metagRoot

F494439

General Info

Members	Datasets	Scaffolds	Average Seq Length
1506	694	1348	226

Family's Representative Sequence

Representative Sequence	3300026121\|Ga0207683_10720193\|Ga0207683_107201931
Length	260
Sequence	MILLTLSAMVVLALVAATVILIRKMNGGGYSLPVTAEWINDLSTEQYRPMLRLLDSADWADGKGTVGEQGALVKRNRQLPELSTVGRQIGELILTALARHPLFFSAALPLKTVPPLFNRYEGGEHYGLHVDGSVRSIPGSGEQLRTDLSCTLFLCEPEDYEGGELEVVDTYGTHEVKLPAGDLILYPSSSLHRVHPVTAGARVCSFFWVQSMVRDERARRLLFDLDQTIQRLTTKLGVEDPEVVRLGGIYHNMIRYWAET

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
3	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
4	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
5	2545555834	Methylobacterium sp. WSM2598	Isolate	Nodule
6	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
7	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
8	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
9	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
10	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
11	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
12	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
13	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
14	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
15	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
16	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
17	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
18	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
19	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
20	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
21	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
22	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
23	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
24	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
25	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
26	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
27	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
28	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
29	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
30	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
31	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
32	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
33	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
34	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
35	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
36	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
37	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
38	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
39	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
40	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
41	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
42	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
43	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
44	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
45	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
46	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
47	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
48	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
49	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
50	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
51	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
52	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
53	2643221588	Altererythrobacter sp. Root672	Isolate	Unclassified
54	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
55	2643221614	Phenylobacterium sp. Root77	Isolate	Unclassified
56	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
57	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
58	2643221658	Variovorax sp. Root411	Isolate	Unclassified
59	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
60	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
61	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
62	2643221672	Variovorax sp. Root434	Isolate	Unclassified
63	2643221683	Variovorax sp. Root473	Isolate	Unclassified
64	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
65	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
66	2721755523	Delftia sp. HK171	Isolate	Unclassified
67	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
68	2738541277	Variovorax sp. GV051	Isolate	Unclassified
69	2738541297	Duganella sp. GV083	Isolate	Unclassified
70	2738541307	Variovorax sp. GV008	Isolate	Unclassified
71	2738541357	Duganella sp. GV053	Isolate	Unclassified
72	2738543003	Duganella sp. GV066	Isolate	Unclassified
73	2738543013	Variovorax sp. BT01	Isolate	Unclassified
74	2738543019	Variovorax sp. GV040	Isolate	Unclassified
75	2738543026	Duganella sp. GV089	Isolate	Unclassified
76	2738543029	Duganella sp. GV039	Isolate	Unclassified
77	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
78	2739367664	Novosphingobium sp. GV002	Isolate	Unclassified
79	2739367865	Novosphingobium sp. GV013	Isolate	Unclassified
80	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
81	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
82	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
83	2818991446	Variovorax sp. 1180	Isolate	Unclassified
84	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
85	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
86	2831864461	Roseateles noduli HZ7	Isolate	Nodule
87	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
88	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
89	2839138175	Delftia acidovorans B15	Isolate	Rhizosphere
90	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
91	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
92	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
93	2842775625	Roseomonas sp. R-71825	Isolate	Unclassified
94	2842780639	Pseudoxanthomonas sp. R-71986	Isolate	Unclassified
95	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
96	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
97	2857553236	Duganella sp. R-74557	Isolate	Unclassified
98	2876601092	Pantoea endophytica 596	Isolate	Unclassified
99	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
100	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
101	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
102	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
103	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
104	2885198086	Variovorax sp. 679	Isolate	Unclassified
105	2885211737	Variovorax sp. 553	Isolate	Unclassified
106	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
107	2886848708	Mitsuaria sp. TWR114	Isolate	Rhizosphere
108	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
109	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
110	2896184354	Aurantiacibacter suaedae GH3-15	Isolate	Rhizosphere
111	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
112	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
113	2904424332	Duganella sp. 1411	Isolate	Rhizosphere
114	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
115	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
116	2904504865	Serratia marcescens 1822	Isolate	Unclassified
117	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
118	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
119	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
120	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
121	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
122	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
123	2906610324
124	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
125	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
126	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
127	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
128	2919476304	Duganella sp. 3397	Isolate	Unclassified
129	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
130	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
131	2922425934
132	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
133	2928037797	Variovorax sp. 1126	Isolate	Unclassified
134	2928044640	Variovorax sp. 1128	Isolate	Unclassified
135	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
136	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
137	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
138	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
139	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
140	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
141	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
142	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
143	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
144	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
145	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
146	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
147	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
148	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
149	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
150	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
151	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
152	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
153	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
154	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
155	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
156	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
157	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
158	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
159	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
160	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
161	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
162	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
163	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
164	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
165	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
166	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
167	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
168	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
169	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
170	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
171	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
172	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
173	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
174	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
175	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
176	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
177	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
178	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
179	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
180	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
181	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
182	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
183	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
184	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
185	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
186	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
187	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
188	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
189	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
190	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
191	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
192	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
193	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
194	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
195	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
196	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
197	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
198	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
199	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
200	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
201	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
202	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
203	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
204	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
205	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
206	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
207	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
208	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
209	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
210	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
211	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
212	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
213	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
214	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
215	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
216	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
217	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
218	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
219	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
220	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
221	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
222	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
223	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
224	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
225	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
226	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
227	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
228	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
229	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
230	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
231	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
232	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
233	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
234	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
235	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
236	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
237	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
238	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
239	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
240	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
241	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
242	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
243	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
244	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
245	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
246	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
247	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
248	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
249	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
250	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
251	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
252	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
253	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
254	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
255	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
256	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
257	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
258	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
259	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
260	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
261	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
262	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
263	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
264	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
265	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
266	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
267	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
268	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
269	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
270	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
271	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
272	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
273	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
274	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
275	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
276	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
277	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
278	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
279	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
280	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
281	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
282	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
283	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
284	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
285	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
286	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
287	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
288	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
289	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
290	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
291	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
292	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
293	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
294	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
295	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
296	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
297	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
301	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
302	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
304	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
306	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
307	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
309	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
310	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
311	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
312	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
313	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
314	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
316	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
321	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
322	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
324	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
325	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
376	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
377	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
379	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
383	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
384	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
385	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
386	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
387	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
388	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
389	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
390	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
391	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
392	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
393	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
394	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
395	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
396	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
397	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
398	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
399	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
400	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
401	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
402	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
403	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
404	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
405	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
406	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
407	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
408	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
409	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
410	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
411	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
412	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
413	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
414	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
415	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
416	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
417	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
418	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
419	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
420	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
421	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
422	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
423	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
424	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
425	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
426	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
427	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
428	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
429	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
430	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
431	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
432	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
433	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
434	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
435	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
436	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
437	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
438	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
439	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
440	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
441	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
442	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
443	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
444	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
445	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
446	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
447	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
448	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
449	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
450	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
451	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
452	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
453	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
454	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
455	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
456	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
457	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
458	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
459	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
460	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
461	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
462	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
463	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
464	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
465	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
466	3300042144	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89	Metagenome	Rhizosphere
467	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
468	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
469	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
470	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
471	3300042533	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472	Metagenome	Rhizosphere
472	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
473	3300044650	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E	Metagenome	Unclassified
474	3300044671	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E	Metagenome	Unclassified
475	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
476	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
477	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
478	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
479	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
480	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
481	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
482	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
483	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
484	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
485	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
486	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
487	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
488	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
489	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
490	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
491	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
492	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
493	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
494	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
495	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
496	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
497	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
498	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
499	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
500	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
501	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
502	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
503	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
504	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
505	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
506	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
507	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
508	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
509	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
510	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
511	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
512	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
513	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
514	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
515	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
516	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
517	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
518	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
519	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
520	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
521	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
522	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
523	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
524	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
525	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
526	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
527	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
528	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
529	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
530	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
531	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
532	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
533	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
534	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
535	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
536	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
537	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
538	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
539	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
540	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
541	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
542	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
543	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
544	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
545	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
546	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
547	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
548	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
549	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
550	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
551	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
552	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
553	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
554	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
555	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
556	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
557	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
558	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
559	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
560	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
561	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
562	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
563	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
564	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
565	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
566	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
567	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
568	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
569	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
570	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
571	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
572	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
573	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
574	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
575	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
576	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
577	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
578	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
579	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
580	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
581	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
582	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
583	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
584	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
585	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
586	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
587	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
588	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
589	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
590	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
591	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
592	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
593	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
594	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
595	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
596	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
597	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
598	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
599	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
600	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
601	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
602	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
603	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
604	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
605	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
606	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
607	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
608	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
609	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
610	3300049667	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control	Metagenome	Rhizosphere
611	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
612	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
613	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
614	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
615	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
616	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
617	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
618	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
619	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
620	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
621	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
622	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
623	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
624	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
625	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
626	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
627	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
628	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
629	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
630	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
631	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
632	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
633	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
634	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
635	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
636	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
637	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
638	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
639	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
640	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
641	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
642	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
643	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
644	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
645	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
646	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
647	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
648	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
649	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
650	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
651	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
652	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
653	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
654	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
655	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
656	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
657	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
658	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
659	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
660	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
661	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
662	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
663	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
664	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
665	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
666	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
667	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
668	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
669	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
670	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
671	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
672	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
673	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
674	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
675	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
676	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
677	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
678	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
679	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
680	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
681	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
682	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
683	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
684	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
685	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
686	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
687	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
688	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
689	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
690	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
691	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
692	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
693	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
694	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	89.36
Metatranscriptomes	0.13
Isolates	10.51

Biome Distribution

Category	Percentage (%)
Aerial Root	0.13
Bulb	0
Endosphere	22.84
Nodule	1.13
Rhizoplane	6.71
Rhizosphere	55.78
Stem	0
Stem Tuber	0
Unclassified	13.41

