | Bacteria | 4794 |
| 916 | Ga0307510_10002916 | 3300033180 | Bacteria | 19686 |
| 917 | Ga0316592_1000006 | 3300033524 | Bacteria | 14706 |
| 918 | Ga0316592_1000008 | 3300033524 | Bacteria | 14268 |
| 919 | Ga0316592_1000011 | 3300033524 | Bacteria | 13521 |
| 920 | Ga0316592_1000041 | 3300033524 | Bacteria | 10240 |
| 921 | Ga0316592_1000052 | 3300033524 | Bacteria | 9955 |
| 922 | Ga0316592_1000138 | 3300033524 | Bacteria | 8013 |
| 923 | Ga0316592_1000366 | 3300033524 | Bacteria | 5983 |
| 924 | Ga0316592_1000376 | 3300033524 | Bacteria | 5927 |
| 925 | Ga0316592_1000599 | 3300033524 | Bacteria | 5204 |
| 926 | Ga0316592_1000948 | 3300033524 | Bacteria | 4447 |
| 927 | Ga0316592_1004104 | 3300033524 | Bacteria | 2683 |
| 928 | Ga0316592_1006795 | 3300033524 | Bacteria | 2215 |
| 929 | Ga0316592_1008079 | 3300033524 | Bacteria | 2068 |
| 930 | Ga0316592_1012592 | 3300033524 | Bacteria | 1736 |
| 931 | Ga0316592_1014409 | 3300033524 | Bacteria | 1640 |
| 932 | Ga0316592_1017527 | 3300033524 | Bacteria | 1503 |
| 933 | Ga0316592_1018461 | 3300033524 | Bacteria | 1469 |
| 934 | Ga0316592_1056512 | 3300033524 | Bacteria | 879 |
| 935 | Ga0316586_1000040 | 3300033527 | Bacteria | 8841 |
| 936 | Ga0316586_1000064 | 3300033527 | Bacteria | 7843 |
| 937 | Ga0316586_1000155 | 3300033527 | Bacteria | 5568 |
| 938 | Ga0316586_1000334 | 3300033527 | Bacteria | 4367 |
| 939 | Ga0316586_1001184 | 3300033527 | Bacteria | 2882 |
| 940 | Ga0316586_1006567 | 3300033527 | Bacteria | 1671 |
| 941 | Ga0316586_1007742 | 3300033527 | Bacteria | 1573 |
| 942 | Ga0316586_1010816 | 3300033527 | Bacteria | 1389 |
| 943 | Ga0316586_1010956 | 3300033527 | Bacteria | 1382 |
| 944 | Ga0316586_1013729 | 3300033527 | Bacteria | 1271 |
| 945 | Ga0316586_1032370 | 3300033527 | Bacteria | 900 |
| 946 | Ga0316586_1037859 | 3300033527 | Unclassified | 841 |
| 947 | Ga0316586_1056268 | 3300033527 | Bacteria | 710 |
| 948 | Ga0316588_1000073 | 3300033528 | Bacteria | 8863 |
| 949 | Ga0316588_1000195 | 3300033528 | Bacteria | 6976 |
| 950 | Ga0316588_1000407 | 3300033528 | Bacteria | 5694 |
| 951 | Ga0316588_1000735 | 3300033528 | Bacteria | 4837 |
| 952 | Ga0316588_1001039 | 3300033528 | Bacteria | 4362 |
| 953 | Ga0316588_1001345 | 3300033528 | Bacteria | 3987 |
| 954 | Ga0316588_1001652 | 3300033528 | Bacteria | 3720 |
| 955 | Ga0316588_1003314 | 3300033528 | Bacteria | 2921 |
| 956 | Ga0316588_1009002 | 3300033528 | Bacteria | 2071 |
| 957 | Ga0316588_1015255 | 3300033528 | Bacteria | 1690 |
| 958 | Ga0316588_1026611 | 3300033528 | Bacteria | 1340 |
| 959 | Ga0316588_1030773 | 3300033528 | Bacteria | 1259 |
| 960 | Ga0316588_1061324 | 3300033528 | Bacteria | 918 |
| 961 | Ga0316588_1122815 | 3300033528 | Bacteria | 658 |
| 962 | Ga0316587_1000021 | 3300033529 | Bacteria | 9386 |
| 963 | Ga0316587_1000416 | 3300033529 | Bacteria | 4200 |
| 964 | Ga0316587_1000541 | 3300033529 | Bacteria | 3919 |
| 965 | Ga0316587_1000717 | 3300033529 | Bacteria | 3603 |
| 966 | Ga0316587_1003352 | 3300033529 | Bacteria | 2236 |
| 967 | Ga0316587_1003517 | 3300033529 | Bacteria | 2204 |
| 968 | Ga0316587_1007661 | 3300033529 | Bacteria | 1681 |
| 969 | Ga0316587_1008511 | 3300033529 | Bacteria | 1613 |
| 970 | Ga0316587_1010910 | 3300033529 | Bacteria | 1459 |
| 971 | Ga0316587_1025000 | 3300033529 | Bacteria | 1036 |
| 972 | Ga0316587_1071352 | 3300033529 | Bacteria | 650 |
| 973 | Ga0316587_1083978 | 3300033529 | Bacteria | 604 |
| 974 | Ga0316596_1000013 | 3300033541 | Bacteria | 16477 |
| 975 | Ga0316596_1000014 | 3300033541 | Bacteria | 16366 |
| 976 | Ga0316596_1000016 | 3300033541 | Bacteria | 15149 |
| 977 | Ga0316596_1000028 | 3300033541 | Bacteria | 14394 |
| 978 | Ga0316596_1000038 | 3300033541 | Bacteria | 13809 |
| 979 | Ga0316596_1000064 | 3300033541 | Bacteria | 12159 |
| 980 | Ga0316596_1000073 | 3300033541 | Bacteria | 11690 |
| 981 | Ga0316596_1000123 | 3300033541 | Bacteria | 10193 |
| 982 | Ga0316596_1000530 | 3300033541 | Bacteria | 6566 |
| 983 | Ga0316596_1000650 | 3300033541 | Bacteria | 6228 |
| 984 | Ga0316596_1000651 | 3300033541 | Bacteria | 6226 |
| 985 | Ga0316596_1001457 | 3300033541 | Bacteria | 4782 |
| 986 | Ga0316596_1002088 | 3300033541 | Bacteria | 4213 |
| 987 | Ga0316596_1003277 | 3300033541 | Bacteria | 3527 |
| 988 | Ga0316596_1004904 | 3300033541 | Bacteria | 3027 |
| 989 | Ga0316596_1005186 | 3300033541 | Bacteria | 2968 |
| 990 | Ga0316596_1005400 | 3300033541 | Bacteria | 2918 |
| 991 | Ga0316596_1005567 | 3300033541 | Bacteria | 2883 |
| 992 | Ga0316596_1007005 | 3300033541 | Bacteria | 2648 |
| 993 | Ga0316596_1007149 | 3300033541 | Bacteria | 2629 |
| 994 | Ga0316596_1009658 | 3300033541 | Bacteria | 2317 |
| 995 | Ga0316596_1010023 | 3300033541 | Bacteria | 2285 |
| 996 | Ga0316596_1011868 | 3300033541 | Bacteria | 2137 |
| 997 | Ga0316596_1017275 | 3300033541 | Bacteria | 1813 |
| 998 | Ga0316596_1020570 | 3300033541 | Bacteria | 1679 |
| 999 | Ga0316596_1035745 | 3300033541 | Bacteria | 1298 |
| 1000 | Ga0316596_1053390 | 3300033541 | Bacteria | 1072 |
| 1001 | Ga0316596_1056384 | 3300033541 | Bacteria | 1044 |
| 1002 | Ga0316596_1114463 | 3300033541 | Bacteria | 733 |
| 1003 | Ga0373950_0119981 | 3300034818 | Bacteria | 581 |
| 1004 | Ga0373958_0046938 | 3300034819 | Bacteria | 901 |
| 1005 | Ga0373944_0040350 | 3300035089 | Bacteria | 1440 |
| 1006 | Ga0373946_0094781 | 3300035171 | Bacteria | 1329 |
| 1007 | Ga0316574_0000016 | 3300035398 | Bacteria | 41302 |
| 1008 | Ga0316574_0000085 | 3300035398 | Bacteria | 26529 |
| 1009 | Ga0316574_0005225 | 3300035398 | Bacteria | 6904 |
| 1010 | Ga0316574_0005612 | 3300035398 | Bacteria | 6707 |
| 1011 | Ga0316574_0009540 | 3300035398 | Bacteria | 5440 |
| 1012 | Ga0316574_0030582 | 3300035398 | Bacteria | 3262 |
| 1013 | Ga0316574_0038164 | 3300035398 | Bacteria | 2948 |
| 1014 | Ga0316574_0038892 | 3300035398 | Bacteria | 2922 |
| 1015 | Ga0316574_0046734 | 3300035398 | Bacteria | 2685 |
| 1016 | Ga0316574_0085918 | 3300035398 | Bacteria | 2002 |
| 1017 | Ga0316574_0104625 | 3300035398 | Bacteria | 1812 |
| 1018 | Ga0316574_0146426 | 3300035398 | Bacteria | 1522 |
| 1019 | Ga0316574_0199847 | 3300035398 | Bacteria | 1284 |
| 1020 | Ga0316574_0204879 | 3300035398 | Bacteria | 1266 |
| 1021 | Ga0316574_0217955 | 3300035398 | Bacteria | 1223 |
| 1022 | Ga0316574_0228311 | 3300035398 | Bacteria | 1192 |
| 1023 | Ga0316574_0371394 | 3300035398 | Bacteria | 903 |
| 1024 | Ga0316574_0446570 | 3300035398 | Bacteria | 810 |
| 1025 | Ga0316574_0494815 | 3300035398 | Bacteria | 763 |
| 1026 | Ga0316574_0700118 | 3300035398 | Bacteria | 621 |
| 1027 | Ga0373927_0058076 | 3300035695 | Bacteria | 2502 |
| 1028 | Ga0373927_0417545 | 3300035695 | Bacteria | 885 |
| 1029 | Ga0310109_019185 | 3300036534 | Bacteria | 924 |
| 1030 | Ga0316582_0000015 | 3300036647 | Bacteria | 41441 |
| 1031 | Ga0316582_0001466 | 3300036647 | Bacteria | 10378 |
| 1032 | Ga0316582_0002224 | 3300036647 | Bacteria | 9011 |
| 1033 | Ga0316582_0003997 | 3300036647 | Bacteria | 7369 |
| 1034 | Ga0316582_0004346 | 3300036647 | Bacteria | 7138 |
| 1035 | Ga0316582_0013137 | 3300036647 | Bacteria | 4650 |
| 1036 | Ga0316582_0025002 | 3300036647 | Bacteria | 3580 |
| 1037 | Ga0316582_0073891 | 3300036647 | Bacteria | 2213 |
| 1038 | Ga0316582_0075143 | 3300036647 | Bacteria | 2195 |
| 1039 | Ga0316582_0092551 | 3300036647 | Bacteria | 1992 |
| 1040 | Ga0316582_0093922 | 3300036647 | Bacteria | 1978 |
| 1041 | Ga0316582_0156816 | 3300036647 | Bacteria | 1541 |
| 1042 | Ga0316582_0202149 | 3300036647 | Bacteria | 1356 |
| 1043 | Ga0316582_0226216 | 3300036647 | Bacteria | 1280 |
| 1044 | Ga0316582_0422686 | 3300036647 | Bacteria | 918 |
| 1045 | Ga0316582_0484157 | 3300036647 | Bacteria | 853 |
| 1046 | Ga0316582_0620070 | 3300036647 | Bacteria | 744 |
| 1047 | Ga0316584_0000487 | 3300036712 | Bacteria | 20931 |
| 1048 | Ga0316584_0000609 | 3300036712 | Bacteria | 19432 |
| 1049 | Ga0316584_0001578 | 3300036712 | Bacteria | 13834 |
| 1050 | Ga0316584_0004833 | 3300036712 | Bacteria | 8958 |
| 1051 | Ga0316584_0015064 | 3300036712 | Bacteria | 5524 |
| 1052 | Ga0316584_0018774 | 3300036712 | Bacteria | 4991 |
| 1053 | Ga0316584_0024637 | 3300036712 | Bacteria | 4406 |
| 1054 | Ga0316584_0044752 | 3300036712 | Bacteria | 3302 |
| 1055 | Ga0316584_0063752 | 3300036712 | Bacteria | 2759 |
| 1056 | Ga0316584_0074355 | 3300036712 | Bacteria | 2547 |
| 1057 | Ga0316584_0096606 | 3300036712 | Bacteria | 2212 |
| 1058 | Ga0316584_0112247 | 3300036712 | Bacteria | 2039 |
| 1059 | Ga0316584_0133058 | 3300036712 | Bacteria | 1857 |
| 1060 | Ga0316584_0149420 | 3300036712 | Bacteria | 1740 |
| 1061 | Ga0316584_0167539 | 3300036712 | Bacteria | 1631 |
| 1062 | Ga0316584_0181023 | 3300036712 | Bacteria | 1560 |
| 1063 | Ga0316584_0184552 | 3300036712 | Bacteria | 1543 |
| 1064 | Ga0316584_0238807 | 3300036712 | Bacteria | 1330 |
| 1065 | Ga0316584_0347997 | 3300036712 | Bacteria | 1065 |
| 1066 | Ga0373925_0938189 | 3300037068 | Bacteria | 713 |
| 1067 | Ga0395899_0001959 | 3300037312 | Bacteria | 16927 |
| 1068 | Ga0395899_0039188 | 3300037312 | Bacteria | 3548 |
| 1069 | Ga0395899_0181187 | 3300037312 | Bacteria | 1479 |
| 1070 | Ga0395899_0218082 | 3300037312 | Bacteria | 1323 |
| 1071 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 1072 | Ga0395900_0000374 | 3300037418 | Bacteria | 64539 |
| 1073 | Ga0395900_0023658 | 3300037418 | Bacteria | 6285 |
| 1074 | Ga0395900_0031782 | 3300037418 | Bacteria | 5425 |
| 1075 | Ga0395900_0137469 | 3300037418 | Bacteria | 2503 |
| 1076 | Ga0395900_0142284 | 3300037418 | Bacteria | 2455 |
| 1077 | Ga0395900_0300964 | 3300037418 | Bacteria | 1590 |
| 1078 | Ga0395900_0326447 | 3300037418 | Bacteria | 1513 |
| 1079 | Ga0395900_1042937 | 3300037418 | Bacteria | 736 |
| 1080 | Ga0395900_1192256 | 3300037418 | Bacteria | 677 |
| 1081 | Ga0395898_0000558 | 3300037466 | Bacteria | 69802 |
| 1082 | Ga0395898_0000600 | 3300037466 | Bacteria | 66858 |
| 1083 | Ga0395898_0006608 | 3300037466 | Bacteria | 12359 |
| 1084 | Ga0395898_0045474 | 3300037466 | Bacteria | 4315 |
| 1085 | Ga0395898_0118682 | 3300037466 | Bacteria | 2534 |
| 1086 | Ga0316581_0007450 | 3300037588 | Bacteria | 2937 |
| 1087 | Ga0316581_0025276 | 3300037588 | Bacteria | 1766 |
| 1088 | Ga0316581_0056956 | 3300037588 | Bacteria | 1198 |
| 1089 | Ga0316581_0065940 | 3300037588 | Bacteria | 1112 |
| 1090 | Ga0395901_0002939 | 3300038443 | Bacteria | 17197 |
| 1091 | Ga0395901_0011584 | 3300038443 | Bacteria | 8935 |
| 1092 | Ga0395901_0020479 | 3300038443 | Bacteria | 6769 |
| 1093 | Ga0395901_0109817 | 3300038443 | Bacteria | 2895 |
| 1094 | Ga0395901_0144172 | 3300038443 | Bacteria | 2503 |
| 1095 | Ga0395901_0160496 | 3300038443 | Bacteria | 2361 |
| 1096 | Ga0395901_0206597 | 3300038443 | Bacteria | 2057 |
| 1097 | Ga0395901_0422099 | 3300038443 | Bacteria | 1367 |
| 1098 | Ga0400484_10568 | 3300038725 | Bacteria | 4359 |