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_2098926	2162886007	Bacteria	2360
2	SwRhRL2b_contig_2200712	2162886007	Bacteria	2353
3	JGI24740J21852_10001628	3300001979	Bacteria	10346
4	JGI24740J21852_10002839	3300001979	Bacteria	7739
5	JGI24740J21852_10013472	3300001979	Bacteria	3048
6	JGI24740J21852_10036409	3300001979	Bacteria	1529
7	JGI24739J22299_10000354	3300001989	Bacteria	15714
8	JGI24737J22298_10002383	3300001990	Bacteria	6706
9	JGI24737J22298_10003480	3300001990	Bacteria	5553
10	JGI25156J39149_1008143	3300002705	Bacteria	2671
11	JGI25162J39368_1004372	3300002737	Bacteria	3325
12	JGI25152J39213_1005453	3300002773	Bacteria	3704
13	JGI25152J39213_1006465	3300002773	Bacteria	3190
14	JGI25150J39212_1002881	3300002774	Bacteria	4162
15	JGI25159J45721_1011896	3300002987	Bacteria	2105
16	JGI25159J45721_1011908	3300002987	Bacteria	2104
17	JGI25151J46595_10000664	3300003187	Bacteria	29294
18	JGI25151J46595_10007419	3300003187	Bacteria	5377
19	JGI25151J46595_10011006	3300003187	Bacteria	4177
20	JGI25151J46595_10016823	3300003187	Bacteria	3190
21	JGI25153J46596_10022717	3300003215	Bacteria	2303
22	JGI25153J46596_10025601	3300003215	Bacteria	2105
23	JGI25153J46596_10025649	3300003215	Bacteria	2102
24	JGI25153J46596_10031507	3300003215	Bacteria	1784
25	rootH1_10008601	3300003316	Bacteria	4939
26	rootH1_10009565	3300003316	Bacteria	5500
27	rootH1_10009565	3300003323	Bacteria	5356
28	rootH1_10088361	3300003316	Bacteria	2760
29	rootH2_10006506	3300003320	Bacteria	13860
30	rootL2_10000651	3300003322	Bacteria	23314
31	rootL2_10018460	3300003322	Bacteria	3337
32	rootL2_10070143	3300003322	Bacteria	8499
33	rootL2_10169569	3300003322	Bacteria	3669
34	rootL2_10199998	3300003322	Bacteria	1021
35	rootH1_10006604	3300003323	Bacteria	3627
36	rootH1_10039841	3300003316	Bacteria	6678
37	rootH1_10039841	3300003323	Bacteria	86560
38	rootH1_10041426	3300003323	Bacteria	2453
39	rootH1_10113531	3300003323	Bacteria	1559
40	JGI25160J50197_1019179	3300003354	Bacteria	2105
41	JGI25160J50197_1019183	3300003354	Bacteria	2104
42	JGI25161J50226_1011391	3300003374	Bacteria	1123
43	JGI25161J50226_1012563	3300003374	Bacteria	1009
44	Ga0006562J51391_1004720	3300003578	Bacteria	9199
45	JGI25404J52841_10002403	3300003659	Bacteria	3535
46	JGI25404J52841_10015372	3300003659	Bacteria	1661
47	Ga0055538_1000050	3300003751	Bacteria	130812
48	Ga0055538_1001037	3300003751	Bacteria	6303
49	Ga0055538_1002271	3300003751	Bacteria	2926
50	Ga0055539_1000074	3300003752	Bacteria	130812
51	Ga0055539_1000171	3300003752	Bacteria	57283
52	Ga0055539_1000185	3300003752	Bacteria	52003
53	Ga0055533_1000010	3300003756	Bacteria	491196
54	Ga0055533_1000081	3300003756	Bacteria	130812
55	Ga0055533_1002157	3300003756	Bacteria	4697
56	Ga0055532_1000006	3300003758	Bacteria	451244
57	Ga0055525_1000108	3300003759	Bacteria	130812
58	Ga0055525_1000966	3300003759	Bacteria	7848
59	Ga0055535_1000004	3300003761	Bacteria	451244
60	Ga0055535_1000084	3300003761	Bacteria	104652
61	Ga0055535_1000292	3300003761	Bacteria	52350
62	Ga0055542_1000033	3300003762	Bacteria	233997
63	Ga0055529_1000273	3300003763	Bacteria	61443
64	Ga0055529_1000828	3300003763	Bacteria	18291
65	Ga0055526_1000054	3300003771	Bacteria	113702
66	Ga0055526_1000535	3300003771	Bacteria	30070
67	Ga0055526_1022900	3300003771	Bacteria	2105
68	Ga0055526_1022908	3300003771	Bacteria	2104
69	Ga0055537_1009653	3300003773	Bacteria	2105
70	Ga0055524_1000864	3300003775	Bacteria	19828
71	Ga0055524_1005156	3300003775	Bacteria	5892
72	Ga0055524_1021887	3300003775	Bacteria	2105
73	Ga0055524_1021892	3300003775	Bacteria	2104
74	Ga0055536_1001382	3300003781	Bacteria	14722
75	Ga0055536_1002930	3300003781	Bacteria	9373
76	Ga0055536_1010724	3300003781	Bacteria	3596
77	Ga0055536_1032527	3300003781	Bacteria	1348
78	Ga0055534_1004166	3300003784	Bacteria	4277
79	Ga0055534_1005892	3300003784	Bacteria	3190
80	Ga0055528_1020870	3300003790	Bacteria	2105
81	Ga0055530_10004010	3300003791	Bacteria	7916
82	Ga0055530_10004105	3300003791	Bacteria	7739
83	Ga0055530_10004840	3300003791	Bacteria	6733
84	Ga0055530_10006778	3300003791	Bacteria	4996
85	Ga0055530_10009858	3300003791	Bacteria	3606
86	Ga0055540_1000733	3300003792	Bacteria	22290
87	Ga0055540_1008745	3300003792	Bacteria	3600
88	Ga0055540_1013411	3300003792	Bacteria	2505
89	Ga0055540_1016481	3300003792	Bacteria	2101
90	Ga0055540_1041648	3300003792	Bacteria	988
91	Ga0055531_10000329	3300003794	Bacteria	46869
92	Ga0055531_10001613	3300003794	Bacteria	16357
93	Ga0055531_10001667	3300003794	Bacteria	16000
94	Ga0055531_10002763	3300003794	Bacteria	11516
95	Ga0055531_10025988	3300003794	Bacteria	2104
96	Ga0055531_10026127	3300003794	Bacteria	2093
97	Ga0055541_1000052	3300003841	Bacteria	130812
98	Ga0055541_1002927	3300003841	Bacteria	3295
99	Ga0058692_1005047	3300003856	Bacteria	3811
100	Ga0055543_1001590	3300004625	Bacteria	8740
101	Ga0055543_1009170	3300004625	Bacteria	2145
102	Ga0055543_1009267	3300004625	Bacteria	2125
103	Ga0065165_1000079	3300005262	Bacteria	162095
104	Ga0065165_1000482	3300005262	Bacteria	61748
105	Ga0065165_1015015	3300005262	Bacteria	2974
106	Ga0065165_1021847	3300005262	Bacteria	2211
107	Ga0065165_1025074	3300005262	Bacteria	1991
108	Ga0065704_10077523	3300005289	Bacteria	4708
109	Ga0065704_10091080	3300005289	Bacteria	2742
110	Ga0065704_10191172	3300005289	Bacteria	1145
111	Ga0065707_10000531	3300005295	Bacteria	28166
112	Ga0070658_10181640	3300005327	Bacteria	1770
113	Ga0070658_10187675	3300005327	Bacteria	1742
114	Ga0070658_10305689	3300005327	Bacteria	1356
115	Ga0070690_100126686	3300005330	Bacteria	1720
116	Ga0070690_100221875	3300005330	Bacteria	1325
117	Ga0070690_100424813	3300005330	Bacteria	980
118	Ga0070670_100025988	3300005331	Bacteria	5039
119	Ga0070670_100367851	3300005331	Bacteria	1265
120	Ga0068869_100379290	3300005334	Bacteria	1158
121	Ga0070666_10139957	3300005335	Bacteria	1685
122	Ga0070666_10248856	3300005335	Bacteria	1258
123	Ga0070682_100004145	3300005337	Bacteria	8039
124	Ga0070682_100022477	3300005337	Bacteria	3736
125	Ga0070682_100049921	3300005337	Bacteria	2610
126	Ga0070660_100037197	3300005339	Bacteria	3690
127	Ga0070660_100368548	3300005339	Bacteria	1185
128	Ga0070660_100818675	3300005339	Bacteria	784
129	Ga0070689_100238407	3300005340	Bacteria	1497
130	Ga0070689_100344471	3300005340	Bacteria	1249
131	Ga0070687_100120914	3300005343	Bacteria	1498
132	Ga0070661_100000143	3300005344	Bacteria	58391
133	Ga0070661_100000336	3300005344	Bacteria	37535
134	Ga0070668_100132672	3300005347	Bacteria	2000
135	Ga0070668_100319489	3300005347	Bacteria	1307
136	Ga0070669_100000144	3300005353	Bacteria	63492
137	Ga0070669_100019206	3300005353	Bacteria	4882
138	Ga0070669_100063583	3300005353	Bacteria	2716
139	Ga0070675_100012564	3300005354	Bacteria	6639
140	Ga0070675_100112165	3300005354	Bacteria	2308
141	Ga0070671_100000030	3300005355	Bacteria	112182
142	Ga0070671_100010287	3300005355	Bacteria	7505
143	Ga0070674_100070064	3300005356	Bacteria	2476
144	Ga0070674_100097513	3300005356	Bacteria	2135
145	Ga0070674_100174562	3300005356	Bacteria	1641
146	Ga0070674_100488260	3300005356	Bacteria	1023
147	Ga0070659_100024982	3300005366	Unclassified	4585
148	Ga0070667_100000968	3300005367	Bacteria	26399
149	Ga0070667_100010769	3300005367	Bacteria	7557
150	Ga0070667_100012122	3300005367	Bacteria	7137
151	Ga0070667_100117075	3300005367	Bacteria	2314
152	Ga0070667_100290125	3300005367	Bacteria	1471
153	Ga0070667_100506406	3300005367	Bacteria	1107
154	Ga0070709_10134428	3300005434	Bacteria	1692
155	Ga0070709_10761378	3300005434	Bacteria	757
156	Ga0070713_100536246	3300005436	Bacteria	1107
157	Ga0070663_100000246	3300005455	Bacteria	27518
158	Ga0070663_100147199	3300005455	Bacteria	1803
159	Ga0070662_100348473	3300005457	Bacteria	1213
160	Ga0070662_100460863	3300005457	Bacteria	1056
161	Ga0070662_100473118	3300005457	Bacteria	1042
162	Ga0070662_100581041	3300005457	Bacteria	941
163	Ga0070681_10012756	3300005458	Bacteria	8338
164	Ga0068867_100149041	3300005459	Bacteria	1836
165	Ga0070685_10152152	3300005466	Bacteria	1467
166	Ga0070685_10157368	3300005466	Bacteria	1445
167	Ga0070706_100079983	3300005467	Bacteria	3026
168	Ga0070706_100631200	3300005467	Bacteria	995
169	Ga0070707_100235492	3300005468	Bacteria	1782
170	Ga0070679_100087379	3300005530	Bacteria	3105
171	Ga0070679_100137878	3300005530	Unclassified	2421
172	Ga0070679_100359727	3300005530	Bacteria	1403
173	Ga0068853_100012662	3300005539	Bacteria	6868
174	Ga0068853_100038274	3300005539	Bacteria	4084
175	Ga0068853_100054227	3300005539	Bacteria	3455
176	Ga0070672_100040886	3300005543	Bacteria	3561
177	Ga0070672_100089507	3300005543	Bacteria	2480
178	Ga0070665_100001180	3300005548	Bacteria	31967
179	Ga0070665_100020215	3300005548	Bacteria	6685
180	Ga0070665_100051090	3300005548	Bacteria	4147
181	Ga0070665_100109059	3300005548	Bacteria	2770
182	Ga0070665_100269103	3300005548	Bacteria	1706
183	Ga0070665_100490240	3300005548	Bacteria	1240
184	Ga0068855_100000137	3300005563	Bacteria	93126
185	Ga0068855_100003478	3300005563	Bacteria	19277
186	Ga0068855_100005033	3300005563	Bacteria	16129
187	Ga0068855_100024079	3300005563	Bacteria	7288
188	Ga0068855_100034832	3300005563	Bacteria	6001
189	Ga0068855_100448918	3300005563	Bacteria	1407
190	Ga0068855_100893859	3300005563	Bacteria	939
191	Ga0068855_101174978	3300005563	Bacteria	799
192	Ga0070664_100000122	3300005564	Bacteria	51758
193	Ga0070664_100018005	3300005564	Bacteria	5800
194	Ga0070664_100454240	3300005564	Bacteria	1177
195	Ga0068857_100045392	3300005577	Bacteria	3898
196	Ga0068857_100875281	3300005577	Bacteria	860
197	Ga0068854_100000585	3300005578	Bacteria	21723
198	Ga0068854_100026756	3300005578	Bacteria	3968
199	Ga0068856_100001446	3300005614	Bacteria	24888
200	Ga0068856_100253064	3300005614	Bacteria	1776
201	Ga0068856_100333839	3300005614	Bacteria	1534
202	Ga0068852_100024597	3300005616	Bacteria	4870
203	Ga0068852_100078439	3300005616	Bacteria	2922
204	Ga0068852_101001745	3300005616	Bacteria	854
205	Ga0068859_100017816	3300005617	Bacteria	7140
206	Ga0068864_100000060	3300005618	Bacteria	124506
207	Ga0068864_100003823	3300005618	Bacteria	12412
208	Ga0068864_100071799	3300005618	Bacteria	3015
209	Ga0068864_100075922	3300005618	Bacteria	2935
210	Ga0068864_100107940	3300005618	Bacteria	2477
211	Ga0068864_100767000	3300005618	Bacteria	946
212	Ga0068861_100058408	3300005719	Bacteria	2950
213	Ga0068861_100062352	3300005719	Bacteria	2864
214	Ga0068851_10021443	3300005834	Bacteria	3137
215	Ga0068851_10027742	3300005834	Bacteria	2792
216	Ga0068851_10138221	3300005834	Bacteria	1323
217	Ga0068870_10029378	3300005840	Bacteria	2769
218	Ga0068863_100000023	3300005841	Bacteria	186490
219	Ga0068863_100000106	3300005841	Bacteria	90344
220	Ga0068863_100006027	3300005841	Bacteria	11892
221	Ga0068863_100039641	3300005841	Bacteria	4481
222	Ga0068863_100057377	3300005841	Bacteria	3685
223	Ga0068863_100139249	3300005841	Bacteria	2319
224	Ga0068858_100003851	3300005842	Bacteria	14831
225	Ga0068858_100011301	3300005842	Bacteria	8435
226	Ga0068860_100000386	3300005843	Bacteria	57855
227	Ga0068862_100096485	3300005844	Bacteria	2581
228	Ga0068862_100480591	3300005844	Bacteria	1176
229	Ga0068862_100643943	3300005844	Bacteria	1022
230	Ga0081455_10002149	3300005937	Bacteria	23509
231	Ga0081540_1038789	3300005983	Bacteria	2506
232	Ga0075365_10041974	3300006038	Bacteria	2989
233	Ga0075368_10074369	3300006042	Bacteria	1376
234	Ga0075363_100001701	3300006048	Bacteria	8542
235	Ga0075363_100189959	3300006048	Bacteria	1171
236	Ga0075362_10016368	3300006177	Bacteria	3035
237	Ga0075362_10078028	3300006177	Bacteria	1523
238	Ga0075362_10144914	3300006177	Bacteria	1137
239	Ga0075367_10106510	3300006178	Bacteria	1718
240	Ga0075369_10002187	3300006186	Bacteria	6910
241	Ga0075369_10110967	3300006186	Bacteria	1236
242	Ga0075366_10018499	3300006195	Bacteria	4023
243	Ga0075366_10033130	3300006195	Bacteria	3043
244	Ga0075366_10046508	3300006195	Bacteria	2571
245	Ga0075366_10050209	3300006195	Bacteria	2476
246	Ga0075366_10085310	3300006195	Bacteria	1889
247	Ga0075366_10121431	3300006195	Bacteria	1575
248	Ga0075366_10162792	3300006195	Bacteria	1352
249	Ga0075370_10002131	3300006353	Bacteria	9041
250	Ga0075370_10005249	3300006353	Bacteria	6413
251	Ga0075370_10006660	3300006353	Bacteria	5827
252	Ga0075370_10021246	3300006353	Bacteria	3556
253	Ga0075370_10024466	3300006353	Bacteria	3336
254	Ga0075370_10024554	3300006353	Bacteria	3331
255	Ga0075370_10030061	3300006353	Bacteria	3030
256	Ga0075370_10058295	3300006353	Bacteria	2196
257	Ga0075370_10065628	3300006353	Bacteria	2070
258	Ga0075370_10072767	3300006353	Bacteria	1968
259	Ga0075370_10161343	3300006353	Bacteria	1316
260	Ga0068871_100491345	3300006358	Bacteria	1105
261	Ga0075428_100980314	3300006844	Bacteria	895
262	Ga0075430_100033792	3300006846	Bacteria	4340
263	Ga0075430_100402162	3300006846	Bacteria	1130
264	Ga0075431_100005327	3300006847	Bacteria	12685
265	Ga0075431_100626095	3300006847	Bacteria	1058
266	Ga0075429_100112186	3300006880	Bacteria	2383
267	Ga0068865_100511590	3300006881	Bacteria	1003
268	Ga0097620_100017816	3300006931	Bacteria	7140
269	Ga0099823_1000002	3300006944	Bacteria	212272
270	Ga0079104_1000020	3300006946	Bacteria	256848
271	Ga0105251_10000122	3300009011	Bacteria	78326
272	Ga0105251_10003140	3300009011	Bacteria	12255
273	Ga0105244_10000183	3300009036	Bacteria	63415
274	Ga0105244_10001568	3300009036	Bacteria	18161
275	Ga0105244_10013403	3300009036	Bacteria	4795
276	Ga0105250_10000014	3300009092	Bacteria	268458
277	Ga0105250_10000020	3300009092	Bacteria	242010
278	Ga0105250_10000026	3300009092	Bacteria	213233
279	Ga0105250_10000202	3300009092	Bacteria	50535
280	Ga0105250_10012457	3300009092	Bacteria	3510
281	Ga0105250_10019453	3300009092	Bacteria	2745
282	Ga0105250_10030804	3300009092	Bacteria	2156
283	Ga0105240_10009574	3300009093	Bacteria	13716
284	Ga0105240_10045798	3300009093	Bacteria	5547
285	Ga0105240_10052688	3300009093	Bacteria	5113
286	Ga0105240_10075218	3300009093	Bacteria	4166
287	Ga0105240_10096519	3300009093	Bacteria	3602
288	Ga0105240_10167101	3300009093	Bacteria	2608
289	Ga0105240_10360683	3300009093	Bacteria	1646
290	Ga0111539_10002755	3300009094	Bacteria	23313
291	Ga0111539_10027511	3300009094	Bacteria	6945
292	Ga0111539_10108548	3300009094	Bacteria	3257
293	Ga0111539_10196470	3300009094	Bacteria	2353
294	Ga0111539_11172312	3300009094	Bacteria	892
295	Ga0105245_10898373	3300009098	Bacteria	927
296	Ga0105247_10140798	3300009101	Unclassified	1580
297	Ga0114129_10077926	3300009147	Bacteria	4610
298	Ga0114129_10620130	3300009147	Bacteria	1399
299	Ga0105243_10002185	3300009148	Bacteria	16494
300	Ga0105243_10015574	3300009148	Bacteria	5747
301	Ga0105243_10023123	3300009148	Bacteria	4728
302	Ga0105242_10107117	3300009176	Bacteria	2377
303	Ga0105248_10001464	3300009177	Bacteria	26304
304	Ga0105248_10008111	3300009177	Bacteria	11528
305	Ga0105248_10143218	3300009177	Bacteria	2697
306	Ga0105248_10283929	3300009177	Unclassified	1863
307	Ga0105248_11500867	3300009177	Bacteria	763
308	Ga0105237_10000064	3300009545	Bacteria	139463
309	Ga0105237_10001399	3300009545	Bacteria	31864
310	Ga0105237_10034779	3300009545	Bacteria	5099
311	Ga0105237_10099200	3300009545	Bacteria	2904
312	Ga0105238_10000869	3300009551	Bacteria	31184
313	Ga0105238_10048074	3300009551	Bacteria	4300
314	Ga0105238_10050635	3300009551	Bacteria	4181
315	Ga0105238_10173229	3300009551	Bacteria	2134
316	Ga0105249_10000696	3300009553	Bacteria	30523
317	Ga0105249_10149437	3300009553	Bacteria	2248
318	Ga0105029_100139	3300009984	Bacteria	3636
319	Ga0105239_10002059	3300010375	Bacteria	26053
320	Ga0105239_10011067	3300010375	Bacteria	10072
321	Ga0105239_10030271	3300010375	Bacteria	5950
322	Ga0105239_10037060	3300010375	Bacteria	5349
323	Ga0105239_10340355	3300010375	Bacteria	1693
324	Ga0157319_1000007	3300012497	Bacteria	318528
325	Ga0157314_1000538	3300012500	Bacteria	3567
326	Ga0157373_10000373	3300013100	Bacteria	35806
327	Ga0157373_10014267	3300013100	Bacteria	5828
328	Ga0157373_10031106	3300013100	Bacteria	3841
329	Ga0157373_10267509	3300013100	Bacteria	1210
330	Ga0157371_10000072	3300013102	Bacteria	163917
331	Ga0157371_10000666	3300013102	Bacteria	40804
332	Ga0157370_10000031	3300013104	Bacteria	139879
333	Ga0157370_10122058	3300013104	Bacteria	2433
334	Ga0157370_10267506	3300013104	Bacteria	1580
335	Ga0157369_10002342	3300013105	Bacteria	22793
336	Ga0157369_10039882	3300013105	Bacteria	5130
337	Ga0157369_10228078	3300013105	Bacteria	1948
338	Ga0157378_10315556	3300013297	Bacteria	1517
339	Ga0157378_10931135	3300013297	Bacteria	901
340	Ga0163162_10149935	3300013306	Bacteria	2449
341	Ga0163162_10195180	3300013306	Bacteria	2153
342	Ga0163162_10388361	3300013306	Bacteria	1529
343	Ga0163162_10396011	3300013306	Bacteria	1514
344	Ga0163162_10873449	3300013306	Bacteria	1014
345	Ga0157372_10001411	3300013307	Bacteria	25934
346	Ga0157372_10009743	3300013307	Bacteria	10218
347	Ga0157372_11105227	3300013307	Bacteria	917
348	Ga0157375_10081033	3300013308	Bacteria	3285
349	Ga0157375_10205744	3300013308	Bacteria	2124
350	Ga0157375_10336546	3300013308	Bacteria	1675
351	Ga0163163_10049209	3300014325	Bacteria	4147
352	Ga0163163_10086160	3300014325	Bacteria	3150
353	Ga0157380_10000318	3300014326	Bacteria	29048
354	Ga0157380_10050446	3300014326	Bacteria	3287
355	Ga0157380_10059205	3300014326	Bacteria	3055
356	Ga0157380_10092055	3300014326	Bacteria	2504
357	Ga0157380_10134749	3300014326	Bacteria	2112
358	Ga0157380_10169578	3300014326	Bacteria	1905
359	Ga0157380_10189877	3300014326	Bacteria	1813
360	Ga0182008_10000845	3300014497	Bacteria	21349
361	Ga0182008_10002275	3300014497	Bacteria	12122
362	Ga0182008_10006934	3300014497	Bacteria	6288
363	Ga0182008_10019825	3300014497	Bacteria	3467
364	Ga0182008_10254969	3300014497	Bacteria	906
365	Ga0157377_10300712	3300014745	Bacteria	1059
366	Ga0157379_10065925	3300014968	Bacteria	3237
367	Ga0157379_10253288	3300014968	Bacteria	1599
368	Ga0157376_10153295	3300014969	Bacteria	2080
369	Ga0157376_10241125	3300014969	Bacteria	1684
370	Ga0157376_10320551	3300014969	Bacteria	1473
371	Ga0182006_1001179	3300015261	Bacteria	16418
372	Ga0182006_1001945	3300015261	Bacteria	11727
373	Ga0182006_1005176	3300015261	Bacteria	6257
374	Ga0182006_1062502	3300015261	Bacteria	1401
375	Ga0182007_10001682	3300015262	Bacteria	11711
376	Ga0182007_10015207	3300015262	Bacteria	2877
377	Ga0182007_10036092	3300015262	Bacteria	1664
378	Ga0183365_10001	3300015684	Bacteria	2090444
379	Ga0163161_10000128	3300017792	Bacteria	70965
380	Ga0163161_10003865	3300017792	Bacteria	10501
381	Ga0163161_10012215	3300017792	Bacteria	5957
382	Ga0163161_10101407	3300017792	Bacteria	2143
383	Ga0163161_10147505	3300017792	Bacteria	1786
384	Ga0163161_10158175	3300017792	Bacteria	1726
385	Ga0163161_10221313	3300017792	Bacteria	1466
386	Ga0163161_10657483	3300017792	Bacteria	869
387	Ga0154015_1468224	3300020610	Bacteria	4783
388	Ga0213872_10009892	3300021361	Bacteria	4555
389	Ga0213876_10006269	3300021384	Bacteria	6483
390	Ga0209436_108427	3300025208	Bacteria	2053
391	Ga0209436_112861	3300025208	Bacteria	1400
392	Ga0209784_100002	3300025224	Bacteria	1753105
393	Ga0209784_100006	3300025224	Bacteria	930704
394	Ga0209784_100391	3300025224	Bacteria	20022
395	Ga0209784_100520	3300025224	Bacteria	14622
396	Ga0209566_100002	3300025225	Bacteria	2614868
397	Ga0209566_100003	3300025225	Bacteria	1753105
398	Ga0209566_101933	3300025225	Bacteria	4510
399	Ga0209566_101963	3300025225	Bacteria	4420
400	Ga0209674_100003	3300025226	Bacteria	2196646
401	Ga0209674_100004	3300025226	Bacteria	1753105
402	Ga0209674_100010	3300025226	Bacteria	1038638
403	Ga0209674_103796	3300025226	Bacteria	2662
404	Ga0209672_100228	3300025228	Bacteria	42777
405	Ga0209672_100448	3300025228	Bacteria	23309
406	Ga0209147_100015	3300025229	Bacteria	565073
407	Ga0209147_101646	3300025229	Bacteria	7374
408	Ga0209563_100004	3300025230	Bacteria	1814108
409	Ga0209563_100006	3300025230	Bacteria	1753105
410	Ga0209563_100049	3300025230	Bacteria	358472
411	Ga0209563_110446	3300025230	Bacteria	1353
412	Ga0209437_100272	3300025233	Bacteria	77336
413	Ga0209258_100021	3300025242	Bacteria	565073
414	Ga0209258_100089	3300025242	Bacteria	234040
415	Ga0209258_100128	3300025242	Bacteria	177216
416	Ga0207425_1000257	3300025245	Bacteria	39389
417	Ga0207425_1000422	3300025245	Bacteria	28344
418	Ga0207425_1001684	3300025245	Bacteria	8813
419	Ga0207425_1008063	3300025245	Bacteria	2728
420	Ga0209677_100003	3300025253	Bacteria	1753105
421	Ga0209677_100007	3300025253	Bacteria	1021332
422	Ga0209677_100050	3300025253	Bacteria	176828
423	Ga0209677_107578	3300025253	Bacteria	2273
424	Ga0209148_1000097	3300025254	Bacteria	234049
425	Ga0209148_1002543	3300025254	Bacteria	6086
426	Ga0209759_1000926	3300025256	Bacteria	21318
427	Ga0209759_1001118	3300025256	Bacteria	17255
428	Ga0209759_1018263	3300025256	Bacteria	1699
429	Ga0209129_1000033	3300025258	Bacteria	336894
430	Ga0209129_1000222	3300025258	Bacteria	64597
431	Ga0209129_1001977	3300025258	Bacteria	10673
432	Ga0209129_1006040	3300025258	Bacteria	4059
433	Ga0209129_1007416	3300025258	Bacteria	3273
434	Ga0209233_1008699	3300025261	Bacteria	3121
435	Ga0209565_1000516	3300025263	Bacteria	27851
436	Ga0209565_1001404	3300025263	Bacteria	10689
437	Ga0209455_1000028	3300025272	Bacteria	565073
438	Ga0209455_1000116	3300025272	Bacteria	177216
439	Ga0209673_1000899	3300025273	Bacteria	38238
440	Ga0209673_1001394	3300025273	Bacteria	23565
441	Ga0209673_1005423	3300025273	Bacteria	6412
442	Ga0209673_1014350	3300025273	Bacteria	3068
443	Ga0209673_1028484	3300025273	Bacteria	1797
444	Ga0209130_1000105	3300025284	Bacteria	135199
445	Ga0209130_1000615	3300025284	Bacteria	34069
446	Ga0209130_1000980	3300025284	Bacteria	22384
447	Ga0209130_1029719	3300025284	Bacteria	1136
448	Ga0209675_1000588	3300025291	Bacteria	26180
449	Ga0209675_1001765	3300025291	Bacteria	11847
450	Ga0209675_1005310	3300025291	Bacteria	5426
451	Ga0209676_1000260	3300025292	Bacteria	111683
452	Ga0209676_1000376	3300025292	Bacteria	82203
453	Ga0209676_1000615	3300025292	Bacteria	52037
454	Ga0209676_1001304	3300025292	Bacteria	25409
455	Ga0209676_1004531	3300025292	Bacteria	7698
456	Ga0209676_1017068	3300025292	Bacteria	2586
457	Ga0209676_1035980	3300025292	Bacteria	1446
458	Ga0209025_1000193	3300025294	Bacteria	149339
459	Ga0209025_1000221	3300025294	Bacteria	135793
460	Ga0209025_1001070	3300025294	Bacteria	39701
461	Ga0209025_1009557	3300025294	Bacteria	6733
462	Ga0209025_1023791	3300025294	Bacteria	3187
463	Ga0209025_1036737	3300025294	Bacteria	2187
464	Ga0209025_1041236	3300025294	Bacteria	1980
465	Ga0209564_1000030	3300025295	Bacteria	503296
466	Ga0209564_1000042	3300025295	Bacteria	392805
467	Ga0209564_1000151	3300025295	Bacteria	168783
468	Ga0209564_1000246	3300025295	Bacteria	117096
469	Ga0209564_1000498	3300025295	Bacteria	64577
470	Ga0209758_1000027	3300025297	Bacteria	549650
471	Ga0209758_1000379	3300025297	Bacteria	77337
472	Ga0209758_1000414	3300025297	Bacteria	72487
473	Ga0209758_1000800	3300025297	Bacteria	44656
474	Ga0209758_1014868	3300025297	Bacteria	4091
475	Ga0209758_1048911	3300025297	Bacteria	1498
476	Ga0209050_1000515	3300025298	Bacteria	65209
477	Ga0209050_1000600	3300025298	Bacteria	57329
478	Ga0209050_1000737	3300025298	Bacteria	47468
479	Ga0209050_1000977	3300025298	Bacteria	36542
480	Ga0209050_1001487	3300025298	Bacteria	24916
481	Ga0209050_1002014	3300025298	Bacteria	18937
482	Ga0209050_1002366	3300025298	Bacteria	16428
483	Ga0209050_1018494	3300025298	Bacteria	2705
484	Ga0209256_1000069	3300025299	Bacteria	245640
485	Ga0209256_1000506	3300025299	Bacteria	57382
486	Ga0209256_1001426	3300025299	Bacteria	24827
487	Ga0209256_1002066	3300025299	Bacteria	17690
488	Ga0209256_1012057	3300025299	Bacteria	3368
489	Ga0207426_1000027	3300025302	Bacteria	513176
490	Ga0207426_1000859	3300025302	Bacteria	31835
491	Ga0209051_1000004	3300025303	Bacteria	1155596
492	Ga0209051_1000319	3300025303	Bacteria	72894
493	Ga0209051_1000637	3300025303	Bacteria	40331
494	Ga0209051_1000707	3300025303	Bacteria	36542
495	Ga0209051_1000832	3300025303	Bacteria	31807
496	Ga0209051_1001383	3300025303	Bacteria	20933
497	Ga0209051_1005989	3300025303	Bacteria	6950
498	Ga0209051_1010973	3300025303	Bacteria	4518
499	Ga0209051_1012359	3300025303	Bacteria	4137
500	Ga0209051_1044584	3300025303	Bacteria	1543
501	Ga0209051_1053517	3300025303	Bacteria	1325
502	Ga0209257_1000063	3300025304	Bacteria	359089
503	Ga0209257_1000281	3300025304	Bacteria	114413
504	Ga0209257_1000698	3300025304	Bacteria	52037
505	Ga0209257_1001403	3300025304	Bacteria	28763
506	Ga0209257_1001995	3300025304	Bacteria	21901
507	Ga0209257_1002063	3300025304	Bacteria	21217
508	Ga0209257_1002789	3300025304	Bacteria	16469
509	Ga0209257_1004895	3300025304	Bacteria	9886
510	Ga0209257_1010059	3300025304	Bacteria	4894
511	Ga0209257_1010109	3300025304	Bacteria	4867
512	Ga0209257_1044583	3300025304	Bacteria	1293
513	Ga0207656_10077272	3300025321	Bacteria	1490
514	Ga0207656_10089035	3300025321	Bacteria	1398
515	Ga0207696_1000003	3300025711	Bacteria	860639
516	Ga0207696_1000036	3300025711	Bacteria	337736
517	Ga0207696_1000058	3300025711	Bacteria	248495
518	Ga0207696_1000059	3300025711	Bacteria	245763
519	Ga0207696_1000087	3300025711	Bacteria	194367
520	Ga0207655_1000370	3300025728	Bacteria	63426
521	Ga0207655_1000566	3300025728	Bacteria	45937
522	Ga0207655_1002256	3300025728	Bacteria	15935
523	Ga0207655_1003494	3300025728	Bacteria	11661
524	Ga0207655_1008596	3300025728	Bacteria	6459
525	Ga0207655_1015935	3300025728	Bacteria	4143
526	Ga0207655_1018554	3300025728	Bacteria	3682
527	Ga0207713_1000005	3300025735	Bacteria	649958
528	Ga0207713_1000006	3300025735	Bacteria	586163
529	Ga0207682_10071482	3300025893	Bacteria	1471
530	Ga0207642_10223286	3300025899	Bacteria	1054
531	Ga0207710_10073361	3300025900	Bacteria	1574
532	Ga0207647_10003146	3300025904	Bacteria	12384
533	Ga0207643_10018777	3300025908	Bacteria	3787
534	Ga0207643_10041521	3300025908	Bacteria	2592
535	Ga0207705_10148015	3300025909	Bacteria	1758