| 1099 | Ga0400484_27221 | 3300038725 | Bacteria | 11015 |
| 1100 | Ga0400484_28932 | 3300038725 | Bacteria | 10422 |
| 1101 | Ga0400484_30405 | 3300038725 | Bacteria | 18960 |
| 1102 | Ga0400484_44058 | 3300038725 | Bacteria | 9517 |
| 1103 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 1104 | Ga0400490_07361 | 3300038726 | Bacteria | 19331 |
| 1105 | Ga0400490_11843 | 3300038726 | Bacteria | 2151 |
| 1106 | Ga0400490_19939 | 3300038726 | Bacteria | 2587 |
| 1107 | Ga0400490_39901 | 3300038726 | Bacteria | 15663 |
| 1108 | Ga0400491_28158 | 3300038727 | Bacteria | 6406 |
| 1109 | Ga0400488_21953 | 3300038741 | Bacteria | 1813 |
| 1110 | Ga0400488_44035 | 3300038741 | Bacteria | 1632 |
| 1111 | Ga0400488_49024 | 3300038741 | Bacteria | 3498 |
| 1112 | Ga0400488_52572 | 3300038741 | Bacteria | 1825 |
| 1113 | Ga0400488_59057 | 3300038741 | Bacteria | 3347 |
| 1114 | Ga0400483_092352 | 3300039062 | Bacteria | 246443 |
| 1115 | Ga0400483_092373 | 3300039062 | Bacteria | 3253 |
| 1116 | Ga0400483_140144 | 3300039062 | Bacteria | 16717 |
| 1117 | Ga0400483_141649 | 3300039062 | Bacteria | 8613 |
| 1118 | Ga0400483_153100 | 3300039062 | Bacteria | 13456 |
| 1119 | Ga0400483_208501 | 3300039062 | Bacteria | 3936 |
| 1120 | Ga0400483_222800 | 3300039062 | Bacteria | 244239 |
| 1121 | Ga0400483_232923 | 3300039062 | Bacteria | 3087 |
| 1122 | Ga0400483_233637 | 3300039062 | Bacteria | 29223 |
| 1123 | Ga0400487_00820 | 3300039110 | Bacteria | 3258 |
| 1124 | Ga0400487_06175 | 3300039110 | Bacteria | 1091 |
| 1125 | Ga0400487_07519 | 3300039110 | Bacteria | 4533 |
| 1126 | Ga0400487_16358 | 3300039110 | Bacteria | 1796 |
| 1127 | Ga0400487_29008 | 3300039110 | Bacteria | 14273 |
| 1128 | Ga0400487_33555 | 3300039110 | Bacteria | 69184 |
| 1129 | Ga0400487_49904 | 3300039110 | Bacteria | 1768 |
| 1130 | Ga0400487_54841 | 3300039110 | Bacteria | 3504 |
| 1131 | Ga0237816_00020 | 3300039145 | Bacteria | 9419 |
| 1132 | Ga0436365_0188979 | 3300039437 | Bacteria | 5898 |
| 1133 | Ga0439436_0000027 | 3300041404 | Bacteria | 53417 |
| 1134 | Ga0439439_0146178 | 3300041406 | Bacteria | 669 |
| 1135 | Ga0439465_0000141 | 3300041413 | Bacteria | 17802 |
| 1136 | Ga0439465_0040016 | 3300041413 | Bacteria | 1514 |
| 1137 | Ga0451789_0966640 | 3300041443 | Bacteria | 1214 |
| 1138 | Ga0451790_01501 | 3300041444 | Bacteria | 929 |
| 1139 | Ga0451794_19753 | 3300041446 | Bacteria | 607 |
| 1140 | Ga0451797_0341736 | 3300041453 | Bacteria | 1333 |
| 1141 | Ga0451797_0596018 | 3300041453 | Bacteria | 1564 |
| 1142 | Ga0451795_0306315 | 3300041456 | Bacteria | 835 |
| 1143 | Ga0451800_1077986 | 3300041459 | Bacteria | 530 |
| 1144 | Ga0451802_1297400 | 3300041460 | Bacteria | 732 |
| 1145 | Ga0451802_1980770 | 3300041460 | Bacteria | 624 |
| 1146 | Ga0451837_0112688 | 3300041494 | Bacteria | 882 |
| 1147 | Ga0451849_0505711 | 3300041505 | Bacteria | 782 |
| 1148 | Ga0451849_0530033 | 3300041505 | Bacteria | 601 |
| 1149 | Ga0451843_0334910 | 3300041509 | Bacteria | 2015 |
| 1150 | Ga0451853_3021768 | 3300041512 | Bacteria | 825 |
| 1151 | Ga0439433_0007937 | 3300041999 | Bacteria | 2296 |
| 1152 | Ga0439437_001358 | 3300042000 | Bacteria | 2573 |
| 1153 | Ga0439445_0007238 | 3300042004 | Bacteria | 2571 |
| 1154 | Ga0439445_0026697 | 3300042004 | Bacteria | 1480 |
| 1155 | Ga0439448_0036535 | 3300042005 | Bacteria | 1576 |
| 1156 | Ga0439432_012770 | 3300042006 | Bacteria | 2865 |
| 1157 | Ga0439449_0005045 | 3300042007 | Bacteria | 5078 |
| 1158 | Ga0439455_0060015 | 3300042012 | Bacteria | 1007 |
| 1159 | Ga0439462_0033917 | 3300042015 | Bacteria | 1354 |
| 1160 | Ga0439446_0024361 | 3300042156 | Bacteria | 1726 |
| 1161 | Ga0450908_005953 | 3300042184 | Bacteria | 2330 |
| 1162 | Ga0439434_0129497 | 3300042435 | Bacteria | 827 |
| 1163 | Ga0439459_0000125 | 3300042438 | Bacteria | 7509 |
| 1164 | Ga0439459_0133528 | 3300042438 | Bacteria | 636 |
| 1165 | Ga0451577_0126055 | 3300042876 | Bacteria | 2294 |
| 1166 | Ga0466972_0179289 | 3300044658 | Bacteria | 993 |
| 1167 | Ga0466975_0052900 | 3300044661 | Bacteria | 2894 |
| 1168 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 1169 | Ga0466982_0000210 | 3300044672 | Bacteria | 15368 |
| 1170 | Ga0466965_0003853 | 3300044683 | Bacteria | 6624 |
| 1171 | Ga0466965_0024440 | 3300044683 | Bacteria | 2922 |
| 1172 | Ga0466966_0002549 | 3300044684 | Bacteria | 11933 |
| 1173 | Ga0466966_0096631 | 3300044684 | Bacteria | 1829 |
| 1174 | Ga0466961_0009962 | 3300044693 | Bacteria | 6057 |
| 1175 | Ga0466961_0128671 | 3300044693 | Bacteria | 1587 |
| 1176 | Ga0466963_0315394 | 3300044694 | Bacteria | 1100 |
| 1177 | Ga0466963_0381121 | 3300044694 | Bacteria | 994 |
| 1178 | Ga0466963_0515852 | 3300044694 | Bacteria | 844 |
| 1179 | Ga0466964_0006055 | 3300044706 | Bacteria | 4507 |
| 1180 | Ga0466964_0109654 | 3300044706 | Bacteria | 1229 |
| 1181 | Ga0453684_0002985 | 3300044712 | Bacteria | 39370 |
| 1182 | Ga0453684_0059911 | 3300044712 | Bacteria | 4902 |
| 1183 | Ga0466971_0000338 | 3300044719 | Bacteria | 17942 |
| 1184 | Ga0466971_0021121 | 3300044719 | Bacteria | 2896 |
| 1185 | Ga0466968_0000409 | 3300044735 | Bacteria | 14226 |
| 1186 | Ga0466970_0001896 | 3300044765 | Bacteria | 10104 |
| 1187 | Ga0466970_0289934 | 3300044765 | Bacteria | 921 |
| 1188 | Ga0466957_0003550 | 3300044842 | Bacteria | 8589 |
| 1189 | Ga0466957_0029303 | 3300044842 | Bacteria | 3281 |
| 1190 | Ga0466960_0002345 | 3300044901 | Bacteria | 7115 |
| 1191 | Ga0466959_0053652 | 3300045049 | Bacteria | 2946 |
| 1192 | Ga0466959_0143077 | 3300045049 | Bacteria | 1689 |
| 1193 | Ga0466958_0005279 | 3300045836 | Bacteria | 6926 |
| 1194 | Ga0466967_0379550 | 3300045976 | Bacteria | 1372 |
| 1195 | Ga0466967_0395937 | 3300045976 | Bacteria | 1343 |
| 1196 | Ga0466967_0415306 | 3300045976 | Bacteria | 1311 |
| 1197 | Ga0495617_001870 | 3300046452 | Bacteria | 8887 |
| 1198 | Ga0495629_0235336 | 3300046459 | Bacteria | 1262 |
| 1199 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 1200 | Ga0495638_0006581 | 3300046460 | Bacteria | 8449 |
| 1201 | Ga0495651_0255075 | 3300046462 | Bacteria | 1196 |
| 1202 | Ga0495650_0000202 | 3300046471 | Bacteria | 129910 |
| 1203 | Ga0495650_0004760 | 3300046471 | Bacteria | 9123 |
| 1204 | Ga0495650_0045834 | 3300046471 | Bacteria | 1838 |
| 1205 | Ga0495580_0397750 | 3300046472 | Bacteria | 929 |
| 1206 | Ga0495582_0218917 | 3300046473 | Bacteria | 1089 |
| 1207 | Ga0495605_0109671 | 3300046474 | Bacteria | 1260 |
| 1208 | Ga0495639_0023140 | 3300046475 | Bacteria | 2729 |
| 1209 | Ga0495584_0001537 | 3300046491 | Bacteria | 13711 |
| 1210 | Ga0495585_0004023 | 3300046492 | Bacteria | 9679 |
| 1211 | Ga0495607_0022784 | 3300046501 | Bacteria | 3929 |
| 1212 | Ga0495607_0058148 | 3300046501 | Bacteria | 2212 |
| 1213 | Ga0495583_0012059 | 3300046506 | Bacteria | 4921 |
| 1214 | Ga0495606_0001329 | 3300046507 | Bacteria | 33751 |
| 1215 | Ga0495606_0006502 | 3300046507 | Bacteria | 10753 |
| 1216 | Ga0495606_0135141 | 3300046507 | Bacteria | 1461 |
| 1217 | Ga0495606_0343365 | 3300046507 | Bacteria | 794 |
| 1218 | Ga0495610_0001380 | 3300046512 | Bacteria | 21565 |
| 1219 | Ga0495610_0021781 | 3300046512 | Bacteria | 3518 |
| 1220 | Ga0495610_0231653 | 3300046512 | Bacteria | 741 |
| 1221 | Ga0495620_0046763 | 3300046515 | Bacteria | 1866 |
| 1222 | Ga0495632_0005327 | 3300046519 | Bacteria | 8538 |
| 1223 | Ga0495632_0018010 | 3300046519 | Bacteria | 3883 |
| 1224 | Ga0495648_0034606 | 3300046524 | Bacteria | 3285 |
| 1225 | Ga0495648_0212259 | 3300046524 | Bacteria | 961 |
| 1226 | Ga0495663_0001032 | 3300046525 | Bacteria | 9218 |
| 1227 | Ga0495663_0203644 | 3300046525 | Bacteria | 691 |
| 1228 | Ga0495587_0472223 | 3300046536 | Bacteria | 694 |
| 1229 | Ga0495598_0040702 | 3300046537 | Bacteria | 1356 |
| 1230 | Ga0495609_0001578 | 3300046538 | Bacteria | 14896 |
| 1231 | Ga0495621_0014526 | 3300046539 | Bacteria | 2493 |
| 1232 | Ga0495668_0046721 | 3300046616 | Bacteria | 2405 |
| 1233 | Ga0495611_0000029 | 3300046648 | Bacteria | 115887 |
| 1234 | Ga0495625_0001724 | 3300046660 | Bacteria | 25395 |
| 1235 | Ga0495625_0098383 | 3300046660 | Bacteria | 2012 |
| 1236 | Ga0495625_0100807 | 3300046660 | Bacteria | 1984 |
| 1237 | Ga0495661_0008049 | 3300046665 | Bacteria | 7318 |
| 1238 | Ga0495657_0064277 | 3300046675 | Bacteria | 2418 |
| 1239 | Ga0495599_0262574 | 3300046678 | Bacteria | 1049 |
| 1240 | Ga0495658_0011888 | 3300046683 | Bacteria | 4392 |
| 1241 | Ga0495670_0021017 | 3300046691 | Bacteria | 3218 |
| 1242 | Ga0495670_0072690 | 3300046691 | Bacteria | 1742 |
| 1243 | Ga0495671_0005114 | 3300046692 | Bacteria | 7717 |
| 1244 | Ga0495649_0000383 | 3300046694 | Bacteria | 38398 |
| 1245 | Ga0495649_0006659 | 3300046694 | Bacteria | 7174 |
| 1246 | Ga0495589_0000144 | 3300046794 | Bacteria | 65654 |
| 1247 | Ga0495660_0003242 | 3300046810 | Bacteria | 10114 |
| 1248 | Ga0495660_0062741 | 3300046810 | Bacteria | 1991 |
| 1249 | Ga0495672_0016648 | 3300047320 | Bacteria | 4943 |
| 1250 | Ga0495683_0004657 | 3300047323 | Bacteria | 7733 |
| 1251 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 1252 | Ga0495673_0004383 | 3300047469 | Bacteria | 8851 |
| 1253 | Ga0495673_0005855 | 3300047469 | Bacteria | 7350 |
| 1254 | Ga0495686_0054658 | 3300047472 | Bacteria | 2499 |
| 1255 | Ga0495593_0178491 | 3300047673 | Bacteria | 1070 |
| 1256 | Ga0496100_0044063 | 3300048903 | Bacteria | 2856 |
| 1257 | Ga0496101_0009854 | 3300048904 | Bacteria | 6293 |
| 1258 | Ga0496101_0283358 | 3300048904 | Bacteria | 1295 |
| 1259 | Ga0496101_0411632 | 3300048904 | Bacteria | 1065 |
| 1260 | Ga0496102_0717425 | 3300048905 | Bacteria | 923 |
| 1261 | Ga0496104_0000099 | 3300048907 | Bacteria | 84201 |
| 1262 | Ga0496104_0760623 | 3300048907 | Bacteria | 876 |
| 1263 | Ga0496105_0000021 | 3300048908 | Bacteria | 164255 |
| 1264 | Ga0496105_0024102 | 3300048908 | Bacteria | 4942 |
| 1265 | Ga0496106_0008692 | 3300048909 | Bacteria | 7515 |
| 1266 | Ga0496106_0829400 | 3300048909 | Bacteria | 733 |
| 1267 | Ga0496107_0042581 | 3300048910 | Bacteria | 3261 |
| 1268 | Ga0496108_0075478 | 3300048911 | Bacteria | 2848 |
| 1269 | Ga0496112_0052028 | 3300048915 | Bacteria | 4018 |
| 1270 | Ga0496113_0042432 | 3300048916 | Bacteria | 3361 |
| 1271 | Ga0496114_0031674 | 3300048917 | Bacteria | 4350 |
| 1272 | Ga0496114_0066989 | 3300048917 | Bacteria | 3011 |
| 1273 | Ga0496115_0002269 | 3300048918 | Bacteria | 13760 |
| 1274 | Ga0496115_0450466 | 3300048918 | Bacteria | 1039 |
| 1275 | Ga0496116_0026353 | 3300048919 | Bacteria | 4255 |
| 1276 | Ga0496116_0120273 | 3300048919 | Bacteria | 1522 |
| 1277 | Ga0496117_0009197 | 3300048920 | Bacteria | 9248 |
| 1278 | Ga0496118_0013918 | 3300048921 | Bacteria | 7565 |
| 1279 | Ga0496118_0294156 | 3300048921 | Bacteria | 895 |
| 1280 | Ga0496119_0013048 | 3300048922 | Bacteria | 6666 |
| 1281 | Ga0496119_0014507 | 3300048922 | Bacteria | 6158 |
| 1282 | Ga0496120_0005412 | 3300048923 | Bacteria | 10189 |