536	Ga0207705_10198312	3300025909	Bacteria	1520
537	Ga0207707_10034512	3300025912	Unclassified	4427
538	Ga0207707_10637653	3300025912	Bacteria	899
539	Ga0207695_10002043	3300025913	Bacteria	30943
540	Ga0207695_10002542	3300025913	Bacteria	26794
541	Ga0207695_10003541	3300025913	Bacteria	21873
542	Ga0207695_10008561	3300025913	Bacteria	12783
543	Ga0207695_10048835	3300025913	Bacteria	4466
544	Ga0207695_10080109	3300025913	Bacteria	3308
545	Ga0207695_10187589	3300025913	Bacteria	1986
546	Ga0207671_10000061	3300025914	Bacteria	175061
547	Ga0207671_10001933	3300025914	Bacteria	22965
548	Ga0207671_10062971	3300025914	Bacteria	2755
549	Ga0207660_10271063	3300025917	Bacteria	1345
550	Ga0207660_10793860	3300025917	Bacteria	773
551	Ga0207657_10230650	3300025919	Bacteria	1481
552	Ga0207649_10000449	3300025920	Bacteria	29607
553	Ga0207649_10000628	3300025920	Bacteria	23646
554	Ga0207652_10003276	3300025921	Bacteria	13417
555	Ga0207652_10130950	3300025921	Unclassified	2237
556	Ga0207646_10330701	3300025922	Bacteria	1377
557	Ga0207681_10000146	3300025923	Bacteria	58869
558	Ga0207681_10257748	3300025923	Bacteria	1364
559	Ga0207694_10002124	3300025924	Bacteria	16322
560	Ga0207694_10009148	3300025924	Bacteria	7478
561	Ga0207694_10034464	3300025924	Bacteria	3881
562	Ga0207694_10358221	3300025924	Bacteria	1208
563	Ga0207694_10549552	3300025924	Bacteria	969
564	Ga0207659_10041497	3300025926	Bacteria	3222
565	Ga0207659_10076934	3300025926	Bacteria	2455
566	Ga0207659_10118454	3300025926	Bacteria	2025
567	Ga0207644_10000011	3300025931	Bacteria	223950
568	Ga0207644_10005239	3300025931	Bacteria	8465
569	Ga0207690_10126842	3300025932	Bacteria	1862
570	Ga0207706_10078281	3300025933	Bacteria	2908
571	Ga0207706_10162445	3300025933	Bacteria	1963
572	Ga0207709_10000230	3300025935	Bacteria	70768
573	Ga0207709_10000240	3300025935	Bacteria	68308
574	Ga0207709_10000267	3300025935	Bacteria	61457
575	Ga0207709_10009269	3300025935	Bacteria	5421
576	Ga0207670_10207707	3300025936	Bacteria	1491
577	Ga0207670_10224710	3300025936	Bacteria	1439
578	Ga0207669_10094207	3300025937	Bacteria	1959
579	Ga0207669_10344976	3300025937	Bacteria	1148
580	Ga0207669_10439834	3300025937	Bacteria	1031
581	Ga0207669_10459202	3300025937	Bacteria	1011
582	Ga0207669_10529495	3300025937	Bacteria	947
583	Ga0207704_10028332	3300025938	Bacteria	3106
584	Ga0207704_10193128	3300025938	Bacteria	1483
585	Ga0207691_10025352	3300025940	Bacteria	5569
586	Ga0207691_10032522	3300025940	Bacteria	4862
587	Ga0207711_10001333	3300025941	Bacteria	23353
588	Ga0207711_10004083	3300025941	Bacteria	12527
589	Ga0207711_10177295	3300025941	Bacteria	1937
590	Ga0207711_10244749	3300025941	Unclassified	1645
591	Ga0207711_10683467	3300025941	Bacteria	957
592	Ga0207689_10014440	3300025942	Bacteria	6718
593	Ga0207661_10189183	3300025944	Bacteria	1804
594	Ga0207679_10000007	3300025945	Bacteria	460140
595	Ga0207679_10000107	3300025945	Bacteria	68403
596	Ga0207679_10351913	3300025945	Bacteria	1284
597	Ga0207679_10607275	3300025945	Bacteria	986
598	Ga0207667_10000112	3300025949	Bacteria	131462
599	Ga0207667_10000140	3300025949	Bacteria	109932
600	Ga0207667_10000186	3300025949	Bacteria	90817
601	Ga0207667_10010966	3300025949	Bacteria	10562
602	Ga0207667_10135438	3300025949	Bacteria	2536
603	Ga0207667_10309729	3300025949	Bacteria	1613
604	Ga0207667_10577962	3300025949	Bacteria	1134
605	Ga0207667_10734050	3300025949	Bacteria	988
606	Ga0207712_10000704	3300025961	Bacteria	25812
607	Ga0207668_10000154	3300025972	Bacteria	47517
608	Ga0207640_10000036	3300025981	Bacteria	111085
609	Ga0207640_10000107	3300025981	Bacteria	63143
610	Ga0207658_10001008	3300025986	Bacteria	23029
611	Ga0207658_10012500	3300025986	Bacteria	5799
612	Ga0207658_10014272	3300025986	Bacteria	5440
613	Ga0207658_10183420	3300025986	Bacteria	1734
614	Ga0207658_10444472	3300025986	Bacteria	1147
615	Ga0207703_10000571	3300026035	Bacteria	37816
616	Ga0207703_10001573	3300026035	Bacteria	20694
617	Ga0207703_10035340	3300026035	Bacteria	3971
618	Ga0207703_10398036	3300026035	Bacteria	1277
619	Ga0207639_10001769	3300026041	Bacteria	14537
620	Ga0207639_10164674	3300026041	Bacteria	1872
621	Ga0207639_10486604	3300026041	Bacteria	1125
622	Ga0207678_10000207	3300026067	Bacteria	51939
623	Ga0207678_10035033	3300026067	Bacteria	4370
624	Ga0207678_10191397	3300026067	Bacteria	1748
625	Ga0207708_10032445	3300026075	Bacteria	3966
626	Ga0207708_10066642	3300026075	Bacteria	2753
627	Ga0207708_10068470	3300026075	Bacteria	2717
628	Ga0207702_10000260	3300026078	Bacteria	61036
629	Ga0207702_10064551	3300026078	Bacteria	3133
630	Ga0207641_10000067	3300026088	Bacteria	155379
631	Ga0207641_10000733	3300026088	Bacteria	35188
632	Ga0207641_10042394	3300026088	Bacteria	3818
633	Ga0207641_10117312	3300026088	Bacteria	2370
634	Ga0207641_10225248	3300026088	Bacteria	1741
635	Ga0207641_10534553	3300026088	Bacteria	1142
636	Ga0207648_10024168	3300026089	Bacteria	5429
637	Ga0207648_10053236	3300026089	Bacteria	3538
638	Ga0207648_10126989	3300026089	Bacteria	2244
639	Ga0207676_10001977	3300026095	Bacteria	14926
640	Ga0207676_10105688	3300026095	Bacteria	2344
641	Ga0207676_10211368	3300026095	Bacteria	1721
642	Ga0207674_10000279	3300026116	Bacteria	64457
643	Ga0207674_10153316	3300026116	Bacteria	2260
644	Ga0207674_10208918	3300026116	Bacteria	1901
645	Ga0207674_10258081	3300026116	Bacteria	1690
646	Ga0207675_100000016	3300026118	Bacteria	126353
647	Ga0207675_100006073	3300026118	Bacteria	11494
648	Ga0207675_100039313	3300026118	Bacteria	4415
649	Ga0207675_100080069	3300026118	Bacteria	3062
650	Ga0207675_100080544	3300026118	Bacteria	3053
651	Ga0207675_100724311	3300026118	Bacteria	1005
652	Ga0207683_10019338	3300026121	Bacteria	5815
653	Ga0207683_10168106	3300026121	Bacteria	1985
654	Ga0207683_10235521	3300026121	Bacteria	1670
655	Ga0207683_10720193	3300026121	Bacteria	925
656	Ga0207698_10027127	3300026142	Bacteria	4063
657	Ga0207698_10037461	3300026142	Bacteria	3572
658	Ga0207698_10142085	3300026142	Bacteria	2070
659	Ga0207698_10148798	3300026142	Bacteria	2029
660	Ga0207698_10669576	3300026142	Bacteria	1030
661	Ga0209281_1000002	3300027111	Bacteria	1924012
662	Ga0209389_1008091	3300027296	Bacteria	9328
663	Ga0209371_1000153	3300027312	Bacteria	108815
664	Ga0209371_1000598	3300027312	Bacteria	32318
665	Ga0209371_1001807	3300027312	Bacteria	13359
666	Ga0207428_10022957	3300027907	Bacteria	5254
667	Ga0207428_10093414	3300027907	Bacteria	2333
668	Ga0268266_10000812	3300028379	Bacteria	41107
669	Ga0268266_10005024	3300028379	Bacteria	12491
670	Ga0268266_10026742	3300028379	Bacteria	4910
671	Ga0268266_10329645	3300028379	Bacteria	1430
672	Ga0268265_10061915	3300028380	Bacteria	2873
673	Ga0268265_10135462	3300028380	Bacteria	2054
674	Ga0268265_10830045	3300028380	Bacteria	903
675	Ga0268264_10000040	3300028381	Bacteria	373714
676	Ga0265337_1008277	3300028556	Bacteria	3797
677	Ga0265334_10000732	3300028573	Bacteria	16475
678	Ga0265336_10000006	3300028666	Bacteria	348453
679	Ga0307515_10000567	3300028794	Bacteria	87086
680	Ga0307515_10001286	3300028794	Bacteria	56985
681	Ga0307515_10001764	3300028794	Bacteria	48206
682	Ga0307515_10032674	3300028794	Bacteria	8606
683	Ga0265338_10018208	3300028800	Bacteria	7530
684	Ga0265338_10171367	3300028800	Bacteria	1664
685	Ga0265324_10006334	3300029957	Bacteria	4953
686	Ga0268256_1001577	3300030500	Bacteria	13359
687	Ga0268256_1002302	3300030500	Bacteria	9895
688	Ga0268256_1016738	3300030500	Bacteria	2089
689	Ga0307511_10114381	3300030521	Bacteria	1701
690	Ga0307512_10021151	3300030522	Bacteria	5870
691	Ga0316181_1084923	3300030744	Bacteria	7969
692	Ga0316182_1321233	3300030745	Bacteria	1679
693	Ga0265328_10100420	3300031239	Bacteria	1071
694	Ga0265339_10019383	3300031249	Bacteria	3995
695	Ga0265327_10000602	3300031251	Bacteria	59632
696	Ga0307513_10002614	3300031456	Bacteria	24859
697	Ga0307513_10012566	3300031456	Bacteria	10441
698	Ga0307513_10015253	3300031456	Bacteria	9325
699	Ga0307513_10016687	3300031456	Bacteria	8841
700	Ga0307513_10067713	3300031456	Bacteria	3744
701	Ga0307513_10228530	3300031456	Bacteria	1675
702	Ga0307513_10376312	3300031456	Bacteria	1161
703	Ga0307513_10440632	3300031456	Bacteria	1029
704	Ga0307509_10000635	3300031507	Bacteria	59944
705	Ga0307509_10022947	3300031507	Bacteria	7018
706	Ga0307509_10038589	3300031507	Bacteria	5209
707	Ga0307509_10139951	3300031507	Bacteria	2358
708	Ga0307509_10300989	3300031507	Bacteria	1352
709	Ga0307408_100000222	3300031548	Bacteria	60417
710	Ga0307408_100001360	3300031548	Bacteria	18267
711	Ga0307408_100069150	3300031548	Bacteria	2603
712	Ga0307408_100166939	3300031548	Bacteria	1754
713	Ga0307508_10000133	3300031616	Bacteria	87867
714	Ga0307508_10193959	3300031616	Bacteria	1632
715	Ga0307508_10412641	3300031616	Bacteria	942
716	Ga0307514_10000897	3300031649	Bacteria	46121
717	Ga0307514_10004805	3300031649	Bacteria	12315
718	Ga0307514_10208775	3300031649	Bacteria	1216
719	Ga0265314_10082752	3300031711	Bacteria	2111
720	Ga0307516_10000253	3300031730	Bacteria	68852
721	Ga0307516_10003782	3300031730	Bacteria	19218
722	Ga0307516_10013972	3300031730	Bacteria	8521
723	Ga0307516_10109280	3300031730	Bacteria	2571
724	Ga0307516_10203790	3300031730	Bacteria	1696
725	Ga0307516_10276172	3300031730	Bacteria	1364
726	Ga0307405_10155518	3300031731	Bacteria	1613
727	Ga0307405_10167644	3300031731	Bacteria	1563
728	Ga0307413_10118041	3300031824	Bacteria	1790
729	Ga0307413_10404527	3300031824	Bacteria	1070
730	Ga0307410_10037219	3300031852	Bacteria	3176
731	Ga0307410_10432838	3300031852	Bacteria	1069
732	Ga0307410_10979206	3300031852	Bacteria	728
733	Ga0307406_10002944	3300031901	Bacteria	9274
734	Ga0307406_10021794	3300031901	Bacteria	3795
735	Ga0307412_10188922	3300031911	Bacteria	1556
736	Ga0307409_100006964	3300031995	Bacteria	6715
737	Ga0307409_100095462	3300031995	Bacteria	2450
738	Ga0307416_100038054	3300032002	Bacteria	3708
739	Ga0307416_100053591	3300032002	Bacteria	3237
740	Ga0307416_100209534	3300032002	Bacteria	1858
741	Ga0307414_10253094	3300032004	Bacteria	1465
742	Ga0307414_10663257	3300032004	Bacteria	941
743	Ga0307411_10001084	3300032005	Bacteria	10578
744	Ga0307411_10226476	3300032005	Bacteria	1454
745	Ga0307411_10282813	3300032005	Bacteria	1321
746	Ga0307411_10805454	3300032005	Bacteria	827
747	Ga0307415_100029481	3300032126	Bacteria	3508
748	Ga0373938_0010704	3300034957	Bacteria	1692
749	Ga0373934_0011434	3300035086	Bacteria	3339
750	Ga0373952_0046388	3300035092	Bacteria	1021
751	Ga0373932_0119811	3300035112	Bacteria	876
752	Ga0373939_0007732	3300035114	Bacteria	2617
753	Ga0373939_0036189	3300035114	Bacteria	1459
754	Ga0373953_0012542	3300035117	Bacteria	3005
755	Ga0373954_0001004	3300035118	Bacteria	11147
756	Ga0373956_0043575	3300035119	Bacteria	1998
757	Ga0373957_0001219	3300035120	Bacteria	6866
758	Ga0373960_0003684	3300035121	Bacteria	3478
759	Ga0373943_0285731	3300035170	Bacteria	934
760	Ga0373924_0034900	3300035410	Bacteria	2038
761	Ga0373931_0019674	3300035691	Bacteria	3372
762	Ga0373931_0046230	3300035691	Bacteria	2300
763	Ga0373927_0239015	3300035695	Bacteria	1194
764	Ga0373933_0031401	3300035724	Bacteria	3081
765	Ga0373933_0113692	3300035724	Bacteria	1691
766	Ga0373933_0556240	3300035724	Bacteria	753
767	Ga0373937_0016193	3300036401	Bacteria	6615
768	Ga0395899_0018962	3300037312	Bacteria	5227
769	Ga0395900_0007309	3300037418	Bacteria	11424
770	Ga0395900_0021786	3300037418	Bacteria	6552
771	Ga0395900_0448240	3300037418	Bacteria	1247
772	Ga0395898_0040565	3300037466	Bacteria	4603
773	Ga0395898_0122984	3300037466	Bacteria	2486
774	Ga0395905_0015972	3300037471	Bacteria	7136
775	Ga0395905_0037528	3300037471	Bacteria	4548
776	Ga0395905_0068999	3300037471	Bacteria	3311
777	Ga0395905_0316227	3300037471	Bacteria	1450
778	Ga0395905_0558592	3300037471	Bacteria	1046
779	Ga0395905_0822683	3300037471	Bacteria	831
780	Ga0395901_0044932	3300038443	Bacteria	4582
781	Ga0395901_0056687	3300038443	Bacteria	4076
782	Ga0436365_0734446	3300039437	Bacteria	3935
783	Ga0436361_0181041	3300039447	Bacteria	7286
784	Ga0436361_0369932	3300039447	Bacteria	3401
785	Ga0436361_0444457	3300039447	Bacteria	38464
786	Ga0436361_0799021	3300039447	Bacteria	1234
787	Ga0439436_0000274	3300041404	Bacteria	12450
788	Ga0439438_000454	3300041405	Bacteria	18521
789	Ga0439439_0000663	3300041406	Bacteria	6048
790	Ga0439447_021493	3300041407	Bacteria	1699
791	Ga0439461_0092655	3300041410	Bacteria	726
792	Ga0451789_0061987	3300041443	Bacteria	5225
793	Ga0451789_0921895	3300041443	Bacteria	1452
794	Ga0451791_0286608	3300041451	Bacteria	837
795	Ga0451791_1409985	3300041451	Bacteria	1596
796	Ga0451791_1587116	3300041451	Bacteria	790
797	Ga0451793_1341243	3300041452	Bacteria	1617
798	Ga0451797_0552398	3300041453	Bacteria	1023
799	Ga0451797_1355763	3300041453	Bacteria	1310
800	Ga0451795_0599323	3300041456	Bacteria	6225
801	Ga0451795_1053640	3300041456	Bacteria	2036
802	Ga0451800_0604447	3300041459	Bacteria	1894
803	Ga0451804_0124619	3300041463	Bacteria	2798
804	Ga0451804_0815268	3300041463	Bacteria	1858
805	Ga0451807_0913292	3300041486	Bacteria	7653
806	Ga0451807_1763648	3300041486	Bacteria	1974
807	Ga0451849_0323083	3300041505	Bacteria	1661
808	Ga0451853_0346075	3300041512	Bacteria	3006
809	Ga0451853_3233094	3300041512	Bacteria	3589
810	Ga0439433_0002117	3300041999	Bacteria	4175
811	Ga0439442_017672	3300042002	Bacteria	1472
812	Ga0439448_0039815	3300042005	Bacteria	1516
813	Ga0439432_001869	3300042006	Bacteria	7916
814	Ga0439449_0002571	3300042007	Bacteria	7087
815	Ga0439454_003851	3300042011	Bacteria	1696
816	Ga0439457_007362	3300042014	Bacteria	2646
817	Ga0439462_0000492	3300042015	Bacteria	7779
818	Ga0439462_0007444	3300042015	Bacteria	2740
819	Ga0450911_000101	3300042115	Bacteria	34905
820	Ga0450911_000343	3300042115	Bacteria	16355
821	Ga0450923_018719	3300042125	Bacteria	1327
822	Ga0450888_000215	3300042126	Bacteria	5191
823	Ga0450890_002465	3300042127	Bacteria	2546
824	Ga0450890_003589	3300042127	Bacteria	2058
825	Ga0450897_001089	3300042128	Bacteria	1752
826	Ga0450892_000837	3300042130	Bacteria	3378
827	Ga0450894_015668	3300042131	Bacteria	1005
828	Ga0450889_000928	3300042144	Bacteria	3124
829	Ga0439434_0053289	3300042435	Bacteria	1256
830	Ga0439459_0000041	3300042438	Bacteria	10569
831	Ga0450916_000906	3300042530	Bacteria	2825
832	Ga0450893_0006213	3300042532	Bacteria	1928
833	Ga0450901_001085	3300042533	Bacteria	3159
834	Ga0451577_0005694	3300042876	Bacteria	12642
835	Ga0466986_0022637	3300044650	Bacteria	4174
836	Ga0466978_0006210	3300044671	Bacteria	6062
837	Ga0466965_0002685	3300044683	Bacteria	7614
838	Ga0466961_0000242	3300044693	Bacteria	36694
839	Ga0466963_0046523	3300044694	Bacteria	2861
840	Ga0466964_0020721	3300044706	Bacteria	2534
841	Ga0466964_0046584	3300044706	Bacteria	1768
842	Ga0466968_0014745	3300044735	Bacteria	3092
843	Ga0466968_0024476	3300044735	Bacteria	2466
844	Ga0466960_0119370	3300044901	Bacteria	1379
845	Ga0466959_0001530	3300045049	Bacteria	14219
846	Ga0466967_0003039	3300045976	Bacteria	10765
847	Ga0466967_0434164	3300045976	Bacteria	1281
848	Ga0495627_003165	3300046453	Bacteria	7422
849	Ga0495627_004939	3300046453	Bacteria	5482
850	Ga0495627_009844	3300046453	Bacteria	3500
851	Ga0495592_0009482	3300046454	Bacteria	7319
852	Ga0495603_0023899	3300046455	Bacteria	3697
853	Ga0495590_0008085	3300046457	Bacteria	4029
854	Ga0495629_0001281	3300046459	Bacteria	19758
855	Ga0495638_0000079	3300046460	Bacteria	157488
856	Ga0495638_0010215	3300046460	Bacteria	6535
857	Ga0495638_0017239	3300046460	Bacteria	4822
858	Ga0495638_0019793	3300046460	Bacteria	4450
859	Ga0495638_0020208	3300046460	Bacteria	4400
860	Ga0495638_0045923	3300046460	Bacteria	2746
861	Ga0495651_0151795	3300046462	Bacteria	1669
862	Ga0495651_0178762	3300046462	Bacteria	1504
863	Ga0495653_0003914	3300046463	Bacteria	12039
864	Ga0495650_0000265	3300046471	Bacteria	100744
865	Ga0495650_0000437	3300046471	Bacteria	66997
866	Ga0495650_0006649	3300046471	Bacteria	7170
867	Ga0495650_0047128	3300046471	Bacteria	1804
868	Ga0495650_0131389	3300046471	Bacteria	913
869	Ga0495605_0156296	3300046474	Bacteria	1014
870	Ga0495639_0064580	3300046475	Bacteria	1682
871	Ga0495584_0054081	3300046491	Bacteria	2020
872	Ga0495584_0058836	3300046491	Bacteria	1933
873	Ga0495584_0062761	3300046491	Bacteria	1867
874	Ga0495585_0002344	3300046492	Bacteria	13609
875	Ga0495585_0003325	3300046492	Bacteria	10914
876	Ga0495585_0004518	3300046492	Bacteria	9014
877	Ga0495585_0005043	3300046492	Bacteria	8419
878	Ga0495585_0099842	3300046492	Bacteria	1553
879	Ga0495596_0001033	3300046500	Bacteria	16549
880	Ga0495607_0004924	3300046501	Bacteria	9709
881	Ga0495583_0000144	3300046506	Bacteria	121268
882	Ga0495583_0002787	3300046506	Bacteria	14399
883	Ga0495583_0053739	3300046506	Bacteria	1827
884	Ga0495606_0000101	3300046507	Bacteria	146752
885	Ga0495606_0000623	3300046507	Bacteria	55841
886	Ga0495606_0001938	3300046507	Bacteria	25633
887	Ga0495606_0005505	3300046507	Bacteria	12104
888	Ga0495606_0072615	3300046507	Bacteria	2161
889	Ga0495606_0229656	3300046507	Bacteria	1041
890	Ga0495608_0203181	3300046511	Bacteria	1247
891	Ga0495610_0000012	3300046512	Bacteria	517442
892	Ga0495610_0000293	3300046512	Bacteria	52547
893	Ga0495610_0008182	3300046512	Bacteria	6815
894	Ga0495610_0009323	3300046512	Bacteria	6217
895	Ga0495610_0081502	3300046512	Bacteria	1485
896	Ga0495616_0001145	3300046513	Bacteria	18718
897	Ga0495616_0001686	3300046513	Bacteria	15063
898	Ga0495616_0039331	3300046513	Bacteria	2423
899	Ga0495616_0044032	3300046513	Bacteria	2265
900	Ga0495620_0006425	3300046515	Bacteria	6459
901	Ga0495620_0019996	3300046515	Bacteria	3279
902	Ga0495628_0009404	3300046516	Bacteria	8342
903	Ga0495631_0000792	3300046518	Bacteria	20201
904	Ga0495631_0010142	3300046518	Bacteria	4676
905	Ga0495632_0013420	3300046519	Bacteria	4676
906	Ga0495632_0029918	3300046519	Bacteria	2831
907	Ga0495637_0002714	3300046520	Bacteria	9642
908	Ga0495637_0036688	3300046520	Bacteria	2133
909	Ga0495637_0077363	3300046520	Bacteria	1332
910	Ga0495643_0000289	3300046522	Bacteria	71822
911	Ga0495643_0006441	3300046522	Bacteria	7740
912	Ga0495643_0035509	3300046522	Bacteria	2745
913	Ga0495644_0037171	3300046523	Bacteria	1837
914	Ga0495648_0046550	3300046524	Bacteria	2687
915	Ga0495648_0060059	3300046524	Bacteria	2264
916	Ga0495663_0001189	3300046525	Bacteria	8395
917	Ga0495663_0008947	3300046525	Bacteria	2776
918	Ga0495663_0009196	3300046525	Bacteria	2739
919	Ga0495642_0021015	3300046528	Bacteria	2566
920	Ga0495642_0159412	3300046528	Bacteria	978
921	Ga0495652_0003535	3300046529	Bacteria	15358
922	Ga0495654_0001538	3300046530	Bacteria	15652
923	Ga0495654_0032945	3300046530	Bacteria	2625
924	Ga0495654_0076334	3300046530	Bacteria	1579
925	Ga0495640_0008340	3300046533	Bacteria	8125
926	Ga0495640_0285920	3300046533	Bacteria	1026
927	Ga0495587_0058386	3300046536	Bacteria	2266
928	Ga0495609_0027513	3300046538	Bacteria	2598
929	Ga0495609_0076833	3300046538	Bacteria	1463
930	Ga0495621_0004768	3300046539	Bacteria	3848
931	Ga0495621_0011922	3300046539	Bacteria	2702
932	Ga0495597_0000863	3300046542	Bacteria	23744
933	Ga0495597_0004214	3300046542	Bacteria	7958
934	Ga0495597_0004297	3300046542	Bacteria	7873
935	Ga0495597_0046818	3300046542	Bacteria	1916
936	Ga0495597_0214637	3300046542	Bacteria	766
937	Ga0495645_0067120	3300046543	Bacteria	2590
938	Ga0495645_0463713	3300046543	Bacteria	797
939	Ga0495622_0000019	3300046557	Bacteria	169931
940	Ga0495622_0001106	3300046557	Bacteria	14103
941	Ga0495622_0122435	3300046557	Bacteria	1187
942	Ga0495633_0003321	3300046558	Bacteria	10806
943	Ga0495633_0004972	3300046558	Bacteria	8297
944	Ga0495633_0014808	3300046558	Bacteria	4061
945	Ga0495633_0025155	3300046558	Bacteria	2933
946	Ga0495633_0045361	3300046558	Bacteria	2081
947	Ga0495633_0058886	3300046558	Bacteria	1802
948	Ga0495667_0020775	3300046559	Bacteria	4430
949	Ga0495656_0000376	3300046615	Bacteria	14908
950	Ga0495656_0000635	3300046615	Bacteria	11260
951	Ga0495656_0003883	3300046615	Bacteria	5084
952	Ga0495656_0096558	3300046615	Bacteria	1360
953	Ga0495656_0135676	3300046615	Bacteria	1175
954	Ga0495668_0000391	3300046616	Bacteria	57845
955	Ga0495668_0000712	3300046616	Bacteria	40090
956	Ga0495668_0002191	3300046616	Bacteria	16694
957	Ga0495668_0013101	3300046616	Bacteria	4905
958	Ga0495668_0019156	3300046616	Bacteria	3948
959	Ga0495668_0022947	3300046616	Bacteria	3563
960	Ga0495668_0026720	3300046616	Bacteria	3274
961	Ga0495668_0327945	3300046616	Bacteria	840
962	Ga0495634_0006578	3300046642	Bacteria	8814
963	Ga0495611_0058700	3300046648	Bacteria	1745
964	Ga0495611_0229071	3300046648	Bacteria	864
965	Ga0495625_0000172	3300046660	Bacteria	101622
966	Ga0495625_0006032	3300046660	Bacteria	10886
967	Ga0495625_0016156	3300046660	Bacteria	5881
968	Ga0495625_0026167	3300046660	Bacteria	4412
969	Ga0495625_0043671	3300046660	Bacteria	3249
970	Ga0495625_0044517	3300046660	Bacteria	3213
971	Ga0495625_0124475	3300046660	Bacteria	1751
972	Ga0495625_0155280	3300046660	Bacteria	1536
973	Ga0495625_0172128	3300046660	Bacteria	1445
974	Ga0495625_0237783	3300046660	Bacteria	1187
975	Ga0495635_0025187	3300046663	Bacteria	4143
976	Ga0495635_0467300	3300046663	Bacteria	833
977	Ga0495659_0037181	3300046664	Bacteria	1723
978	Ga0495659_0055233	3300046664	Bacteria	1455
979	Ga0495661_0024841	3300046665	Bacteria	3877
980	Ga0495661_0027741	3300046665	Bacteria	3631
981	Ga0495661_0072206	3300046665	Bacteria	2014
982	Ga0495661_0081312	3300046665	Bacteria	1867
983	Ga0495661_0158851	3300046665	Bacteria	1215
984	Ga0495588_0005838	3300046674	Bacteria	5508
985	Ga0495588_0029205	3300046674	Bacteria	2765
986	Ga0495588_0059966	3300046674	Bacteria	1969
987	Ga0495646_0005468	3300046680	Bacteria	8028
988	Ga0495647_0035985	3300046681	Bacteria	1862
989	Ga0495658_0015851	3300046683	Bacteria	3873
990	Ga0495669_0028423	3300046684	Bacteria	2449
991	Ga0495613_0046480	3300046689	Bacteria	3210
992	Ga0495670_0006166	3300046691	Bacteria	5888
993	Ga0495670_0011879	3300046691	Bacteria	4285
994	Ga0495670_0036838	3300046691	Bacteria	2438
995	Ga0495670_0050219	3300046691	Bacteria	2088
996	Ga0495670_0056765	3300046691	Bacteria	1965
997	Ga0495671_0000006	3300046692	Bacteria	500471
998	Ga0495671_0006935	3300046692	Bacteria	6500
999	Ga0495671_0036171	3300046692	Bacteria	2502
1000	Ga0495671_0091322	3300046692	Bacteria	1490
1001	Ga0495671_0185411	3300046692	Bacteria	1010
1002	Ga0495649_0000911	3300046694	Bacteria	23367
1003	Ga0495649_0021575	3300046694	Bacteria	3608
1004	Ga0495649_0057161	3300046694	Bacteria	2104
1005	Ga0495649_0193159	3300046694	Bacteria	1059
1006	Ga0495589_0044252	3300046794	Bacteria	2215
1007	Ga0495600_0034137	3300046809	Bacteria	3302
1008	Ga0495660_0003915	3300046810	Bacteria	9104
1009	Ga0495581_0081561	3300047315	Bacteria	1873
1010	Ga0495581_0170029	3300047315	Bacteria	1275
1011	Ga0495604_0047819	3300047317	Bacteria	3330
1012	Ga0495674_0203094	3300047319	Bacteria	1643
1013	Ga0495672_0000291	3300047320	Bacteria	69062
1014	Ga0495672_0067873	3300047320	Bacteria	2030
1015	Ga0495676_0001292	3300047321	Bacteria	21470
1016	Ga0495680_0073758	3300047322	Bacteria	2592
1017	Ga0495683_0009439	3300047323	Bacteria	5197
1018	Ga0495683_0021557	3300047323	Bacteria	3320
1019	Ga0495683_0093073	3300047323	Bacteria	1458
1020	Ga0495683_0176883	3300047323	Bacteria	977
1021	Ga0495687_047451	3300047443	Bacteria	1848
1022	Ga0495675_0068733	3300047444	Bacteria	2237
1023	Ga0495675_0325938	3300047444	Bacteria	908
1024	Ga0495677_0004635	3300047445	Bacteria	5245
1025	Ga0495677_0005234	3300047445	Bacteria	4933
1026	Ga0495677_0057786	3300047445	Bacteria	1434
1027	Ga0495677_0211708	3300047445	Bacteria	754
1028	Ga0495679_014646	3300047446	Bacteria	2896
1029	Ga0495679_030702	3300047446	Bacteria	1741
1030	Ga0495679_035644	3300047446	Bacteria	1575
1031	Ga0495673_0000003	3300047469	Bacteria	1491337
1032	Ga0495673_0000050	3300047469	Bacteria	262267
1033	Ga0495681_0012653	3300047470	Bacteria	4944
1034	Ga0495681_0094087	3300047470	Bacteria	1319
1035	Ga0495684_0003601	3300047471	Bacteria	12078
1036	Ga0495684_0216846	3300047471	Bacteria	1405
1037	Ga0495686_0012570	3300047472	Bacteria	5918
1038	Ga0495686_0067727	3300047472	Bacteria	2203
1039	Ga0495686_0117261	3300047472	Bacteria	1591
1040	Ga0495686_0166686	3300047472	Bacteria	1283
1041	Ga0495686_0174745	3300047472	Bacteria	1247
1042	Ga0495593_0002191	3300047673	Bacteria	11688
1043	Ga0495593_0055835	3300047673	Bacteria	2077
1044	Ga0495602_0187164	3300048088	Bacteria	1591
1045	Ga0495602_0429278	3300048088	Bacteria	937
1046	Ga0495614_0000302	3300048089	Bacteria	19477
1047	Ga0495626_0002477	3300048091	Bacteria	12774
1048	Ga0496101_0000238	3300048904	Bacteria	40786
1049	Ga0496101_0006068	3300048904	Bacteria	7756
1050	Ga0496101_0007565	3300048904	Bacteria	7047
1051	Ga0496101_0191288	3300048904	Bacteria	1579
1052	Ga0496102_0006020	3300048905	Bacteria	10331
1053	Ga0496102_0061580	3300048905	Bacteria	3434
1054	Ga0496102_0092216	3300048905	Bacteria	2805
1055	Ga0496103_0003185	3300048906	Bacteria	10084
1056	Ga0496103_0023107	3300048906	Bacteria	3748
1057	Ga0496103_0047711	3300048906	Bacteria	2647
1058	Ga0496103_0063182	3300048906	Bacteria	2306
1059	Ga0496104_0002726	3300048907	Bacteria	15206
1060	Ga0496104_0003045	3300048907	Bacteria	14441
1061	Ga0496104_0053547	3300048907	Bacteria	3813
1062	Ga0496104_0117050	3300048907	Bacteria	2557
1063	Ga0496105_0000870	3300048908	Bacteria	20664
1064	Ga0496105_0005533	3300048908	Bacteria	9588
1065	Ga0496105_0014853	3300048908	Bacteria	6200
1066	Ga0496105_0098282	3300048908	Bacteria	2417
1067	Ga0496105_0398464	3300048908	Bacteria	1093
1068	Ga0496106_0003608	3300048909	Bacteria	11538
1069	Ga0496106_0298821	3300048909	Bacteria	1291
1070	Ga0496107_0001068	3300048910	Bacteria	16437
1071	Ga0496108_0034563	3300048911	Bacteria	4200
1072	Ga0496109_0057947	3300048912	Bacteria	3538
1073	Ga0496109_0121750	3300048912	Bacteria	2431
1074	Ga0496109_0204495	3300048912	Bacteria	1856
1075	Ga0496109_0409539	3300048912	Bacteria	1281
1076	Ga0496110_0000891	3300048913	Bacteria	21073
1077	Ga0496110_0017480	3300048913	Bacteria	6000