| 1283 | Ga0496121_0000290 | 3300048924 | Bacteria | 104280 |
| 1284 | Ga0496121_0010306 | 3300048924 | Bacteria | 10571 |
| 1285 | Ga0496121_0042451 | 3300048924 | Bacteria | 3956 |
| 1286 | Ga0496121_0089818 | 3300048924 | Bacteria | 2403 |
| 1287 | Ga0496121_0591701 | 3300048924 | Bacteria | 686 |
| 1288 | Ga0496122_0018830 | 3300048925 | Bacteria | 6348 |
| 1289 | Ga0496122_0046603 | 3300048925 | Bacteria | 3355 |
| 1290 | Ga0496122_0114298 | 3300048925 | Bacteria | 1761 |
| 1291 | Ga0496123_0012847 | 3300048926 | Bacteria | 7092 |
| 1292 | Ga0496123_0024610 | 3300048926 | Bacteria | 4570 |
| 1293 | Ga0496123_0066416 | 3300048926 | Bacteria | 2284 |
| 1294 | Ga0496123_0098588 | 3300048926 | Bacteria | 1708 |
| 1295 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 1296 | Ga0496124_0000472 | 3300048927 | Bacteria | 69226 |
| 1297 | Ga0496124_0239835 | 3300048927 | Bacteria | 1349 |
| 1298 | Ga0496125_0000379 | 3300048928 | Bacteria | 83187 |
| 1299 | Ga0496125_0036008 | 3300048928 | Bacteria | 4329 |
| 1300 | Ga0496125_0124580 | 3300048928 | Bacteria | 1829 |
| 1301 | Ga0496126_0006212 | 3300048929 | Bacteria | 13367 |
| 1302 | Ga0496126_0007636 | 3300048929 | Bacteria | 11804 |
| 1303 | Ga0496126_0062723 | 3300048929 | Bacteria | 3334 |
| 1304 | Ga0496126_0098679 | 3300048929 | Bacteria | 2559 |
| 1305 | Ga0496126_0148912 | 3300048929 | Bacteria | 2007 |
| 1306 | Ga0496126_0574209 | 3300048929 | Bacteria | 892 |
| 1307 | Ga0496126_1212883 | 3300048929 | Bacteria | 554 |
| 1308 | Ga0501308_002440 | 3300049128 | Bacteria | 1631 |
| 1309 | Ga0501305_039468 | 3300049161 | Bacteria | 764 |
| 1310 | Ga0501307_000537 | 3300049162 | Bacteria | 2662 |
| 1311 | Ga0501307_001082 | 3300049162 | Bacteria | 2172 |
| 1312 | Ga0501307_019589 | 3300049162 | Bacteria | 869 |
| 1313 | Ga0495678_004567 | 3300049459 | Bacteria | 7963 |
| 1314 | Ga0495678_029848 | 3300049459 | Bacteria | 2287 |
| 1315 | Ga0495682_0009001 | 3300049460 | Bacteria | 3917 |
| 1316 | Ga0501290_000463 | 3300049513 | Bacteria | 6299 |
| 1317 | Ga0501300_006013 | 3300049523 | Bacteria | 1789 |
| 1318 | Ga0501311_002462 | 3300049527 | Bacteria | 1777 |
| 1319 | Ga0501311_036198 | 3300049527 | Bacteria | 733 |
| 1320 | Ga0501314_003485 | 3300049530 | Bacteria | 1272 |
| 1321 | Ga0501317_048686 | 3300049533 | Bacteria | 667 |
| 1322 | Ga0501317_067609 | 3300049533 | Bacteria | 597 |
| 1323 | Ga0501320_002831 | 3300049536 | Bacteria | 1421 |
| 1324 | Ga0501322_001937 | 3300049538 | Bacteria | 1226 |
| 1325 | Ga0501325_003336 | 3300049541 | Bacteria | 1163 |
| 1326 | Ga0501327_06849 | 3300049543 | Bacteria | 700 |
| 1327 | Ga0501336_011583 | 3300049552 | Bacteria | 720 |
| 1328 | Ga0501336_013674 | 3300049552 | Bacteria | 681 |
| 1329 | Ga0501031_0081097 | 3300049568 | Bacteria | 2115 |
| 1330 | Ga0501032_0017477 | 3300049569 | Bacteria | 5037 |
| 1331 | Ga0501032_0034469 | 3300049569 | Bacteria | 3465 |
| 1332 | Ga0501032_0043715 | 3300049569 | Bacteria | 3032 |
| 1333 | Ga0501032_0286398 | 3300049569 | Bacteria | 1066 |
| 1334 | Ga0501033_0004184 | 3300049570 | Bacteria | 11618 |
| 1335 | Ga0501033_0004251 | 3300049570 | Bacteria | 11520 |
| 1336 | Ga0501033_0005276 | 3300049570 | Bacteria | 10253 |
| 1337 | Ga0501033_0032195 | 3300049570 | Bacteria | 3937 |
| 1338 | Ga0501033_0036983 | 3300049570 | Bacteria | 3656 |
| 1339 | Ga0501034_0000903 | 3300049571 | Bacteria | 43233 |
| 1340 | Ga0501034_0002672 | 3300049571 | Bacteria | 21050 |
| 1341 | Ga0501034_0008263 | 3300049571 | Bacteria | 11016 |
| 1342 | Ga0501034_0288859 | 3300049571 | Bacteria | 1578 |
| 1343 | Ga0501034_0437174 | 3300049571 | Bacteria | 1227 |
| 1344 | Ga0501036_0029857 | 3300049572 | Bacteria | 4607 |
| 1345 | Ga0501036_0288981 | 3300049572 | Bacteria | 1372 |
| 1346 | Ga0501037_0001035 | 3300049573 | Bacteria | 20561 |
| 1347 | Ga0501037_0003782 | 3300049573 | Bacteria | 10981 |
| 1348 | Ga0501037_0054455 | 3300049573 | Bacteria | 2925 |
| 1349 | Ga0501037_0118288 | 3300049573 | Bacteria | 1906 |
| 1350 | Ga0501037_0205010 | 3300049573 | Bacteria | 1392 |
| 1351 | Ga0501038_0013134 | 3300049574 | Bacteria | 7553 |
| 1352 | Ga0501038_0022943 | 3300049574 | Bacteria | 5586 |
| 1353 | Ga0501038_0070058 | 3300049574 | Bacteria | 2978 |
| 1354 | Ga0501040_0009838 | 3300049576 | Bacteria | 6243 |
| 1355 | Ga0501043_0024041 | 3300049579 | Bacteria | 4781 |
| 1356 | Ga0501043_0034619 | 3300049579 | Bacteria | 3972 |
| 1357 | Ga0501043_0041617 | 3300049579 | Bacteria | 3610 |
| 1358 | Ga0501043_0059687 | 3300049579 | Bacteria | 2993 |
| 1359 | Ga0501046_0013020 | 3300049580 | Bacteria | 7058 |
| 1360 | Ga0501046_0041114 | 3300049580 | Bacteria | 3690 |
| 1361 | Ga0501046_0079984 | 3300049580 | Bacteria | 2526 |
| 1362 | Ga0501047_0013042 | 3300049581 | Bacteria | 7872 |
| 1363 | Ga0501047_0180752 | 3300049581 | Bacteria | 1976 |
| 1364 | Ga0501047_0411154 | 3300049581 | Bacteria | 1185 |
| 1365 | Ga0501048_0024220 | 3300049582 | Bacteria | 4430 |
| 1366 | Ga0501069_0009337 | 3300049585 | Bacteria | 5178 |
| 1367 | Ga0501069_0034143 | 3300049585 | Bacteria | 2802 |
| 1368 | Ga0501069_0099636 | 3300049585 | Bacteria | 1649 |
| 1369 | Ga0501070_0006574 | 3300049586 | Bacteria | 9894 |
| 1370 | Ga0501070_0011369 | 3300049586 | Bacteria | 7523 |
| 1371 | Ga0501070_0011561 | 3300049586 | Bacteria | 7452 |
| 1372 | Ga0501070_0032811 | 3300049586 | Bacteria | 4344 |
| 1373 | Ga0501070_0085817 | 3300049586 | Bacteria | 2606 |
| 1374 | Ga0501070_0238345 | 3300049586 | Bacteria | 1489 |
| 1375 | Ga0501070_0590131 | 3300049586 | Bacteria | 886 |
| 1376 | Ga0501071_0004109 | 3300049587 | Bacteria | 9201 |
| 1377 | Ga0501073_0001831 | 3300049589 | Bacteria | 15830 |
| 1378 | Ga0501073_0082961 | 3300049589 | Bacteria | 2230 |
| 1379 | Ga0501073_0093557 | 3300049589 | Bacteria | 2088 |
| 1380 | Ga0501074_0000179 | 3300049590 | Bacteria | 34289 |
| 1381 | Ga0501074_0000980 | 3300049590 | Bacteria | 18498 |
| 1382 | Ga0501074_0299814 | 3300049590 | Bacteria | 1141 |
| 1383 | Ga0501074_0461256 | 3300049590 | Bacteria | 900 |
| 1384 | Ga0501077_0022199 | 3300049593 | Bacteria | 4020 |
| 1385 | Ga0501077_0082138 | 3300049593 | Bacteria | 2042 |
| 1386 | Ga0501225_0032672 | 3300049705 | Bacteria | 1431 |
| 1387 | Ga0501245_030831 | 3300049708 | Bacteria | 886 |
| 1388 | Ga0501080_0001184 | 3300049742 | Bacteria | 21614 |
| 1389 | Ga0501080_0002282 | 3300049742 | Bacteria | 16696 |
| 1390 | Ga0501080_0046155 | 3300049742 | Bacteria | 4058 |
| 1391 | Ga0501080_0156106 | 3300049742 | Bacteria | 2108 |
| 1392 | Ga0501080_0236360 | 3300049742 | Bacteria | 1669 |
| 1393 | Ga0501268_011794 | 3300049765 | Bacteria | 1386 |
| 1394 | Ga0501035_0009970 | 3300049822 | Bacteria | 8817 |
| 1395 | Ga0501035_0025382 | 3300049822 | Bacteria | 5433 |
| 1396 | Ga0501035_0028659 | 3300049822 | Bacteria | 5082 |
| 1397 | Ga0501035_0032264 | 3300049822 | Bacteria | 4766 |
| 1398 | Ga0501035_0090608 | 3300049822 | Bacteria | 2691 |
| 1399 | Ga0501035_0185348 | 3300049822 | Bacteria | 1791 |
| 1400 | Ga0501035_0865639 | 3300049822 | Bacteria | 718 |
| 1401 | Ga0501044_0014874 | 3300049823 | Bacteria | 8389 |
| 1402 | Ga0501044_0043547 | 3300049823 | Bacteria | 4662 |
| 1403 | Ga0501044_0051894 | 3300049823 | Bacteria | 4228 |
| 1404 | Ga0501045_0672188 | 3300049824 | Bacteria | 765 |
| 1405 | Ga0501045_1378979 | 3300049824 | Bacteria | 512 |
| 1406 | Ga0501204_070297 | 3300049850 | Bacteria | 575 |
| 1407 | nmdc:mga03n38_135_c1 | 3300050490 | Bacteria | 16000 |
| 1408 | nmdc:mga00v17_123_c1 | 3300050491 | Bacteria | 45547 |
| 1409 | nmdc:mga00v17_138056_c1 | 3300050491 | Bacteria | 1562 |
| 1410 | nmdc:mga00v17_211938_c1 | 3300050491 | Bacteria | 1254 |
| 1411 | nmdc:mga00v17_248400_c1 | 3300050491 | Bacteria | 1154 |
| 1412 | nmdc:mga00v17_2568_c1 | 3300050491 | Bacteria | 9325 |
| 1413 | nmdc:mga00v17_385_c1 | 3300050491 | Bacteria | 25012 |
| 1414 | nmdc:mga0yw44_265_c1 | 3300050492 | Bacteria | 17906 |
| 1415 | nmdc:mga0yw44_615759_c1 | 3300050492 | Bacteria | 738 |
| 1416 | nmdc:mga06z11_3977_c1 | 3300050494 | Bacteria | 5765 |
| 1417 | nmdc:mga06z11_6666_c1 | 3300050494 | Bacteria | 4721 |
| 1418 | nmdc:mga04h51_51254_c1 | 3300050495 | Unclassified | 1386 |
| 1419 | nmdc:mga07m45_68_c1 | 3300050496 | Bacteria | 39566 |
| 1420 | nmdc:mga0n895_17129_c1 | 3300050512 | Bacteria | 6675 |
| 1421 | nmdc:mga0sz30_10120_c1 | 3300050516 | Bacteria | 3265 |
| 1422 | nmdc:mga0sz30_17_c1 | 3300050516 | Bacteria | 48963 |
| 1423 | nmdc:mga0sz30_99934_c1 | 3300050516 | Bacteria | 1267 |
| 1424 | Ga0495619_0129500 | 3300053085 | Bacteria | 1734 |
| 1425 | Ga0500643_000120 | 3300053087 | Bacteria | 81701 |
| 1426 | Ga0500555_001368 | 3300053103 | Bacteria | 7599 |
| 1427 | Ga0500652_161016 | 3300053131 | Bacteria | 927 |
| 1428 | Ga0500564_020687 | 3300053138 | Bacteria | 3011 |
| 1429 | Ga0500622_0161269 | 3300053156 | Bacteria | 1051 |
| 1430 | Ga0500633_0000338 | 3300053160 | Bacteria | 7069 |
| 1431 | Ga0500645_034551 | 3300053730 | Bacteria | 1510 |
| 1432 | Ga0500601_054018 | 3300053737 | Bacteria | 503 |
| 1433 | Ga0501084_0464553 | 3300054114 | Bacteria | 1070 |
| 1434 | Ga0500661_014977 | 3300055283 | Bacteria | 1393 |
| 1435 | Ga0587084_000162 | 3300059477 | Bacteria | 4147 |
| 1436 | Ga0587093_006937 | 3300059478 | Bacteria | 1251 |
| 1437 | Ga0587073_0000278 | 3300059492 | Bacteria | 4139 |
| 1438 | Ga0587073_0045080 | 3300059492 | Bacteria | 978 |
| 1439 | Ga0587073_0074536 | 3300059492 | Bacteria | 828 |
| 1440 | Ga0587077_047677 | 3300059493 | Bacteria | 885 |
| 1441 | Ga0587080_000220 | 3300059503 | Bacteria | 4144 |
| 1442 | Ga0587082_000004 | 3300059504 | Bacteria | 11540 |
| 1443 | Ga0587083_0044594 | 3300059505 | Bacteria | 943 |
| 1444 | Ga0587085_000125 | 3300059506 | Bacteria | 4109 |
| 1445 | Ga0587086_003741 | 3300059507 | Bacteria | 1550 |
| 1446 | Ga0587088_002042 | 3300059508 | Bacteria | 2223 |
| 1447 | Ga0587088_021818 | 3300059508 | Bacteria | 1074 |
| 1448 | Ga0587090_006568 | 3300059510 | Bacteria | 1499 |
| 1449 | Ga0587098_003805 | 3300059604 | Bacteria | 1384 |
| 1450 | Ga0587106_003388 | 3300059605 | Bacteria | 1666 |
| 1451 | Ga0587101_003436 | 3300059623 | Bacteria | 1608 |
| 1452 | Ga0587101_003959 | 3300059623 | Bacteria | 1548 |
| 1453 | Ga0587113_003513 | 3300059625 | Bacteria | 1199 |
| 1454 | Ga0587128_029169 | 3300059630 | Bacteria | 903 |
| 1455 | Ga0587062_001288 | 3300059639 | Bacteria | 2114 |
| 1456 | Ga0587067_000324 | 3300059640 | Bacteria | 3931 |
| 1457 | Ga0587067_068520 | 3300059640 | Bacteria | 760 |
| 1458 | Ga0587068_016917 | 3300059641 | Bacteria | 1160 |
| 1459 | Ga0587069_027433 | 3300059642 | Bacteria | 899 |
| 1460 | Ga0587069_055272 | 3300059642 | Bacteria | 717 |
| 1461 | Ga0587072_000098 | 3300059643 | Bacteria | 6863 |
| 1462 | Ga0587076_011160 | 3300059645 | Bacteria | 1315 |
| 1463 | Ga0587076_069799 | 3300059645 | Bacteria | 727 |
| 1464 | Ga0587078_000665 | 3300059646 | Bacteria | 2722 |