1078	Ga0496110_0215611	3300048913	Bacteria	1745
1079	Ga0496110_0456138	3300048913	Bacteria	1165
1080	Ga0496110_0478371	3300048913	Bacteria	1134
1081	Ga0496110_0843992	3300048913	Bacteria	821
1082	Ga0496111_0058432	3300048914	Bacteria	2792
1083	Ga0496111_0215356	3300048914	Bacteria	1427
1084	Ga0496111_0323492	3300048914	Bacteria	1142
1085	Ga0496112_0049350	3300048915	Bacteria	4126
1086	Ga0496112_0151309	3300048915	Bacteria	2288
1087	Ga0496112_0189500	3300048915	Bacteria	2019
1088	Ga0496112_0471491	3300048915	Bacteria	1192
1089	Ga0496112_0577409	3300048915	Bacteria	1057
1090	Ga0496113_0002138	3300048916	Bacteria	11391
1091	Ga0496113_0101575	3300048916	Bacteria	2229
1092	Ga0496113_0607041	3300048916	Bacteria	876
1093	Ga0496114_0053478	3300048917	Bacteria	3366
1094	Ga0496116_0029356	3300048919	Bacteria	3966
1095	Ga0496116_0044188	3300048919	Bacteria	3029
1096	Ga0496116_0053528	3300048919	Bacteria	2665
1097	Ga0496117_0014560	3300048920	Bacteria	6768
1098	Ga0496117_0026152	3300048920	Bacteria	4571
1099	Ga0496117_0096882	3300048920	Bacteria	1881
1100	Ga0496117_0111540	3300048920	Bacteria	1702
1101	Ga0496118_0008991	3300048921	Bacteria	10191
1102	Ga0496118_0010618	3300048921	Bacteria	9093
1103	Ga0496118_0014322	3300048921	Bacteria	7432
1104	Ga0496118_0014723	3300048921	Bacteria	7304
1105	Ga0496118_0078678	3300048921	Bacteria	2332
1106	Ga0496118_0139534	3300048921	Bacteria	1540
1107	Ga0496119_0001479	3300048922	Bacteria	28146
1108	Ga0496119_0030380	3300048922	Bacteria	3644
1109	Ga0496119_0033972	3300048922	Bacteria	3369
1110	Ga0496120_0000945	3300048923	Bacteria	39769
1111	Ga0496120_0004933	3300048923	Bacteria	10853
1112	Ga0496120_0059285	3300048923	Bacteria	2146
1113	Ga0496121_0000152	3300048924	Bacteria	150767
1114	Ga0496121_0000196	3300048924	Bacteria	135812
1115	Ga0496121_0001855	3300048924	Bacteria	33972
1116	Ga0496121_0008739	3300048924	Bacteria	11817
1117	Ga0496121_0010811	3300048924	Bacteria	10221
1118	Ga0496121_0028800	3300048924	Bacteria	5159
1119	Ga0496121_0047986	3300048924	Bacteria	3638
1120	Ga0496121_0222661	3300048924	Bacteria	1327
1121	Ga0496121_0240834	3300048924	Bacteria	1260
1122	Ga0496121_0242667	3300048924	Bacteria	1254
1123	Ga0496122_0000546	3300048925	Bacteria	77920
1124	Ga0496122_0006699	3300048925	Bacteria	13109
1125	Ga0496122_0013790	3300048925	Bacteria	7875
1126	Ga0496122_0065807	3300048925	Bacteria	2624
1127	Ga0496122_0071832	3300048925	Bacteria	2464
1128	Ga0496122_0092062	3300048925	Bacteria	2062
1129	Ga0496123_0000235	3300048926	Bacteria	111823
1130	Ga0496123_0009893	3300048926	Bacteria	8510
1131	Ga0496123_0058274	3300048926	Bacteria	2506
1132	Ga0496123_0058941	3300048926	Bacteria	2486
1133	Ga0496123_0075947	3300048926	Bacteria	2071
1134	Ga0496123_0110488	3300048926	Bacteria	1573
1135	Ga0496123_0165721	3300048926	Bacteria	1172
1136	Ga0496124_0000032	3300048927	Bacteria	332524
1137	Ga0496124_0012772	3300048927	Bacteria	8255
1138	Ga0496124_0015879	3300048927	Bacteria	7192
1139	Ga0496124_0016715	3300048927	Bacteria	6959
1140	Ga0496124_0025460	3300048927	Bacteria	5358
1141	Ga0496124_0034669	3300048927	Bacteria	4425
1142	Ga0496124_0040112	3300048927	Bacteria	4053
1143	Ga0496124_0040476	3300048927	Bacteria	4030
1144	Ga0496124_0078860	3300048927	Bacteria	2713
1145	Ga0496124_0478795	3300048927	Bacteria	841
1146	Ga0496124_0509856	3300048927	Bacteria	804
1147	Ga0496125_0000016	3300048928	Bacteria	512512
1148	Ga0496125_0000383	3300048928	Bacteria	82288
1149	Ga0496125_0000464	3300048928	Bacteria	72660
1150	Ga0496125_0000804	3300048928	Bacteria	51187
1151	Ga0496125_0003106	3300048928	Bacteria	20687
1152	Ga0496125_0003950	3300048928	Bacteria	17491
1153	Ga0496125_0005607	3300048928	Bacteria	13860
1154	Ga0496125_0005957	3300048928	Bacteria	13345
1155	Ga0496125_0012018	3300048928	Bacteria	8619
1156	Ga0496125_0013691	3300048928	Bacteria	7957
1157	Ga0496125_0015110	3300048928	Bacteria	7485
1158	Ga0496125_0082815	3300048928	Bacteria	2444
1159	Ga0496125_0155918	3300048928	Bacteria	1560
1160	Ga0496125_0205687	3300048928	Bacteria	1284
1161	Ga0496126_0005453	3300048929	Bacteria	14509
1162	Ga0496126_0009748	3300048929	Bacteria	10170
1163	Ga0496126_0036411	3300048929	Bacteria	4602
1164	Ga0496126_0041509	3300048929	Bacteria	4257
1165	Ga0496126_0052788	3300048929	Bacteria	3692
1166	Ga0496126_0333635	3300048929	Bacteria	1244
1167	Ga0496126_0668181	3300048929	Bacteria	811
1168	Ga0495678_000002	3300049459	Bacteria	999613
1169	Ga0495678_011932	3300049459	Bacteria	4138
1170	Ga0495682_0137788	3300049460	Bacteria	872
1171	Ga0501031_0000595	3300049568	Bacteria	21292
1172	Ga0501031_0018407	3300049568	Bacteria	4546
1173	Ga0501031_0465931	3300049568	Bacteria	816
1174	Ga0501032_0292393	3300049569	Bacteria	1054
1175	Ga0501033_0159126	3300049570	Bacteria	1626
1176	Ga0501034_0299036	3300049571	Bacteria	1546
1177	Ga0501034_0654860	3300049571	Bacteria	952
1178	Ga0501037_0066664	3300049573	Bacteria	2622
1179	Ga0501038_0067355	3300049574	Bacteria	3046
1180	Ga0501038_0286648	3300049574	Bacteria	1295
1181	Ga0501039_0153162	3300049575	Bacteria	1811
1182	Ga0501042_0053900	3300049578	Bacteria	2869
1183	Ga0501043_0217322	3300049579	Bacteria	1480
1184	Ga0501047_0470541	3300049581	Unclassified	1085
1185	Ga0501067_0013742	3300049583	Bacteria	4483
1186	Ga0501067_0291629	3300049583	Bacteria	908
1187	Ga0501069_0017246	3300049585	Bacteria	3885
1188	Ga0501070_0050152	3300049586	Bacteria	3465
1189	Ga0501071_0000964	3300049587	Bacteria	15695
1190	Ga0501071_0804602	3300049587	Bacteria	725
1191	Ga0501073_0004452	3300049589	Bacteria	10527
1192	Ga0501073_0313098	3300049589	Unclassified	1083
1193	Ga0501074_0002061	3300049590	Bacteria	13892
1194	Ga0501075_0016428	3300049591	Bacteria	5333
1195	Ga0501076_0245606	3300049592	Bacteria	1464
1196	Ga0501077_0008949	3300049593	Bacteria	6211
1197	Ga0501222_012176	3300049662	Bacteria	1134
1198	Ga0501230_013899	3300049667	Unclassified	1313
1199	Ga0501079_0000806	3300049741	Bacteria	21347
1200	Ga0501080_0004388	3300049742	Bacteria	12531
1201	Ga0501080_0563183	3300049742	Unclassified	1014
1202	Ga0501083_0017304	3300049744	Bacteria	5025
1203	Ga0501083_0198803	3300049744	Bacteria	1308
1204	Ga0501035_0001647	3300049822	Bacteria	22563
1205	Ga0501035_0091255	3300049822	Bacteria	2681
1206	Ga0501035_0137099	3300049822	Bacteria	2130
1207	Ga0501035_0539684	3300049822	Bacteria	956
1208	Ga0501044_0471525	3300049823	Bacteria	1159
1209	nmdc:mga03683_13160_c1	3300050489	Bacteria	3039
1210	nmdc:mga03683_34340_c1	3300050489	Bacteria	2052
1211	nmdc:mga03n38_28011_c1	3300050490	Bacteria	2343
1212	nmdc:mga03n38_72954_c1	3300050490	Bacteria	1593
1213	nmdc:mga0yw44_419131_c1	3300050492	Bacteria	906
1214	nmdc:mga0k408_11592_c1	3300050493	Bacteria	4804
1215	nmdc:mga0k408_144331_c1	3300050493	Bacteria	1417
1216	nmdc:mga0k408_17454_c1	3300050493	Bacteria	3999
1217	nmdc:mga0k408_40231_c1	3300050493	Bacteria	2689
1218	nmdc:mga0k408_76799_c1	3300050493	Bacteria	1952
1219	nmdc:mga06z11_132716_c1	3300050494	Bacteria	1400
1220	nmdc:mga06z11_256673_c1	3300050494	Bacteria	1030
1221	nmdc:mga07m45_137256_c1	3300050496	Bacteria	1416
1222	nmdc:mga07m45_146360_c1	3300050496	Bacteria	1369
1223	nmdc:mga07m45_14979_c1	3300050496	Bacteria	4139
1224	nmdc:mga07m45_160799_c1	3300050496	Bacteria	1304
1225	nmdc:mga07m45_21461_c1	3300050496	Bacteria	3517
1226	nmdc:mga07m45_24245_c1	3300050496	Bacteria	3322
1227	nmdc:mga07m45_25179_c1	3300050496	Bacteria	3262
1228	nmdc:mga07m45_47102_c1	3300050496	Bacteria	2423
1229	nmdc:mga07m45_5378_c1	3300050496	Bacteria	6373
1230	nmdc:mga07m45_61872_c1	3300050496	Bacteria	2121
1231	nmdc:mga05p37_411527_c1	3300050507	Bacteria	1576
1232	nmdc:mga09592_108338_c1	3300050508	Bacteria	2383
1233	nmdc:mga0qj67_157848_c1	3300050509	Bacteria	1841
1234	nmdc:mga0qj67_29580_c1	3300050509	Bacteria	4255
1235	nmdc:mga0qj67_75728_c1	3300050509	Bacteria	2690
1236	nmdc:mga06r32_1267_c1	3300050510	Bacteria	22709
1237	nmdc:mga06r32_203888_c1	3300050510	Bacteria	1965
1238	nmdc:mga06r32_320700_c1	3300050510	Bacteria	1535
1239	nmdc:mga06r32_907737_c1	3300050510	Bacteria	837
1240	nmdc:mga08y16_16245_c1	3300050511	Bacteria	7827
1241	nmdc:mga08y16_582917_c1	3300050511	Bacteria	1129
1242	nmdc:mga08y16_61125_c1	3300050511	Bacteria	3934
1243	nmdc:mga08y16_69085_c1	3300050511	Bacteria	3683
1244	nmdc:mga0sz30_146358_c1	3300050516	Bacteria	1044
1245	Ga0495601_0099733	3300053077	Bacteria	1875
1246	Ga0495601_0214462	3300053077	Bacteria	1257
1247	Ga0500610_0033148	3300053079	Bacteria	2633
1248	Ga0500610_0038258	3300053079	Bacteria	2471
1249	Ga0500635_0000208	3300053080	Bacteria	28812
1250	Ga0495595_0040688	3300053084	Bacteria	2124
1251	Ga0495619_0045790	3300053085	Bacteria	2874
1252	Ga0500578_0185929	3300053086	Bacteria	1278
1253	Ga0500643_000376	3300053087	Bacteria	34859
1254	Ga0500643_003033	3300053087	Bacteria	8289
1255	Ga0500643_024850	3300053087	Bacteria	1895
1256	Ga0500643_041896	3300053087	Bacteria	1342
1257	Ga0500646_0008683	3300053090	Bacteria	2603
1258	Ga0500583_0166506	3300053092	Bacteria	1098
1259	Ga0500651_0000024	3300053093	Bacteria	129450
1260	Ga0500651_0096696	3300053093	Bacteria	1814
1261	Ga0500566_0006230	3300053094	Bacteria	7089
1262	Ga0500566_0007556	3300053094	Bacteria	6439
1263	Ga0500566_0033160	3300053094	Bacteria	3010
1264	Ga0500641_0000875	3300053096	Bacteria	10768
1265	Ga0500641_0007939	3300053096	Bacteria	3784
1266	Ga0500641_0221192	3300053096	Bacteria	803
1267	Ga0500650_0026667	3300053098	Bacteria	2594
1268	Ga0500555_002499	3300053103	Bacteria	5314
1269	Ga0500556_0002665	3300053104	Bacteria	5563
1270	Ga0500556_0003520	3300053104	Bacteria	4588
1271	Ga0500556_0015270	3300053104	Bacteria	2365
1272	Ga0500562_000424	3300053108	Bacteria	10273
1273	Ga0500562_017292	3300053108	Bacteria	1858
1274	Ga0500569_000410	3300053109	Bacteria	7007
1275	Ga0500571_000051	3300053110	Bacteria	35723
1276	Ga0500592_002986	3300053116	Bacteria	2706
1277	Ga0500593_021040	3300053117	Bacteria	2869
1278	Ga0500593_110181	3300053117	Bacteria	1133
1279	Ga0500595_034514	3300053119	Bacteria	1672
1280	Ga0500597_103620	3300053120	Bacteria	1236
1281	Ga0500607_002042	3300053121	Bacteria	17000
1282	Ga0500607_034418	3300053121	Bacteria	2774
1283	Ga0500608_008130	3300053122	Bacteria	4390
1284	Ga0500608_054398	3300053122	Bacteria	1920
1285	Ga0500614_019612	3300053123	Bacteria	1551
1286	Ga0500618_000532	3300053125	Bacteria	23841
1287	Ga0500618_001158	3300053125	Bacteria	12766
1288	Ga0500618_001641	3300053125	Bacteria	9629
1289	Ga0500618_023002	3300053125	Bacteria	1512
1290	Ga0500626_029869	3300053128	Bacteria	2460
1291	Ga0500642_0014869	3300053130	Bacteria	2908
1292	Ga0500642_0083867	3300053130	Bacteria	1467
1293	Ga0500652_001276	3300053131	Bacteria	7981
1294	Ga0500655_000770	3300053133	Bacteria	6319
1295	Ga0500655_003116	3300053133	Bacteria	3009
1296	Ga0500658_0000226	3300053134	Bacteria	26958
1297	Ga0500658_0000310	3300053134	Bacteria	21887
1298	Ga0500559_0001061	3300053136	Bacteria	16692
1299	Ga0500559_0002634	3300053136	Bacteria	9152
1300	Ga0500559_0014006	3300053136	Bacteria	3390
1301	Ga0500561_0024619	3300053137	Bacteria	1455
1302	Ga0500564_036236	3300053138	Bacteria	2276
1303	Ga0500564_053379	3300053138	Bacteria	1846
1304	Ga0500568_0004319	3300053139	Bacteria	7625
1305	Ga0500568_0005294	3300053139	Bacteria	6700
1306	Ga0500573_0042915	3300053140	Bacteria	2611
1307	Ga0500574_009734	3300053141	Bacteria	2100
1308	Ga0500574_017043	3300053141	Bacteria	1766
1309	Ga0500577_0002625	3300053142	Bacteria	4603
1310	Ga0500579_138940	3300053143	Bacteria	1105
1311	Ga0500590_041819	3300053148	Bacteria	2356
1312	Ga0500590_060286	3300053148	Bacteria	1908
1313	Ga0500616_0023917	3300053153	Bacteria	3399
1314	Ga0500616_0114379	3300053153	Bacteria	1298
1315	Ga0500616_0157985	3300053153	Bacteria	1042
1316	Ga0500619_000075	3300053154	Bacteria	27587
1317	Ga0500619_116084	3300053154	Bacteria	912
1318	Ga0500622_0000142	3300053156	Bacteria	76275
1319	Ga0500622_0001772	3300053156	Bacteria	16534
1320	Ga0500622_0005954	3300053156	Bacteria	7182
1321	Ga0500622_0011823	3300053156	Bacteria	4744
1322	Ga0500622_0069257	3300053156	Bacteria	1787
1323	Ga0500622_0079534	3300053156	Bacteria	1643
1324	Ga0500622_0093084	3300053156	Bacteria	1493
1325	Ga0500627_0002002	3300053158	Bacteria	5885
1326	Ga0500627_0136992	3300053158	Bacteria	1106
1327	Ga0500633_0109499	3300053160	Bacteria	1022
1328	Ga0500634_0023050	3300053161	Bacteria	3383
1329	Ga0500634_0025682	3300053161	Bacteria	3206
1330	Ga0500636_0006613	3300053177	Bacteria	6662
1331	Ga0500637_0000774	3300053178	Bacteria	12861
1332	Ga0500570_086708	3300053724	Bacteria	1383
1333	Ga0500625_109463	3300053729	Bacteria	1137
1334	Ga0500645_000184	3300053730	Bacteria	48312
1335	Ga0500645_000557	3300053730	Bacteria	24558
1336	Ga0500645_001117	3300053730	Bacteria	14632
1337	Ga0500656_015640	3300053732	Bacteria	891
1338	Ga0500565_001120	3300053734	Bacteria	1713
1339	Ga0500596_005428	3300053735	Bacteria	2244
1340	Ga0500596_016347	3300053735	Bacteria	1115
1341	Ga0500587_010013	3300053739	Bacteria	1205
1342	Ga0501084_0073726	3300054114	Bacteria	2858
1343	Ga0500661_040736	3300055283	Bacteria	823
1344	Ga0590071_003267	3300059421	Bacteria	3994
1345	Ga0501082_0002356	3300060353	Bacteria	16543
1346	Ga0501082_0004992	3300060353	Bacteria	11584
1347	Ga0501082_0103547	3300060353	Bacteria	2462
1348	Ga0530510_0453325	3300061734	Bacteria	970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047315	Ga0495581_0170029	Ga0495581_0170029_90_644	179
2	3300035724	Ga0373933_0556240	Ga0373933_0556240_41_679	209
3	3300046542	Ga0495597_0214637	Ga0495597_0214637_115_747	210
4	3300046674	Ga0495588_0059966	Ga0495588_0059966_1324_1956	210
5	3300053130	Ga0500642_0083867	Ga0500642_0083867_815_1447	210
6	3300053156	Ga0500622_0093084	Ga0500622_0093084_839_1480	210
7	3300009551	Ga0105238_10000869	Ga0105238_1000086925	211
8	3300048927	Ga0496124_0000032	Ga0496124_0000032_127167_127856	211
9	3300006844	Ga0075428_100980314	Ga0075428_1009803141	212
10	3300046513	Ga0495616_0001686	Ga0495616_0001686_4993_5670	212
11	3300048927	Ga0496124_0509856	Ga0496124_0509856_138_779	213
12	3300048929	Ga0496126_0668181	Ga0496126_0668181_10_651	213
13	3300046664	Ga0495659_0037181	Ga0495659_0037181_1045_1695	214
14	3300048914	Ga0496111_0323492	Ga0496111_0323492_15_665	214
15	iso_pu_bacteria	2928070936	2928076778	215
16	iso_pu_bacteria	2903768456	2903773781	216
17	3300042533	Ga0450901_001085	Ga0450901_001085_1235_1891	217
18	3300046457	Ga0495590_0008085	Ga0495590_0008085_3300_3977	217
19	3300046519	Ga0495632_0029918	Ga0495632_0029918_2102_2779	217
20	3300046660	Ga0495625_0155280	Ga0495625_0155280_386_1063	217
21	3300046460	Ga0495638_0010215	Ga0495638_0010215_3221_3877	218
22	3300046522	Ga0495643_0035509	Ga0495643_0035509_1650_2306	218
23	iso_pu_bacteria	2842747753	2842748565	218
24	iso_pu_bacteria	2928064002	2928065872	218
25	3300005347	Ga0070668_100132672	Ga0070668_1001326722	219
26	3300005367	Ga0070667_100010769	Ga0070667_1000107693	219
27	3300005548	Ga0070665_100001180	Ga0070665_10000118028	219
28	3300005844	Ga0068862_100096485	Ga0068862_1000964852	219
29	3300025972	Ga0207668_10000154	Ga0207668_1000015431	219
30	3300025986	Ga0207658_10012500	Ga0207658_100125006	219
31	3300028379	Ga0268266_10000812	Ga0268266_1000081238	219
32	3300028380	Ga0268265_10135462	Ga0268265_101354622	219
33	3300050492	nmdc:mga0yw44_419131_c1	nmdc:mga0yw44_419131_c1_24_683	219
34	3300053087	Ga0500643_041896	Ga0500643_041896_18_695	219
35	3300009094	Ga0111539_10002755	Ga0111539_1000275517	220
36	3300009147	Ga0114129_10077926	Ga0114129_100779262	220
37	3300035170	Ga0373943_0285731	Ga0373943_0285731_233_901	220
38	3300049583	Ga0501067_0291629	Ga0501067_0291629_163_831	220
39	3300049585	Ga0501069_0017246	Ga0501069_0017246_1111_1779	220
40	3300050510	nmdc:mga06r32_203888_c1	nmdc:mga06r32_203888_c1_810_1472	220
41	3300053119	Ga0500595_034514	Ga0500595_034514_115_783	220
42	3300053148	Ga0500590_041819	Ga0500590_041819_1015_1683	220
43	3300053732	Ga0500656_015640	Ga0500656_015640_105_773	220
44	iso_pu_bacteria	2599185169	2599410864	220
45	iso_pu_bacteria	2600255254	2601521621	220
46	iso_pu_bacteria	2600255255	2601526646	220
47	iso_pu_bacteria	2600255280	2601613476	220
48	iso_pu_bacteria	2600255281	2601622379	220
49	iso_pu_bacteria	2600255287	2601643107	220
50	iso_pu_bacteria	2600255288	2601650415	220
51	iso_pu_bacteria	2600255289	2601655704	220
52	iso_pu_bacteria	2600255290	2601656951	220
53	iso_pu_bacteria	2600255291	2601662928	220
54	iso_pu_bacteria	2600255298	2601695887	220
55	iso_pu_bacteria	2600255299	2601700561	220
56	iso_pu_bacteria	2600255300	2601704748	220
57	iso_pu_bacteria	2600255301	2601709777	220
58	iso_pu_bacteria	2600255302	2601714789	220
59	iso_pu_bacteria	2600255303	2601720912	220
60	iso_pu_bacteria	2600255304	2601725195	220
61	iso_pu_bacteria	2600255305	2601729737	220
62	iso_pu_bacteria	2600255306	2601734754	220
63	iso_pu_bacteria	2600255307	2601743814	220
64	iso_pu_bacteria	2600255309	2601754268	220
65	iso_pu_bacteria	2600255392	2602021733	220
66	iso_pu_bacteria	2602042052	2603660303	220
67	iso_pu_bacteria	2602042053	2603665578	220
68	iso_pu_bacteria	2602042103	2603837109	220
69	iso_pu_bacteria	2602042104	2603842185	220
70	iso_pu_bacteria	2602042105	2603847258	220
71	iso_pu_bacteria	2602042106	2603852329	220
72	iso_pu_bacteria	2602042110	2603870382	220
73	iso_pu_bacteria	2602042111	2603875395	220
74	iso_pu_bacteria	2603880178	2606047573	220
75	iso_pu_bacteria	2603880184	2606070009	220
76	iso_pu_bacteria	2603880202	2606145924	220
77	iso_pu_bacteria	2603880211	2606174974	220
78	iso_pu_bacteria	2675903046	2676408031	220
79	iso_pu_bacteria	2739367655	2739613543	220
80	iso_pu_bacteria	2842757796	2842759261	220
81	iso_pu_bacteria	2894023352	2894027093	220
82	iso_pu_bacteria	2904479285	2904481620	220
83	3300005289	Ga0065704_10077523	Ga0065704_100775234	221
84	3300030521	Ga0307511_10114381	Ga0307511_101143812	221
85	3300048925	Ga0496122_0013790	Ga0496122_0013790_4212_4877	221
86	iso_pu_bacteria	2554235234	2555261472	221
87	iso_pu_bacteria	2636415599	2637225758	221
88	iso_pu_bacteria	2775507074	2777023609	221
89	iso_pu_bacteria	2842775625	2842777682	221
90	iso_pu_bacteria	2855730933	2855737104	221
91	iso_pu_bacteria	2855767633	2855767814	221
92	iso_pu_bacteria	2876601092	2876601800	221
93	iso_pu_bacteria	2881412998	2881416645	221
94	iso_pu_bacteria	2884086401	2884089756	221
95	iso_pu_bacteria	2904504865	2904508217	221
96	iso_pu_bacteria	2904513164	2904513387	221
97	iso_pu_bacteria	2919108558	2919111848	221
98	iso_pu_bacteria	2939573065	2939574509	221
99	iso_pu_bacteria	2939602548	2939605769	221
100	iso_pu_bacteria	2939607340	2939608259	221
101	iso_pu_bacteria	2969079654	2969082755	221
102	iso_pu_bacteria	2971820967	2971824722	221
103	iso_pu_bacteria	2984559226	2984559820	221
104	iso_pu_bacteria	2984595703	2984597902	221
105	iso_pu_bacteria	8016733728	8016735313	221
106	iso_pu_bacteria	8019499862	8019501207	221
107	iso_pu_bacteria	8055087960	8055088958	221
108	iso_pu_bacteria	8055092621	8055093885	221
109	iso_pu_bacteria	8055097453	8055099329	221
110	3300005434	Ga0070709_10134428	Ga0070709_101344282	222
111	3300005434	Ga0070709_10761378	Ga0070709_107613781	222
112	3300005436	Ga0070713_100536246	Ga0070713_1005362462	222
113	3300005530	Ga0070679_100137878	Ga0070679_1001378783	222
114	3300013297	Ga0157378_10315556	Ga0157378_103155561	222
115	3300025921	Ga0207652_10130950	Ga0207652_101309503	222
116	3300028556	Ga0265337_1008277	Ga0265337_10082772	222
117	3300028573	Ga0265334_10000732	Ga0265334_100007327	222
118	3300028800	Ga0265338_10018208	Ga0265338_100182082	222
119	3300028800	Ga0265338_10171367	Ga0265338_101713672	222
120	3300035691	Ga0373931_0046230	Ga0373931_0046230_1170_1850	222
121	3300035724	Ga0373933_0113692	Ga0373933_0113692_55_738	222
122	3300037312	Ga0395899_0018962	Ga0395899_0018962_2705_3391	222
123	3300037418	Ga0395900_0021786	Ga0395900_0021786_3461_4147	222
124	3300037466	Ga0395898_0122984	Ga0395898_0122984_1711_2397	222
125	3300037471	Ga0395905_0015972	Ga0395905_0015972_2209_2895	222
126	3300037471	Ga0395905_0068999	Ga0395905_0068999_146_823	222
127	3300037471	Ga0395905_0316227	Ga0395905_0316227_290_976	222
128	3300038443	Ga0395901_0044932	Ga0395901_0044932_2207_2893	222
129	3300039447	Ga0436361_0444457	Ga0436361_0444457_20675_21361	222
130	3300041452	Ga0451793_1341243	Ga0451793_1341243_798_1538	222
131	3300046524	Ga0495648_0046550	Ga0495648_0046550_1354_2022	222
132	3300046533	Ga0495640_0285920	Ga0495640_0285920_10_693	222
133	3300053096	Ga0500641_0221192	Ga0500641_0221192_45_722	222
134	3300053125	Ga0500618_000532	Ga0500618_000532_8168_8905	222
135	3300053125	Ga0500618_001158	Ga0500618_001158_7667_8353	222
136	iso_pu_bacteria	2521172590	2521559171	222
137	iso_pu_bacteria	2551306416	2553004001	222
138	iso_pu_bacteria	2585428058	2587732366	222
139	iso_pu_bacteria	2585428062	2587757817	222
140	iso_pu_bacteria	2588253510	2588292013	222
141	iso_pu_bacteria	2599185214	2599624095	222
142	iso_pu_bacteria	2599185226	2599672106	222
143	iso_pu_bacteria	2599185227	2599681811	222
144	iso_pu_bacteria	2599185229	2599693825	222
145	iso_pu_bacteria	2643221658	2644328845	222
146	iso_pu_bacteria	2643221660	2644339417	222
147	iso_pu_bacteria	2643221672	2644397936	222
148	iso_pu_bacteria	2643221683	2644469104	222
149	iso_pu_bacteria	2721755523	2722885889	222
150	iso_pu_bacteria	2738541277	2738719881	222
151	iso_pu_bacteria	2738541297	2738830604	222
152	iso_pu_bacteria	2738541307	2738879706	222
153	iso_pu_bacteria	2738541357	2739154343	222
154	iso_pu_bacteria	2738543003	2739196320	222
155	iso_pu_bacteria	2738543013	2739252204	222
156	iso_pu_bacteria	2738543019	2739279080	222
157	iso_pu_bacteria	2738543026	2739322739	222
158	iso_pu_bacteria	2738543029	2739340980	222
159	iso_pu_bacteria	2765235838	2765570373	222
160	iso_pu_bacteria	2818991445	2819594110	222
161	iso_pu_bacteria	2818991446	2819596539	222
162	iso_pu_bacteria	2818991449	2819615687	222
163	iso_pu_bacteria	2831265667	2831269576	222
164	iso_pu_bacteria	2831864461	2831865409	222
165	iso_pu_bacteria	2839094727	2839096700	222
166	iso_pu_bacteria	2839138175	2839139725	222
167	iso_pu_bacteria	2842733646	2842734664	222
168	iso_pu_bacteria	2842780639	2842783440	222
169	iso_pu_bacteria	2857553236	2857555384	222
170	iso_pu_bacteria	2884811622	2884816147	222
171	iso_pu_bacteria	2884836552	2884839410	222
172	iso_pu_bacteria	2884852848	2884856780	222
173	iso_pu_bacteria	2885198086	2885199255	222
174	iso_pu_bacteria	2885211737	2885212906	222
175	iso_pu_bacteria	2886848708	2886849554	222
176	iso_pu_bacteria	2896154374	2896158126	222
177	iso_pu_bacteria	2904424332	2904428233	222
178	iso_pu_bacteria	2904439833	2904443494	222
179	iso_pu_bacteria	2904530477	2904532475	222
180	iso_pu_bacteria	2904541872	2904543972	222
181	iso_pu_bacteria	2904584206	2904584945	222
182	iso_pu_bacteria	2904584206	2904589146	222
183	iso_pu_bacteria	2904589729	2904590372	222
184	iso_pu_bacteria	2904589729	2904591467	222
185	iso_pu_bacteria	2904601388	2904605489	222
186	iso_pu_bacteria	2919046199	2919048264	222
187	iso_pu_bacteria	2919079590	2919080235	222
188	iso_pu_bacteria	2919079590	2919081261	222
189	iso_pu_bacteria	2919476304	2919476539	222
190	iso_pu_bacteria	2919688452	2919692020	222
191	iso_pu_bacteria	2923510766	2923512869	222
192	iso_pu_bacteria	2928037797	2928037971	222
193	iso_pu_bacteria	2928044640	2928046423	222
194	iso_pu_bacteria	2928084124	2928090473	222
195	iso_pu_bacteria	2928115317	2928120361	222
196	iso_pu_bacteria	2928130867	2928132823	222
197	iso_pu_bacteria	2929160207	2929162469	222
198	iso_pu_bacteria	2945909444	2945913156	222
199	iso_pu_bacteria	2945984333	2945984570	222
200	iso_pu_bacteria	2513237098	2513674391	223
201	iso_pu_bacteria	2524023210	2524470465	223
202	iso_pu_bacteria	2545555834	2545676393	223
203	iso_pu_bacteria	2585428106	2587919918	223
204	iso_pu_bacteria	2596583598	2597032605	223
205	iso_pu_bacteria	2599185178	2599447292	223
206	iso_pu_bacteria	2643221588	2643950509	223
207	iso_pu_bacteria	2643221598	2643998214	223
208	iso_pu_bacteria	2643221614	2644087250	223
209	iso_pu_bacteria	2643221640	2644223450	223
210	iso_pu_bacteria	2643221642	2644237192	223
211	iso_pu_bacteria	2643221661	2644342203	223
212	iso_pu_bacteria	2643221666	2644368489	223
213	iso_pu_bacteria	2667528175	2671121879	223
214	iso_pu_bacteria	2728368998	2728753295	223
215	iso_pu_bacteria	2739367664	2739649514	223
216	iso_pu_bacteria	2739367865	2740027987	223
217	iso_pu_bacteria	2885383462	2885390826	223
218	iso_pu_bacteria	2896184354	2896184454	223
219	iso_pu_bacteria	2900577576	2900582406	223
220	iso_pu_bacteria	2906610324	2906617213	223
221	iso_pu_bacteria	2919138771	2919142889	223
222	iso_pu_bacteria	2922361189	2922365659	223
223	iso_pu_bacteria	2922425934	2922430615	223
224	iso_pu_bacteria	2928058823	2928061005	223
225	iso_pu_bacteria	2928531327	2928532062	223
226	iso_pu_bacteria	641522639	641641419	223
227	iso_pu_bacteria	8006984368	8006987955	223
228	3300005327	Ga0070658_10305689	Ga0070658_103056892	224
229	3300005330	Ga0070690_100221875	Ga0070690_1002218752	224
230	3300005367	Ga0070667_100012122	Ga0070667_1000121225	224
231	3300005457	Ga0070662_100348473	Ga0070662_1003484732	224
232	3300005466	Ga0070685_10152152	Ga0070685_101521522	224
233	3300005539	Ga0068853_100038274	Ga0068853_1000382742	224
234	3300005548	Ga0070665_100109059	Ga0070665_1001090592	224
235	3300005614	Ga0068856_100253064	Ga0068856_1002530642	224
236	3300005618	Ga0068864_100000060	Ga0068864_1000000608	224
237	3300005618	Ga0068864_100075922	Ga0068864_1000759224	224
238	3300005841	Ga0068863_100000023	Ga0068863_100000023122	224
239	3300005842	Ga0068858_100011301	Ga0068858_1000113012	224
240	3300009092	Ga0105250_10012457	Ga0105250_100124575	224
241	3300009177	Ga0105248_10001464	Ga0105248_100014645	224
242	3300009177	Ga0105248_10008111	Ga0105248_100081113	224
243	3300009551	Ga0105238_10050635	Ga0105238_100506352	224
244	3300009551	Ga0105238_10173229	Ga0105238_101732292	224
245	3300009553	Ga0105249_10000696	Ga0105249_1000069627	224
246	3300013307	Ga0157372_10009743	Ga0157372_100097432	224
247	3300014968	Ga0157379_10065925	Ga0157379_100659252	224
248	3300025304	Ga0209257_1004895	Ga0209257_10048952	224
249	3300025728	Ga0207655_1015935	Ga0207655_10159353	224
250	3300025924	Ga0207694_10549552	Ga0207694_105495521	224
251	3300025941	Ga0207711_10001333	Ga0207711_100013335	224
252	3300025941	Ga0207711_10004083	Ga0207711_100040833	224
253	3300025961	Ga0207712_10000704	Ga0207712_100007042	224
254	3300026035	Ga0207703_10000571	Ga0207703_1000057111	224
255	3300026067	Ga0207678_10035033	Ga0207678_100350334	224
256	3300026067	Ga0207678_10191397	Ga0207678_101913972	224
257	3300026075	Ga0207708_10068470	Ga0207708_100684702	224
258	3300026078	Ga0207702_10064551	Ga0207702_100645513	224
259	3300026088	Ga0207641_10000067	Ga0207641_10000067149	224
260	3300026095	Ga0207676_10001977	Ga0207676_100019779	224
261	3300026095	Ga0207676_10105688	Ga0207676_101056882	224
262	3300030745	Ga0316182_1321233	Ga0316182_13212332	224
263	3300031249	Ga0265339_10019383	Ga0265339_100193833	224
264	3300031251	Ga0265327_10000602	Ga0265327_1000060246	224
265	3300031456	Ga0307513_10376312	Ga0307513_103763122	224
266	3300031616	Ga0307508_10193959	Ga0307508_101939592	224
267	3300031649	Ga0307514_10000897	Ga0307514_1000089722	224
268	3300032004	Ga0307414_10663257	Ga0307414_106632571	224
269	3300037471	Ga0395905_0037528	Ga0395905_0037528_2947_3624	224
270	3300037471	Ga0395905_0558592	Ga0395905_0558592_212_889	224
271	3300041443	Ga0451789_0921895	Ga0451789_0921895_244_951	224
272	3300041451	Ga0451791_1409985	Ga0451791_1409985_874_1581	224
273	3300041505	Ga0451849_0323083	Ga0451849_0323083_134_841	224
274	3300041512	Ga0451853_0346075	Ga0451853_0346075_1730_2407	224
275	3300042115	Ga0450911_000343	Ga0450911_000343_10902_11579	224
276	3300044706	Ga0466964_0046584	Ga0466964_0046584_744_1421	224
277	3300046506	Ga0495583_0053739	Ga0495583_0053739_945_1622	224
278	3300046512	Ga0495610_0081502	Ga0495610_0081502_663_1340	224
279	3300046515	Ga0495620_0019996	Ga0495620_0019996_362_1039	224
280	3300046522	Ga0495643_0006441	Ga0495643_0006441_2344_3021	224
281	3300046525	Ga0495663_0001189	Ga0495663_0001189_3983_4660	224
282	3300046542	Ga0495597_0004297	Ga0495597_0004297_5706_6383	224
283	3300046543	Ga0495645_0463713	Ga0495645_0463713_42_725	224
284	3300046557	Ga0495622_0001106	Ga0495622_0001106_8087_8764	224
285	3300046558	Ga0495633_0003321	Ga0495633_0003321_3703_4380	224
286	3300046616	Ga0495668_0013101	Ga0495668_0013101_2777_3454	224
287	3300046660	Ga0495625_0237783	Ga0495625_0237783_327_1004	224
288	3300046692	Ga0495671_0091322	Ga0495671_0091322_489_1169	224
289	3300047320	Ga0495672_0067873	Ga0495672_0067873_1128_1805	224
290	3300047443	Ga0495687_047451	Ga0495687_047451_807_1484	224
291	3300047445	Ga0495677_0211708	Ga0495677_0211708_15_692	224
292	3300047471	Ga0495684_0216846	Ga0495684_0216846_91_774	224
293	3300047673	Ga0495593_0055835	Ga0495593_0055835_646_1323	224
294	3300048906	Ga0496103_0047711	Ga0496103_0047711_1335_2012	224
295	3300048919	Ga0496116_0053528	Ga0496116_0053528_1860_2537	224
296	3300048920	Ga0496117_0014560	Ga0496117_0014560_686_1363	224
297	3300048921	Ga0496118_0014723	Ga0496118_0014723_6396_7073	224
298	3300048922	Ga0496119_0030380	Ga0496119_0030380_25_702	224
299	3300048924	Ga0496121_0000152	Ga0496121_0000152_82352_83029	224
300	3300048924	Ga0496121_0010811	Ga0496121_0010811_765_1442	224
301	3300048925	Ga0496122_0006699	Ga0496122_0006699_7247_7927	224
302	3300048926	Ga0496123_0009893	Ga0496123_0009893_1806_2486	224
303	3300048927	Ga0496124_0078860	Ga0496124_0078860_915_1592	224
304	3300048928	Ga0496125_0000383	Ga0496125_0000383_40713_41393	224
305	3300048928	Ga0496125_0005957	Ga0496125_0005957_6875_7552	224
306	3300048928	Ga0496125_0012018	Ga0496125_0012018_3651_4328	224
307	3300048929	Ga0496126_0041509	Ga0496126_0041509_656_1333	224
308	3300048929	Ga0496126_0052788	Ga0496126_0052788_2310_2987	224
309	3300049460	Ga0495682_0137788	Ga0495682_0137788_69_746	224
310	3300049568	Ga0501031_0465931	Ga0501031_0465931_78_761	224
311	3300049570	Ga0501033_0159126	Ga0501033_0159126_652_1335	224
312	3300049574	Ga0501038_0286648	Ga0501038_0286648_177_860	224
313	3300049581	Ga0501047_0470541	Ga0501047_0470541_297_986	224
314	3300049589	Ga0501073_0313098	Ga0501073_0313098_133_870	224
315	3300049662	Ga0501222_012176	Ga0501222_012176_353_1030	224
316	3300049742	Ga0501080_0563183	Ga0501080_0563183_35_724	224
317	3300049744	Ga0501083_0198803	Ga0501083_0198803_320_1000	224
318	3300049822	Ga0501035_0137099	Ga0501035_0137099_475_1152	224
319	3300049822	Ga0501035_0539684	Ga0501035_0539684_183_866	224
320	3300049823	Ga0501044_0471525	Ga0501044_0471525_54_737	224
321	3300053080	Ga0500635_0000208	Ga0500635_0000208_22686_23363	224
322	3300053094	Ga0500566_0033160	Ga0500566_0033160_2002_2679	224
323	3300053103	Ga0500555_002499	Ga0500555_002499_4281_4958	224
324	3300053104	Ga0500556_0002665	Ga0500556_0002665_1005_1682	224
325	3300053104	Ga0500556_0015270	Ga0500556_0015270_248_925	224
326	3300053108	Ga0500562_000424	Ga0500562_000424_7957_8634	224
327	3300053109	Ga0500569_000410	Ga0500569_000410_3224_3901	224
328	3300053122	Ga0500608_054398	Ga0500608_054398_85_762	224
329	3300053123	Ga0500614_019612	Ga0500614_019612_717_1394	224
330	3300053138	Ga0500564_053379	Ga0500564_053379_947_1624	224
331	3300053148	Ga0500590_060286	Ga0500590_060286_1210_1887	224
332	3300053154	Ga0500619_116084	Ga0500619_116084_41_718	224
333	3300053177	Ga0500636_0006613	Ga0500636_0006613_4787_5464	224
334	3300053178	Ga0500637_0000774	Ga0500637_0000774_6303_6980	224
335	3300053729	Ga0500625_109463	Ga0500625_109463_333_1010	224
336	3300053730	Ga0500645_000557	Ga0500645_000557_12134_12814	224
337	3300053730	Ga0500645_001117	Ga0500645_001117_8091_8768	224
338	3300053735	Ga0500596_005428	Ga0500596_005428_357_1034	224
339	3300055283	Ga0500661_040736	Ga0500661_040736_31_708	224
340	3300001979	JGI24740J21852_10002839	JGI24740J21852_100028391	225
341	3300001989	JGI24739J22299_10000354	JGI24739J22299_100003547	225
342	3300001990	JGI24737J22298_10002383	JGI24737J22298_100023831	225
343	3300001990	JGI24737J22298_10003480	JGI24737J22298_100034802	225
344	3300003187	JGI25151J46595_10000664	JGI25151J46595_1000066420	225
345	3300003215	JGI25153J46596_10031507	JGI25153J46596_100315072	225
346	3300003316	rootH1_10008601	rootH1_100086012	225
347	3300003322	rootL2_10018460	rootL2_100184605	225
348	3300003322	rootL2_10070143	rootL2_100701432	225
349	3300003578	Ga0006562J51391_1004720	Ga0006562J51391_10047208	225
350	3300003856	Ga0058692_1005047	Ga0058692_10050473	225
351	3300005262	Ga0065165_1025074	Ga0065165_10250741	225
352	3300005295	Ga0065707_10000531	Ga0065707_1000053127	225
353	3300005353	Ga0070669_100019206	Ga0070669_1000192062	225
354	3300005354	Ga0070675_100012564	Ga0070675_1000125642	225
355	3300005367	Ga0070667_100506406	Ga0070667_1005064062	225
356	3300005563	Ga0068855_100003478	Ga0068855_10000347814	225
357	3300005577	Ga0068857_100875281	Ga0068857_1008752811	225
358	3300005578	Ga0068854_100000585	Ga0068854_10000058514	225
359	3300005578	Ga0068854_100026756	Ga0068854_1000267562	225
360	3300005834	Ga0068851_10021443	Ga0068851_100214434	225
361	3300009011	Ga0105251_10000122	Ga0105251_1000012251	225
362	3300009011	Ga0105251_10003140	Ga0105251_100031405	225
363	3300009036	Ga0105244_10000183	Ga0105244_1000018320	225
364	3300009036	Ga0105244_10013403	Ga0105244_100134035	225
365	3300009092	Ga0105250_10000014	Ga0105250_10000014181	225
366	3300009092	Ga0105250_10000020	Ga0105250_1000002092	225
367	3300009092	Ga0105250_10000026	Ga0105250_10000026122	225
368	3300009092	Ga0105250_10000202	Ga0105250_1000020230	225
369	3300009092	Ga0105250_10019453	Ga0105250_100194532	225
370	3300009092	Ga0105250_10030804	Ga0105250_100308041	225
371	3300009093	Ga0105240_10009574	Ga0105240_1000957410	225
372	3300009093	Ga0105240_10052688	Ga0105240_100526882	225
373	3300009545	Ga0105237_10000064	Ga0105237_10000064122	225
374	3300009545	Ga0105237_10034779	Ga0105237_100347794	225
375	3300010375	Ga0105239_10030271	Ga0105239_100302712	225
376	3300010375	Ga0105239_10037060	Ga0105239_100370602	225
377	3300012500	Ga0157314_1000538	Ga0157314_10005382	225
378	3300013100	Ga0157373_10000373	Ga0157373_1000037326	225
379	3300013100	Ga0157373_10031106	Ga0157373_100311062	225
380	3300013102	Ga0157371_10000666	Ga0157371_100006669	225
381	3300013104	Ga0157370_10267506	Ga0157370_102675062	225
382	3300013105	Ga0157369_10039882	Ga0157369_100398821	225
383	3300013105	Ga0157369_10228078	Ga0157369_102280782	225
384	3300013306	Ga0163162_10388361	Ga0163162_103883612	225
385	3300014497	Ga0182008_10000845	Ga0182008_1000084518	225
386	3300025258	Ga0209129_1006040	Ga0209129_10060404	225
387	3300025294	Ga0209025_1000193	Ga0209025_100019360	225
388	3300025297	Ga0209758_1000414	Ga0209758_100041443	225
389	3300025297	Ga0209758_1048911	Ga0209758_10489112	225
390	3300025711	Ga0207696_1000003	Ga0207696_1000003706	225
391	3300025711	Ga0207696_1000036	Ga0207696_1000036139	225
392	3300025711	Ga0207696_1000058	Ga0207696_1000058162	225
393	3300025711	Ga0207696_1000059	Ga0207696_1000059110	225
394	3300025711	Ga0207696_1000087	Ga0207696_1000087182	225
395	3300025728	Ga0207655_1000370	Ga0207655_100037020	225
396	3300025728	Ga0207655_1008596	Ga0207655_10085965	225
397	3300025728	Ga0207655_1018554	Ga0207655_10185545	225
398	3300025735	Ga0207713_1000005	Ga0207713_100000552	225
399	3300025735	Ga0207713_1000006	Ga0207713_1000006458	225
400	3300025904	Ga0207647_10003146	Ga0207647_100031464	225
401	3300025913	Ga0207695_10002043	Ga0207695_1000204314	225
402	3300025913	Ga0207695_10008561	Ga0207695_1000856110	225
403	3300025913	Ga0207695_10080109	Ga0207695_100801092	225
404	3300025914	Ga0207671_10000061	Ga0207671_1000006114	225
405	3300025949	Ga0207667_10000140	Ga0207667_1000014064	225
406	3300025949	Ga0207667_10000186	Ga0207667_1000018621	225
407	3300025981	Ga0207640_10000036	Ga0207640_1000003615	225
408	3300026035	Ga0207703_10035340	Ga0207703_100353403	225
409	3300026116	Ga0207674_10000279	Ga0207674_1000027945	225
410	3300026118	Ga0207675_100000016	Ga0207675_100000016108	225
411	3300026142	Ga0207698_10142085	Ga0207698_101420852	225
412	3300027312	Ga0209371_1000153	Ga0209371_100015329	225
413	3300027312	Ga0209371_1000598	Ga0209371_100059840	225
414	3300027312	Ga0209371_1001807	Ga0209371_100180714	225
415	3300030500	Ga0268256_1001577	Ga0268256_100157714	225
416	3300030500	Ga0268256_1002302	Ga0268256_10023022	225
417	3300030500	Ga0268256_1016738	Ga0268256_10167382	225
418	3300031824	Ga0307413_10404527	Ga0307413_104045272	225
419	3300031852	Ga0307410_10432838	Ga0307410_104328382	225
420	3300031995	Ga0307409_100095462	Ga0307409_1000954622	225
421	3300032005	Ga0307411_10805454	Ga0307411_108054542	225
422	3300041405	Ga0439438_000454	Ga0439438_000454_10541_11218	225
423	3300041451	Ga0451791_1587116	Ga0451791_1587116_87_773	225
424	3300042005	Ga0439448_0039815	Ga0439448_0039815_544_1224	225
425	3300046460	Ga0495638_0019793	Ga0495638_0019793_3089_3766	225
426	3300046471	Ga0495650_0047128	Ga0495650_0047128_287_964	225
427	3300046491	Ga0495584_0062761	Ga0495584_0062761_805_1482	225
428	3300046492	Ga0495585_0005043	Ga0495585_0005043_496_1173	225
429	3300046512	Ga0495610_0008182	Ga0495610_0008182_3069_3746	225
430	3300046616	Ga0495668_0327945	Ga0495668_0327945_78_755	225
431	3300047445	Ga0495677_0004635	Ga0495677_0004635_4099_4776	225
432	3300047446	Ga0495679_030702	Ga0495679_030702_918_1595	225
433	3300047446	Ga0495679_035644	Ga0495679_035644_138_815	225
434	3300048904	Ga0496101_0000238	Ga0496101_0000238_39985_40662	225
435	3300048904	Ga0496101_0006068	Ga0496101_0006068_5147_5824	225
436	3300048920	Ga0496117_0111540	Ga0496117_0111540_279_956	225
437	3300048921	Ga0496118_0010618	Ga0496118_0010618_683_1360	225
438	3300048921	Ga0496118_0139534	Ga0496118_0139534_617_1294	225
439	3300048922	Ga0496119_0001479	Ga0496119_0001479_21917_22594	225
440	3300048922	Ga0496119_0033972	Ga0496119_0033972_2569_3246	225
441	3300048923	Ga0496120_0000945	Ga0496120_0000945_25469_26146	225
442	3300048923	Ga0496120_0004933	Ga0496120_0004933_4144_4821	225
443	3300048924	Ga0496121_0008739	Ga0496121_0008739_10997_11677	225
444	3300048925	Ga0496122_0065807	Ga0496122_0065807_1523_2200	225
445	3300048925	Ga0496122_0071832	Ga0496122_0071832_1753_2430	225
446	3300048926	Ga0496123_0058274	Ga0496123_0058274_1404_2081	225
447	3300048926	Ga0496123_0075947	Ga0496123_0075947_982_1659	225
448	3300048926	Ga0496123_0165721	Ga0496123_0165721_75_752	225
449	3300048927	Ga0496124_0012772	Ga0496124_0012772_4143_4820	225
450	3300048927	Ga0496124_0025460	Ga0496124_0025460_2213_2890	225
451	3300048927	Ga0496124_0034669	Ga0496124_0034669_3330_4007	225
452	3300048927	Ga0496124_0040476	Ga0496124_0040476_2156_2833	225
453	3300048928	Ga0496125_0000016	Ga0496125_0000016_92666_93343	225
454	3300048928	Ga0496125_0000804	Ga0496125_0000804_10097_10777	225
455	3300048928	Ga0496125_0082815	Ga0496125_0082815_118_795	225
456	3300048929	Ga0496126_0009748	Ga0496126_0009748_1653_2330	225
457	3300048929	Ga0496126_0333635	Ga0496126_0333635_384_1061	225
458	3300049569	Ga0501032_0292393	Ga0501032_0292393_365_1042	225
459	3300049573	Ga0501037_0066664	Ga0501037_0066664_709_1392	225
460	3300049579	Ga0501043_0217322	Ga0501043_0217322_375_1052	225
461	3300049822	Ga0501035_0091255	Ga0501035_0091255_1276_1959	225
462	3300001979	JGI24740J21852_10013472	JGI24740J21852_100134722	226
463	3300001979	JGI24740J21852_10036409	JGI24740J21852_100364092	226
464	3300002705	JGI25156J39149_1008143	JGI25156J39149_10081431	226
465	3300002737	JGI25162J39368_1004372	JGI25162J39368_10043723	226
466	3300002773	JGI25152J39213_1005453	JGI25152J39213_10054533	226
467	3300002773	JGI25152J39213_1006465	JGI25152J39213_10064652	226
468	3300002774	JGI25150J39212_1002881	JGI25150J39212_10028813	226
469	3300002987	JGI25159J45721_1011896	JGI25159J45721_10118961	226
470	3300002987	JGI25159J45721_1011908	JGI25159J45721_10119081	226
471	3300003187	JGI25151J46595_10007419	JGI25151J46595_100074192	226
472	3300003187	JGI25151J46595_10011006	JGI25151J46595_100110063	226
473	3300003187	JGI25151J46595_10016823	JGI25151J46595_100168232	226
474	3300003215	JGI25153J46596_10022717	JGI25153J46596_100227172	226
475	3300003215	JGI25153J46596_10025601	JGI25153J46596_100256011	226
476	3300003215	JGI25153J46596_10025649	JGI25153J46596_100256492	226
477	3300003316	rootH1_10009565	rootH1_100095654	226
478	3300003316	rootH1_10088361	rootH1_100883612	226
479	3300003320	rootH2_10006506	rootH2_100065064	226
480	3300003322	rootL2_10000651	rootL2_100006517	226
481	3300003322	rootL2_10169569	rootL2_101695692	226
482	3300003323	rootH1_10006604	rootH1_100066043	226
483	3300003323	rootH1_10039841	rootH1_1003984140	226
484	3300003323	rootH1_10041426	rootH1_100414262	226
485	3300003323	rootH1_10113531	rootH1_101135312	226
486	3300003354	JGI25160J50197_1019179	JGI25160J50197_10191791	226
487	3300003354	JGI25160J50197_1019183	JGI25160J50197_10191831	226
488	3300003374	JGI25161J50226_1011391	JGI25161J50226_10113911	226
489	3300003374	JGI25161J50226_1012563	JGI25161J50226_10125632	226
490	3300003751	Ga0055538_1000050	Ga0055538_1000050117	226
491	3300003752	Ga0055539_1000074	Ga0055539_1000074117	226
492	3300003752	Ga0055539_1000171	Ga0055539_100017111	226
493	3300003756	Ga0055533_1000010	Ga0055533_1000010294	226
494	3300003756	Ga0055533_1000081	Ga0055533_1000081117	226
495	3300003759	Ga0055525_1000108	Ga0055525_10001088	226
496	3300003761	Ga0055535_1000084	Ga0055535_100008484	226
497	3300003761	Ga0055535_1000292	Ga0055535_100029225	226
498	3300003762	Ga0055542_1000033	Ga0055542_1000033105	226
499	3300003763	Ga0055529_1000828	Ga0055529_100082816	226
500	3300003771	Ga0055526_1000054	Ga0055526_100005456	226
501	3300003771	Ga0055526_1000535	Ga0055526_10005358	226
502	3300003771	Ga0055526_1022900	Ga0055526_10229001	226
503	3300003771	Ga0055526_1022908	Ga0055526_10229081	226
504	3300003773	Ga0055537_1009653	Ga0055537_10096531	226
505	3300003775	Ga0055524_1000864	Ga0055524_100086415	226
506	3300003775	Ga0055524_1005156	Ga0055524_10051563	226
507	3300003775	Ga0055524_1021887	Ga0055524_10218871	226
508	3300003775	Ga0055524_1021892	Ga0055524_10218921	226
509	3300003781	Ga0055536_1001382	Ga0055536_100138212	226
510	3300003781	Ga0055536_1002930	Ga0055536_10029303	226
511	3300003781	Ga0055536_1010724	Ga0055536_10107246	226
512	3300003781	Ga0055536_1032527	Ga0055536_10325272	226
513	3300003784	Ga0055534_1004166	Ga0055534_10041663	226
514	3300003784	Ga0055534_1005892	Ga0055534_10058922	226
515	3300003790	Ga0055528_1020870	Ga0055528_10208701	226
516	3300003791	Ga0055530_10004105	Ga0055530_100041052	226
517	3300003791	Ga0055530_10006778	Ga0055530_100067785	226
518	3300003791	Ga0055530_10009858	Ga0055530_100098581	226
519	3300003792	Ga0055540_1000733	Ga0055540_10007336	226
520	3300003792	Ga0055540_1008745	Ga0055540_10087451	226
521	3300003792	Ga0055540_1013411	Ga0055540_10134112	226
522	3300003792	Ga0055540_1016481	Ga0055540_10164811	226
523	3300003792	Ga0055540_1041648	Ga0055540_10416481	226
524	3300003794	Ga0055531_10001613	Ga0055531_1000161310	226
525	3300003794	Ga0055531_10001667	Ga0055531_100016679	226
526	3300003794	Ga0055531_10002763	Ga0055531_100027631	226
527	3300003794	Ga0055531_10025988	Ga0055531_100259881	226
528	3300003794	Ga0055531_10026127	Ga0055531_100261271	226
529	3300003841	Ga0055541_1000052	Ga0055541_1000052117	226
530	3300004625	Ga0055543_1001590	Ga0055543_10015902	226
531	3300004625	Ga0055543_1009170	Ga0055543_10091701	226
532	3300004625	Ga0055543_1009267	Ga0055543_10092671	226
533	3300005262	Ga0065165_1000079	Ga0065165_100007946	226
534	3300005262	Ga0065165_1000482	Ga0065165_100048212	226
535	3300005262	Ga0065165_1015015	Ga0065165_10150153	226
536	3300005262	Ga0065165_1021847	Ga0065165_10218472	226
537	3300005289	Ga0065704_10191172	Ga0065704_101911722	226
538	3300005327	Ga0070658_10181640	Ga0070658_101816402	226
539	3300005327	Ga0070658_10187675	Ga0070658_101876751	226
540	3300005330	Ga0070690_100126686	Ga0070690_1001266862	226
541	3300005331	Ga0070670_100025988	Ga0070670_1000259884	226
542	3300005337	Ga0070682_100004145	Ga0070682_1000041454	226
543	3300005337	Ga0070682_100022477	Ga0070682_1000224772	226
544	3300005337	Ga0070682_100049921	Ga0070682_1000499212	226
545	3300005339	Ga0070660_100037197	Ga0070660_1000371972	226
546	3300005339	Ga0070660_100368548	Ga0070660_1003685482	226
547	3300005339	Ga0070660_100818675	Ga0070660_1008186751	226
548	3300005340	Ga0070689_100344471	Ga0070689_1003444711	226
549	3300005344	Ga0070661_100000143	Ga0070661_1000001439	226
550	3300005353	Ga0070669_100063583	Ga0070669_1000635832	226
551	3300005354	Ga0070675_100112165	Ga0070675_1001121652	226
552	3300005356	Ga0070674_100070064	Ga0070674_1000700642	226
553	3300005356	Ga0070674_100097513	Ga0070674_1000975131	226
554	3300005356	Ga0070674_100174562	Ga0070674_1001745622	226
555	3300005356	Ga0070674_100488260	Ga0070674_1004882601	226
556	3300005366	Ga0070659_100024982	Ga0070659_1000249824	226
557	3300005367	Ga0070667_100117075	Ga0070667_1001170753	226
558	3300005367	Ga0070667_100290125	Ga0070667_1002901252	226
559	3300005455	Ga0070663_100147199	Ga0070663_1001471992	226
560	3300005457	Ga0070662_100460863	Ga0070662_1004608632	226
561	3300005457	Ga0070662_100473118	Ga0070662_1004731182	226
562	3300005457	Ga0070662_100581041	Ga0070662_1005810411	226
563	3300005458	Ga0070681_10012756	Ga0070681_100127562	226
564	3300005459	Ga0068867_100149041	Ga0068867_1001490412	226
565	3300005466	Ga0070685_10157368	Ga0070685_101573682	226
566	3300005467	Ga0070706_100079983	Ga0070706_1000799832	226
567	3300005530	Ga0070679_100087379	Ga0070679_1000873792	226
568	3300005539	Ga0068853_100012662	Ga0068853_1000126622	226
569	3300005539	Ga0068853_100054227	Ga0068853_1000542272	226
570	3300005543	Ga0070672_100040886	Ga0070672_1000408862	226
571	3300005543	Ga0070672_100089507	Ga0070672_1000895071	226
572	3300005548	Ga0070665_100051090	Ga0070665_1000510905	226
573	3300005548	Ga0070665_100490240	Ga0070665_1004902402	226
574	3300005563	Ga0068855_100000137	Ga0068855_1000001377	226
575	3300005563	Ga0068855_100005033	Ga0068855_10000503314	226
576	3300005563	Ga0068855_100024079	Ga0068855_1000240797	226
577	3300005563	Ga0068855_100034832	Ga0068855_1000348322	226
578	3300005563	Ga0068855_100448918	Ga0068855_1004489182	226
579	3300005563	Ga0068855_100893859	Ga0068855_1008938591	226
580	3300005564	Ga0070664_100018005	Ga0070664_1000180053	226
581	3300005564	Ga0070664_100454240	Ga0070664_1004542402	226
582	3300005614	Ga0068856_100333839	Ga0068856_1003338391	226
583	3300005616	Ga0068852_100078439	Ga0068852_1000784392	226
584	3300005616	Ga0068852_101001745	Ga0068852_1010017451	226
585	3300005618	Ga0068864_100107940	Ga0068864_1001079402	226
586	3300005618	Ga0068864_100767000	Ga0068864_1007670002	226
587	3300005719	Ga0068861_100058408	Ga0068861_1000584082	226
588	3300005719	Ga0068861_100062352	Ga0068861_1000623522	226
589	3300005834	Ga0068851_10027742	Ga0068851_100277422	226
590	3300005834	Ga0068851_10138221	Ga0068851_101382212	226
591	3300005840	Ga0068870_10029378	Ga0068870_100293782	226
592	3300005841	Ga0068863_100057377	Ga0068863_1000573772	226
593	3300005844	Ga0068862_100480591	Ga0068862_1004805912	226
594	3300005844	Ga0068862_100643943	Ga0068862_1006439432	226
595	3300005937	Ga0081455_10002149	Ga0081455_100021495	226
596	3300006042	Ga0075368_10074369	Ga0075368_100743692	226
597	3300006048	Ga0075363_100001701	Ga0075363_1000017018	226
598	3300006048	Ga0075363_100189959	Ga0075363_1001899591	226
599	3300006177	Ga0075362_10016368	Ga0075362_100163683	226
600	3300006177	Ga0075362_10078028	Ga0075362_100780282	226
601	3300006177	Ga0075362_10144914	Ga0075362_101449142	226
602	3300006178	Ga0075367_10106510	Ga0075367_101065102	226
603	3300006186	Ga0075369_10110967	Ga0075369_101109672	226
604	3300006195	Ga0075366_10018499	Ga0075366_100184993	226
605	3300006195	Ga0075366_10033130	Ga0075366_100331303	226
606	3300006195	Ga0075366_10046508	Ga0075366_100465082	226
607	3300006195	Ga0075366_10050209	Ga0075366_100502093	226
608	3300006195	Ga0075366_10085310	Ga0075366_100853102	226
609	3300006195	Ga0075366_10121431	Ga0075366_101214312	226
610	3300006195	Ga0075366_10162792	Ga0075366_101627922	226
611	3300006353	Ga0075370_10002131	Ga0075370_100021316	226
612	3300006353	Ga0075370_10005249	Ga0075370_1000524910	226
613	3300006353	Ga0075370_10006660	Ga0075370_100066602	226
614	3300006353	Ga0075370_10021246	Ga0075370_100212462	226
615	3300006353	Ga0075370_10024466	Ga0075370_100244662	226
616	3300006353	Ga0075370_10024554	Ga0075370_100245542	226
617	3300006353	Ga0075370_10030061	Ga0075370_100300612	226
618	3300006353	Ga0075370_10058295	Ga0075370_100582951	226
619	3300006353	Ga0075370_10065628	Ga0075370_100656281	226
620	3300006353	Ga0075370_10072767	Ga0075370_100727673	226
621	3300006353	Ga0075370_10161343	Ga0075370_101613432	226
622	3300006358	Ga0068871_100491345	Ga0068871_1004913452	226
623	3300006846	Ga0075430_100033792	Ga0075430_1000337923	226
624	3300006846	Ga0075430_100402162	Ga0075430_1004021622	226
625	3300006881	Ga0068865_100511590	Ga0068865_1005115902	226
626	3300006944	Ga0099823_1000002	Ga0099823_100000297	226
627	3300006946	Ga0079104_1000020	Ga0079104_1000020118	226
628	3300009036	Ga0105244_10001568	Ga0105244_1000156814	226
629	3300009093	Ga0105240_10045798	Ga0105240_100457983	226
630	3300009093	Ga0105240_10167101	Ga0105240_101671012	226
631	3300009093	Ga0105240_10360683	Ga0105240_103606832	226
632	3300009094	Ga0111539_10027511	Ga0111539_100275113	226
633	3300009094	Ga0111539_11172312	Ga0111539_111723121	226
634	3300009098	Ga0105245_10898373	Ga0105245_108983732	226
635	3300009148	Ga0105243_10002185	Ga0105243_1000218512	226
636	3300009148	Ga0105243_10015574	Ga0105243_100155742	226
637	3300009148	Ga0105243_10023123	Ga0105243_100231232	226
638	3300009176	Ga0105242_10107117	Ga0105242_101071172	226
639	3300009545	Ga0105237_10001399	Ga0105237_1000139911	226
640	3300009545	Ga0105237_10099200	Ga0105237_100992002	226
641	3300009551	Ga0105238_10048074	Ga0105238_100480743	226
642	3300009984	Ga0105029_100139	Ga0105029_1001392	226
643	3300010375	Ga0105239_10002059	Ga0105239_1000205910	226
644	3300010375	Ga0105239_10011067	Ga0105239_100110672	226
645	3300010375	Ga0105239_10340355	Ga0105239_103403552	226
646	3300012497	Ga0157319_1000007	Ga0157319_1000007105	226
647	3300013104	Ga0157370_10122058	Ga0157370_101220583	226
648	3300013297	Ga0157378_10931135	Ga0157378_109311351	226
649	3300013306	Ga0163162_10195180	Ga0163162_101951802	226
650	3300013306	Ga0163162_10396011	Ga0163162_103960113	226
651	3300013308	Ga0157375_10081033	Ga0157375_100810332	226
652	3300013308	Ga0157375_10205744	Ga0157375_102057442	226
653	3300013308	Ga0157375_10336546	Ga0157375_103365462	226
654	3300014325	Ga0163163_10049209	Ga0163163_100492094	226
655	3300014325	Ga0163163_10086160	Ga0163163_100861602	226
656	3300014326	Ga0157380_10000318	Ga0157380_1000031826	226
657	3300014326	Ga0157380_10059205	Ga0157380_100592052	226
658	3300014326	Ga0157380_10169578	Ga0157380_101695783	226
659	3300014326	Ga0157380_10189877	Ga0157380_101898772	226
660	3300014497	Ga0182008_10002275	Ga0182008_100022753	226
661	3300014497	Ga0182008_10006934	Ga0182008_100069341	226
662	3300014497	Ga0182008_10019825	Ga0182008_100198253	226
663	3300014497	Ga0182008_10254969	Ga0182008_102549691	226
664	3300014745	Ga0157377_10300712	Ga0157377_103007122	226
665	3300014969	Ga0157376_10153295	Ga0157376_101532952	226
666	3300014969	Ga0157376_10241125	Ga0157376_102411253	226
667	3300014969	Ga0157376_10320551	Ga0157376_103205512	226
668	3300015261	Ga0182006_1001179	Ga0182006_100117915	226
669	3300015261	Ga0182006_1001945	Ga0182006_100194516	226
670	3300015261	Ga0182006_1005176	Ga0182006_10051764	226
671	3300015261	Ga0182006_1062502	Ga0182006_10625023	226
672	3300015262	Ga0182007_10001682	Ga0182007_100016829	226
673	3300015262	Ga0182007_10015207	Ga0182007_100152071	226
674	3300015262	Ga0182007_10036092	Ga0182007_100360922	226
675	3300015684	Ga0183365_10001	Ga0183365_10001299	226
676	3300017792	Ga0163161_10000128	Ga0163161_1000012877	226
677	3300017792	Ga0163161_10003865	Ga0163161_100038658	226