| 1465 | Ga0587107_000874 | 3300059652 | Bacteria | 2228 |
| 1466 | Ga0587107_000958 | 3300059652 | Bacteria | 2168 |
| 1467 | Ga0587120_001282 | 3300059659 | Bacteria | 1538 |
| 1468 | Ga0587124_014470 | 3300059660 | Bacteria | 751 |
| 1469 | Ga0587071_001996 | 3300060344 | Bacteria | 2684 |
| 1470 | Ga0587111_0061638 | 3300060346 | Bacteria | 855 |
| 1471 | Ga0501082_0000351 | 3300060353 | Bacteria | 40723 |
| 1472 | Ga0466962_0003514 | 3300061719 | Bacteria | 7467 |
| 1473 | Ga0466962_0005585 | 3300061719 | Bacteria | 6037 |
| 1474 | Ga0466962_0006812 | 3300061719 | Bacteria | 5484 |
| 1475 | 2525556146 | 2524614729 | Bacteria | 3091755 |
| 1476 | 2538834120 | 2537561836 | Bacteria | 3910579 |
| 1477 | 2595448057 | 2593339238 | Bacteria | 4182970 |
| 1478 | 2595451353 | 2593339239 | Bacteria | 4124669 |
| 1479 | 2630648928 | 2627854209 | Bacteria | 3093011 |
| 1480 | 2643829536 | 2643221562 | Bacteria | 4048635 |
| 1481 | 2643895209 | 2643221577 | Bacteria | 3710843 |
| 1482 | 2643906213 | 2643221579 | Bacteria | 4443405 |
| 1483 | 2643915233 | 2643221581 | Bacteria | 3893603 |
| 1484 | 2644477368 | 2643221685 | Bacteria | 3673288 |
| 1485 | 2721028612 | 2718218334 | Bacteria | 4765486 |
| 1486 | 2735835797 | 2734482264 | Unclassified | 5014763 |
| 1487 | 2739226998 | 2738543009 | Bacteria | 4944499 |
| 1488 | 2739732112 | 2739367700 | Bacteria | 4747630 |
| 1489 | 2819566541 | 2818991440 | Bacteria | 4774720 |
| 1490 | 2842781638 | 2842780639 | Bacteria | 4337790 |
| 1491 | 2842915013 | 2842914999 | Bacteria | 4419378 |
| 1492 | 2842922247 | 2842918807 | Bacteria | 4289178 |
| 1493 | 2884339575 | 2884338543 | Bacteria | 4610696 |
| 1494 | 2884413740 | 2884411467 | Bacteria | 5246714 |
| 1495 | 2895397486 | 2895395659 | Bacteria | 3983269 |
| 1496 | 2895501288 | 2895498888 | Bacteria | 5283788 |
| 1497 | 2895514431 | 2895511927 | Bacteria | 6802080 |
| 1498 | 2895524087 | 2895522137 | Bacteria | 3284416 |
| 1499 | 2895527575 | 2895525241 | Bacteria | 3388457 |
| 1500 | 2904467197 | 2904463128 | Bacteria | 4775606 |
| 1501 | 2919086788 | 2919085039 | Bacteria | 4532964 |
| 1502 | 2919404432 | 2919404418 | Bacteria | 4232372 |
| 1503 | 2919515174 | 2919513703 | Bacteria | 3844312 |
| 1504 | 2919678191 | 2919675420 | Bacteria | 3969095 |
| 1505 | 2923519217 | 2923516293 | Bacteria | 3716336 |
| 1506 | 2928964810 | 2928963466 | Bacteria | 5165703 |
| 1507 | 2939612721 | 2939611941 | Bacteria | 3892017 |
| 1508 | 2941473839 | 2941471342 | Bacteria | 5018624 |
| 1509 | 2953997364 | 2953994433 | Bacteria | 4303959 |
| 1510 | 2987605659 | 2987605356 | Bacteria | 4187822 |
| 1511 | 8002871456 | 8002869464 | Bacteria | 3588529 |
| 1512 | Ga0105239_10016716 | |||
| 1513 | JGI24736J21556_1000834 | |||
| 1514 | JGI24736J21556_1011766 | |||
| 1515 | JGI24741J21665_1002594 | |||
| 1516 | JGI24741J21665_1003527 | |||
| 1517 | JGI24741J21665_1016908 | |||
| 1518 | JGI24740J21852_10000021 | |||
| 1519 | JGI24740J21852_10008167 | |||
| 1520 | JGI24739J22299_10000118 | |||
| 1521 | JGI24739J22299_10006773 | |||
| 1522 | JGI24737J22298_10000685 | |||
| 1523 | JGI24737J22298_10009379 | |||
| 1524 | JGI24735J21928_10001587 | |||
| 1525 | JGI24735J21928_10003017 | |||
| 1526 | JGI24735J21928_10004966 | |||
| 1527 | JGI24735J21928_10077607 | |||
| 1528 | JGI24738J21930_10000244 | |||
| 1529 | JGI25156J39149_1022995 | |||
| 1530 | JGI25162J39368_1002823 | |||
| 1531 | JGI25162J39368_1004851 | |||
| 1532 | JGI25162J39368_1007633 | |||
| 1533 | JGI25162J39368_1009713 | |||
| 1534 | JGI25162J39368_1009724 | |||
| 1535 | JGI25154J39366_1004667 | |||
| 1536 | JGI25154J39366_1009597 | |||
| 1537 | JGI25157J39369_1001153 | |||
| 1538 | JGI25157J39369_1002257 | |||
| 1539 | JGI25157J39369_1002562 | |||
| 1540 | JGI25163J39215_1001625 | |||
| 1541 | JGI25164J39214_1000312 | |||
| 1542 | JGI25164J39214_1000781 | |||
| 1543 | JGI25152J39213_1020082 | |||
| 1544 | JGI25152J39213_1023998 | |||
| 1545 | JGI25165J46597_1000586 | |||
| 1546 | JGI25165J46597_1001532 | |||
| 1547 | JGI25165J46597_1010465 | |||
| 1548 | JGI25153J46596_10044279 | |||
| 1549 | rootH2_10053540 | |||
| 1550 | Ga0006556J51387_1018520 | |||
| 1551 | Ga0006556J51387_1029536 | |||
| 1552 | Ga0006558J51389_1018313 | |||
| 1553 | Ga0006560J51390_1017170 | |||
| 1554 | Ga0006560J51390_1022654 | |||
| 1555 | Ga0006554J51385_1017088 | |||
| 1556 | Ga0006554J51385_1020490 | |||
| 1557 | Ga0007409J51694_1052656 | |||
| 1558 | Ga0006562J51391_1006869 | |||
| 1559 | Ga0006562J51391_1018587 | |||
| 1560 | Ga0007429J51699_1074699 | |||
| 1561 | Ga0055538_1000680 | |||
| 1562 | Ga0055539_1000456 | |||
| 1563 | Ga0055533_1000432 | |||
| 1564 | Ga0055533_1001562 | |||
| 1565 | Ga0055525_1000111 | |||
| 1566 | Ga0055527_1001990 | |||
| 1567 | Ga0055527_1005431 | |||
| 1568 | Ga0055527_1005551 | |||
| 1569 | Ga0055535_1004607 | |||
| 1570 | Ga0055535_1006497 | |||
| 1571 | Ga0055535_1009753 | |||
| 1572 | Ga0055542_1002415 | |||
| 1573 | Ga0055542_1002419 | |||
| 1574 | Ga0055542_1010749 | |||
| 1575 | Ga0055542_1010940 | |||
| 1576 | Ga0055542_1014856 | |||
| 1577 | Ga0055542_1014872 | |||
| 1578 | Ga0055529_1000211 | |||
| 1579 | Ga0055529_1001427 | |||
| 1580 | Ga0055529_1006343 | |||
| 1581 | Ga0055529_1006494 | |||
| 1582 | Ga0055529_1007498 | |||
| 1583 | Ga0055531_10010210 | |||
| 1584 | Ga0055531_10026295 | |||
| 1585 | Ga0058863_11854684 | |||
| 1586 | Ga0058860_10173151 | |||
| 1587 | Ga0065165_1000598 | |||
| 1588 | Ga0065165_1014398 | |||
| 1589 | Ga0065704_10014668 | |||
| 1590 | Ga0065712_10045478 | |||
| 1591 | Ga0065715_10387468 | |||
| 1592 | Ga0065707_10525630 | |||
| 1593 | Ga0070658_10079794 | |||
| 1594 | Ga0070658_10116570 | |||
| 1595 | Ga0070658_10173032 | |||
| 1596 | Ga0070658_10808705 | |||
| 1597 | Ga0070658_10849479 | |||
| 1598 | Ga0070676_10073677 | |||
| 1599 | Ga0070683_100157216 | |||
| 1600 | Ga0070683_100397330 | |||
| 1601 | Ga0070690_100520364 | |||
| 1602 | Ga0070670_100000015 | |||
| 1603 | Ga0070670_100114614 | |||
| 1604 | Ga0070670_100128667 | |||
| 1605 | Ga0070670_100671425 | |||
| 1606 | Ga0070677_10047856 | |||
| 1607 | Ga0070666_10000012 | |||
| 1608 | Ga0070666_10004872 | |||
| 1609 | Ga0070666_10005025 | |||
| 1610 | Ga0070666_10192157 | |||
| 1611 | Ga0070680_100038408 | |||
| 1612 | Ga0070680_100120993 | |||
| 1613 | Ga0070680_100126385 | |||
| 1614 | Ga0070680_100137925 | |||
| 1615 | Ga0070680_100332029 | |||
| 1616 | Ga0070680_100836378 | |||
| 1617 | Ga0070682_100005710 | |||
| 1618 | Ga0070682_100014033 | |||
| 1619 | Ga0070682_100067467 | |||
| 1620 | Ga0070682_100071520 | |||
| 1621 | Ga0070682_100102914 | |||
| 1622 | Ga0068868_100113147 | |||
| 1623 | Ga0068868_100166417 | |||
| 1624 | Ga0070660_100112812 | |||
| 1625 | Ga0070660_100113633 | |||
| 1626 | Ga0070660_100148886 | |||
| 1627 | Ga0070660_100180219 | |||
| 1628 | Ga0070689_100013126 | |||
| 1629 | Ga0070691_10014961 | |||
| 1630 | Ga0070691_10075743 | |||
| 1631 | Ga0070691_10080247 | |||
| 1632 | Ga0070691_10170469 | |||
| 1633 | Ga0070661_100035059 | |||
| 1634 | Ga0070661_100041400 | |||
| 1635 | Ga0070661_100049277 | |||
| 1636 | Ga0070661_100082561 | |||
| 1637 | Ga0070661_100084529 | |||
| 1638 | Ga0070661_100196512 | |||
| 1639 | Ga0070661_100938734 | |||
| 1640 | Ga0070692_10037868 | |||
| 1641 | Ga0070692_10069511 | |||
| 1642 | Ga0070692_10089534 | |||
| 1643 | Ga0070692_10625681 | |||
| 1644 | Ga0070668_100015678 | |||
| 1645 | Ga0070668_100021079 | |||
| 1646 | Ga0070668_100446007 | |||
| 1647 | Ga0070668_100967250 | |||
| 1648 | Ga0070668_101134250 | |||
| 1649 | Ga0070669_100004607 | |||
| 1650 | Ga0070669_100063003 | |||
| 1651 | Ga0070669_100068175 | |||
| 1652 | Ga0070669_100621250 | |||
| 1653 | Ga0070675_100062636 | |||
| 1654 | Ga0070675_100354451 | |||
| 1655 | Ga0070675_100370200 | |||
| 1656 | Ga0070671_100000013 | |||
| 1657 | Ga0070671_100204483 | |||
| 1658 | Ga0070674_100441951 | |||
| 1659 | Ga0070673_100218257 | |||
| 1660 | Ga0070688_100001170 | |||
| 1661 | Ga0070659_100193733 | |||
| 1662 | Ga0070659_100204926 | |||
| 1663 | Ga0070659_100239692 | |||
| 1664 | Ga0070659_100249519 | |||
| 1665 | Ga0070667_100000015 | |||
| 1666 | Ga0070667_100307002 | |||
| 1667 | Ga0070667_100456785 | |||
| 1668 | Ga0070667_100548428 | |||
| 1669 | Ga0070709_10547879 | |||
| 1670 | Ga0070714_100436318 | |||
| 1671 | Ga0070714_100439110 | |||
| 1672 | Ga0070714_100443383 | |||
| 1673 | Ga0070713_100008401 | |||
| 1674 | Ga0070713_101285498 | |||
| 1675 | Ga0070710_10018563 | |||
| 1676 | Ga0070711_100133362 | |||
| 1677 | Ga0070700_100202755 | |||
| 1678 | Ga0070663_100063416 | |||
| 1679 | Ga0070663_100094181 | |||
| 1680 | Ga0070663_100096100 | |||
| 1681 | Ga0070663_100099814 | |||
| 1682 | Ga0070663_100104002 | |||
| 1683 | Ga0070663_100714871 | |||
| 1684 | Ga0070663_100998143 | |||
| 1685 | Ga0070678_100003045 | |||
| 1686 | Ga0070662_100025886 | |||
| 1687 | Ga0070662_100163663 | |||
| 1688 | Ga0070662_100208325 | |||
| 1689 | Ga0070662_100330820 | |||
| 1690 | Ga0070662_100525028 | |||
| 1691 | Ga0070681_10000250 | |||
| 1692 | Ga0070681_10037765 | |||
| 1693 | Ga0070681_10046978 | |||
| 1694 | Ga0070681_10162597 | |||
| 1695 | Ga0070681_10178476 | |||
| 1696 | Ga0070681_10215106 | |||
| 1697 | Ga0070681_10473218 | |||
| 1698 | Ga0070681_10919424 | |||
| 1699 | Ga0070685_10000104 | |||
| 1700 | Ga0070685_10002255 | |||
| 1701 | Ga0070685_10046788 | |||
| 1702 | Ga0070685_10063320 | |||
| 1703 | Ga0070706_101274781 | |||
| 1704 | Ga0070698_100047038 | |||
| 1705 | Ga0070679_100046691 | |||
| 1706 | Ga0070679_100057568 | |||
| 1707 | Ga0070679_100092348 | |||
| 1708 | Ga0070679_100214300 | |||
| 1709 | Ga0070679_100214704 | |||
| 1710 | Ga0070679_100464393 | |||
| 1711 | Ga0070684_100082507 | |||
| 1712 | Ga0070684_100126859 | |||
| 1713 | Ga0070684_100551531 | |||
| 1714 | Ga0070684_100567810 | |||
| 1715 | Ga0068853_100093919 | |||
| 1716 | Ga0068853_100190825 | |||
| 1717 | Ga0068853_100204102 | |||
| 1718 | Ga0068853_100226394 | |||
| 1719 | Ga0068853_100395040 | |||
| 1720 | Ga0070672_100284254 | |||
| 1721 | Ga0070672_100457028 | |||
| 1722 | Ga0070672_100661488 | |||
| 1723 | Ga0070696_100006375 | |||
| 1724 | Ga0070696_100008697 | |||
| 1725 | Ga0070696_100010164 | |||
| 1726 | Ga0070696_100120127 | |||
| 1727 | Ga0070696_100407907 | |||
| 1728 | Ga0070696_100713001 | |||
| 1729 | Ga0070693_100007266 | |||
| 1730 | Ga0070693_100009800 | |||
| 1731 | Ga0070693_100010949 | |||
| 1732 | Ga0070693_100011890 | |||
| 1733 | Ga0070693_100278154 | |||
| 1734 | Ga0070665_100003465 | |||
| 1735 | Ga0070665_100004322 | |||
| 1736 | Ga0070665_100004348 | |||
| 1737 | Ga0070665_100008860 | |||
| 1738 | Ga0068855_100027951 | |||
| 1739 | Ga0068855_100148373 | |||
| 1740 | Ga0068855_100182261 | |||
| 1741 | Ga0068855_100214346 | |||
| 1742 | Ga0068855_100218882 | |||
| 1743 | Ga0068855_100358623 | |||
| 1744 | Ga0068855_100459535 | |||
| 1745 | Ga0068855_100542745 | |||
| 1746 | Ga0068855_101096358 | |||
| 1747 | Ga0070664_100134459 | |||
| 1748 | Ga0070664_100207178 | |||
| 1749 | Ga0070664_100320168 | |||
| 1750 | Ga0068857_100000998 | |||
| 1751 | Ga0068857_100113748 | |||
| 1752 | Ga0068857_100145109 | |||
| 1753 | Ga0068857_100315285 | |||
| 1754 | Ga0068857_100476463 | |||
| 1755 | Ga0068857_100889505 | |||
| 1756 | Ga0068854_100002422 | |||
| 1757 | Ga0068854_100008257 | |||
| 1758 | Ga0068854_100024883 | |||
| 1759 | Ga0068854_100047152 | |||
| 1760 | Ga0068854_100100630 | |||
| 1761 | Ga0068854_100327377 | |||
| 1762 | Ga0068854_100683010 | |||
| 1763 | Ga0068856_100004630 | |||
| 1764 | Ga0068856_100004797 | |||
| 1765 | Ga0068856_100014197 | |||
| 1766 | Ga0068856_100016200 | |||
| 1767 | Ga0068856_100176917 | |||
| 1768 | Ga0068856_100182072 | |||
| 1769 | Ga0068856_100317454 | |||
| 1770 | Ga0068856_100377121 | |||
| 1771 | Ga0068856_100506201 | |||
| 1772 | Ga0068856_100912965 | |||
| 1773 | Ga0068856_101148750 | |||
| 1774 | Ga0068852_100020534 | |||
| 1775 | Ga0068852_100028025 | |||
| 1776 | Ga0068852_100039943 | |||
| 1777 | Ga0068852_100185001 | |||
| 1778 | Ga0068852_100278253 | |||
| 1779 | Ga0068852_100583728 | |||
| 1780 | Ga0068852_101383946 | |||
| 1781 | Ga0068859_100005854 | |||
| 1782 | Ga0068859_100077312 | |||
| 1783 | Ga0068859_100254682 | |||
| 1784 | Ga0068864_100000056 | |||
| 1785 | Ga0068864_100176397 | |||
| 1786 | Ga0068866_10059552 | |||
| 1787 | Ga0068851_10007152 | |||
| 1788 | Ga0068851_10008970 | |||
| 1789 | Ga0068851_10062443 | |||
| 1790 | Ga0068851_10277326 | |||
| 1791 | Ga0068851_10470494 | |||
| 1792 | Ga0068870_10001674 | |||
| 1793 | Ga0068870_10754905 | |||
| 1794 | Ga0068863_100108830 | |||
| 1795 | Ga0068858_100006088 | |||
| 1796 | Ga0068858_100031324 | |||
| 1797 | Ga0068858_100100650 | |||
| 1798 | Ga0068858_100496666 | |||
| 1799 | Ga0068860_100069308 | |||
| 1800 | Ga0068862_100008335 | |||
| 1801 | Ga0068862_100010918 | |||
| 1802 | Ga0075365_10000030 | |||
| 1803 | Ga0075365_10916867 | |||
| 1804 | Ga0075368_10075335 | |||
| 1805 | Ga0075363_100001020 | |||
| 1806 | Ga0075364_10000068 | |||
| 1807 | Ga0075364_10006019 | |||
| 1808 | Ga0075364_10024136 | |||
| 1809 | Ga0075364_10045776 | |||
| 1810 | Ga0075364_10150145 | |||
| 1811 | Ga0075364_10689074 | |||
| 1812 | Ga0070716_100034277 | |||
| 1813 | Ga0075367_10018355 | |||
| 1814 | Ga0075367_10083925 | |||
| 1815 | Ga0075369_10000030 | |||
| 1816 | Ga0075369_10090158 | |||
| 1817 | Ga0075427_10000015 | |||
| 1818 | Ga0075370_10000042 | |||
| 1819 | Ga0075434_100029763 | |||
| 1820 | Ga0068865_100010514 | |||
| 1821 | Ga0068865_100037315 | |||
| 1822 | Ga0068865_100174338 | |||
| 1823 | Ga0097620_100005854 | |||
| 1824 | Ga0097620_100077315 | |||
| 1825 | Ga0097620_100254709 | |||
| 1826 | Ga0105240_10001149 | |||
| 1827 | Ga0105240_10155079 | |||
| 1828 | Ga0105240_10160771 | |||
| 1829 | Ga0105240_10279921 | |||
| 1830 | Ga0105240_10575911 | |||
| 1831 | Ga0105240_10585481 | |||
| 1832 | Ga0105240_10659400 | |||
| 1833 | Ga0105240_10767205 | |||
| 1834 | Ga0105240_10842223 | |||
| 1835 | Ga0105240_11373058 | |||
| 1836 | Ga0111539_11376173 | |||
| 1837 | Ga0105247_10001324 | |||
| 1838 | Ga0105247_10034259 | |||
| 1839 | Ga0105241_10073856 | |||
| 1840 | Ga0105241_10170821 | |||
| 1841 | Ga0105241_10180245 | |||
| 1842 | Ga0105241_10414041 | |||
| 1843 | Ga0105241_10607832 | |||
| 1844 | Ga0105242_10003026 | |||
| 1845 | Ga0105248_10023564 | |||
| 1846 | Ga0105248_10117754 | |||
| 1847 | Ga0105237_10005040 | |||
| 1848 | Ga0105237_10005934 | |||
| 1849 | Ga0105237_10068309 | |||
| 1850 | Ga0105237_10140547 | |||
| 1851 | Ga0105237_10417725 | |||
| 1852 | Ga0105238_10002505 | |||
| 1853 | Ga0105238_10014023 | |||
| 1854 | Ga0105238_10022836 | |||
| 1855 | Ga0105238_10178754 | |||
| 1856 | Ga0105238_10235288 | |||
| 1857 | Ga0105238_10398970 | |||
| 1858 | Ga0105238_10643489 | |||
| 1859 | Ga0105238_10719234 | |||
| 1860 | Ga0105238_10762215 | |||
| 1861 | Ga0105249_10012650 | |||
| 1862 | Ga0105249_10062574 | |||
| 1863 | Ga0105249_10090427 | |||
| 1864 | Ga0105249_10703723 | |||
| 1865 | Ga0105249_10830935 | |||
| 1866 | Ga0105148_101335 | |||
| 1867 | Ga0105239_10004445 | |||
| 1868 | Ga0105239_10006660 | |||
| 1869 | Ga0105239_10018940 | |||
| 1870 | Ga0105239_10051327 | |||
| 1871 | Ga0105239_10120664 | |||
| 1872 | Ga0105239_10121728 | |||
| 1873 | Ga0157317_1001760 | |||
| 1874 | Ga0157318_1002276 | |||
| 1875 | Ga0157319_1000654 | |||
| 1876 | Ga0157345_1006431 | |||
| 1877 | Ga0157345_1013483 | |||
| 1878 | Ga0157314_1000264 | |||
| 1879 | Ga0157314_1002788 | |||
| 1880 | Ga0157324_1000130 | |||
| 1881 | Ga0157316_1001768 | |||
| 1882 | Ga0157327_1007855 | |||
| 1883 | Ga0157326_1007991 | |||
| 1884 | Ga0157373_10097490 | |||
| 1885 | Ga0157373_10162009 | |||
| 1886 | Ga0157373_10281434 | |||
| 1887 | Ga0157371_10057568 | |||
| 1888 | Ga0157371_10062803 | |||
| 1889 | Ga0157371_10094267 | |||
| 1890 | Ga0157371_10095337 | |||
| 1891 | Ga0157371_10105493 | |||
| 1892 | Ga0157371_10129719 | |||
| 1893 | Ga0157371_10213771 | |||
| 1894 | Ga0157371_10278786 | |||
| 1895 | Ga0157371_10515360 | |||
| 1896 | Ga0157371_10754053 | |||
| 1897 | Ga0157370_10039480 | |||
| 1898 | Ga0157370_10060742 | |||
| 1899 | Ga0157370_10080667 | |||
| 1900 | Ga0157370_10152581 | |||
| 1901 | Ga0157370_10239737 | |||
| 1902 | Ga0157370_10416647 | |||
| 1903 | Ga0157370_10656243 | |||
| 1904 | Ga0157370_10915202 | |||
| 1905 | Ga0157369_10000125 | |||
| 1906 | Ga0157369_10004613 | |||
| 1907 | Ga0157369_10025057 | |||
| 1908 | Ga0157369_10043551 | |||
| 1909 | Ga0157369_10044682 | |||
| 1910 | Ga0157369_10053594 | |||
| 1911 | Ga0157369_10066443 | |||
| 1912 | Ga0157369_10149485 | |||
| 1913 | Ga0157369_10218558 | |||
| 1914 | Ga0157369_10497236 | |||
| 1915 | Ga0157374_10294683 | |||
| 1916 | Ga0157378_10525821 | |||
| 1917 | Ga0157378_12190874 | |||
| 1918 | Ga0163162_10001854 | |||
| 1919 | Ga0163162_10008705 | |||
| 1920 | Ga0163162_10039619 | |||
| 1921 | Ga0163162_10056316 | |||
| 1922 | Ga0163162_10569747 | |||
| 1923 | Ga0163162_10906806 | |||
| 1924 | Ga0157372_10022741 | |||
| 1925 | Ga0157372_10153500 | |||
| 1926 | Ga0157372_10220465 | |||
| 1927 | Ga0157372_10252088 | |||
| 1928 | Ga0157372_10262875 | |||
| 1929 | Ga0157372_10308959 | |||
| 1930 | Ga0157372_10327961 | |||
| 1931 | Ga0157372_10398502 | |||
| 1932 | Ga0157372_10447730 | |||
| 1933 | Ga0157372_10460998 | |||
| 1934 | Ga0157372_10539463 | |||
| 1935 | Ga0157372_10579907 | |||
| 1936 | Ga0157375_10000319 | |||
| 1937 | Ga0157375_10288067 | |||
| 1938 | Ga0163163_10000199 | |||
| 1939 | Ga0182008_10003539 | |||
| 1940 | Ga0182008_10003930 | |||
| 1941 | Ga0157379_10195720 | |||
| 1942 | Ga0157379_10294675 | |||
| 1943 | Ga0157376_10009877 | |||
| 1944 | Ga0157376_10237233 | |||
| 1945 | Ga0182006_1002396 | |||
| 1946 | Ga0182006_1052122 | |||
| 1947 | Ga0182007_10001054 | |||
| 1948 | Ga0182005_1003380 | |||
| 1949 | Ga0182005_1004843 | |||
| 1950 | Ga0182005_1025793 | |||
| 1951 | Ga0183369_1007 | |||
| 1952 | Ga0183368_1002 | |||
| 1953 | Ga0163161_10280668 | |||
| 1954 | Ga0197907_10084022 | |||
| 1955 | Ga0197907_10443089 | |||
| 1956 | Ga0206356_10024670 | |||
| 1957 | Ga0206356_10639948 | |||
| 1958 | Ga0206356_10655197 | |||
| 1959 | Ga0206356_11779262 | |||
| 1960 | Ga0206356_11818570 | |||
| 1961 | Ga0206355_1541314 | |||
| 1962 | Ga0206355_1560542 | |||
| 1963 | Ga0206355_1639836 | |||
| 1964 | Ga0206351_10247550 | |||
| 1965 | Ga0206351_10506122 | |||
| 1966 | Ga0206351_10693657 | |||
| 1967 | Ga0206352_10308657 | |||
| 1968 | Ga0206352_10574827 | |||
| 1969 | Ga0206352_11092907 | |||
| 1970 | Ga0206350_10086102 | |||
| 1971 | Ga0206350_10683875 | |||
| 1972 | Ga0206350_10853760 | |||
| 1973 | Ga0206354_10159778 | |||
| 1974 | Ga0206354_10285212 | |||
| 1975 | Ga0206354_11321677 | |||
| 1976 | Ga0206353_10107238 | |||
| 1977 | Ga0206353_10129542 | |||
| 1978 | Ga0206353_10520420 | |||
| 1979 | Ga0206353_11816607 | |||
| 1980 | Ga0154015_1297936 | |||
| 1981 | Ga0154015_1473023 | |||
| 1982 | Ga0213876_10074788 | |||
| 1983 | Ga0224712_10000264 | |||
| 1984 | Ga0224712_10002283 | |||
| 1985 | Ga0224712_10065857 | |||
| 1986 | Ga0209760_100502 | |||
| 1987 | Ga0209784_100167 | |||
| 1988 | Ga0209674_100043 | |||
| 1989 | Ga0209674_100381 | |||
| 1990 | Ga0209674_100632 | |||
| 1991 | Ga0209674_101912 | |||
| 1992 | Ga0209672_100004 | |||
| 1993 | Ga0209672_100029 | |||
| 1994 | Ga0209672_101110 | |||
| 1995 | Ga0209672_101977 | |||
| 1996 | Ga0209672_103560 | |||
| 1997 | Ga0209147_109375 | |||
| 1998 | Ga0209563_100103 | |||
| 1999 | Ga0207427_100144 | |||
| 2000 | Ga0207427_100209 | |||
| 2001 | Ga0207427_100327 | |||
| 2002 | Ga0207427_106521 | |||
| 2003 | Ga0207427_108186 | |||
| 2004 | Ga0209437_100020 | |||
| 2005 | Ga0209437_100193 | |||
| 2006 | Ga0209437_100256 | |||
| 2007 | Ga0209437_100465 | |||
| 2008 | Ga0209437_101616 | |||
| 2009 | Ga0209258_100003 | |||
| 2010 | Ga0209258_100053 | |||
| 2011 | Ga0209258_100149 | |||
| 2012 | Ga0209258_100329 | |||
| 2013 | Ga0209258_101240 | |||
| 2014 | Ga0209258_105981 | |||
| 2015 | Ga0209646_1000796 | |||
| 2016 | Ga0209646_1002559 | |||
| 2017 | Ga0209646_1009412 | |||
| 2018 | Ga0209026_1000060 | |||
| 2019 | Ga0209026_1000274 | |||
| 2020 | Ga0209026_1000293 | |||
| 2021 | Ga0209026_1000516 | |||
| 2022 | Ga0209026_1001271 | |||
| 2023 | Ga0209677_101383 | |||
| 2024 | Ga0209148_1000002 | |||
| 2025 | Ga0209148_1000009 | |||
| 2026 | Ga0209148_1000010 | |||
| 2027 | Ga0209148_1000025 | |||
| 2028 | Ga0209148_1000039 | |||
| 2029 | Ga0209148_1000143 | |||
| 2030 | Ga0209148_1005039 | |||
| 2031 | Ga0209759_1000658 | |||
| 2032 | Ga0209759_1001361 | |||
| 2033 | Ga0209759_1001919 | |||
| 2034 | Ga0209759_1002020 | |||
| 2035 | Ga0209759_1007648 | |||
| 2036 | Ga0209759_1013219 | |||
| 2037 | Ga0209129_1000835 | |||
| 2038 | Ga0209129_1007534 | |||
| 2039 | Ga0209233_1000009 | |||
| 2040 | Ga0209233_1000020 | |||
| 2041 | Ga0209233_1000151 | |||
| 2042 | Ga0209233_1000920 | |||
| 2043 | Ga0209233_1002051 | |||
| 2044 | Ga0209455_1000004 | |||
| 2045 | Ga0209455_1000034 | |||
| 2046 | Ga0209455_1000060 | |||
| 2047 | Ga0209455_1000086 | |||
| 2048 | Ga0209455_1000095 | |||
| 2049 | Ga0209676_1000156 | |||
| 2050 | Ga0209758_1005974 | |||
| 2051 | Ga0209758_1018540 | |||
| 2052 | Ga0209758_1063731 | |||
| 2053 | Ga0209256_1002932 | |||
| 2054 | Ga0207426_1003716 | |||
| 2055 | Ga0209051_1009647 | |||
| 2056 | Ga0209257_1002665 | |||
| 2057 | Ga0209257_1005259 | |||
| 2058 | Ga0207656_10002597 | |||
| 2059 | Ga0207710_10012607 | |||
| 2060 | Ga0207680_10000013 | |||
| 2061 | Ga0207680_10017400 | |||
| 2062 | Ga0207680_10047575 | |||
| 2063 | Ga0207680_10121264 | |||
| 2064 | Ga0207647_10000287 | |||
| 2065 | Ga0207647_10001185 | |||
| 2066 | Ga0207647_10036662 | |||
| 2067 | Ga0207647_10142461 | |||
| 2068 | Ga0207647_10153788 | |||
| 2069 | Ga0207645_10015789 | |||