678	3300017792	Ga0163161_10012215	Ga0163161_100122154	226
679	3300017792	Ga0163161_10101407	Ga0163161_101014074	226
680	3300017792	Ga0163161_10147505	Ga0163161_101475051	226
681	3300017792	Ga0163161_10158175	Ga0163161_101581752	226
682	3300017792	Ga0163161_10221313	Ga0163161_102213132	226
683	3300017792	Ga0163161_10657483	Ga0163161_106574831	226
684	3300021361	Ga0213872_10009892	Ga0213872_100098922	226
685	3300025208	Ga0209436_108427	Ga0209436_1084272	226
686	3300025208	Ga0209436_112861	Ga0209436_1128612	226
687	3300025224	Ga0209784_100002	Ga0209784_1000021469	226
688	3300025225	Ga0209566_100003	Ga0209566_1000031469	226
689	3300025226	Ga0209674_100003	Ga0209674_1000031630	226
690	3300025226	Ga0209674_100004	Ga0209674_1000041469	226
691	3300025228	Ga0209672_100228	Ga0209672_10022830	226
692	3300025229	Ga0209147_101646	Ga0209147_1016465	226
693	3300025230	Ga0209563_100006	Ga0209563_1000061469	226
694	3300025230	Ga0209563_100049	Ga0209563_10004992	226
695	3300025233	Ga0209437_100272	Ga0209437_10027257	226
696	3300025242	Ga0209258_100089	Ga0209258_100089104	226
697	3300025242	Ga0209258_100128	Ga0209258_10012816	226
698	3300025245	Ga0207425_1000257	Ga0207425_100025730	226
699	3300025245	Ga0207425_1000422	Ga0207425_100042210	226
700	3300025245	Ga0207425_1001684	Ga0207425_100168411	226
701	3300025245	Ga0207425_1008063	Ga0207425_10080634	226
702	3300025253	Ga0209677_100003	Ga0209677_1000031469	226
703	3300025253	Ga0209677_100050	Ga0209677_10005049	226
704	3300025253	Ga0209677_107578	Ga0209677_1075782	226
705	3300025254	Ga0209148_1000097	Ga0209148_1000097104	226
706	3300025256	Ga0209759_1001118	Ga0209759_100111816	226
707	3300025256	Ga0209759_1018263	Ga0209759_10182632	226
708	3300025258	Ga0209129_1000033	Ga0209129_1000033296	226
709	3300025258	Ga0209129_1000222	Ga0209129_100022236	226
710	3300025258	Ga0209129_1001977	Ga0209129_10019772	226
711	3300025258	Ga0209129_1007416	Ga0209129_10074162	226
712	3300025263	Ga0209565_1000516	Ga0209565_100051622	226
713	3300025263	Ga0209565_1001404	Ga0209565_10014043	226
714	3300025272	Ga0209455_1000116	Ga0209455_100011616	226
715	3300025273	Ga0209673_1000899	Ga0209673_100089923	226
716	3300025273	Ga0209673_1001394	Ga0209673_100139411	226
717	3300025273	Ga0209673_1005423	Ga0209673_10054237	226
718	3300025273	Ga0209673_1014350	Ga0209673_10143502	226
719	3300025273	Ga0209673_1028484	Ga0209673_10284842	226
720	3300025284	Ga0209130_1000105	Ga0209130_1000105120	226
721	3300025284	Ga0209130_1000615	Ga0209130_100061533	226
722	3300025284	Ga0209130_1000980	Ga0209130_100098022	226
723	3300025284	Ga0209130_1029719	Ga0209130_10297192	226
724	3300025291	Ga0209675_1000588	Ga0209675_100058818	226
725	3300025291	Ga0209675_1001765	Ga0209675_10017653	226
726	3300025291	Ga0209675_1005310	Ga0209675_10053103	226
727	3300025292	Ga0209676_1000260	Ga0209676_100026051	226
728	3300025292	Ga0209676_1001304	Ga0209676_10013048	226
729	3300025292	Ga0209676_1004531	Ga0209676_100453111	226
730	3300025292	Ga0209676_1017068	Ga0209676_10170682	226
731	3300025292	Ga0209676_1035980	Ga0209676_10359802	226
732	3300025294	Ga0209025_1000221	Ga0209025_1000221116	226
733	3300025294	Ga0209025_1001070	Ga0209025_100107011	226
734	3300025294	Ga0209025_1009557	Ga0209025_10095572	226
735	3300025294	Ga0209025_1023791	Ga0209025_10237914	226
736	3300025294	Ga0209025_1036737	Ga0209025_10367372	226
737	3300025294	Ga0209025_1041236	Ga0209025_10412362	226
738	3300025295	Ga0209564_1000030	Ga0209564_1000030130	226
739	3300025295	Ga0209564_1000042	Ga0209564_100004251	226
740	3300025295	Ga0209564_1000151	Ga0209564_1000151145	226
741	3300025295	Ga0209564_1000246	Ga0209564_100024628	226
742	3300025295	Ga0209564_1000498	Ga0209564_100049836	226
743	3300025297	Ga0209758_1000027	Ga0209758_1000027296	226
744	3300025297	Ga0209758_1000379	Ga0209758_100037950	226
745	3300025297	Ga0209758_1000800	Ga0209758_10008007	226
746	3300025297	Ga0209758_1014868	Ga0209758_10148682	226
747	3300025298	Ga0209050_1000600	Ga0209050_100060036	226
748	3300025298	Ga0209050_1000977	Ga0209050_100097734	226
749	3300025298	Ga0209050_1001487	Ga0209050_100148714	226
750	3300025298	Ga0209050_1002014	Ga0209050_100201415	226
751	3300025298	Ga0209050_1002366	Ga0209050_100236612	226
752	3300025298	Ga0209050_1018494	Ga0209050_10184942	226
753	3300025299	Ga0209256_1000069	Ga0209256_1000069193	226
754	3300025299	Ga0209256_1000506	Ga0209256_100050616	226
755	3300025299	Ga0209256_1001426	Ga0209256_10014266	226
756	3300025299	Ga0209256_1002066	Ga0209256_10020666	226
757	3300025299	Ga0209256_1012057	Ga0209256_10120572	226
758	3300025302	Ga0207426_1000027	Ga0207426_1000027261	226
759	3300025302	Ga0207426_1000859	Ga0207426_10008598	226
760	3300025303	Ga0209051_1000004	Ga0209051_1000004694	226
761	3300025303	Ga0209051_1000319	Ga0209051_100031911	226
762	3300025303	Ga0209051_1000707	Ga0209051_10007071	226
763	3300025303	Ga0209051_1000832	Ga0209051_100083229	226
764	3300025303	Ga0209051_1001383	Ga0209051_100138310	226
765	3300025303	Ga0209051_1005989	Ga0209051_10059892	226
766	3300025303	Ga0209051_1010973	Ga0209051_10109732	226
767	3300025303	Ga0209051_1012359	Ga0209051_10123592	226
768	3300025303	Ga0209051_1044584	Ga0209051_10445842	226
769	3300025303	Ga0209051_1053517	Ga0209051_10535172	226
770	3300025304	Ga0209257_1000063	Ga0209257_1000063180	226
771	3300025304	Ga0209257_1000281	Ga0209257_1000281115	226
772	3300025304	Ga0209257_1001403	Ga0209257_10014032	226
773	3300025304	Ga0209257_1001995	Ga0209257_10019951	226
774	3300025304	Ga0209257_1002063	Ga0209257_10020637	226
775	3300025304	Ga0209257_1002789	Ga0209257_10027897	226
776	3300025304	Ga0209257_1010059	Ga0209257_10100593	226
777	3300025304	Ga0209257_1044583	Ga0209257_10445831	226
778	3300025321	Ga0207656_10077272	Ga0207656_100772722	226
779	3300025321	Ga0207656_10089035	Ga0207656_100890351	226
780	3300025728	Ga0207655_1000566	Ga0207655_100056638	226
781	3300025728	Ga0207655_1002256	Ga0207655_10022562	226
782	3300025728	Ga0207655_1003494	Ga0207655_10034946	226
783	3300025893	Ga0207682_10071482	Ga0207682_100714821	226
784	3300025899	Ga0207642_10223286	Ga0207642_102232861	226
785	3300025908	Ga0207643_10018777	Ga0207643_100187772	226
786	3300025908	Ga0207643_10041521	Ga0207643_100415212	226
787	3300025909	Ga0207705_10148015	Ga0207705_101480152	226
788	3300025909	Ga0207705_10198312	Ga0207705_101983122	226
789	3300025912	Ga0207707_10034512	Ga0207707_100345122	226
790	3300025913	Ga0207695_10003541	Ga0207695_100035412	226
791	3300025913	Ga0207695_10048835	Ga0207695_100488354	226
792	3300025914	Ga0207671_10001933	Ga0207671_100019337	226
793	3300025914	Ga0207671_10062971	Ga0207671_100629712	226
794	3300025917	Ga0207660_10271063	Ga0207660_102710632	226
795	3300025919	Ga0207657_10230650	Ga0207657_102306502	226
796	3300025920	Ga0207649_10000628	Ga0207649_100006289	226
797	3300025924	Ga0207694_10002124	Ga0207694_1000212415	226
798	3300025924	Ga0207694_10009148	Ga0207694_100091487	226
799	3300025924	Ga0207694_10034464	Ga0207694_100344642	226
800	3300025924	Ga0207694_10358221	Ga0207694_103582212	226
801	3300025926	Ga0207659_10041497	Ga0207659_100414973	226
802	3300025926	Ga0207659_10076934	Ga0207659_100769342	226
803	3300025926	Ga0207659_10118454	Ga0207659_101184542	226
804	3300025932	Ga0207690_10126842	Ga0207690_101268422	226
805	3300025933	Ga0207706_10078281	Ga0207706_100782815	226
806	3300025933	Ga0207706_10162445	Ga0207706_101624452	226
807	3300025935	Ga0207709_10000230	Ga0207709_1000023038	226
808	3300025935	Ga0207709_10000240	Ga0207709_1000024051	226
809	3300025935	Ga0207709_10000267	Ga0207709_100002676	226
810	3300025935	Ga0207709_10009269	Ga0207709_100092693	226
811	3300025936	Ga0207670_10207707	Ga0207670_102077072	226
812	3300025937	Ga0207669_10094207	Ga0207669_100942072	226
813	3300025937	Ga0207669_10459202	Ga0207669_104592021	226
814	3300025937	Ga0207669_10529495	Ga0207669_105294952	226
815	3300025938	Ga0207704_10028332	Ga0207704_100283322	226
816	3300025940	Ga0207691_10025352	Ga0207691_100253525	226
817	3300025940	Ga0207691_10032522	Ga0207691_100325224	226
818	3300025941	Ga0207711_10177295	Ga0207711_101772952	226
819	3300025942	Ga0207689_10014440	Ga0207689_100144402	226
820	3300025945	Ga0207679_10000107	Ga0207679_1000010751	226
821	3300025945	Ga0207679_10351913	Ga0207679_103519132	226
822	3300025945	Ga0207679_10607275	Ga0207679_106072752	226
823	3300025949	Ga0207667_10000112	Ga0207667_1000011238	226
824	3300025949	Ga0207667_10010966	Ga0207667_100109665	226
825	3300025949	Ga0207667_10135438	Ga0207667_101354382	226
826	3300025949	Ga0207667_10309729	Ga0207667_103097292	226
827	3300025949	Ga0207667_10577962	Ga0207667_105779622	226
828	3300025949	Ga0207667_10734050	Ga0207667_107340502	226
829	3300025986	Ga0207658_10014272	Ga0207658_100142724	226
830	3300025986	Ga0207658_10444472	Ga0207658_104444721	226
831	3300026041	Ga0207639_10001769	Ga0207639_1000176910	226
832	3300026041	Ga0207639_10164674	Ga0207639_101646742	226
833	3300026041	Ga0207639_10486604	Ga0207639_104866042	226
834	3300026075	Ga0207708_10032445	Ga0207708_100324453	226
835	3300026075	Ga0207708_10066642	Ga0207708_100666422	226
836	3300026089	Ga0207648_10024168	Ga0207648_100241684	226
837	3300026089	Ga0207648_10053236	Ga0207648_100532363	226
838	3300026089	Ga0207648_10126989	Ga0207648_101269892	226
839	3300026118	Ga0207675_100006073	Ga0207675_10000607311	226
840	3300026118	Ga0207675_100039313	Ga0207675_1000393135	226
841	3300026118	Ga0207675_100080069	Ga0207675_1000800692	226
842	3300026118	Ga0207675_100080544	Ga0207675_1000805442	226
843	3300026118	Ga0207675_100724311	Ga0207675_1007243112	226
844	3300026121	Ga0207683_10019338	Ga0207683_100193385	226
845	3300026121	Ga0207683_10168106	Ga0207683_101681062	226
846	3300026121	Ga0207683_10235521	Ga0207683_102355212	226
847	3300026142	Ga0207698_10037461	Ga0207698_100374612	226
848	3300026142	Ga0207698_10148798	Ga0207698_101487982	226
849	3300026142	Ga0207698_10669576	Ga0207698_106695762	226
850	3300027111	Ga0209281_1000002	Ga0209281_1000002629	226
851	3300027296	Ga0209389_1008091	Ga0209389_10080917	226
852	3300028379	Ga0268266_10329645	Ga0268266_103296452	226
853	3300028380	Ga0268265_10830045	Ga0268265_108300452	226
854	3300028666	Ga0265336_10000006	Ga0265336_10000006101	226
855	3300028794	Ga0307515_10000567	Ga0307515_100005676	226
856	3300028794	Ga0307515_10001286	Ga0307515_1000128646	226
857	3300028794	Ga0307515_10001764	Ga0307515_1000176442	226
858	3300028794	Ga0307515_10032674	Ga0307515_100326744	226
859	3300029957	Ga0265324_10006334	Ga0265324_100063344	226
860	3300030522	Ga0307512_10021151	Ga0307512_100211512	226
861	3300030744	Ga0316181_1084923	Ga0316181_10849232	226
862	3300031456	Ga0307513_10002614	Ga0307513_100026146	226
863	3300031456	Ga0307513_10012566	Ga0307513_100125663	226
864	3300031456	Ga0307513_10015253	Ga0307513_100152536	226
865	3300031456	Ga0307513_10016687	Ga0307513_100166875	226
866	3300031456	Ga0307513_10067713	Ga0307513_100677132	226
867	3300031456	Ga0307513_10228530	Ga0307513_102285302	226
868	3300031456	Ga0307513_10440632	Ga0307513_104406321	226
869	3300031507	Ga0307509_10000635	Ga0307509_1000063536	226
870	3300031507	Ga0307509_10022947	Ga0307509_100229474	226
871	3300031507	Ga0307509_10038589	Ga0307509_100385892	226
872	3300031507	Ga0307509_10139951	Ga0307509_101399512	226
873	3300031507	Ga0307509_10300989	Ga0307509_103009892	226
874	3300031548	Ga0307408_100000222	Ga0307408_10000022214	226
875	3300031548	Ga0307408_100001360	Ga0307408_1000013604	226
876	3300031548	Ga0307408_100069150	Ga0307408_1000691503	226
877	3300031548	Ga0307408_100166939	Ga0307408_1001669392	226
878	3300031616	Ga0307508_10000133	Ga0307508_1000013316	226
879	3300031616	Ga0307508_10412641	Ga0307508_104126411	226
880	3300031649	Ga0307514_10004805	Ga0307514_100048058	226
881	3300031649	Ga0307514_10208775	Ga0307514_102087752	226
882	3300031711	Ga0265314_10082752	Ga0265314_100827522	226
883	3300031730	Ga0307516_10000253	Ga0307516_1000025341	226
884	3300031730	Ga0307516_10003782	Ga0307516_100037827	226
885	3300031730	Ga0307516_10013972	Ga0307516_100139725	226
886	3300031730	Ga0307516_10109280	Ga0307516_101092804	226
887	3300031730	Ga0307516_10203790	Ga0307516_102037902	226
888	3300031730	Ga0307516_10276172	Ga0307516_102761722	226
889	3300031731	Ga0307405_10155518	Ga0307405_101555182	226
890	3300031731	Ga0307405_10167644	Ga0307405_101676442	226
891	3300031824	Ga0307413_10118041	Ga0307413_101180412	226
892	3300031852	Ga0307410_10037219	Ga0307410_100372193	226
893	3300031852	Ga0307410_10979206	Ga0307410_109792061	226
894	3300031901	Ga0307406_10002944	Ga0307406_100029448	226
895	3300031901	Ga0307406_10021794	Ga0307406_100217945	226
896	3300031911	Ga0307412_10188922	Ga0307412_101889222	226
897	3300031995	Ga0307409_100006964	Ga0307409_1000069646	226
898	3300032002	Ga0307416_100038054	Ga0307416_1000380542	226
899	3300032002	Ga0307416_100053591	Ga0307416_1000535914	226
900	3300032002	Ga0307416_100209534	Ga0307416_1002095342	226
901	3300032005	Ga0307411_10001084	Ga0307411_100010847	226
902	3300032005	Ga0307411_10226476	Ga0307411_102264761	226
903	3300032005	Ga0307411_10282813	Ga0307411_102828132	226
904	3300032126	Ga0307415_100029481	Ga0307415_1000294812	226
905	3300035114	Ga0373939_0007732	Ga0373939_0007732_774_1454	226
906	3300037418	Ga0395900_0448240	Ga0395900_0448240_51_731	226
907	3300037466	Ga0395898_0040565	Ga0395898_0040565_3485_4165	226
908	3300037471	Ga0395905_0822683	Ga0395905_0822683_126_806	226
909	3300038443	Ga0395901_0056687	Ga0395901_0056687_162_842	226
910	3300039447	Ga0436361_0181041	Ga0436361_0181041_5918_6598	226
911	3300039447	Ga0436361_0369932	Ga0436361_0369932_1952_2632	226
912	3300039447	Ga0436361_0799021	Ga0436361_0799021_279_959	226
913	3300041404	Ga0439436_0000274	Ga0439436_0000274_4062_4742	226
914	3300041406	Ga0439439_0000663	Ga0439439_0000663_3284_3964	226
915	3300041407	Ga0439447_021493	Ga0439447_021493_433_1113	226
916	3300041410	Ga0439461_0092655	Ga0439461_0092655_31_711	226
917	3300041443	Ga0451789_0061987	Ga0451789_0061987_3344_4033	226
918	3300041451	Ga0451791_0286608	Ga0451791_0286608_93_773	226
919	3300041453	Ga0451797_0552398	Ga0451797_0552398_31_729	226
920	3300041453	Ga0451797_1355763	Ga0451797_1355763_429_1109	226
921	3300041456	Ga0451795_0599323	Ga0451795_0599323_2118_2807	226
922	3300041456	Ga0451795_1053640	Ga0451795_1053640_1214_1894	226
923	3300041459	Ga0451800_0604447	Ga0451800_0604447_588_1268	226
924	3300041463	Ga0451804_0124619	Ga0451804_0124619_426_1115	226
925	3300041463	Ga0451804_0815268	Ga0451804_0815268_493_1173	226
926	3300041486	Ga0451807_0913292	Ga0451807_0913292_790_1470	226
927	3300041486	Ga0451807_1763648	Ga0451807_1763648_362_1042	226
928	3300041512	Ga0451853_3233094	Ga0451853_3233094_2878_3558	226
929	3300041999	Ga0439433_0002117	Ga0439433_0002117_2954_3634	226
930	3300042002	Ga0439442_017672	Ga0439442_017672_310_990	226
931	3300042006	Ga0439432_001869	Ga0439432_001869_1527_2207	226
932	3300042007	Ga0439449_0002571	Ga0439449_0002571_3784_4464	226
933	3300042011	Ga0439454_003851	Ga0439454_003851_990_1670	226
934	3300042014	Ga0439457_007362	Ga0439457_007362_762_1442	226
935	3300042015	Ga0439462_0000492	Ga0439462_0000492_3171_3851	226
936	3300042115	Ga0450911_000101	Ga0450911_000101_20404_21126	226
937	3300042125	Ga0450923_018719	Ga0450923_018719_244_924	226
938	3300042126	Ga0450888_000215	Ga0450888_000215_3725_4405	226
939	3300042127	Ga0450890_002465	Ga0450890_002465_1614_2294	226
940	3300042127	Ga0450890_003589	Ga0450890_003589_1027_1707	226
941	3300042128	Ga0450897_001089	Ga0450897_001089_782_1462	226
942	3300042130	Ga0450892_000837	Ga0450892_000837_1560_2240	226
943	3300042131	Ga0450894_015668	Ga0450894_015668_121_801	226
944	3300042144	Ga0450889_000928	Ga0450889_000928_2363_3043	226
945	3300042435	Ga0439434_0053289	Ga0439434_0053289_488_1168	226
946	3300042438	Ga0439459_0000041	Ga0439459_0000041_8342_9022	226
947	3300042530	Ga0450916_000906	Ga0450916_000906_1531_2211	226
948	3300042532	Ga0450893_0006213	Ga0450893_0006213_284_964	226
949	3300042876	Ga0451577_0005694	Ga0451577_0005694_5154_5834	226
950	3300044735	Ga0466968_0014745	Ga0466968_0014745_2393_3073	226
951	3300044901	Ga0466960_0119370	Ga0466960_0119370_10_690	226
952	3300046453	Ga0495627_004939	Ga0495627_004939_4773_5453	226
953	3300046453	Ga0495627_009844	Ga0495627_009844_432_1112	226
954	3300046460	Ga0495638_0017239	Ga0495638_0017239_2057_2746	226
955	3300046460	Ga0495638_0020208	Ga0495638_0020208_2764_3444	226
956	3300046462	Ga0495651_0151795	Ga0495651_0151795_817_1497	226
957	3300046462	Ga0495651_0178762	Ga0495651_0178762_783_1463	226
958	3300046471	Ga0495650_0000265	Ga0495650_0000265_145_831	226
959	3300046471	Ga0495650_0000437	Ga0495650_0000437_50958_51638	226
960	3300046471	Ga0495650_0006649	Ga0495650_0006649_4680_5360	226
961	3300046475	Ga0495639_0064580	Ga0495639_0064580_483_1172	226
962	3300046492	Ga0495585_0003325	Ga0495585_0003325_4060_4740	226
963	3300046501	Ga0495607_0004924	Ga0495607_0004924_8751_9455	226
964	3300046506	Ga0495583_0000144	Ga0495583_0000144_91133_91813	226
965	3300046507	Ga0495606_0000101	Ga0495606_0000101_47838_48542	226
966	3300046507	Ga0495606_0000623	Ga0495606_0000623_2118_2804	226
967	3300046507	Ga0495606_0001938	Ga0495606_0001938_15294_15974	226
968	3300046507	Ga0495606_0229656	Ga0495606_0229656_70_759	226
969	3300046512	Ga0495610_0000012	Ga0495610_0000012_413688_414368	226
970	3300046512	Ga0495610_0000293	Ga0495610_0000293_3784_4488	226
971	3300046512	Ga0495610_0009323	Ga0495610_0009323_1323_2003	226
972	3300046513	Ga0495616_0001145	Ga0495616_0001145_783_1463	226
973	3300046515	Ga0495620_0006425	Ga0495620_0006425_1150_1830	226
974	3300046518	Ga0495631_0000792	Ga0495631_0000792_18486_19166	226
975	3300046519	Ga0495632_0013420	Ga0495632_0013420_2122_2802	226
976	3300046520	Ga0495637_0002714	Ga0495637_0002714_6945_7625	226
977	3300046520	Ga0495637_0036688	Ga0495637_0036688_247_927	226
978	3300046522	Ga0495643_0000289	Ga0495643_0000289_69405_70085	226
979	3300046524	Ga0495648_0060059	Ga0495648_0060059_894_1574	226
980	3300046528	Ga0495642_0021015	Ga0495642_0021015_1240_1926	226
981	3300046530	Ga0495654_0001538	Ga0495654_0001538_2347_3027	226
982	3300046530	Ga0495654_0032945	Ga0495654_0032945_1458_2138	226
983	3300046530	Ga0495654_0076334	Ga0495654_0076334_62_742	226
984	3300046539	Ga0495621_0011922	Ga0495621_0011922_21_701	226
985	3300046542	Ga0495597_0000863	Ga0495597_0000863_19658_20338	226
986	3300046557	Ga0495622_0000019	Ga0495622_0000019_76327_77013	226
987	3300046558	Ga0495633_0025155	Ga0495633_0025155_447_1127	226
988	3300046558	Ga0495633_0045361	Ga0495633_0045361_609_1313	226
989	3300046615	Ga0495656_0000376	Ga0495656_0000376_3484_4164	226
990	3300046615	Ga0495656_0096558	Ga0495656_0096558_126_806	226
991	3300046615	Ga0495656_0135676	Ga0495656_0135676_266_955	226
992	3300046616	Ga0495668_0000391	Ga0495668_0000391_5567_6247	226
993	3300046616	Ga0495668_0000712	Ga0495668_0000712_25469_26173	226
994	3300046616	Ga0495668_0002191	Ga0495668_0002191_7083_7763	226
995	3300046616	Ga0495668_0026720	Ga0495668_0026720_1789_2469	226
996	3300046660	Ga0495625_0006032	Ga0495625_0006032_9465_10145	226
997	3300046660	Ga0495625_0016156	Ga0495625_0016156_965_1645	226
998	3300046660	Ga0495625_0026167	Ga0495625_0026167_2130_2810	226
999	3300046660	Ga0495625_0044517	Ga0495625_0044517_2517_3197	226
1000	3300046660	Ga0495625_0124475	Ga0495625_0124475_918_1598	226
1001	3300046660	Ga0495625_0172128	Ga0495625_0172128_709_1389	226
1002	3300046665	Ga0495661_0081312	Ga0495661_0081312_421_1101	226
1003	3300046674	Ga0495588_0029205	Ga0495588_0029205_315_995	226
1004	3300046683	Ga0495658_0015851	Ga0495658_0015851_2020_2700	226
1005	3300046691	Ga0495670_0036838	Ga0495670_0036838_50_730	226
1006	3300046691	Ga0495670_0050219	Ga0495670_0050219_1250_1930	226
1007	3300046692	Ga0495671_0000006	Ga0495671_0000006_315474_316154	226
1008	3300046692	Ga0495671_0006935	Ga0495671_0006935_4163_4843	226
1009	3300046692	Ga0495671_0036171	Ga0495671_0036171_1311_1991	226
1010	3300046694	Ga0495649_0000911	Ga0495649_0000911_12872_13552	226
1011	3300046694	Ga0495649_0021575	Ga0495649_0021575_1807_2511	226
1012	3300046694	Ga0495649_0057161	Ga0495649_0057161_110_790	226
1013	3300046694	Ga0495649_0193159	Ga0495649_0193159_245_931	226
1014	3300046794	Ga0495589_0044252	Ga0495589_0044252_655_1335	226
1015	3300046810	Ga0495660_0003915	Ga0495660_0003915_5670_6350	226
1016	3300047315	Ga0495581_0081561	Ga0495581_0081561_610_1299	226
1017	3300047320	Ga0495672_0000291	Ga0495672_0000291_1702_2382	226
1018	3300047321	Ga0495676_0001292	Ga0495676_0001292_16686_17366	226
1019	3300047323	Ga0495683_0009439	Ga0495683_0009439_1195_1875	226
1020	3300047323	Ga0495683_0021557	Ga0495683_0021557_549_1229	226
1021	3300047323	Ga0495683_0176883	Ga0495683_0176883_173_871	226
1022	3300047446	Ga0495679_014646	Ga0495679_014646_560_1240	226
1023	3300047469	Ga0495673_0000003	Ga0495673_0000003_89127_89807	226
1024	3300047469	Ga0495673_0000050	Ga0495673_0000050_184367_185047	226
1025	3300047472	Ga0495686_0012570	Ga0495686_0012570_1867_2571	226
1026	3300047472	Ga0495686_0117261	Ga0495686_0117261_431_1111	226
1027	3300047472	Ga0495686_0166686	Ga0495686_0166686_536_1216	226
1028	3300047472	Ga0495686_0174745	Ga0495686_0174745_388_1068	226
1029	3300048088	Ga0495602_0187164	Ga0495602_0187164_96_776	226
1030	3300048089	Ga0495614_0000302	Ga0495614_0000302_3740_4420	226
1031	3300048904	Ga0496101_0007565	Ga0496101_0007565_2052_2732	226
1032	3300048905	Ga0496102_0006020	Ga0496102_0006020_8370_9050	226
1033	3300048905	Ga0496102_0061580	Ga0496102_0061580_187_867	226
1034	3300048906	Ga0496103_0003185	Ga0496103_0003185_463_1143	226
1035	3300048906	Ga0496103_0063182	Ga0496103_0063182_1179_1859	226
1036	3300048907	Ga0496104_0003045	Ga0496104_0003045_3191_3871	226
1037	3300048908	Ga0496105_0014853	Ga0496105_0014853_4165_4845	226
1038	3300048912	Ga0496109_0121750	Ga0496109_0121750_1257_1946	226
1039	3300048913	Ga0496110_0017480	Ga0496110_0017480_3453_4133	226
1040	3300048913	Ga0496110_0215611	Ga0496110_0215611_219_908	226
1041	3300048913	Ga0496110_0843992	Ga0496110_0843992_109_789	226
1042	3300048914	Ga0496111_0058432	Ga0496111_0058432_1790_2470	226
1043	3300048915	Ga0496112_0151309	Ga0496112_0151309_198_878	226
1044	3300048915	Ga0496112_0189500	Ga0496112_0189500_1148_1828	226
1045	3300048915	Ga0496112_0577409	Ga0496112_0577409_220_900	226
1046	3300048916	Ga0496113_0607041	Ga0496113_0607041_136_816	226
1047	3300048919	Ga0496116_0029356	Ga0496116_0029356_1446_2126	226
1048	3300048919	Ga0496116_0044188	Ga0496116_0044188_1354_2034	226
1049	3300048920	Ga0496117_0026152	Ga0496117_0026152_3818_4498	226
1050	3300048921	Ga0496118_0014322	Ga0496118_0014322_3009_3689	226
1051	3300048921	Ga0496118_0078678	Ga0496118_0078678_216_896	226
1052	3300048924	Ga0496121_0001855	Ga0496121_0001855_23335_24015	226
1053	3300048924	Ga0496121_0028800	Ga0496121_0028800_4227_4907	226
1054	3300048924	Ga0496121_0047986	Ga0496121_0047986_275_955	226
1055	3300048924	Ga0496121_0222661	Ga0496121_0222661_317_997	226
1056	3300048924	Ga0496121_0240834	Ga0496121_0240834_265_945	226
1057	3300048925	Ga0496122_0000546	Ga0496122_0000546_63180_63860	226
1058	3300048925	Ga0496122_0092062	Ga0496122_0092062_515_1195	226
1059	3300048926	Ga0496123_0000235	Ga0496123_0000235_49239_49919	226
1060	3300048926	Ga0496123_0058941	Ga0496123_0058941_882_1562	226
1061	3300048926	Ga0496123_0110488	Ga0496123_0110488_219_899	226
1062	3300048927	Ga0496124_0015879	Ga0496124_0015879_5797_6477	226
1063	3300048927	Ga0496124_0016715	Ga0496124_0016715_5838_6518	226
1064	3300048927	Ga0496124_0040112	Ga0496124_0040112_1543_2223	226
1065	3300048928	Ga0496125_0000464	Ga0496125_0000464_8510_9190	226
1066	3300048928	Ga0496125_0003950	Ga0496125_0003950_3692_4372	226
1067	3300048928	Ga0496125_0005607	Ga0496125_0005607_6519_7199	226
1068	3300048928	Ga0496125_0013691	Ga0496125_0013691_2814_3536	226
1069	3300048928	Ga0496125_0015110	Ga0496125_0015110_190_870	226
1070	3300048928	Ga0496125_0155918	Ga0496125_0155918_145_825	226
1071	3300048928	Ga0496125_0205687	Ga0496125_0205687_532_1236	226
1072	3300049459	Ga0495678_000002	Ga0495678_000002_435929_436609	226
1073	3300049459	Ga0495678_011932	Ga0495678_011932_1105_1785	226
1074	3300049568	Ga0501031_0018407	Ga0501031_0018407_1370_2089	226
1075	3300049571	Ga0501034_0299036	Ga0501034_0299036_182_862	226
1076	3300049571	Ga0501034_0654860	Ga0501034_0654860_14_694	226
1077	3300049575	Ga0501039_0153162	Ga0501039_0153162_904_1584	226
1078	3300049578	Ga0501042_0053900	Ga0501042_0053900_707_1387	226
1079	3300049583	Ga0501067_0013742	Ga0501067_0013742_1359_2039	226
1080	3300049586	Ga0501070_0050152	Ga0501070_0050152_2429_3109	226
1081	3300049587	Ga0501071_0000964	Ga0501071_0000964_14578_15258	226
1082	3300049587	Ga0501071_0804602	Ga0501071_0804602_15_695	226
1083	3300049589	Ga0501073_0004452	Ga0501073_0004452_6798_7478	226
1084	3300049590	Ga0501074_0002061	Ga0501074_0002061_6901_7581	226
1085	3300049591	Ga0501075_0016428	Ga0501075_0016428_2537_3217	226
1086	3300049592	Ga0501076_0245606	Ga0501076_0245606_387_1067	226
1087	3300049593	Ga0501077_0008949	Ga0501077_0008949_3877_4557	226
1088	3300049667	Ga0501230_013899	Ga0501230_013899_313_993	226
1089	3300049741	Ga0501079_0000806	Ga0501079_0000806_3153_3833	226
1090	3300049742	Ga0501080_0004388	Ga0501080_0004388_3018_3698	226
1091	3300049744	Ga0501083_0017304	Ga0501083_0017304_2140_2820	226
1092	3300049822	Ga0501035_0001647	Ga0501035_0001647_14666_15346	226
1093	3300050489	nmdc:mga03683_13160_c1	nmdc:mga03683_13160_c1_1670_2350	226
1094	3300050489	nmdc:mga03683_34340_c1	nmdc:mga03683_34340_c1_982_1662	226
1095	3300050490	nmdc:mga03n38_28011_c1	nmdc:mga03n38_28011_c1_120_800	226
1096	3300050490	nmdc:mga03n38_72954_c1	nmdc:mga03n38_72954_c1_211_891	226
1097	3300050493	nmdc:mga0k408_11592_c1	nmdc:mga0k408_11592_c1_708_1388	226
1098	3300050493	nmdc:mga0k408_144331_c1	nmdc:mga0k408_144331_c1_352_1032	226
1099	3300050493	nmdc:mga0k408_17454_c1	nmdc:mga0k408_17454_c1_2696_3376	226
1100	3300050493	nmdc:mga0k408_40231_c1	nmdc:mga0k408_40231_c1_1617_2297	226