| 2070 | Ga0207643_10002762 | |||
| 2071 | Ga0207705_10004273 | |||
| 2072 | Ga0207705_10006472 | |||
| 2073 | Ga0207705_10008046 | |||
| 2074 | Ga0207705_10011179 | |||
| 2075 | Ga0207705_10016228 | |||
| 2076 | Ga0207705_10021621 | |||
| 2077 | Ga0207705_10140190 | |||
| 2078 | Ga0207654_10015953 | |||
| 2079 | Ga0207654_10167430 | |||
| 2080 | Ga0207654_10241064 | |||
| 2081 | Ga0207654_10242254 | |||
| 2082 | Ga0207654_10406694 | |||
| 2083 | Ga0207707_10000201 | |||
| 2084 | Ga0207707_10000210 | |||
| 2085 | Ga0207707_10001339 | |||
| 2086 | Ga0207707_10006555 | |||
| 2087 | Ga0207707_10007311 | |||
| 2088 | Ga0207707_10007312 | |||
| 2089 | Ga0207707_10010320 | |||
| 2090 | Ga0207707_10044623 | |||
| 2091 | Ga0207707_10134574 | |||
| 2092 | Ga0207707_10162109 | |||
| 2093 | Ga0207707_10236395 | |||
| 2094 | Ga0207707_10306654 | |||
| 2095 | Ga0207695_10000032 | |||
| 2096 | Ga0207695_10000929 | |||
| 2097 | Ga0207695_10004915 | |||
| 2098 | Ga0207695_10006299 | |||
| 2099 | Ga0207695_10007681 | |||
| 2100 | Ga0207695_10016662 | |||
| 2101 | Ga0207695_10022941 | |||
| 2102 | Ga0207695_10030817 | |||
| 2103 | Ga0207695_10033761 | |||
| 2104 | Ga0207695_10061446 | |||
| 2105 | Ga0207695_10197455 | |||
| 2106 | Ga0207671_10000021 | |||
| 2107 | Ga0207671_10001518 | |||
| 2108 | Ga0207671_10002946 | |||
| 2109 | Ga0207671_10006022 | |||
| 2110 | Ga0207663_10290291 | |||
| 2111 | Ga0207660_10000360 | |||
| 2112 | Ga0207660_10009553 | |||
| 2113 | Ga0207660_10034473 | |||
| 2114 | Ga0207660_10060242 | |||
| 2115 | Ga0207660_10116424 | |||
| 2116 | Ga0207660_10337796 | |||
| 2117 | Ga0207657_10006384 | |||
| 2118 | Ga0207657_10057043 | |||
| 2119 | Ga0207657_10074690 | |||
| 2120 | Ga0207657_10343007 | |||
| 2121 | Ga0207649_10002213 | |||
| 2122 | Ga0207649_10026295 | |||
| 2123 | Ga0207649_10062358 | |||
| 2124 | Ga0207649_10071942 | |||
| 2125 | Ga0207649_10077310 | |||
| 2126 | Ga0207649_10084893 | |||
| 2127 | Ga0207649_10131195 | |||
| 2128 | Ga0207652_10002222 | |||
| 2129 | Ga0207652_10004193 | |||
| 2130 | Ga0207652_10005745 | |||
| 2131 | Ga0207652_10011010 | |||
| 2132 | Ga0207652_10013571 | |||
| 2133 | Ga0207652_10083627 | |||
| 2134 | Ga0207652_10088092 | |||
| 2135 | Ga0207652_10139058 | |||
| 2136 | Ga0207652_10348434 | |||
| 2137 | Ga0207681_10003213 | |||
| 2138 | Ga0207681_10019048 | |||
| 2139 | Ga0207681_10237385 | |||
| 2140 | Ga0207694_10002856 | |||
| 2141 | Ga0207694_10007041 | |||
| 2142 | Ga0207694_10007300 | |||
| 2143 | Ga0207694_10007361 | |||
| 2144 | Ga0207694_10017922 | |||
| 2145 | Ga0207694_10024129 | |||
| 2146 | Ga0207694_10025532 | |||
| 2147 | Ga0207694_10136700 | |||
| 2148 | Ga0207694_10356162 | |||
| 2149 | Ga0207650_10000013 | |||
| 2150 | Ga0207650_10017618 | |||
| 2151 | Ga0207650_10364379 | |||
| 2152 | Ga0207650_11498080 | |||
| 2153 | Ga0207659_10668538 | |||
| 2154 | Ga0207700_10029599 | |||
| 2155 | Ga0207664_10001884 | |||
| 2156 | Ga0207664_10384621 | |||
| 2157 | Ga0207644_10000407 | |||
| 2158 | Ga0207644_10339419 | |||
| 2159 | Ga0207690_10000291 | |||
| 2160 | Ga0207690_10003289 | |||
| 2161 | Ga0207690_10003907 | |||
| 2162 | Ga0207690_10024945 | |||
| 2163 | Ga0207690_10202513 | |||
| 2164 | Ga0207690_10283601 | |||
| 2165 | Ga0207690_10351539 | |||
| 2166 | Ga0207706_10006252 | |||
| 2167 | Ga0207706_10015708 | |||
| 2168 | Ga0207706_10048500 | |||
| 2169 | Ga0207706_10445569 | |||
| 2170 | Ga0207686_10005014 | |||
| 2171 | Ga0207686_10168209 | |||
| 2172 | Ga0207686_10533979 | |||
| 2173 | Ga0207686_10637041 | |||
| 2174 | Ga0207670_10008334 | |||
| 2175 | Ga0207670_10080551 | |||
| 2176 | Ga0207669_10121793 | |||
| 2177 | Ga0207704_10014528 | |||
| 2178 | Ga0207704_10139958 | |||
| 2179 | Ga0207704_10736119 | |||
| 2180 | Ga0207665_10044771 | |||
| 2181 | Ga0207691_10046504 | |||
| 2182 | Ga0207691_10247272 | |||
| 2183 | Ga0207691_10418010 | |||
| 2184 | Ga0207711_10000194 | |||
| 2185 | Ga0207711_10239286 | |||
| 2186 | Ga0207689_10139586 | |||
| 2187 | Ga0207689_10227291 | |||
| 2188 | Ga0207689_10339989 | |||
| 2189 | Ga0207661_10004252 | |||
| 2190 | Ga0207661_10416042 | |||
| 2191 | Ga0207679_10007471 | |||
| 2192 | Ga0207679_10372719 | |||
| 2193 | Ga0207667_10008135 | |||
| 2194 | Ga0207667_10008758 | |||
| 2195 | Ga0207667_10009904 | |||
| 2196 | Ga0207667_10010803 | |||
| 2197 | Ga0207667_10012000 | |||
| 2198 | Ga0207667_10054383 | |||
| 2199 | Ga0207667_10056014 | |||
| 2200 | Ga0207667_10084170 | |||
| 2201 | Ga0207667_10085023 | |||
| 2202 | Ga0207667_10088884 | |||
| 2203 | Ga0207667_10155106 | |||
| 2204 | Ga0207667_10179967 | |||
| 2205 | Ga0207667_10444848 | |||
| 2206 | Ga0207667_10491212 | |||
| 2207 | Ga0207712_10002403 | |||
| 2208 | Ga0207712_10480063 | |||
| 2209 | Ga0207712_10672862 | |||
| 2210 | Ga0207668_10008346 | |||
| 2211 | Ga0207668_10014483 | |||
| 2212 | Ga0207640_10002025 | |||
| 2213 | Ga0207640_10003058 | |||
| 2214 | Ga0207640_10004259 | |||
| 2215 | Ga0207640_10014285 | |||
| 2216 | Ga0207640_10045068 | |||
| 2217 | Ga0207640_10650367 | |||
| 2218 | Ga0207658_10000005 | |||
| 2219 | Ga0207658_10012048 | |||
| 2220 | Ga0207658_10176384 | |||
| 2221 | Ga0207677_10020677 | |||
| 2222 | Ga0207677_10046562 | |||
| 2223 | Ga0207677_11696389 | |||
| 2224 | Ga0207703_10001653 | |||
| 2225 | Ga0207703_10020068 | |||
| 2226 | Ga0207703_10050143 | |||
| 2227 | Ga0207703_10064862 | |||
| 2228 | Ga0207703_10616510 | |||
| 2229 | Ga0207639_10000231 | |||
| 2230 | Ga0207639_10000682 | |||
| 2231 | Ga0207639_10008268 | |||
| 2232 | Ga0207639_10018424 | |||
| 2233 | Ga0207639_10064484 | |||
| 2234 | Ga0207639_10084682 | |||
| 2235 | Ga0207639_10179218 | |||
| 2236 | Ga0207639_10314789 | |||
| 2237 | Ga0207639_10733139 | |||
| 2238 | Ga0207678_10018442 | |||
| 2239 | Ga0207678_10020001 | |||
| 2240 | Ga0207678_10030274 | |||
| 2241 | Ga0207678_10056807 | |||
| 2242 | Ga0207678_10067734 | |||
| 2243 | Ga0207678_10267753 | |||
| 2244 | Ga0207678_10278107 | |||
| 2245 | Ga0207708_10416837 | |||
| 2246 | Ga0207702_10000517 | |||
| 2247 | Ga0207702_10000852 | |||
| 2248 | Ga0207702_10004420 | |||
| 2249 | Ga0207702_10007160 | |||
| 2250 | Ga0207702_10011901 | |||
| 2251 | Ga0207702_10012283 | |||
| 2252 | Ga0207702_10022553 | |||
| 2253 | Ga0207702_10061145 | |||
| 2254 | Ga0207702_10289094 | |||
| 2255 | Ga0207641_10003553 | |||
| 2256 | Ga0207641_10092132 | |||
| 2257 | Ga0207648_10027626 | |||
| 2258 | Ga0207648_10648182 | |||
| 2259 | Ga0207676_10000010 | |||
| 2260 | Ga0207674_10017287 | |||
| 2261 | Ga0207674_10077617 | |||
| 2262 | Ga0207674_10160707 | |||
| 2263 | Ga0207675_100561141 | |||
| 2264 | Ga0207683_10022992 | |||
| 2265 | Ga0207683_10167755 | |||
| 2266 | Ga0207698_10003169 | |||
| 2267 | Ga0207698_10003897 | |||
| 2268 | Ga0207698_10007267 | |||
| 2269 | Ga0207698_10433276 | |||
| 2270 | Ga0207698_10572761 | |||
| 2271 | Ga0209968_1003164 | |||
| 2272 | Ga0268266_10000007 | |||
| 2273 | Ga0268266_10000021 | |||
| 2274 | Ga0268266_10002538 | |||
| 2275 | Ga0268266_10019459 | |||
| 2276 | Ga0268266_10091837 | |||
| 2277 | Ga0268264_10000036 | |||
| 2278 | Ga0268264_10027927 | |||
| 2279 | Ga0268264_10063633 | |||
| 2280 | Ga0268264_10133979 | |||
| 2281 | Ga0268264_10727706 | |||
| 2282 | Ga0307517_10316954 | |||
| 2283 | Ga0307515_10335996 | |||
| 2284 | Ga0265338_10503888 | |||
| 2285 | Ga0314311_1173220 | |||
| 2286 | Ga0316181_1145493 | |||
| 2287 | Ga0265769_100367 | |||
| 2288 | Ga0265774_100129 | |||
| 2289 | Ga0265327_10001935 | |||
| 2290 | Ga0307513_10184360 | |||
| 2291 | Ga0307509_10056806 | |||
| 2292 | Ga0307408_100777522 | |||
| 2293 | Ga0307508_10021298 | |||
| 2294 | Ga0316575_10001471 | |||
| 2295 | Ga0316575_10001575 | |||
| 2296 | Ga0316575_10022019 | |||
| 2297 | Ga0316575_10110112 | |||
| 2298 | Ga0316575_10173510 | |||
| 2299 | Ga0316575_10223552 | |||
| 2300 | Ga0316575_10259099 | |||
| 2301 | Ga0316579_10000104 | |||
| 2302 | Ga0316579_10001358 | |||
| 2303 | Ga0316579_10007523 | |||
| 2304 | Ga0316579_10021848 | |||
| 2305 | Ga0316579_10033831 | |||
| 2306 | Ga0316579_10073131 | |||
| 2307 | Ga0316579_10099546 | |||
| 2308 | Ga0316579_10123468 | |||
| 2309 | Ga0316579_10126602 | |||
| 2310 | Ga0316579_10168312 | |||
| 2311 | Ga0316579_10199082 | |||
| 2312 | Ga0316579_10222222 | |||
| 2313 | Ga0316579_10334875 | |||
| 2314 | Ga0316579_10442230 | |||
| 2315 | Ga0316576_10000067 | |||
| 2316 | Ga0316576_10000685 | |||
| 2317 | Ga0316576_10002694 | |||
| 2318 | Ga0316576_10008136 | |||
| 2319 | Ga0316576_10009807 | |||
| 2320 | Ga0316576_10012044 | |||
| 2321 | Ga0316576_10046086 | |||
| 2322 | Ga0316576_10057546 | |||
| 2323 | Ga0316576_10058855 | |||
| 2324 | Ga0316576_10073603 | |||
| 2325 | Ga0316576_10080384 | |||
| 2326 | Ga0316576_10153651 | |||
| 2327 | Ga0316576_10250068 | |||
| 2328 | Ga0316576_10739190 | |||
| 2329 | Ga0316578_10000046 | |||
| 2330 | Ga0316578_10000445 | |||
| 2331 | Ga0316578_10001214 | |||
| 2332 | Ga0316578_10005380 | |||
| 2333 | Ga0316578_10010128 | |||
| 2334 | Ga0316578_10014712 | |||
| 2335 | Ga0316578_10030514 | |||
| 2336 | Ga0316578_10035854 | |||
| 2337 | Ga0316578_10039294 | |||
| 2338 | Ga0316578_10096296 | |||
| 2339 | Ga0316578_10105330 | |||
| 2340 | Ga0316578_10278143 | |||
| 2341 | Ga0316578_10281959 | |||
| 2342 | Ga0316578_10331755 | |||
| 2343 | Ga0316578_10354127 | |||
| 2344 | Ga0316578_10497458 | |||
| 2345 | Ga0307516_10039946 | |||
| 2346 | Ga0307405_10201273 | |||
| 2347 | Ga0307405_10341485 | |||
| 2348 | Ga0316577_10000967 | |||
| 2349 | Ga0316577_10001071 | |||
| 2350 | Ga0316577_10001498 | |||
| 2351 | Ga0316577_10043034 | |||
| 2352 | Ga0316577_10048675 | |||
| 2353 | Ga0316577_10166102 | |||
| 2354 | Ga0316577_10289226 | |||
| 2355 | Ga0307413_10160065 | |||
| 2356 | Ga0307413_10324325 | |||
| 2357 | Ga0307413_10433074 | |||
| 2358 | Ga0307410_10100991 | |||
| 2359 | Ga0307406_10648989 | |||
| 2360 | Ga0307406_11018893 | |||
| 2361 | Ga0307412_10006594 | |||
| 2362 | Ga0307412_10048919 | |||
| 2363 | Ga0307412_10387198 | |||
| 2364 | Ga0307412_10457968 | |||
| 2365 | Ga0307412_10500367 | |||
| 2366 | Ga0307414_10002120 | |||
| 2367 | Ga0307414_10107201 | |||
| 2368 | Ga0307414_10117264 | |||
| 2369 | Ga0307414_10185571 | |||
| 2370 | Ga0307414_10198263 | |||
| 2371 | Ga0307414_10542215 | |||
| 2372 | Ga0307411_10026673 | |||
| 2373 | Ga0307411_10250818 | |||
| 2374 | Ga0316583_10013754 | |||
| 2375 | Ga0316583_10033434 | |||
| 2376 | Ga0316583_10126770 | |||
| 2377 | Ga0316585_10000029 | |||
| 2378 | Ga0316585_10030248 | |||
| 2379 | Ga0316585_10056692 | |||
| 2380 | Ga0316580_10000016 | |||
| 2381 | Ga0316580_10000485 | |||
| 2382 | Ga0316580_10001102 | |||
| 2383 | Ga0316580_10002303 | |||
| 2384 | Ga0316580_10015143 | |||
| 2385 | Ga0316580_10020143 | |||
| 2386 | Ga0316580_10023239 | |||
| 2387 | Ga0316593_10000027 | |||
| 2388 | Ga0316593_10000041 | |||
| 2389 | Ga0316593_10000090 | |||
| 2390 | Ga0316593_10000096 | |||
| 2391 | Ga0316593_10000111 | |||