1101	3300050493	nmdc:mga0k408_76799_c1	nmdc:mga0k408_76799_c1_776_1456	226
1102	3300050494	nmdc:mga06z11_132716_c1	nmdc:mga06z11_132716_c1_695_1375	226
1103	3300050494	nmdc:mga06z11_256673_c1	nmdc:mga06z11_256673_c1_187_867	226
1104	3300050496	nmdc:mga07m45_137256_c1	nmdc:mga07m45_137256_c1_247_939	226
1105	3300050496	nmdc:mga07m45_146360_c1	nmdc:mga07m45_146360_c1_505_1185	226
1106	3300050496	nmdc:mga07m45_14979_c1	nmdc:mga07m45_14979_c1_649_1329	226
1107	3300050496	nmdc:mga07m45_160799_c1	nmdc:mga07m45_160799_c1_314_994	226
1108	3300050496	nmdc:mga07m45_21461_c1	nmdc:mga07m45_21461_c1_685_1365	226
1109	3300050496	nmdc:mga07m45_24245_c1	nmdc:mga07m45_24245_c1_1965_2645	226
1110	3300050496	nmdc:mga07m45_25179_c1	nmdc:mga07m45_25179_c1_714_1394	226
1111	3300050496	nmdc:mga07m45_47102_c1	nmdc:mga07m45_47102_c1_1290_1970	226
1112	3300050496	nmdc:mga07m45_5378_c1	nmdc:mga07m45_5378_c1_5055_5735	226
1113	3300050496	nmdc:mga07m45_61872_c1	nmdc:mga07m45_61872_c1_716_1396	226
1114	3300050509	nmdc:mga0qj67_29580_c1	nmdc:mga0qj67_29580_c1_2838_3518	226
1115	3300050509	nmdc:mga0qj67_75728_c1	nmdc:mga0qj67_75728_c1_152_832	226
1116	3300050516	nmdc:mga0sz30_146358_c1	nmdc:mga0sz30_146358_c1_89_769	226
1117	3300053079	Ga0500610_0033148	Ga0500610_0033148_1807_2487	226
1118	3300053079	Ga0500610_0038258	Ga0500610_0038258_147_827	226
1119	3300053086	Ga0500578_0185929	Ga0500578_0185929_305_985	226
1120	3300053087	Ga0500643_003033	Ga0500643_003033_809_1489	226
1121	3300053090	Ga0500646_0008683	Ga0500646_0008683_1250_1930	226
1122	3300053092	Ga0500583_0166506	Ga0500583_0166506_405_1085	226
1123	3300053093	Ga0500651_0000024	Ga0500651_0000024_109915_110595	226
1124	3300053093	Ga0500651_0096696	Ga0500651_0096696_253_942	226
1125	3300053094	Ga0500566_0007556	Ga0500566_0007556_4169_4849	226
1126	3300053098	Ga0500650_0026667	Ga0500650_0026667_229_918	226
1127	3300053108	Ga0500562_017292	Ga0500562_017292_627_1307	226
1128	3300053110	Ga0500571_000051	Ga0500571_000051_26513_27193	226
1129	3300053116	Ga0500592_002986	Ga0500592_002986_1226_1906	226
1130	3300053117	Ga0500593_021040	Ga0500593_021040_497_1177	226
1131	3300053120	Ga0500597_103620	Ga0500597_103620_14_694	226
1132	3300053121	Ga0500607_002042	Ga0500607_002042_853_1533	226
1133	3300053121	Ga0500607_034418	Ga0500607_034418_1337_2017	226
1134	3300053122	Ga0500608_008130	Ga0500608_008130_3179_3859	226
1135	3300053125	Ga0500618_001641	Ga0500618_001641_724_1404	226
1136	3300053125	Ga0500618_023002	Ga0500618_023002_74_754	226
1137	3300053128	Ga0500626_029869	Ga0500626_029869_1438_2118	226
1138	3300053130	Ga0500642_0014869	Ga0500642_0014869_41_730	226
1139	3300053131	Ga0500652_001276	Ga0500652_001276_3221_3910	226
1140	3300053133	Ga0500655_000770	Ga0500655_000770_93_782	226
1141	3300053133	Ga0500655_003116	Ga0500655_003116_329_1009	226
1142	3300053134	Ga0500658_0000226	Ga0500658_0000226_20647_21327	226
1143	3300053134	Ga0500658_0000310	Ga0500658_0000310_18653_19333	226
1144	3300053136	Ga0500559_0002634	Ga0500559_0002634_6421_7101	226
1145	3300053136	Ga0500559_0014006	Ga0500559_0014006_793_1473	226
1146	3300053137	Ga0500561_0024619	Ga0500561_0024619_385_1065	226
1147	3300053138	Ga0500564_036236	Ga0500564_036236_649_1329	226
1148	3300053139	Ga0500568_0005294	Ga0500568_0005294_3747_4427	226
1149	3300053140	Ga0500573_0042915	Ga0500573_0042915_195_953	226
1150	3300053141	Ga0500574_009734	Ga0500574_009734_415_1095	226
1151	3300053141	Ga0500574_017043	Ga0500574_017043_798_1478	226
1152	3300053142	Ga0500577_0002625	Ga0500577_0002625_1212_1901	226
1153	3300053143	Ga0500579_138940	Ga0500579_138940_369_1058	226
1154	3300053153	Ga0500616_0023917	Ga0500616_0023917_795_1475	226
1155	3300053154	Ga0500619_000075	Ga0500619_000075_17847_18527	226
1156	3300053156	Ga0500622_0000142	Ga0500622_0000142_27278_27967	226
1157	3300053156	Ga0500622_0001772	Ga0500622_0001772_2271_2951	226
1158	3300053156	Ga0500622_0079534	Ga0500622_0079534_390_1070	226
1159	3300053158	Ga0500627_0002002	Ga0500627_0002002_1617_2297	226
1160	3300053158	Ga0500627_0136992	Ga0500627_0136992_390_1070	226
1161	3300053160	Ga0500633_0109499	Ga0500633_0109499_167_847	226
1162	3300053161	Ga0500634_0023050	Ga0500634_0023050_2079_2759	226
1163	3300053161	Ga0500634_0025682	Ga0500634_0025682_2309_2989	226
1164	3300053724	Ga0500570_086708	Ga0500570_086708_314_1003	226
1165	3300053734	Ga0500565_001120	Ga0500565_001120_263_943	226
1166	3300053735	Ga0500596_016347	Ga0500596_016347_143_823	226
1167	3300053739	Ga0500587_010013	Ga0500587_010013_313_993	226
1168	3300054114	Ga0501084_0073726	Ga0501084_0073726_340_1020	226
1169	3300059421	Ga0590071_003267	Ga0590071_003267_783_1463	226
1170	3300060353	Ga0501082_0004992	Ga0501082_0004992_5351_6031	226
1171	3300061734	Ga0530510_0453325	Ga0530510_0453325_261_941	226
1172	iso_pu_bacteria	2838054893	2838060067	226
1173	2162886007	SwRhRL2b_contig_2098926	SwRhRL2b_0102.00009560	227
1174	2162886007	SwRhRL2b_contig_2200712	SwRhRL2b_0679.00005010	227
1175	3300001979	JGI24740J21852_10001628	JGI24740J21852_100016286	227
1176	3300003322	rootL2_10199998	rootL2_101999981	227
1177	3300003659	JGI25404J52841_10002403	JGI25404J52841_100024032	227
1178	3300003659	JGI25404J52841_10015372	JGI25404J52841_100153722	227
1179	3300003751	Ga0055538_1001037	Ga0055538_10010372	227
1180	3300003751	Ga0055538_1002271	Ga0055538_10022713	227
1181	3300003752	Ga0055539_1000185	Ga0055539_100018529	227
1182	3300003756	Ga0055533_1002157	Ga0055533_10021574	227
1183	3300003758	Ga0055532_1000006	Ga0055532_1000006418	227
1184	3300003759	Ga0055525_1000966	Ga0055525_10009663	227
1185	3300003761	Ga0055535_1000004	Ga0055535_1000004418	227
1186	3300003763	Ga0055529_1000273	Ga0055529_100027330	227
1187	3300003791	Ga0055530_10004010	Ga0055530_100040102	227
1188	3300003791	Ga0055530_10004840	Ga0055530_100048402	227
1189	3300003794	Ga0055531_10000329	Ga0055531_1000032944	227
1190	3300003841	Ga0055541_1002927	Ga0055541_10029272	227
1191	3300005289	Ga0065704_10091080	Ga0065704_100910804	227
1192	3300005330	Ga0070690_100424813	Ga0070690_1004248131	227
1193	3300005331	Ga0070670_100367851	Ga0070670_1003678511	227
1194	3300005334	Ga0068869_100379290	Ga0068869_1003792902	227
1195	3300005335	Ga0070666_10139957	Ga0070666_101399572	227
1196	3300005335	Ga0070666_10248856	Ga0070666_102488562	227
1197	3300005340	Ga0070689_100238407	Ga0070689_1002384072	227
1198	3300005343	Ga0070687_100120914	Ga0070687_1001209141	227
1199	3300005344	Ga0070661_100000336	Ga0070661_1000003368	227
1200	3300005347	Ga0070668_100319489	Ga0070668_1003194891	227
1201	3300005353	Ga0070669_100000144	Ga0070669_10000014411	227
1202	3300005355	Ga0070671_100000030	Ga0070671_10000003031	227
1203	3300005355	Ga0070671_100010287	Ga0070671_10001028710	227
1204	3300005367	Ga0070667_100000968	Ga0070667_10000096814	227
1205	3300005455	Ga0070663_100000246	Ga0070663_1000002467	227
1206	3300005467	Ga0070706_100631200	Ga0070706_1006312002	227
1207	3300005468	Ga0070707_100235492	Ga0070707_1002354922	227
1208	3300005530	Ga0070679_100359727	Ga0070679_1003597271	227
1209	3300005548	Ga0070665_100020215	Ga0070665_1000202157	227
1210	3300005548	Ga0070665_100269103	Ga0070665_1002691031	227
1211	3300005563	Ga0068855_101174978	Ga0068855_1011749781	227
1212	3300005564	Ga0070664_100000122	Ga0070664_10000012230	227
1213	3300005577	Ga0068857_100045392	Ga0068857_1000453922	227
1214	3300005614	Ga0068856_100001446	Ga0068856_10000144618	227
1215	3300005616	Ga0068852_100024597	Ga0068852_1000245973	227
1216	3300005617	Ga0068859_100017816	Ga0068859_10001781611	227
1217	3300005618	Ga0068864_100003823	Ga0068864_1000038232	227
1218	3300005618	Ga0068864_100071799	Ga0068864_1000717992	227
1219	3300005841	Ga0068863_100000106	Ga0068863_10000010652	227
1220	3300005841	Ga0068863_100006027	Ga0068863_10000602713	227
1221	3300005841	Ga0068863_100039641	Ga0068863_1000396413	227
1222	3300005841	Ga0068863_100139249	Ga0068863_1001392494	227
1223	3300005842	Ga0068858_100003851	Ga0068858_1000038513	227
1224	3300005843	Ga0068860_100000386	Ga0068860_10000038644	227
1225	3300005983	Ga0081540_1038789	Ga0081540_10387891	227
1226	3300006038	Ga0075365_10041974	Ga0075365_100419741	227
1227	3300006186	Ga0075369_10002187	Ga0075369_100021876	227
1228	3300006847	Ga0075431_100005327	Ga0075431_1000053277	227
1229	3300006847	Ga0075431_100626095	Ga0075431_1006260952	227
1230	3300006880	Ga0075429_100112186	Ga0075429_1001121862	227
1231	3300006931	Ga0097620_100017816	Ga0097620_10001781611	227
1232	3300009093	Ga0105240_10075218	Ga0105240_100752182	227
1233	3300009093	Ga0105240_10096519	Ga0105240_100965192	227
1234	3300009094	Ga0111539_10108548	Ga0111539_101085482	227
1235	3300009094	Ga0111539_10196470	Ga0111539_101964702	227
1236	3300009101	Ga0105247_10140798	Ga0105247_101407982	227
1237	3300009147	Ga0114129_10620130	Ga0114129_106201302	227
1238	3300009177	Ga0105248_10143218	Ga0105248_101432182	227
1239	3300009177	Ga0105248_10283929	Ga0105248_102839292	227
1240	3300009177	Ga0105248_11500867	Ga0105248_115008671	227
1241	3300009553	Ga0105249_10149437	Ga0105249_101494372	227
1242	3300013100	Ga0157373_10014267	Ga0157373_100142672	227
1243	3300013100	Ga0157373_10267509	Ga0157373_102675092	227
1244	3300013102	Ga0157371_10000072	Ga0157371_1000007219	227
1245	3300013104	Ga0157370_10000031	Ga0157370_1000003129	227
1246	3300013105	Ga0157369_10002342	Ga0157369_1000234221	227
1247	3300013306	Ga0163162_10149935	Ga0163162_101499352	227
1248	3300013306	Ga0163162_10873449	Ga0163162_108734491	227
1249	3300013307	Ga0157372_10001411	Ga0157372_1000141120	227
1250	3300013307	Ga0157372_11105227	Ga0157372_111052272	227
1251	3300014326	Ga0157380_10050446	Ga0157380_100504462	227
1252	3300014326	Ga0157380_10092055	Ga0157380_100920552	227
1253	3300014326	Ga0157380_10134749	Ga0157380_101347491	227
1254	3300014968	Ga0157379_10253288	Ga0157379_102532882	227
1255	3300020610	Ga0154015_1468224	Ga0154015_14682242	227
1256	3300021384	Ga0213876_10006269	Ga0213876_100062695	227
1257	3300025224	Ga0209784_100006	Ga0209784_100006637	227
1258	3300025224	Ga0209784_100391	Ga0209784_10039112	227
1259	3300025224	Ga0209784_100520	Ga0209784_1005202	227
1260	3300025225	Ga0209566_100002	Ga0209566_100002637	227
1261	3300025225	Ga0209566_101933	Ga0209566_1019333	227
1262	3300025225	Ga0209566_101963	Ga0209566_1019633	227
1263	3300025226	Ga0209674_100010	Ga0209674_100010499	227
1264	3300025226	Ga0209674_103796	Ga0209674_1037962	227
1265	3300025228	Ga0209672_100448	Ga0209672_10044819	227
1266	3300025229	Ga0209147_100015	Ga0209147_100015132	227
1267	3300025230	Ga0209563_100004	Ga0209563_10000448	227
1268	3300025230	Ga0209563_110446	Ga0209563_1104462	227
1269	3300025242	Ga0209258_100021	Ga0209258_100021132	227
1270	3300025253	Ga0209677_100007	Ga0209677_100007637	227
1271	3300025254	Ga0209148_1002543	Ga0209148_10025435	227
1272	3300025256	Ga0209759_1000926	Ga0209759_100092611	227
1273	3300025261	Ga0209233_1008699	Ga0209233_10086992	227
1274	3300025272	Ga0209455_1000028	Ga0209455_1000028132	227
1275	3300025292	Ga0209676_1000376	Ga0209676_10003762	227
1276	3300025292	Ga0209676_1000615	Ga0209676_100061550	227
1277	3300025298	Ga0209050_1000515	Ga0209050_100051557	227
1278	3300025298	Ga0209050_1000737	Ga0209050_100073734	227
1279	3300025303	Ga0209051_1000637	Ga0209051_100063740	227
1280	3300025304	Ga0209257_1000698	Ga0209257_100069850	227
1281	3300025304	Ga0209257_1010109	Ga0209257_10101093	227
1282	3300025900	Ga0207710_10073361	Ga0207710_100733612	227
1283	3300025912	Ga0207707_10637653	Ga0207707_106376532	227
1284	3300025913	Ga0207695_10002542	Ga0207695_1000254221	227
1285	3300025913	Ga0207695_10187589	Ga0207695_101875892	227
1286	3300025917	Ga0207660_10793860	Ga0207660_107938601	227
1287	3300025920	Ga0207649_10000449	Ga0207649_1000044922	227
1288	3300025921	Ga0207652_10003276	Ga0207652_1000327612	227
1289	3300025922	Ga0207646_10330701	Ga0207646_103307012	227
1290	3300025923	Ga0207681_10000146	Ga0207681_1000014611	227
1291	3300025923	Ga0207681_10257748	Ga0207681_102577482	227
1292	3300025931	Ga0207644_10000011	Ga0207644_10000011129	227
1293	3300025931	Ga0207644_10005239	Ga0207644_1000523910	227
1294	3300025936	Ga0207670_10224710	Ga0207670_102247102	227
1295	3300025937	Ga0207669_10344976	Ga0207669_103449762	227
1296	3300025937	Ga0207669_10439834	Ga0207669_104398341	227
1297	3300025938	Ga0207704_10193128	Ga0207704_101931282	227
1298	3300025941	Ga0207711_10244749	Ga0207711_102447492	227
1299	3300025941	Ga0207711_10683467	Ga0207711_106834671	227
1300	3300025944	Ga0207661_10189183	Ga0207661_101891832	227
1301	3300025945	Ga0207679_10000007	Ga0207679_10000007312	227
1302	3300025981	Ga0207640_10000107	Ga0207640_1000010728	227
1303	3300025986	Ga0207658_10001008	Ga0207658_1000100823	227
1304	3300025986	Ga0207658_10183420	Ga0207658_101834202	227
1305	3300026035	Ga0207703_10001573	Ga0207703_1000157313	227
1306	3300026035	Ga0207703_10398036	Ga0207703_103980362	227
1307	3300026067	Ga0207678_10000207	Ga0207678_1000020718	227
1308	3300026078	Ga0207702_10000260	Ga0207702_1000026030	227
1309	3300026088	Ga0207641_10000733	Ga0207641_1000073320	227
1310	3300026088	Ga0207641_10042394	Ga0207641_100423942	227
1311	3300026088	Ga0207641_10117312	Ga0207641_101173122	227
1312	3300026088	Ga0207641_10225248	Ga0207641_102252482	227
1313	3300026088	Ga0207641_10534553	Ga0207641_105345532	227
1314	3300026095	Ga0207676_10211368	Ga0207676_102113682	227
1315	3300026116	Ga0207674_10153316	Ga0207674_101533162	227
1316	3300026116	Ga0207674_10208918	Ga0207674_102089182	227
1317	3300026116	Ga0207674_10258081	Ga0207674_102580812	227
1318	3300026121	Ga0207683_10720193	Ga0207683_107201931	227
1319	3300026142	Ga0207698_10027127	Ga0207698_100271274	227
1320	3300027907	Ga0207428_10022957	Ga0207428_100229574	227
1321	3300027907	Ga0207428_10093414	Ga0207428_100934142	227
1322	3300028379	Ga0268266_10005024	Ga0268266_1000502414	227
1323	3300028379	Ga0268266_10026742	Ga0268266_100267426	227
1324	3300028380	Ga0268265_10061915	Ga0268265_100619152	227
1325	3300028381	Ga0268264_10000040	Ga0268264_10000040256	227
1326	3300031239	Ga0265328_10100420	Ga0265328_101004202	227
1327	3300032004	Ga0307414_10253094	Ga0307414_102530942	227
1328	3300034957	Ga0373938_0010704	Ga0373938_0010704_256_945	227
1329	3300035086	Ga0373934_0011434	Ga0373934_0011434_1589_2278	227
1330	3300035092	Ga0373952_0046388	Ga0373952_0046388_207_896	227
1331	3300035112	Ga0373932_0119811	Ga0373932_0119811_19_708	227
1332	3300035114	Ga0373939_0036189	Ga0373939_0036189_714_1403	227
1333	3300035117	Ga0373953_0012542	Ga0373953_0012542_1061_1750	227
1334	3300035118	Ga0373954_0001004	Ga0373954_0001004_7145_7834	227
1335	3300035119	Ga0373956_0043575	Ga0373956_0043575_546_1235	227
1336	3300035120	Ga0373957_0001219	Ga0373957_0001219_4490_5179	227
1337	3300035121	Ga0373960_0003684	Ga0373960_0003684_1545_2234	227
1338	3300035410	Ga0373924_0034900	Ga0373924_0034900_603_1292	227
1339	3300035691	Ga0373931_0019674	Ga0373931_0019674_60_749	227
1340	3300035695	Ga0373927_0239015	Ga0373927_0239015_215_898	227
1341	3300035724	Ga0373933_0031401	Ga0373933_0031401_1017_1706	227
1342	3300036401	Ga0373937_0016193	Ga0373937_0016193_3231_3920	227
1343	3300037418	Ga0395900_0007309	Ga0395900_0007309_400_1083	227
1344	3300039437	Ga0436365_0734446	Ga0436365_0734446_76_759	227
1345	3300042015	Ga0439462_0007444	Ga0439462_0007444_1230_1913	227
1346	3300044650	Ga0466986_0022637	Ga0466986_0022637_701_1384	227
1347	3300044671	Ga0466978_0006210	Ga0466978_0006210_4856_5539	227
1348	3300044683	Ga0466965_0002685	Ga0466965_0002685_1706_2389	227
1349	3300044693	Ga0466961_0000242	Ga0466961_0000242_23266_23949	227
1350	3300044694	Ga0466963_0046523	Ga0466963_0046523_178_861	227
1351	3300044706	Ga0466964_0020721	Ga0466964_0020721_1495_2178	227
1352	3300044735	Ga0466968_0024476	Ga0466968_0024476_1427_2110	227
1353	3300045049	Ga0466959_0001530	Ga0466959_0001530_8529_9212	227
1354	3300045976	Ga0466967_0003039	Ga0466967_0003039_4973_5656	227
1355	3300045976	Ga0466967_0434164	Ga0466967_0434164_84_767	227
1356	3300046453	Ga0495627_003165	Ga0495627_003165_3836_4519	227
1357	3300046454	Ga0495592_0009482	Ga0495592_0009482_3421_4110	227
1358	3300046455	Ga0495603_0023899	Ga0495603_0023899_1988_2677	227
1359	3300046459	Ga0495629_0001281	Ga0495629_0001281_18433_19122	227
1360	3300046460	Ga0495638_0000079	Ga0495638_0000079_109096_109779	227
1361	3300046460	Ga0495638_0045923	Ga0495638_0045923_302_985	227
1362	3300046463	Ga0495653_0003914	Ga0495653_0003914_3438_4127	227
1363	3300046471	Ga0495650_0131389	Ga0495650_0131389_31_714	227
1364	3300046474	Ga0495605_0156296	Ga0495605_0156296_162_851	227
1365	3300046491	Ga0495584_0054081	Ga0495584_0054081_24_707	227
1366	3300046491	Ga0495584_0058836	Ga0495584_0058836_995_1678	227
1367	3300046492	Ga0495585_0002344	Ga0495585_0002344_2706_3389	227
1368	3300046492	Ga0495585_0004518	Ga0495585_0004518_7816_8499	227
1369	3300046492	Ga0495585_0099842	Ga0495585_0099842_563_1246	227
1370	3300046500	Ga0495596_0001033	Ga0495596_0001033_11300_11983	227
1371	3300046506	Ga0495583_0002787	Ga0495583_0002787_3523_4206	227
1372	3300046507	Ga0495606_0005505	Ga0495606_0005505_3650_4333	227
1373	3300046507	Ga0495606_0072615	Ga0495606_0072615_1359_2042	227
1374	3300046511	Ga0495608_0203181	Ga0495608_0203181_366_1055	227
1375	3300046513	Ga0495616_0039331	Ga0495616_0039331_1403_2086	227
1376	3300046513	Ga0495616_0044032	Ga0495616_0044032_1094_1777	227
1377	3300046516	Ga0495628_0009404	Ga0495628_0009404_4390_5079	227
1378	3300046518	Ga0495631_0010142	Ga0495631_0010142_3038_3721	227
1379	3300046520	Ga0495637_0077363	Ga0495637_0077363_265_954	227
1380	3300046523	Ga0495644_0037171	Ga0495644_0037171_395_1078	227
1381	3300046525	Ga0495663_0008947	Ga0495663_0008947_447_1130	227
1382	3300046525	Ga0495663_0009196	Ga0495663_0009196_1150_1833	227
1383	3300046528	Ga0495642_0159412	Ga0495642_0159412_132_815	227
1384	3300046529	Ga0495652_0003535	Ga0495652_0003535_5161_5850	227
1385	3300046533	Ga0495640_0008340	Ga0495640_0008340_4952_5641	227
1386	3300046536	Ga0495587_0058386	Ga0495587_0058386_1029_1718	227
1387	3300046538	Ga0495609_0027513	Ga0495609_0027513_313_996	227
1388	3300046538	Ga0495609_0076833	Ga0495609_0076833_140_823	227
1389	3300046539	Ga0495621_0004768	Ga0495621_0004768_717_1400	227
1390	3300046542	Ga0495597_0004214	Ga0495597_0004214_3033_3716	227
1391	3300046542	Ga0495597_0046818	Ga0495597_0046818_851_1534	227
1392	3300046543	Ga0495645_0067120	Ga0495645_0067120_171_860	227
1393	3300046557	Ga0495622_0122435	Ga0495622_0122435_372_1061	227
1394	3300046558	Ga0495633_0004972	Ga0495633_0004972_3191_3874	227
1395	3300046558	Ga0495633_0014808	Ga0495633_0014808_2376_3059	227
1396	3300046558	Ga0495633_0058886	Ga0495633_0058886_233_916	227
1397	3300046559	Ga0495667_0020775	Ga0495667_0020775_3421_4110	227
1398	3300046615	Ga0495656_0000635	Ga0495656_0000635_6982_7665	227
1399	3300046615	Ga0495656_0003883	Ga0495656_0003883_3463_4146	227
1400	3300046616	Ga0495668_0019156	Ga0495668_0019156_430_1113	227
1401	3300046616	Ga0495668_0022947	Ga0495668_0022947_756_1439	227
1402	3300046642	Ga0495634_0006578	Ga0495634_0006578_5520_6209	227
1403	3300046648	Ga0495611_0058700	Ga0495611_0058700_17_700	227
1404	3300046648	Ga0495611_0229071	Ga0495611_0229071_77_760	227
1405	3300046660	Ga0495625_0000172	Ga0495625_0000172_23185_23868	227
1406	3300046660	Ga0495625_0043671	Ga0495625_0043671_934_1617	227
1407	3300046663	Ga0495635_0025187	Ga0495635_0025187_3024_3713	227
1408	3300046663	Ga0495635_0467300	Ga0495635_0467300_131_814	227
1409	3300046664	Ga0495659_0055233	Ga0495659_0055233_247_930	227
1410	3300046665	Ga0495661_0024841	Ga0495661_0024841_779_1462	227
1411	3300046665	Ga0495661_0027741	Ga0495661_0027741_1450_2133	227
1412	3300046665	Ga0495661_0072206	Ga0495661_0072206_638_1321	227
1413	3300046665	Ga0495661_0158851	Ga0495661_0158851_354_1037	227
1414	3300046674	Ga0495588_0005838	Ga0495588_0005838_2301_2990	227
1415	3300046680	Ga0495646_0005468	Ga0495646_0005468_320_1009	227
1416	3300046681	Ga0495647_0035985	Ga0495647_0035985_920_1609	227
1417	3300046684	Ga0495669_0028423	Ga0495669_0028423_1701_2384	227
1418	3300046689	Ga0495613_0046480	Ga0495613_0046480_1763_2452	227
1419	3300046691	Ga0495670_0006166	Ga0495670_0006166_4440_5123	227
1420	3300046691	Ga0495670_0011879	Ga0495670_0011879_767_1450	227
1421	3300046691	Ga0495670_0056765	Ga0495670_0056765_889_1572	227
1422	3300046692	Ga0495671_0185411	Ga0495671_0185411_275_958	227
1423	3300046809	Ga0495600_0034137	Ga0495600_0034137_2421_3110	227
1424	3300047317	Ga0495604_0047819	Ga0495604_0047819_515_1204	227
1425	3300047319	Ga0495674_0203094	Ga0495674_0203094_170_859	227
1426	3300047322	Ga0495680_0073758	Ga0495680_0073758_803_1492	227
1427	3300047323	Ga0495683_0093073	Ga0495683_0093073_154_837	227
1428	3300047444	Ga0495675_0068733	Ga0495675_0068733_803_1492	227
1429	3300047444	Ga0495675_0325938	Ga0495675_0325938_176_865	227
1430	3300047445	Ga0495677_0005234	Ga0495677_0005234_2975_3658	227
1431	3300047445	Ga0495677_0057786	Ga0495677_0057786_58_741	227
1432	3300047470	Ga0495681_0012653	Ga0495681_0012653_336_1019	227
1433	3300047470	Ga0495681_0094087	Ga0495681_0094087_118_801	227
1434	3300047471	Ga0495684_0003601	Ga0495684_0003601_2439_3128	227
1435	3300047472	Ga0495686_0067727	Ga0495686_0067727_221_904	227
1436	3300047673	Ga0495593_0002191	Ga0495593_0002191_7452_8141	227
1437	3300048088	Ga0495602_0429278	Ga0495602_0429278_151_840	227
1438	3300048091	Ga0495626_0002477	Ga0495626_0002477_5897_6580	227
1439	3300048904	Ga0496101_0191288	Ga0496101_0191288_165_848	227
1440	3300048905	Ga0496102_0092216	Ga0496102_0092216_1987_2670	227
1441	3300048906	Ga0496103_0023107	Ga0496103_0023107_2854_3537	227
1442	3300048907	Ga0496104_0002726	Ga0496104_0002726_4130_4813	227
1443	3300048907	Ga0496104_0053547	Ga0496104_0053547_2042_2731	227
1444	3300048907	Ga0496104_0117050	Ga0496104_0117050_1712_2395	227
1445	3300048908	Ga0496105_0000870	Ga0496105_0000870_2590_3273	227
1446	3300048908	Ga0496105_0005533	Ga0496105_0005533_7290_7973	227
1447	3300048908	Ga0496105_0098282	Ga0496105_0098282_131_814	227
1448	3300048908	Ga0496105_0398464	Ga0496105_0398464_315_1004	227
1449	3300048909	Ga0496106_0003608	Ga0496106_0003608_528_1211	227
1450	3300048909	Ga0496106_0298821	Ga0496106_0298821_454_1143	227
1451	3300048910	Ga0496107_0001068	Ga0496107_0001068_12168_12851	227
1452	3300048911	Ga0496108_0034563	Ga0496108_0034563_2096_2779	227
1453	3300048912	Ga0496109_0057947	Ga0496109_0057947_29_712	227
1454	3300048912	Ga0496109_0204495	Ga0496109_0204495_659_1342	227
1455	3300048912	Ga0496109_0409539	Ga0496109_0409539_28_711	227
1456	3300048913	Ga0496110_0000891	Ga0496110_0000891_19536_20219	227
1457	3300048913	Ga0496110_0456138	Ga0496110_0456138_128_811	227
1458	3300048913	Ga0496110_0478371	Ga0496110_0478371_290_973	227
1459	3300048914	Ga0496111_0215356	Ga0496111_0215356_462_1145	227
1460	3300048915	Ga0496112_0049350	Ga0496112_0049350_876_1559	227
1461	3300048915	Ga0496112_0471491	Ga0496112_0471491_481_1164	227
1462	3300048916	Ga0496113_0002138	Ga0496113_0002138_7928_8611	227
1463	3300048916	Ga0496113_0101575	Ga0496113_0101575_852_1535	227
1464	3300048917	Ga0496114_0053478	Ga0496114_0053478_2623_3306	227
1465	3300048920	Ga0496117_0096882	Ga0496117_0096882_263_946	227
1466	3300048921	Ga0496118_0008991	Ga0496118_0008991_963_1646	227
1467	3300048923	Ga0496120_0059285	Ga0496120_0059285_1452_2135	227
1468	3300048924	Ga0496121_0000196	Ga0496121_0000196_85926_86609	227
1469	3300048924	Ga0496121_0242667	Ga0496121_0242667_499_1188	227
1470	3300048927	Ga0496124_0478795	Ga0496124_0478795_93_782	227
1471	3300048928	Ga0496125_0003106	Ga0496125_0003106_11693_12376	227
1472	3300048929	Ga0496126_0005453	Ga0496126_0005453_11628_12311	227
1473	3300048929	Ga0496126_0036411	Ga0496126_0036411_3900_4589	227
1474	3300049568	Ga0501031_0000595	Ga0501031_0000595_13671_14354	227
1475	3300049574	Ga0501038_0067355	Ga0501038_0067355_1491_2174	227
1476	3300050507	nmdc:mga05p37_411527_c1	nmdc:mga05p37_411527_c1_130_813	227
1477	3300050508	nmdc:mga09592_108338_c1	nmdc:mga09592_108338_c1_93_776	227
1478	3300050509	nmdc:mga0qj67_157848_c1	nmdc:mga0qj67_157848_c1_358_1041	227
1479	3300050510	nmdc:mga06r32_1267_c1	nmdc:mga06r32_1267_c1_5261_5944	227
1480	3300050510	nmdc:mga06r32_320700_c1	nmdc:mga06r32_320700_c1_836_1519	227
1481	3300050510	nmdc:mga06r32_907737_c1	nmdc:mga06r32_907737_c1_12_695	227
1482	3300050511	nmdc:mga08y16_16245_c1	nmdc:mga08y16_16245_c1_2922_3605	227
1483	3300050511	nmdc:mga08y16_582917_c1	nmdc:mga08y16_582917_c1_374_1057	227
1484	3300050511	nmdc:mga08y16_61125_c1	nmdc:mga08y16_61125_c1_258_962	227
1485	3300050511	nmdc:mga08y16_69085_c1	nmdc:mga08y16_69085_c1_2860_3597	227
1486	3300053077	Ga0495601_0099733	Ga0495601_0099733_1129_1818	227
1487	3300053077	Ga0495601_0214462	Ga0495601_0214462_501_1190	227
1488	3300053084	Ga0495595_0040688	Ga0495595_0040688_1100_1789	227
1489	3300053085	Ga0495619_0045790	Ga0495619_0045790_1101_1790	227
1490	3300053087	Ga0500643_000376	Ga0500643_000376_806_1489	227
1491	3300053087	Ga0500643_024850	Ga0500643_024850_656_1339	227
1492	3300053094	Ga0500566_0006230	Ga0500566_0006230_1739_2428	227
1493	3300053096	Ga0500641_0000875	Ga0500641_0000875_5968_6651	227
1494	3300053096	Ga0500641_0007939	Ga0500641_0007939_1939_2628	227
1495	3300053104	Ga0500556_0003520	Ga0500556_0003520_150_833	227
1496	3300053117	Ga0500593_110181	Ga0500593_110181_422_1105	227
1497	3300053136	Ga0500559_0001061	Ga0500559_0001061_432_1115	227
1498	3300053139	Ga0500568_0004319	Ga0500568_0004319_6428_7111	227
1499	3300053153	Ga0500616_0114379	Ga0500616_0114379_476_1159	227
1500	3300053153	Ga0500616_0157985	Ga0500616_0157985_99_782	227
1501	3300053156	Ga0500622_0005954	Ga0500622_0005954_367_1050	227
1502	3300053156	Ga0500622_0011823	Ga0500622_0011823_189_872	227
1503	3300053156	Ga0500622_0069257	Ga0500622_0069257_404_1087	227
1504	3300053730	Ga0500645_000184	Ga0500645_000184_1266_1949	227
1505	3300060353	Ga0501082_0002356	Ga0501082_0002356_8886_9569	227
1506	3300060353	Ga0501082_0103547	Ga0501082_0103547_1590_2273	227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

216

259

0.98 PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

115

210

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3dkq-assembly1.cif.gz_B-2	crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution	0.9769	2	227
3dkq-assembly1.cif.gz_C-2	crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution	0.9651	2	227
3dkq-assembly1.cif.gz_A-2	crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution	0.9554	2	227
3dkq-assembly1.cif.gz_B-2	crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution	0.9397	2	227
3dkq-assembly1.cif.gz_C-2	crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution	0.9353	2	227

ID	Description	Score	Start	End	Superfamily
3dkqC01	Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain	0.962	2	178	2.60.120.620
3dkqC01	Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain	0.9287	2	178	2.60.120.620
af_A0A2R8QTR6_26_127_1.20.1280.290	Mainly Alpha;Up-down Bundle;Monooxygenase;	0.9231	183	223	1.20.1280.290
af_Q92982_38_139_1.20.1280.290	Mainly Alpha;Up-down Bundle;Monooxygenase;	0.85	183	223	1.20.1280.290
af_I1MK06_17_180_2.60.120.10	Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls	0.7949	79	174	2.60.120.10

ID	Description	Score	Start	End	GO Terms
AF-B9MCK8-F1-model_v4	PKHD-type hydroxylase Dtpsy_0528 (EC 1.14.11.-)	0.9934	1	227	GO:0005506 GO:0006879 GO:0006974 GO:0016706 GO:0031418
AF-A0A7R8WPC2-F1-model_v4	Uncharacterized protein	0.9934	1	227	GO:0005506 GO:0006879 GO:0006974 GO:0010181 GO:0016706 GO:0031418
AF-A0A645GKJ7-F1-model_v4	PKHD-type hydroxylase (EC 1.14.11.-)	0.9908	55	227	GO:0005506 GO:0006879 GO:0006974 GO:0016706 GO:0031418
AF-A0A1F8U6U9-F1-model_v4	Fe2+-dependent dioxygenase	0.9901	40	227	GO:0005506 GO:0006879 GO:0006974 GO:0016706 GO:0031418
AF-J7J7R1-F1-model_v4	deleted	0.9895	2	227

Feature Viewer

pLDDT	pTM	Quality
95	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494439

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

216

259

0.98

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

115

210

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map