| 2392 | Ga0316593_10000164 | |||
| 2393 | Ga0316593_10000167 | |||
| 2394 | Ga0316593_10000198 | |||
| 2395 | Ga0316593_10000257 | |||
| 2396 | Ga0316593_10000387 | |||
| 2397 | Ga0316593_10000468 | |||
| 2398 | Ga0316593_10000658 | |||
| 2399 | Ga0316593_10001014 | |||
| 2400 | Ga0316593_10001237 | |||
| 2401 | Ga0316593_10001899 | |||
| 2402 | Ga0316593_10002120 | |||
| 2403 | Ga0316593_10002233 | |||
| 2404 | Ga0316593_10003521 | |||
| 2405 | Ga0316593_10004460 | |||
| 2406 | Ga0316593_10004774 | |||
| 2407 | Ga0316593_10004838 | |||
| 2408 | Ga0316593_10005257 | |||
| 2409 | Ga0316593_10007634 | |||
| 2410 | Ga0316593_10009083 | |||
| 2411 | Ga0316593_10010662 | |||
| 2412 | Ga0316593_10012641 | |||
| 2413 | Ga0316593_10020416 | |||
| 2414 | Ga0316593_10021147 | |||
| 2415 | Ga0316593_10033972 | |||
| 2416 | Ga0316593_10036608 | |||
| 2417 | Ga0316593_10038503 | |||
| 2418 | Ga0316593_10058087 | |||
| 2419 | Ga0316593_10058691 | |||
| 2420 | Ga0316593_10069942 | |||
| 2421 | Ga0316593_10074396 | |||
| 2422 | Ga0316593_10076354 | |||
| 2423 | Ga0316593_10094633 | |||
| 2424 | Ga0316593_10096431 | |||
| 2425 | Ga0316593_10104508 | |||
| 2426 | Ga0307507_10039101 | |||
| 2427 | Ga0307510_10002916 | |||
| 2428 | Ga0316592_1000006 | |||
| 2429 | Ga0316592_1000008 | |||
| 2430 | Ga0316592_1000011 | |||
| 2431 | Ga0316592_1000041 | |||
| 2432 | Ga0316592_1000052 | |||
| 2433 | Ga0316592_1000138 | |||
| 2434 | Ga0316592_1000366 | |||
| 2435 | Ga0316592_1000376 | |||
| 2436 | Ga0316592_1000599 | |||
| 2437 | Ga0316592_1000948 | |||
| 2438 | Ga0316592_1004104 | |||
| 2439 | Ga0316592_1006795 | |||
| 2440 | Ga0316592_1008079 | |||
| 2441 | Ga0316592_1012592 | |||
| 2442 | Ga0316592_1014409 | |||
| 2443 | Ga0316592_1017527 | |||
| 2444 | Ga0316592_1018461 | |||
| 2445 | Ga0316592_1056512 | |||
| 2446 | Ga0316586_1000040 | |||
| 2447 | Ga0316586_1000064 | |||
| 2448 | Ga0316586_1000155 | |||
| 2449 | Ga0316586_1000334 | |||
| 2450 | Ga0316586_1001184 | |||
| 2451 | Ga0316586_1006567 | |||
| 2452 | Ga0316586_1007742 | |||
| 2453 | Ga0316586_1010816 | |||
| 2454 | Ga0316586_1010956 | |||
| 2455 | Ga0316586_1013729 | |||
| 2456 | Ga0316586_1032370 | |||
| 2457 | Ga0316586_1037859 | |||
| 2458 | Ga0316586_1056268 | |||
| 2459 | Ga0316588_1000073 | |||
| 2460 | Ga0316588_1000195 | |||
| 2461 | Ga0316588_1000407 | |||
| 2462 | Ga0316588_1000735 | |||
| 2463 | Ga0316588_1001039 | |||
| 2464 | Ga0316588_1001345 | |||
| 2465 | Ga0316588_1001652 | |||
| 2466 | Ga0316588_1003314 | |||
| 2467 | Ga0316588_1009002 | |||
| 2468 | Ga0316588_1015255 | |||
| 2469 | Ga0316588_1026611 | |||
| 2470 | Ga0316588_1030773 | |||
| 2471 | Ga0316588_1061324 | |||
| 2472 | Ga0316588_1122815 | |||
| 2473 | Ga0316587_1000021 | |||
| 2474 | Ga0316587_1000416 | |||
| 2475 | Ga0316587_1000541 | |||
| 2476 | Ga0316587_1000717 | |||
| 2477 | Ga0316587_1003352 | |||
| 2478 | Ga0316587_1003517 | |||
| 2479 | Ga0316587_1007661 | |||
| 2480 | Ga0316587_1008511 | |||
| 2481 | Ga0316587_1010910 | |||
| 2482 | Ga0316587_1025000 | |||
| 2483 | Ga0316587_1071352 | |||
| 2484 | Ga0316587_1083978 | |||
| 2485 | Ga0316596_1000013 | |||
| 2486 | Ga0316596_1000014 | |||
| 2487 | Ga0316596_1000016 | |||
| 2488 | Ga0316596_1000028 | |||
| 2489 | Ga0316596_1000038 | |||
| 2490 | Ga0316596_1000064 | |||
| 2491 | Ga0316596_1000073 | |||
| 2492 | Ga0316596_1000123 | |||
| 2493 | Ga0316596_1000530 | |||
| 2494 | Ga0316596_1000650 | |||
| 2495 | Ga0316596_1000651 | |||
| 2496 | Ga0316596_1001457 | |||
| 2497 | Ga0316596_1002088 | |||
| 2498 | Ga0316596_1003277 | |||
| 2499 | Ga0316596_1004904 | |||
| 2500 | Ga0316596_1005186 | |||
| 2501 | Ga0316596_1005400 | |||
| 2502 | Ga0316596_1005567 | |||
| 2503 | Ga0316596_1007005 | |||
| 2504 | Ga0316596_1007149 | |||
| 2505 | Ga0316596_1009658 | |||
| 2506 | Ga0316596_1010023 | |||
| 2507 | Ga0316596_1011868 | |||
| 2508 | Ga0316596_1017275 | |||
| 2509 | Ga0316596_1020570 | |||
| 2510 | Ga0316596_1035745 | |||
| 2511 | Ga0316596_1053390 | |||
| 2512 | Ga0316596_1056384 | |||
| 2513 | Ga0316596_1114463 | |||
| 2514 | Ga0373950_0119981 | |||
| 2515 | Ga0373958_0046938 | |||
| 2516 | Ga0373944_0040350 | |||
| 2517 | Ga0373946_0094781 | |||
| 2518 | Ga0316574_0000016 | |||
| 2519 | Ga0316574_0000085 | |||
| 2520 | Ga0316574_0005225 | |||
| 2521 | Ga0316574_0005612 | |||
| 2522 | Ga0316574_0009540 | |||
| 2523 | Ga0316574_0030582 | |||
| 2524 | Ga0316574_0038164 | |||
| 2525 | Ga0316574_0038892 | |||
| 2526 | Ga0316574_0046734 | |||
| 2527 | Ga0316574_0085918 | |||
| 2528 | Ga0316574_0104625 | |||
| 2529 | Ga0316574_0146426 | |||
| 2530 | Ga0316574_0199847 | |||
| 2531 | Ga0316574_0204879 | |||
| 2532 | Ga0316574_0217955 | |||
| 2533 | Ga0316574_0228311 | |||
| 2534 | Ga0316574_0371394 | |||
| 2535 | Ga0316574_0446570 | |||
| 2536 | Ga0316574_0494815 | |||
| 2537 | Ga0316574_0700118 | |||
| 2538 | Ga0373927_0058076 | |||
| 2539 | Ga0373927_0417545 | |||
| 2540 | Ga0310109_019185 | |||
| 2541 | Ga0316582_0000015 | |||
| 2542 | Ga0316582_0001466 | |||
| 2543 | Ga0316582_0002224 | |||
| 2544 | Ga0316582_0003997 | |||
| 2545 | Ga0316582_0004346 | |||
| 2546 | Ga0316582_0013137 | |||
| 2547 | Ga0316582_0025002 | |||
| 2548 | Ga0316582_0073891 | |||
| 2549 | Ga0316582_0075143 | |||
| 2550 | Ga0316582_0092551 | |||
| 2551 | Ga0316582_0093922 | |||
| 2552 | Ga0316582_0156816 | |||
| 2553 | Ga0316582_0202149 | |||
| 2554 | Ga0316582_0226216 | |||
| 2555 | Ga0316582_0422686 | |||
| 2556 | Ga0316582_0484157 | |||
| 2557 | Ga0316582_0620070 | |||
| 2558 | Ga0316584_0000487 | |||
| 2559 | Ga0316584_0000609 | |||
| 2560 | Ga0316584_0001578 | |||
| 2561 | Ga0316584_0004833 | |||
| 2562 | Ga0316584_0015064 | |||
| 2563 | Ga0316584_0018774 | |||
| 2564 | Ga0316584_0024637 | |||
| 2565 | Ga0316584_0044752 | |||
| 2566 | Ga0316584_0063752 | |||
| 2567 | Ga0316584_0074355 | |||
| 2568 | Ga0316584_0096606 | |||
| 2569 | Ga0316584_0112247 | |||
| 2570 | Ga0316584_0133058 | |||
| 2571 | Ga0316584_0149420 | |||
| 2572 | Ga0316584_0167539 | |||
| 2573 | Ga0316584_0181023 | |||
| 2574 | Ga0316584_0184552 | |||
| 2575 | Ga0316584_0238807 | |||
| 2576 | Ga0316584_0347997 | |||
| 2577 | Ga0373925_0938189 | |||
| 2578 | Ga0395899_0001959 | |||
| 2579 | Ga0395899_0039188 | |||
| 2580 | Ga0395899_0181187 | |||
| 2581 | Ga0395899_0218082 | |||
| 2582 | Ga0395900_0000012 | |||
| 2583 | Ga0395900_0000374 | |||
| 2584 | Ga0395900_0023658 | |||
| 2585 | Ga0395900_0031782 | |||
| 2586 | Ga0395900_0137469 | |||
| 2587 | Ga0395900_0142284 | |||
| 2588 | Ga0395900_0300964 | |||
| 2589 | Ga0395900_0326447 | |||
| 2590 | Ga0395900_1042937 | |||
| 2591 | Ga0395900_1192256 | |||
| 2592 | Ga0395898_0000558 | |||
| 2593 | Ga0395898_0000600 | |||
| 2594 | Ga0395898_0006608 | |||
| 2595 | Ga0395898_0045474 | |||
| 2596 | Ga0395898_0118682 | |||
| 2597 | Ga0316581_0007450 | |||
| 2598 | Ga0316581_0025276 | |||
| 2599 | Ga0316581_0056956 | |||
| 2600 | Ga0316581_0065940 | |||
| 2601 | Ga0395901_0002939 | |||
| 2602 | Ga0395901_0011584 | |||
| 2603 | Ga0395901_0020479 | |||
| 2604 | Ga0395901_0109817 | |||
| 2605 | Ga0395901_0144172 | |||
| 2606 | Ga0395901_0160496 | |||
| 2607 | Ga0395901_0206597 | |||
| 2608 | Ga0395901_0422099 | |||
| 2609 | Ga0400484_10568 | |||
| 2610 | Ga0400484_27221 | |||
| 2611 | Ga0400484_28932 | |||
| 2612 | Ga0400484_30405 | |||
| 2613 | Ga0400484_44058 | |||
| 2614 | Ga0400490_00437 | |||
| 2615 | Ga0400490_07361 | |||
| 2616 | Ga0400490_11843 | |||
| 2617 | Ga0400490_19939 | |||
| 2618 | Ga0400490_39901 | |||
| 2619 | Ga0400491_28158 | |||
| 2620 | Ga0400488_21953 | |||
| 2621 | Ga0400488_44035 | |||
| 2622 | Ga0400488_49024 | |||
| 2623 | Ga0400488_52572 | |||
| 2624 | Ga0400488_59057 | |||
| 2625 | Ga0400483_092352 | |||
| 2626 | Ga0400483_092373 | |||
| 2627 | Ga0400483_140144 | |||
| 2628 | Ga0400483_141649 | |||
| 2629 | Ga0400483_153100 | |||
| 2630 | Ga0400483_208501 | |||
| 2631 | Ga0400483_222800 | |||
| 2632 | Ga0400483_232923 | |||
| 2633 | Ga0400483_233637 | |||
| 2634 | Ga0400487_00820 | |||
| 2635 | Ga0400487_06175 | |||
| 2636 | Ga0400487_07519 | |||
| 2637 | Ga0400487_16358 | |||
| 2638 | Ga0400487_29008 | |||
| 2639 | Ga0400487_33555 | |||
| 2640 | Ga0400487_49904 | |||
| 2641 | Ga0400487_54841 | |||
| 2642 | Ga0237816_00020 | |||
| 2643 | Ga0436365_0188979 | |||
| 2644 | Ga0439436_0000027 | |||
| 2645 | Ga0439439_0146178 | |||
| 2646 | Ga0439465_0000141 | |||
| 2647 | Ga0439465_0040016 | |||
| 2648 | Ga0451789_0966640 | |||
| 2649 | Ga0451790_01501 | |||
| 2650 | Ga0451794_19753 | |||
| 2651 | Ga0451797_0341736 | |||
| 2652 | Ga0451797_0596018 | |||
| 2653 | Ga0451795_0306315 | |||
| 2654 | Ga0451800_1077986 | |||
| 2655 | Ga0451802_1297400 | |||
| 2656 | Ga0451802_1980770 | |||
| 2657 | Ga0451837_0112688 | |||
| 2658 | Ga0451849_0505711 | |||
| 2659 | Ga0451849_0530033 | |||
| 2660 | Ga0451843_0334910 | |||
| 2661 | Ga0451853_3021768 | |||
| 2662 | Ga0439433_0007937 | |||
| 2663 | Ga0439437_001358 | |||
| 2664 | Ga0439445_0007238 | |||
| 2665 | Ga0439445_0026697 | |||
| 2666 | Ga0439448_0036535 | |||
| 2667 | Ga0439432_012770 | |||
| 2668 | Ga0439449_0005045 | |||
| 2669 | Ga0439455_0060015 | |||
| 2670 | Ga0439462_0033917 | |||
| 2671 | Ga0439446_0024361 | |||
| 2672 | Ga0450908_005953 | |||
| 2673 | Ga0439434_0129497 | |||
| 2674 | Ga0439459_0000125 | |||
| 2675 | Ga0439459_0133528 | |||
| 2676 | Ga0451577_0126055 | |||
| 2677 | Ga0466972_0179289 | |||
| 2678 | Ga0466975_0052900 | |||
| 2679 | Ga0466982_0000005 | |||
| 2680 | Ga0466982_0000210 | |||
| 2681 | Ga0466965_0003853 | |||
| 2682 | Ga0466965_0024440 | |||
| 2683 | Ga0466966_0002549 | |||
| 2684 | Ga0466966_0096631 | |||
| 2685 | Ga0466961_0009962 | |||
| 2686 | Ga0466961_0128671 | |||
| 2687 | Ga0466963_0315394 | |||
| 2688 | Ga0466963_0381121 | |||
| 2689 | Ga0466963_0515852 | |||
| 2690 | Ga0466964_0006055 | |||
| 2691 | Ga0466964_0109654 | |||
| 2692 | Ga0453684_0002985 | |||
| 2693 | Ga0453684_0059911 | |||
| 2694 | Ga0466971_0000338 | |||
| 2695 | Ga0466971_0021121 | |||
| 2696 | Ga0466968_0000409 | |||
| 2697 | Ga0466970_0001896 | |||
| 2698 | Ga0466970_0289934 | |||
| 2699 | Ga0466957_0003550 | |||
| 2700 | Ga0466957_0029303 | |||
| 2701 | Ga0466960_0002345 | |||
| 2702 | Ga0466959_0053652 | |||
| 2703 | Ga0466959_0143077 | |||
| 2704 | Ga0466958_0005279 | |||
| 2705 | Ga0466967_0379550 | |||
| 2706 | Ga0466967_0395937 | |||
| 2707 | Ga0466967_0415306 | |||
| 2708 | Ga0495617_001870 | |||
| 2709 | Ga0495629_0235336 | |||
| 2710 | Ga0495638_0000007 | |||
| 2711 | Ga0495638_0006581 | |||
| 2712 | Ga0495651_0255075 | |||
| 2713 | Ga0495650_0000202 | |||
| 2714 | Ga0495650_0004760 | |||
| 2715 | Ga0495650_0045834 | |||
| 2716 | Ga0495580_0397750 | |||
| 2717 | Ga0495582_0218917 | |||
| 2718 | Ga0495605_0109671 | |||
| 2719 | Ga0495639_0023140 | |||
| 2720 | Ga0495584_0001537 | |||
| 2721 | Ga0495585_0004023 | |||
| 2722 | Ga0495607_0022784 | |||
| 2723 | Ga0495607_0058148 | |||
| 2724 | Ga0495583_0012059 | |||
| 2725 | Ga0495606_0001329 | |||
| 2726 | Ga0495606_0006502 | |||
| 2727 | Ga0495606_0135141 | |||
| 2728 | Ga0495606_0343365 | |||
| 2729 | Ga0495610_0001380 | |||
| 2730 | Ga0495610_0021781 | |||
| 2731 | Ga0495610_0231653 | |||
| 2732 | Ga0495620_0046763 | |||
| 2733 | Ga0495632_0005327 | |||
| 2734 | Ga0495632_0018010 | |||
| 2735 | Ga0495648_0034606 | |||
| 2736 | Ga0495648_0212259 | |||
| 2737 | Ga0495663_0001032 | |||
| 2738 | Ga0495663_0203644 | |||
| 2739 | Ga0495587_0472223 | |||
| 2740 | Ga0495598_0040702 | |||
| 2741 | Ga0495609_0001578 | |||
| 2742 | Ga0495621_0014526 | |||
| 2743 | Ga0495668_0046721 | |||
| 2744 | Ga0495611_0000029 | |||
| 2745 | Ga0495625_0001724 | |||
| 2746 | Ga0495625_0098383 | |||
| 2747 | Ga0495625_0100807 | |||
| 2748 | Ga0495661_0008049 | |||
| 2749 | Ga0495657_0064277 | |||
| 2750 | Ga0495599_0262574 | |||
| 2751 | Ga0495658_0011888 | |||
| 2752 | Ga0495670_0021017 | |||
| 2753 | Ga0495670_0072690 | |||
| 2754 | Ga0495671_0005114 | |||
| 2755 | Ga0495649_0000383 | |||
| 2756 | Ga0495649_0006659 | |||
| 2757 | Ga0495589_0000144 | |||
| 2758 | Ga0495660_0003242 | |||
| 2759 | Ga0495660_0062741 | |||
| 2760 | Ga0495672_0016648 | |||
| 2761 | Ga0495683_0004657 | |||
| 2762 | Ga0495679_000001 | |||
| 2763 | Ga0495673_0004383 | |||
| 2764 | Ga0495673_0005855 | |||
| 2765 | Ga0495686_0054658 | |||
| 2766 | Ga0495593_0178491 | |||
| 2767 | Ga0496100_0044063 | |||
| 2768 | Ga0496101_0009854 | |||
| 2769 | Ga0496101_0283358 | |||
| 2770 | Ga0496101_0411632 | |||
| 2771 | Ga0496102_0717425 | |||
| 2772 | Ga0496104_0000099 | |||
| 2773 | Ga0496104_0760623 | |||
| 2774 | Ga0496105_0000021 | |||
| 2775 | Ga0496105_0024102 | |||
| 2776 | Ga0496106_0008692 | |||
| 2777 | Ga0496106_0829400 | |||
| 2778 | Ga0496107_0042581 | |||
| 2779 | Ga0496108_0075478 | |||
| 2780 | Ga0496112_0052028 | |||
| 2781 | Ga0496113_0042432 | |||
| 2782 | Ga0496114_0031674 | |||
| 2783 | Ga0496114_0066989 | |||
| 2784 | Ga0496115_0002269 | |||
| 2785 | Ga0496115_0450466 | |||
| 2786 | Ga0496116_0026353 | |||
| 2787 | Ga0496116_0120273 | |||
| 2788 | Ga0496117_0009197 | |||
| 2789 | Ga0496118_0013918 | |||
| 2790 | Ga0496118_0294156 | |||
| 2791 | Ga0496119_0013048 | |||
| 2792 | Ga0496119_0014507 | |||
| 2793 | Ga0496120_0005412 | |||
| 2794 | Ga0496121_0000290 | |||
| 2795 | Ga0496121_0010306 | |||
| 2796 | Ga0496121_0042451 | |||
| 2797 | Ga0496121_0089818 | |||
| 2798 | Ga0496121_0591701 | |||
| 2799 | Ga0496122_0018830 | |||
| 2800 | Ga0496122_0046603 | |||
| 2801 | Ga0496122_0114298 | |||
| 2802 | Ga0496123_0012847 | |||
| 2803 | Ga0496123_0024610 | |||
| 2804 | Ga0496123_0066416 | |||
| 2805 | Ga0496123_0098588 | |||
| 2806 | Ga0496124_0000018 | |||
| 2807 | Ga0496124_0000472 | |||
| 2808 | Ga0496124_0239835 | |||
| 2809 | Ga0496125_0000379 | |||
| 2810 | Ga0496125_0036008 | |||
| 2811 | Ga0496125_0124580 | |||
| 2812 | Ga0496126_0006212 | |||
| 2813 | Ga0496126_0007636 | |||
| 2814 | Ga0496126_0062723 | |||
| 2815 | Ga0496126_0098679 | |||
| 2816 | Ga0496126_0148912 | |||
| 2817 | Ga0496126_0574209 | |||
| 2818 | Ga0496126_1212883 | |||
| 2819 | Ga0501308_002440 | |||
| 2820 | Ga0501305_039468 | |||
| 2821 | Ga0501307_000537 | |||
| 2822 | Ga0501307_001082 | |||
| 2823 | Ga0501307_019589 | |||
| 2824 | Ga0495678_004567 | |||
| 2825 | Ga0495678_029848 | |||
| 2826 | Ga0495682_0009001 | |||
| 2827 | Ga0501290_000463 | |||
| 2828 | Ga0501300_006013 | |||
| 2829 | Ga0501311_002462 | |||
| 2830 | Ga0501311_036198 | |||
| 2831 | Ga0501314_003485 | |||
| 2832 | Ga0501317_048686 | |||
| 2833 | Ga0501317_067609 | |||
| 2834 | Ga0501320_002831 | |||
| 2835 | Ga0501322_001937 | |||
| 2836 | Ga0501325_003336 | |||
| 2837 | Ga0501327_06849 | |||
| 2838 | Ga0501336_011583 | |||
| 2839 | Ga0501336_013674 | |||
| 2840 | Ga0501031_0081097 | |||
| 2841 | Ga0501032_0017477 | |||
| 2842 | Ga0501032_0034469 | |||
| 2843 | Ga0501032_0043715 | |||
| 2844 | Ga0501032_0286398 | |||
| 2845 | Ga0501033_0004184 | |||
| 2846 | Ga0501033_0004251 | |||
| 2847 | Ga0501033_0005276 | |||
| 2848 | Ga0501033_0032195 | |||
| 2849 | Ga0501033_0036983 | |||
| 2850 | Ga0501034_0000903 | |||
| 2851 | Ga0501034_0002672 | |||
| 2852 | Ga0501034_0008263 | |||
| 2853 | Ga0501034_0288859 | |||
| 2854 | Ga0501034_0437174 | |||
| 2855 | Ga0501036_0029857 | |||
| 2856 | Ga0501036_0288981 | |||
| 2857 | Ga0501037_0001035 | |||
| 2858 | Ga0501037_0003782 | |||
| 2859 | Ga0501037_0054455 | |||
| 2860 | Ga0501037_0118288 | |||
| 2861 | Ga0501037_0205010 | |||
| 2862 | Ga0501038_0013134 | |||
| 2863 | Ga0501038_0022943 | |||
| 2864 | Ga0501038_0070058 | |||
| 2865 | Ga0501040_0009838 | |||
| 2866 | Ga0501043_0024041 | |||
| 2867 | Ga0501043_0034619 | |||
| 2868 | Ga0501043_0041617 | |||
| 2869 | Ga0501043_0059687 | |||
| 2870 | Ga0501046_0013020 | |||
| 2871 | Ga0501046_0041114 | |||
| 2872 | Ga0501046_0079984 | |||
| 2873 | Ga0501047_0013042 | |||
| 2874 | Ga0501047_0180752 | |||
| 2875 | Ga0501047_0411154 | |||
| 2876 | Ga0501048_0024220 | |||
| 2877 | Ga0501069_0009337 | |||
| 2878 | Ga0501069_0034143 | |||
| 2879 | Ga0501069_0099636 | |||
| 2880 | Ga0501070_0006574 | |||
| 2881 | Ga0501070_0011369 | |||
| 2882 | Ga0501070_0011561 | |||
| 2883 | Ga0501070_0032811 | |||
| 2884 | Ga0501070_0085817 | |||
| 2885 | Ga0501070_0238345 | |||
| 2886 | Ga0501070_0590131 | |||
| 2887 | Ga0501071_0004109 | |||
| 2888 | Ga0501073_0001831 | |||
| 2889 | Ga0501073_0082961 | |||
| 2890 | Ga0501073_0093557 | |||
| 2891 | Ga0501074_0000179 | |||
| 2892 | Ga0501074_0000980 | |||
| 2893 | Ga0501074_0299814 | |||
| 2894 | Ga0501074_0461256 | |||
| 2895 | Ga0501077_0022199 | |||
| 2896 | Ga0501077_0082138 | |||
| 2897 | Ga0501225_0032672 | |||
| 2898 | Ga0501245_030831 | |||
| 2899 | Ga0501080_0001184 | |||
| 2900 | Ga0501080_0002282 | |||
| 2901 | Ga0501080_0046155 | |||
| 2902 | Ga0501080_0156106 | |||
| 2903 | Ga0501080_0236360 | |||
| 2904 | Ga0501268_011794 | |||
| 2905 | Ga0501035_0009970 | |||
| 2906 | Ga0501035_0025382 | |||
| 2907 | Ga0501035_0028659 | |||
| 2908 | Ga0501035_0032264 | |||
| 2909 | Ga0501035_0090608 | |||
| 2910 | Ga0501035_0185348 | |||
| 2911 | Ga0501035_0865639 | |||
| 2912 | Ga0501044_0014874 | |||
| 2913 | Ga0501044_0043547 | |||
| 2914 | Ga0501044_0051894 | |||
| 2915 | Ga0501045_0672188 | |||
| 2916 | Ga0501045_1378979 | |||
| 2917 | Ga0501204_070297 | |||
| 2918 | nmdc:mga03n38_135_c1 | |||
| 2919 | nmdc:mga00v17_123_c1 | |||
| 2920 | nmdc:mga00v17_138056_c1 | |||
| 2921 | nmdc:mga00v17_211938_c1 | |||
| 2922 | nmdc:mga00v17_248400_c1 | |||
| 2923 | nmdc:mga00v17_2568_c1 | |||
| 2924 | nmdc:mga00v17_385_c1 | |||
| 2925 | nmdc:mga0yw44_265_c1 | |||
| 2926 | nmdc:mga0yw44_615759_c1 | |||
| 2927 | nmdc:mga06z11_3977_c1 | |||
| 2928 | nmdc:mga06z11_6666_c1 | |||
| 2929 | nmdc:mga04h51_51254_c1 | |||
| 2930 | nmdc:mga07m45_68_c1 | |||
| 2931 | nmdc:mga0n895_17129_c1 | |||
| 2932 | nmdc:mga0sz30_10120_c1 | |||
| 2933 | nmdc:mga0sz30_17_c1 | |||
| 2934 | nmdc:mga0sz30_99934_c1 | |||
| 2935 | Ga0495619_0129500 | |||
| 2936 | Ga0500643_000120 | |||
| 2937 | Ga0500555_001368 | |||
| 2938 | Ga0500652_161016 | |||
| 2939 | Ga0500564_020687 | |||
| 2940 | Ga0500622_0161269 | |||
| 2941 | Ga0500633_0000338 | |||
| 2942 | Ga0500645_034551 | |||
| 2943 | Ga0500601_054018 | |||
| 2944 | Ga0501084_0464553 | |||
| 2945 | Ga0500661_014977 | |||
| 2946 | Ga0587084_000162 | |||
| 2947 | Ga0587093_006937 | |||
| 2948 | Ga0587073_0000278 | |||
| 2949 | Ga0587073_0045080 | |||
| 2950 | Ga0587073_0074536 | |||
| 2951 | Ga0587077_047677 | |||
| 2952 | Ga0587080_000220 | |||
| 2953 | Ga0587082_000004 | |||
| 2954 | Ga0587083_0044594 | |||
| 2955 | Ga0587085_000125 | |||
| 2956 | Ga0587086_003741 | |||
| 2957 | Ga0587088_002042 | |||
| 2958 | Ga0587088_021818 | |||
| 2959 | Ga0587090_006568 | |||
| 2960 | Ga0587098_003805 | |||
| 2961 | Ga0587106_003388 | |||
| 2962 | Ga0587101_003436 | |||
| 2963 | Ga0587101_003959 | |||
| 2964 | Ga0587113_003513 | |||
| 2965 | Ga0587128_029169 | |||
| 2966 | Ga0587062_001288 | |||
| 2967 | Ga0587067_000324 | |||
| 2968 | Ga0587067_068520 | |||
| 2969 | Ga0587068_016917 | |||
| 2970 | Ga0587069_027433 | |||
| 2971 | Ga0587069_055272 | |||
| 2972 | Ga0587072_000098 | |||
| 2973 | Ga0587076_011160 | |||
| 2974 | Ga0587076_069799 | |||
| 2975 | Ga0587078_000665 | |||
| 2976 | Ga0587107_000874 | |||
| 2977 | Ga0587107_000958 | |||
| 2978 | Ga0587120_001282 | |||
| 2979 | Ga0587124_014470 | |||
| 2980 | Ga0587071_001996 | |||
| 2981 | Ga0587111_0061638 | |||
| 2982 | Ga0501082_0000351 | |||
| 2983 | Ga0466962_0003514 | |||
| 2984 | Ga0466962_0005585 | |||
| 2985 | Ga0466962_0006812 | |||
| 2986 | 2525556146 | |||
| 2987 | 2538834120 | |||
| 2988 | 2595448057 | |||
| 2989 | 2595451353 | |||
| 2990 | 2630648928 | |||
| 2991 | 2643829536 | |||
| 2992 | 2643895209 | |||
| 2993 | 2643906213 | |||
| 2994 | 2643915233 | |||
| 2995 | 2644477368 | |||
| 2996 | 2721028612 | |||
| 2997 | 2735835797 | |||
| 2998 | 2739226998 | |||
| 2999 | 2739732112 | |||
| 3000 | 2819566541 | |||
| 3001 | 2842781638 | |||
| 3002 | 2842915013 | |||
| 3003 | 2842922247 | |||
| 3004 | 2884339575 | |||
| 3005 | 2884413740 | |||
| 3006 | 2895397486 | |||
| 3007 | 2895501288 | |||
| 3008 | 2895514431 | |||
| 3009 | 2895524087 | |||
| 3010 | 2895527575 | |||
| 3011 | 2904467197 | |||
| 3012 | 2919086788 | |||
| 3013 | 2919404432 | |||
| 3014 | 2919515174 | |||
| 3015 | 2919678191 | |||
| 3016 | 2923519217 | |||
| 3017 | 2928964810 | |||
| 3018 | 2939612721 | |||
| 3019 | 2941473839 | |||
| 3020 | 2953997364 | |||
| 3021 | 2987605659 | |||
| 3022 | 8002871456 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9733 | 2 | 178 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9674 | 2 | 178 |
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9664 | 2 | 178 |
| 5ns3-assembly1.cif.gz_A | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.961 | 2 | 178 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.961 | 2 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.936 | 2 | 178 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.931 | 2 | 178 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8933 | 22 | 179 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.893 | 22 | 177 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.878 | 22 | 177 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5KZC6-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9623 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y2FLE2-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9609 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E1NHR5-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9603 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A6I7Q0L2-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9595 | 3 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0H4T8P4-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9594 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |