F494426

General Info

Members Datasets Scaffolds Average Seq Length
1504 583 1408 386

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100008706|Ga0068869_1000087066
Length 360
Sequence MLLELAQWLAREVRAFNVFNYITLRAVLATLTSLVISFLVGPTMIRKLTMYKIGQAVRDDGPQSHLSKAGTPTMGGALVLVAVAVTTLLWADLSNRFVWVVLLVTLGFGVVGWVDDYRKVVHRNPKGLPARVKYFWQSMIGLAAALYLAYSGTAAQTEFIVPFFKQVSYPLGIVGFVIMSYFVIVGASNAVNLTDGLDGLAIMPTVMVGSALGVFAYVAGHAVFSKYLGFPHIPGAGELTVFCAALAGAGLAFLWFNAYPAEVFMGDVGALALGAALGTIAVIVRQEIVLFIMGGVFVVETLSVVLQVASFKLTGKRIFRMAPLHHHYELKGWKENQVVVRFWIITMMLVLFGLSTLKLR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2547132512 Azospira oryzae 6a3 Isolate Unclassified
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
9 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
10 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
16 2643221570 Acidovorax sp. Root568 Isolate Unclassified
17 2643221585 Pelomonas sp. Root662 Isolate Unclassified
18 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
19 2643221596 Acidovorax sp. Root70 Isolate Unclassified
20 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
21 2643221609 Acidovorax sp. Root217 Isolate Unclassified
22 2643221611 Acidovorax sp. Root219 Isolate Unclassified
23 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
24 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
25 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
26 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
27 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
28 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
29 2643221652 Acidovorax sp. Root402 Isolate Unclassified
30 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
31 2643221656 Pelomonas sp. Root405 Isolate Unclassified
32 2643221658 Variovorax sp. Root411 Isolate Unclassified
33 2643221660 Methylibium sp. Root1272 Isolate Unclassified
34 2643221672 Variovorax sp. Root434 Isolate Unclassified
35 2643221683 Variovorax sp. Root473 Isolate Unclassified
36 2643221717 Acidovorax sp. Root267 Isolate Unclassified
37 2721755523 Delftia sp. HK171 Isolate Unclassified
38 2738541277 Variovorax sp. GV051 Isolate Unclassified
39 2738541307 Variovorax sp. GV008 Isolate Unclassified
40 2738541337 Pelomonas sp. BT06 Isolate Unclassified
41 2738543012 Acidovorax sp. CF301 Isolate Unclassified
42 2738543013 Variovorax sp. BT01 Isolate Unclassified
43 2738543019 Variovorax sp. GV040 Isolate Unclassified
44 2816332133 Acidovorax radicis 2721A Isolate Unclassified
45 2818991436 Collimonas arenae 515 Isolate Unclassified
46 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
47 2818991446 Variovorax sp. 1180 Isolate Unclassified
48 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
49 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
50 2831864461 Roseateles noduli HZ7 Isolate Nodule
51 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
52 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
53 2842677519 Variovorax sp. R-72495 Isolate Unclassified
54 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
55 2842733646 Variovorax sp. R-72446 Isolate Unclassified
56 2842747753 Variovorax sp. R-72060 Isolate Unclassified
57 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
58 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
59 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
60 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
61 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
62 2885198086 Variovorax sp. 679 Isolate Unclassified
63 2885211737 Variovorax sp. 553 Isolate Unclassified
64 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
65 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
66 2899924645 Variovorax sp. 369 Isolate Unclassified
67 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
68 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
69 2904456579 Variovorax sp. 2002 Isolate Unclassified
70 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
71 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
72 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
73 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
74 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
75 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
76 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
77 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
78 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
79 2928037797 Variovorax sp. 1126 Isolate Unclassified
80 2928044640 Variovorax sp. 1128 Isolate Unclassified
81 2928051484 Variovorax sp. 1133 Isolate Unclassified
82 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
83 2928070936 Variovorax gossypii 1167 Isolate Unclassified
84 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
85 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
86 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
87 2929520902 Variovorax beijingensis 502 Isolate Unclassified
88 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
89 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
90 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
91 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
92 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
93 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
94 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
95 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
96 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
97 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
100 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
101 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
102 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
103 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
104 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
105 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
106 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
107 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
113 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
114 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
115 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
119 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
120 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
121 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
122 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
123 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
124 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
125 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
126 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
127 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
132 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
133 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
137 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
138 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
139 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
140 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
141 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
142 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
143 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
144 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
145 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
146 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
147 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
148 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
149 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
150 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
151 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
152 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
156 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
157 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
158 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
159 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
160 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
161 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
162 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
163 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
164 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
165 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
166 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
167 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
168 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
169 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
170 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
171 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
172 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
173 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
174 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
175 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
176 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
177 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
180 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
181 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
182 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
183 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
184 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
185 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
186 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
187 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
188 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
189 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
190 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
191 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
192 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
193 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
194 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
195 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
196 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
197 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
198 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
199 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
200 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
201 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
202 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
203 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
204 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
205 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
206 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
207 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
208 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
209 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
210 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
211 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
212 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
213 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
214 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
215 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
216 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
217 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
218 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
219 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
220 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
221 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
222 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
223 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
224 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
225 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
226 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
227 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
228 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
229 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
230 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
231 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
232 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
233 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
234 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
235 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
236 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
237 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
238 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
239 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
240 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
241 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
242 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
243 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
244 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
245 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
246 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
247 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
248 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
249 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
250 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
251 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
252 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
253 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
254 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
255 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
258 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
259 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
266 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
267 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
269 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
270 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
274 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
279 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
288 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
355 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
356 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
358 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
359 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
360 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
362 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
363 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
364 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
365 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
369 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
370 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
371 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
372 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
373 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
374 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
375 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
376 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
377 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
378 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
379 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
380 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
381 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
382 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
383 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
384 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
385 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
386 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
387 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
388 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
389 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
390 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
391 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
392 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
393 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
394 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
395 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
396 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
397 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
398 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
399 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
400 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
401 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
402 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
403 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
404 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
405 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
406 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
407 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
408 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
409 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
410 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
411 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
412 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
413 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
414 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
415 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
416 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
417 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
418 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
419 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
420 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
421 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
422 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
423 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
424 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
425 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
426 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
427 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
428 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
429 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
430 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
431 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
432 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
433 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
434 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
435 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
436 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
437 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
438 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
439 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
440 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
441 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
442 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
443 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
444 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
445 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
446 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
447 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
448 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
449 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
450 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
451 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
452 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
453 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
454 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
455 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
456 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
457 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
458 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
459 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
460 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
461 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
462 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
463 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
464 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
465 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
466 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
467 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
468 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
469 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
470 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
471 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
472 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
473 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
474 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
475 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
476 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
477 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
478 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
479 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
480 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
481 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
482 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
483 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
484 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
485 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
486 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
487 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
488 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
489 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
490 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
491 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
492 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
493 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
494 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
495 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
496 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
497 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
498 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
499 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
500 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
501 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
502 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
503 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
504 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
505 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
506 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
507 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
508 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
509 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
510 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
511 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
512 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
513 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
514 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
515 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
516 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
517 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
518 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
519 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
520 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
521 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
522 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
523 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
524 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
525 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
526 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
527 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
528 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
529 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
530 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
531 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
532 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
533 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
535 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
537 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
538 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
539 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
540 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
541 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
542 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
543 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
544 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
545 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
546 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
547 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
548 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
549 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
550 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
551 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
552 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
553 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
554 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
555 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
556 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
557 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
558 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
559 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
560 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
561 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
562 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
563 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
564 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
565 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
566 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
567 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
568 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
569 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
570 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
571 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
572 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
573 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
574 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
575 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
576 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
577 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
578 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
579 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
580 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
581 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
582 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
583 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.35
Metatranscriptomes 0.27
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.82
Nodule 0.93
Rhizoplane 3.46
Rhizosphere 70.61
Stem 0
Stem Tuber 0
Unclassified 9.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005459 3300001976 Bacteria 1659
2 JGI24740J21852_10009841 3300001979 Bacteria 3718
3 JGI24743J22301_10000318 3300001991 Bacteria 5268
4 JGI25155J39150_1000029 3300002704 Bacteria 118964
5 JGI25155J39150_1000630 3300002704 Bacteria 7245
6 JGI25156J39149_1000062 3300002705 Bacteria 84500
7 JGI25156J39149_1007587 3300002705 Bacteria 2827
8 JGI25162J39368_1000063 3300002737 Bacteria 134747
9 JGI25154J39366_1000053 3300002738 Bacteria 119466
10 JGI25154J39366_1000980 3300002738 Bacteria 11617
11 JGI25157J39369_1000046 3300002741 Bacteria 119470
12 JGI25157J39369_1000148 3300002741 Bacteria 58782
13 JGI25164J39214_1005708 3300002772 Bacteria 1337
14 JGI25152J39213_1006001 3300002773 Bacteria 3405
15 JGI25152J39213_1006432 3300002773 Bacteria 3210
16 JGI25150J39212_1001852 3300002774 Bacteria 5591
17 JGI25165J46597_1000069 3300003214 Bacteria 195460
18 JGI25153J46596_10005062 3300003215 Bacteria 6974
19 JGI25153J46596_10022378 3300003215 Bacteria 2331
20 rootL2_10000966 3300003322 Bacteria 57184
21 JGI25160J50197_1000253 3300003354 Bacteria 40838
22 JGI25161J50226_1000046 3300003374 Bacteria 116165
23 Ga0007409J51694_1052775 3300003575 Bacteria 2665
24 Ga0006562J51391_1013325 3300003578 Bacteria 17825
25 Ga0006562J51391_1013328 3300003578 Bacteria 7450
26 Ga0006562J51391_1029542 3300003578 Bacteria 12747
27 Ga0055538_1000034 3300003751 Bacteria 195460
28 Ga0055538_1000051 3300003751 Bacteria 129958
29 Ga0055539_1000044 3300003752 Bacteria 195460
30 Ga0055539_1000076 3300003752 Bacteria 129958
31 Ga0055533_1000016 3300003756 Bacteria 396179
32 Ga0055533_1000055 3300003756 Bacteria 195460
33 Ga0055533_1000082 3300003756 Bacteria 129958
34 Ga0055525_1000066 3300003759 Bacteria 195460
35 Ga0055525_1000109 3300003759 Bacteria 129958
36 Ga0055525_1001112 3300003759 Bacteria 6608
37 Ga0055527_1005163 3300003760 Bacteria 1721
38 Ga0055535_1000934 3300003761 Bacteria 19510
39 Ga0055542_1000051 3300003762 Bacteria 175242
40 Ga0055529_1000333 3300003763 Bacteria 52783
41 Ga0055526_1003822 3300003771 Bacteria 9360
42 Ga0055526_1006065 3300003771 Bacteria 6686
43 Ga0055526_1018229 3300003771 Bacteria 2630
44 Ga0055537_1000320 3300003773 Bacteria 32832
45 Ga0055537_1001534 3300003773 Bacteria 8838
46 Ga0055537_1007598 3300003773 Bacteria 2597
47 Ga0055524_1000044 3300003775 Bacteria 151631
48 Ga0055524_1000052 3300003775 Bacteria 144959
49 Ga0055536_1017883 3300003781 Bacteria 2297
50 Ga0055534_1001482 3300003784 Bacteria 9319
51 Ga0055534_1003391 3300003784 Bacteria 5020
52 Ga0055534_1003755 3300003784 Bacteria 4676
53 Ga0055528_1002526 3300003790 Bacteria 9743
54 Ga0055528_1002727 3300003790 Bacteria 9271
55 Ga0055528_1014474 3300003790 Bacteria 2917
56 Ga0055528_1016568 3300003790 Bacteria 2597
57 Ga0055530_10003990 3300003791 Bacteria 7959
58 Ga0055530_10028740 3300003791 Bacteria 1497
59 Ga0055540_1000019 3300003792 Bacteria 210593
60 Ga0055540_1000116 3300003792 Bacteria 83801
61 Ga0055540_1001799 3300003792 Bacteria 12186
62 Ga0055540_1007088 3300003792 Bacteria 4305
63 Ga0055540_1018406 3300003792 Bacteria 1915
64 Ga0055540_1020148 3300003792 Bacteria 1773
65 Ga0055531_10000001 3300003794 Bacteria 543586
66 Ga0055531_10000250 3300003794 Bacteria 57734
67 Ga0055531_10000360 3300003794 Bacteria 44186
68 Ga0055531_10001074 3300003794 Bacteria 21465
69 Ga0055531_10005011 3300003794 Bacteria 7854
70 Ga0055541_1000032 3300003841 Bacteria 195460
71 Ga0055541_1000053 3300003841 Bacteria 129958
72 Ga0055543_1000404 3300004625 Bacteria 27579
73 Ga0055543_1001848 3300004625 Bacteria 7724
74 Ga0065165_1000080 3300005262 Bacteria 159638
75 Ga0065165_1000101 3300005262 Bacteria 141486
76 Ga0065165_1011617 3300005262 Bacteria 3649
77 Ga0065714_10088736 3300005288 Bacteria 2005
78 Ga0065704_10152799 3300005289 Bacteria 1404
79 Ga0065712_10013487 3300005290 Bacteria 1940
80 Ga0065715_10109100 3300005293 Bacteria 2684
81 Ga0065715_10200115 3300005293 Bacteria 1366
82 Ga0065707_10017403 3300005295 Bacteria 1832
83 Ga0065707_10087447 3300005295 Bacteria 5021
84 Ga0070676_10006671 3300005328 Bacteria 6182
85 Ga0070676_10011485 3300005328 Bacteria 4814
86 Ga0070676_10030468 3300005328 Bacteria 3077
87 Ga0070676_10101322 3300005328 Bacteria 1779
88 Ga0070683_100009064 3300005329 Bacteria 8492
89 Ga0070683_100046656 3300005329 Bacteria 4003
90 Ga0070683_100101987 3300005329 Bacteria 2703
91 Ga0070690_100014678 3300005330 Bacteria 4651
92 Ga0070670_100017831 3300005331 Bacteria 6093
93 Ga0070670_100024246 3300005331 Bacteria 5218
94 Ga0070670_100041714 3300005331 Bacteria 3943
95 Ga0070670_100060294 3300005331 Bacteria 3257
96 Ga0070670_100069385 3300005331 Bacteria 3025
97 Ga0070677_10010696 3300005333 Bacteria 3144
98 Ga0070677_10020993 3300005333 Bacteria 2389
99 Ga0068869_100008706 3300005334 Bacteria 6554
100 Ga0068869_100010988 3300005334 Bacteria 5928
101 Ga0068869_100054844 3300005334 Bacteria 2903
102 Ga0068869_100057452 3300005334 Bacteria 2841
103 Ga0068869_100060701 3300005334 Bacteria 2772
104 Ga0068869_100144839 3300005334 Bacteria 1838
105 Ga0068869_100237443 3300005334 Bacteria 1451
106 Ga0070666_10002017 3300005335 Bacteria 12359
107 Ga0070666_10002085 3300005335 Bacteria 12146
108 Ga0070666_10007234 3300005335 Bacteria 6842
109 Ga0070666_10166859 3300005335 Bacteria 1540
110 Ga0070666_10217006 3300005335 Bacteria 1348
111 Ga0070680_100009175 3300005336 Bacteria 7586
112 Ga0070680_100118137 3300005336 Bacteria 2212
113 Ga0070682_100072046 3300005337 Bacteria 2213
114 Ga0068868_100002479 3300005338 Bacteria 12803
115 Ga0068868_100008720 3300005338 Bacteria 7259
116 Ga0068868_100011294 3300005338 Bacteria 6502
117 Ga0068868_100015252 3300005338 Bacteria 5680
118 Ga0068868_100025044 3300005338 Bacteria 4532
119 Ga0068868_100077031 3300005338 Bacteria 2667
120 Ga0068868_100132339 3300005338 Bacteria 2042
121 Ga0070660_100010146 3300005339 Bacteria 6646
122 Ga0070660_100016617 3300005339 Bacteria 5345
123 Ga0070660_100030279 3300005339 Bacteria 4061
124 Ga0070660_100056082 3300005339 Bacteria 3047
125 Ga0070660_100169243 3300005339 Bacteria 1764
126 Ga0070689_100006450 3300005340 Bacteria 8119
127 Ga0070689_100049233 3300005340 Bacteria 3252
128 Ga0070661_100000438 3300005344 Bacteria 31889
129 Ga0070661_100004052 3300005344 Bacteria 10084
130 Ga0070661_100007525 3300005344 Bacteria 7513
131 Ga0070661_100021533 3300005344 Bacteria 4607
132 Ga0070661_100027172 3300005344 Bacteria 4119
133 Ga0070661_100037457 3300005344 Bacteria 3528
134 Ga0070661_100056385 3300005344 Bacteria 2879
135 Ga0070661_100062540 3300005344 Bacteria 2732
136 Ga0070661_100068487 3300005344 Bacteria 2608
137 Ga0070661_100128680 3300005344 Bacteria 1901
138 Ga0070668_100006235 3300005347 Bacteria 8832
139 Ga0070668_100034620 3300005347 Bacteria 3850
140 Ga0070668_100119179 3300005347 Bacteria 2108
141 Ga0070669_100000836 3300005353 Bacteria 22361
142 Ga0070669_100007603 3300005353 Bacteria 7748
143 Ga0070675_100005877 3300005354 Bacteria 9400
144 Ga0070675_100008456 3300005354 Bacteria 7990
145 Ga0070675_100009844 3300005354 Bacteria 7452
146 Ga0070675_100009921 3300005354 Bacteria 7426
147 Ga0070675_100030409 3300005354 Bacteria 4360
148 Ga0070675_100033037 3300005354 Bacteria 4192
149 Ga0070675_100040122 3300005354 Bacteria 3821
150 Ga0070675_100069679 3300005354 Bacteria 2914
151 Ga0070675_100097175 3300005354 Bacteria 2476
152 Ga0070675_100104043 3300005354 Bacteria 2394
153 Ga0070675_100109297 3300005354 Bacteria 2337
154 Ga0070675_100152851 3300005354 Bacteria 1980
155 Ga0070675_100183000 3300005354 Bacteria 1812
156 Ga0070671_100016262 3300005355 Bacteria 6018
157 Ga0070671_100020139 3300005355 Bacteria 5437
158 Ga0070671_100028811 3300005355 Bacteria 4576
159 Ga0070671_100034619 3300005355 Bacteria 4181
160 Ga0070671_100075349 3300005355 Bacteria 2818
161 Ga0070671_100091607 3300005355 Bacteria 2547
162 Ga0070671_100101544 3300005355 Bacteria 2413
163 Ga0070674_100067268 3300005356 Bacteria 2520
164 Ga0070674_100079454 3300005356 Bacteria 2340
165 Ga0070673_100002109 3300005364 Bacteria 12020
166 Ga0070673_100007014 3300005364 Bacteria 7387
167 Ga0070673_100012438 3300005364 Bacteria 5842
168 Ga0070673_100032447 3300005364 Bacteria 3933
169 Ga0070673_100034161 3300005364 Bacteria 3845
170 Ga0070673_100067153 3300005364 Bacteria 2867
171 Ga0070688_100007417 3300005365 Bacteria 5912
172 Ga0070688_100020548 3300005365 Bacteria 3840
173 Ga0070688_100062864 3300005365 Bacteria 2351
174 Ga0070659_100001517 3300005366 Bacteria 16743
175 Ga0070659_100005912 3300005366 Bacteria 8817
176 Ga0070659_100006674 3300005366 Bacteria 8340
177 Ga0070659_100027105 3300005366 Bacteria 4412
178 Ga0070659_100040928 3300005366 Bacteria 3621
179 Ga0070659_100061022 3300005366 Bacteria 2979
180 Ga0070659_100099618 3300005366 Bacteria 2338
181 Ga0070667_100008976 3300005367 Bacteria 8276
182 Ga0070667_100078199 3300005367 Bacteria 2826
183 Ga0070667_100085453 3300005367 Bacteria 2706
184 Ga0070714_100066057 3300005435 Bacteria 3117
185 Ga0070713_100001286 3300005436 Bacteria 16035
186 Ga0070713_100037564 3300005436 Bacteria 3916
187 Ga0070713_100097345 3300005436 Bacteria 2542
188 Ga0070710_10017813 3300005437 Bacteria 3645
189 Ga0070711_100165078 3300005439 Bacteria 1682
190 Ga0070705_100167164 3300005440 Bacteria 1476
191 Ga0070700_100005556 3300005441 Bacteria 6683
192 Ga0070700_100165449 3300005441 Bacteria 1527
193 Ga0070708_100002113 3300005445 Bacteria 15337
194 Ga0070708_100039865 3300005445 Bacteria 4112
195 Ga0070663_100001569 3300005455 Bacteria 12571
196 Ga0070663_100001571 3300005455 Bacteria 12554
197 Ga0070663_100018838 3300005455 Bacteria 4536
198 Ga0070663_100032139 3300005455 Bacteria 3614
199 Ga0070663_100042377 3300005455 Bacteria 3198
200 Ga0070678_100002034 3300005456 Bacteria 10937
201 Ga0070678_100011593 3300005456 Bacteria 5444
202 Ga0070678_100016983 3300005456 Bacteria 4672
203 Ga0070678_100042434 3300005456 Bacteria 3233
204 Ga0070678_100106891 3300005456 Bacteria 2181
205 Ga0070662_100000797 3300005457 Bacteria 19366
206 Ga0070662_100003074 3300005457 Bacteria 10362
207 Ga0070662_100015946 3300005457 Bacteria 5040
208 Ga0070662_100022556 3300005457 Bacteria 4311
209 Ga0070662_100044324 3300005457 Bacteria 3186
210 Ga0070662_100044744 3300005457 Bacteria 3172
211 Ga0070681_10005522 3300005458 Bacteria 12219
212 Ga0070681_10015862 3300005458 Bacteria 7510
213 Ga0070681_10039054 3300005458 Bacteria 4759
214 Ga0070681_10122983 3300005458 Bacteria 2528
215 Ga0070681_10250846 3300005458 Bacteria 1682
216 Ga0068867_100000072 3300005459 Bacteria 61663
217 Ga0068867_100012146 3300005459 Bacteria 6084
218 Ga0068867_100015998 3300005459 Bacteria 5326
219 Ga0068867_100042119 3300005459 Bacteria 3339
220 Ga0068867_100151478 3300005459 Bacteria 1822
221 Ga0070685_10008232 3300005466 Bacteria 5348
222 Ga0070706_100003148 3300005467 Bacteria 16310
223 Ga0070679_100002623 3300005530 Bacteria 16359
224 Ga0070679_100013959 3300005530 Bacteria 7698
225 Ga0070679_100027132 3300005530 Bacteria 5633
226 Ga0070684_100005280 3300005535 Bacteria 9886
227 Ga0070684_100025049 3300005535 Bacteria 5010
228 Ga0070684_100113710 3300005535 Bacteria 2429
229 Ga0070684_100120705 3300005535 Bacteria 2358
230 Ga0068853_100008733 3300005539 Bacteria 8152
231 Ga0068853_100010500 3300005539 Bacteria 7488
232 Ga0068853_100051363 3300005539 Bacteria 3548
233 Ga0068853_100200788 3300005539 Bacteria 1814
234 Ga0070672_100006178 3300005543 Bacteria 8017
235 Ga0070672_100012097 3300005543 Bacteria 6041
236 Ga0070672_100043693 3300005543 Bacteria 3457
237 Ga0070672_100079220 3300005543 Bacteria 2629
238 Ga0070672_100150738 3300005543 Bacteria 1923
239 Ga0070686_100039757 3300005544 Bacteria 2932
240 Ga0070696_100045688 3300005546 Bacteria 3034
241 Ga0070665_100001671 3300005548 Bacteria 25571
242 Ga0070665_100014514 3300005548 Bacteria 7902
243 Ga0070665_100026041 3300005548 Bacteria 5890
244 Ga0070665_100031464 3300005548 Bacteria 5341
245 Ga0068855_100001947 3300005563 Bacteria 25644
246 Ga0068855_100013553 3300005563 Bacteria 9834
247 Ga0068855_100020007 3300005563 Bacteria 8038
248 Ga0068855_100021278 3300005563 Bacteria 7777
249 Ga0068855_100022085 3300005563 Bacteria 7628
250 Ga0068855_100064929 3300005563 Bacteria 4256
251 Ga0068855_100284948 3300005563 Bacteria 1833
252 Ga0070664_100000572 3300005564 Bacteria 28020
253 Ga0070664_100004505 3300005564 Bacteria 11177
254 Ga0070664_100010523 3300005564 Bacteria 7497
255 Ga0070664_100011975 3300005564 Bacteria 7042
256 Ga0070664_100017181 3300005564 Bacteria 5939
257 Ga0070664_100024891 3300005564 Bacteria 4958
258 Ga0070664_100035428 3300005564 Bacteria 4190
259 Ga0070664_100056592 3300005564 Bacteria 3332
260 Ga0070664_100109582 3300005564 Bacteria 2408
261 Ga0070664_100151381 3300005564 Bacteria 2048
262 Ga0068857_100002092 3300005577 Bacteria 16226
263 Ga0068857_100009749 3300005577 Bacteria 8341
264 Ga0068857_100019562 3300005577 Bacteria 5947
265 Ga0068857_100043710 3300005577 Bacteria 3973
266 Ga0068854_100002901 3300005578 Bacteria 10652
267 Ga0068854_100004679 3300005578 Bacteria 8624
268 Ga0068854_100005922 3300005578 Bacteria 7744
269 Ga0068854_100008715 3300005578 Bacteria 6527
270 Ga0068854_100010091 3300005578 Bacteria 6116
271 Ga0068854_100202106 3300005578 Bacteria 1563
272 Ga0068856_100003475 3300005614 Bacteria 15910
273 Ga0068856_100004714 3300005614 Bacteria 13539
274 Ga0068856_100013533 3300005614 Bacteria 7896
275 Ga0068856_100060225 3300005614 Bacteria 3751
276 Ga0068856_100200213 3300005614 Bacteria 2011
277 Ga0070702_100008273 3300005615 Bacteria 5028
278 Ga0070702_100013368 3300005615 Bacteria 4143
279 Ga0070702_100035799 3300005615 Bacteria 2745
280 Ga0068852_100006367 3300005616 Bacteria 8528
281 Ga0068852_100009785 3300005616 Bacteria 7127
282 Ga0068852_100011377 3300005616 Bacteria 6696
283 Ga0068852_100016444 3300005616 Bacteria 5770
284 Ga0068852_100029219 3300005616 Bacteria 4525
285 Ga0068852_100050451 3300005616 Bacteria 3565
286 Ga0068852_100103957 3300005616 Bacteria 2570
287 Ga0068852_100170849 3300005616 Bacteria 2038
288 Ga0068852_100275515 3300005616 Bacteria 1620
289 Ga0068859_100001759 3300005617 Bacteria 22061
290 Ga0068859_100002838 3300005617 Bacteria 17576
291 Ga0068859_100010805 3300005617 Bacteria 9191
292 Ga0068859_100036303 3300005617 Bacteria 4948
293 Ga0068859_100046656 3300005617 Bacteria 4350
294 Ga0068859_100342822 3300005617 Bacteria 1588
295 Ga0068864_100002362 3300005618 Bacteria 15612
296 Ga0068864_100005230 3300005618 Bacteria 10636
297 Ga0068864_100005322 3300005618 Bacteria 10542
298 Ga0068864_100011034 3300005618 Bacteria 7468
299 Ga0068864_100014018 3300005618 Bacteria 6647
300 Ga0068864_100080310 3300005618 Bacteria 2857
301 Ga0068864_100094802 3300005618 Bacteria 2638
302 Ga0068864_100163016 3300005618 Bacteria 2028
303 Ga0068866_10001400 3300005718 Bacteria 10388
304 Ga0068866_10015287 3300005718 Bacteria 3407
305 Ga0068861_100001649 3300005719 Bacteria 14258
306 Ga0068861_100002141 3300005719 Bacteria 12777
307 Ga0068861_100006425 3300005719 Bacteria 8007
308 Ga0068861_100010613 3300005719 Bacteria 6396
309 Ga0068861_100014120 3300005719 Bacteria 5601
310 Ga0068861_100021452 3300005719 Bacteria 4641
311 Ga0068851_10004000 3300005834 Bacteria 6616
312 Ga0068851_10031226 3300005834 Bacteria 2644
313 Ga0068851_10041079 3300005834 Bacteria 2325
314 Ga0068870_10000981 3300005840 Bacteria 11256
315 Ga0068870_10138090 3300005840 Bacteria 1423
316 Ga0068863_100007421 3300005841 Bacteria 10730
317 Ga0068863_100009748 3300005841 Bacteria 9367
318 Ga0068863_100025176 3300005841 Bacteria 5674
319 Ga0068863_100025192 3300005841 Bacteria 5672
320 Ga0068863_100037649 3300005841 Bacteria 4604
321 Ga0068863_100051872 3300005841 Bacteria 3887
322 Ga0068863_100056582 3300005841 Bacteria 3713
323 Ga0068863_100106534 3300005841 Bacteria 2667
324 Ga0068863_100137817 3300005841 Bacteria 2331
325 Ga0068863_100177019 3300005841 Bacteria 2047
326 Ga0068858_100000947 3300005842 Bacteria 30015
327 Ga0068858_100007512 3300005842 Bacteria 10535
328 Ga0068858_100057393 3300005842 Bacteria 3598
329 Ga0068858_100070827 3300005842 Bacteria 3232
330 Ga0068858_100096548 3300005842 Bacteria 2754
331 Ga0068860_100000590 3300005843 Bacteria 43453
332 Ga0068860_100052167 3300005843 Bacteria 3890
333 Ga0068860_100071631 3300005843 Bacteria 3293
334 Ga0068860_100082698 3300005843 Bacteria 3053
335 Ga0068860_100144366 3300005843 Bacteria 2289
336 Ga0068862_100013089 3300005844 Bacteria 6861
337 Ga0068862_100014282 3300005844 Bacteria 6587
338 Ga0068862_100034543 3300005844 Bacteria 4279
339 Ga0068862_100037384 3300005844 Bacteria 4115
340 Ga0068862_100043174 3300005844 Bacteria 3843
341 Ga0068862_100060042 3300005844 Bacteria 3265
342 Ga0075365_10005740 3300006038 Bacteria 6735
343 Ga0075365_10050093 3300006038 Bacteria 2754
344 Ga0075365_10092652 3300006038 Bacteria 2060
345 Ga0075365_10116201 3300006038 Bacteria 1842
346 Ga0075365_10145844 3300006038 Bacteria 1645
347 Ga0075368_10017820 3300006042 Bacteria 2661
348 Ga0075368_10046679 3300006042 Bacteria 1713
349 Ga0075364_10026805 3300006051 Bacteria 3678
350 Ga0075364_10035233 3300006051 Bacteria 3234
351 Ga0075432_10031116 3300006058 Bacteria 1847
352 Ga0070716_100018621 3300006173 Bacteria 3620
353 Ga0070716_100120684 3300006173 Bacteria 1640
354 Ga0075362_10002448 3300006177 Bacteria 6240
355 Ga0075362_10031931 3300006177 Bacteria 2282
356 Ga0075362_10062616 3300006177 Bacteria 1685
357 Ga0075367_10009399 3300006178 Bacteria 5108
358 Ga0075367_10011488 3300006178 Bacteria 4689
359 Ga0075367_10029375 3300006178 Bacteria 3144
360 Ga0075367_10046968 3300006178 Bacteria 2538
361 Ga0075366_10001777 3300006195 Bacteria 10884
362 Ga0075366_10005505 3300006195 Bacteria 6861
363 Ga0075366_10008469 3300006195 Bacteria 5720
364 Ga0075366_10061854 3300006195 Bacteria 2226
365 Ga0075366_10123098 3300006195 Bacteria 1563
366 Ga0097621_100009497 3300006237 Bacteria 7062
367 Ga0097621_100009981 3300006237 Bacteria 6920
368 Ga0097621_100038502 3300006237 Bacteria 3837
369 Ga0097621_100039883 3300006237 Bacteria 3773
370 Ga0097621_100069465 3300006237 Bacteria 2908
371 Ga0097621_100071592 3300006237 Bacteria 2865
372 Ga0097621_100303580 3300006237 Bacteria 1410
373 Ga0097621_100350519 3300006237 Bacteria 1313
374 Ga0075370_10000547 3300006353 Bacteria 14418
375 Ga0075370_10010371 3300006353 Bacteria 4870
376 Ga0075370_10010601 3300006353 Bacteria 4827
377 Ga0075370_10023495 3300006353 Bacteria 3396
378 Ga0068871_100003477 3300006358 Bacteria 10822
379 Ga0068871_100007404 3300006358 Bacteria 7838
380 Ga0068871_100014944 3300006358 Bacteria 5803
381 Ga0068871_100063179 3300006358 Bacteria 3027
382 Ga0068871_100097689 3300006358 Bacteria 2455
383 Ga0068871_100099589 3300006358 Bacteria 2433
384 Ga0068871_100178021 3300006358 Bacteria 1826
385 Ga0075434_100025677 3300006871 Bacteria 5765
386 Ga0075429_100000199 3300006880 Bacteria 39995
387 Ga0075429_100043639 3300006880 Bacteria 3902
388 Ga0068865_100002420 3300006881 Bacteria 11023
389 Ga0068865_100020119 3300006881 Bacteria 4328
390 Ga0075436_100018851 3300006914 Bacteria 4725
391 Ga0097620_100001759 3300006931 Bacteria 22061
392 Ga0097620_100002838 3300006931 Bacteria 17576
393 Ga0097620_100010805 3300006931 Bacteria 9191
394 Ga0097620_100036302 3300006931 Bacteria 4948
395 Ga0097620_100046656 3300006931 Bacteria 4350
396 Ga0097620_100342816 3300006931 Bacteria 1588
397 Ga0099824_1027880 3300006942 Bacteria 2652
398 Ga0099823_1000108 3300006944 Bacteria 41193
399 Ga0079104_1000037 3300006946 Bacteria 189207
400 Ga0079104_1000206 3300006946 Bacteria 82424
401 Ga0099826_10006960 3300006948 Bacteria 8290
402 Ga0075435_100032473 3300007076 Bacteria 4123
403 Ga0105244_10010566 3300009036 Bacteria 5590
404 Ga0105250_10000294 3300009092 Bacteria 39500
405 Ga0105240_10012066 3300009093 Bacteria 11973
406 Ga0105240_10012882 3300009093 Bacteria 11516
407 Ga0105240_10031744 3300009093 Bacteria 6845
408 Ga0105240_10047500 3300009093 Bacteria 5432
409 Ga0105240_10051763 3300009093 Bacteria 5166
410 Ga0105240_10109992 3300009093 Bacteria 3336
411 Ga0105240_10316966 3300009093 Bacteria 1778
412 Ga0111539_10048149 3300009094 Bacteria 5091
413 Ga0111539_10144488 3300009094 Bacteria 2785
414 Ga0105245_10060559 3300009098 Bacteria 3409
415 Ga0105245_10347878 3300009098 Bacteria 1468
416 Ga0105245_10377880 3300009098 Bacteria 1410
417 Ga0105245_10387134 3300009098 Bacteria 1394
418 Ga0105243_10001108 3300009148 Bacteria 24452
419 Ga0105243_10001868 3300009148 Bacteria 17976
420 Ga0105243_10093394 3300009148 Bacteria 2483
421 Ga0105243_10120540 3300009148 Bacteria 2210
422 Ga0105243_10158622 3300009148 Bacteria 1948
423 Ga0105243_10385206 3300009148 Bacteria 1298
424 Ga0105241_10004716 3300009174 Bacteria 10056
425 Ga0105241_10069834 3300009174 Bacteria 2724
426 Ga0105241_10256939 3300009174 Bacteria 1483
427 Ga0105242_10011479 3300009176 Bacteria 6811
428 Ga0105242_10030183 3300009176 Bacteria 4328
429 Ga0105242_10049864 3300009176 Bacteria 3408
430 Ga0105242_10121374 3300009176 Bacteria 2243
431 Ga0105242_10340321 3300009176 Bacteria 1382
432 Ga0105248_10000507 3300009177 Bacteria 44310
433 Ga0105248_10006109 3300009177 Bacteria 13214
434 Ga0105248_10007313 3300009177 Bacteria 12115
435 Ga0105248_10061200 3300009177 Bacteria 4227
436 Ga0105248_10119810 3300009177 Bacteria 2968
437 Ga0105248_10160069 3300009177 Bacteria 2540
438 Ga0105237_10003214 3300009545 Bacteria 19566
439 Ga0105237_10066737 3300009545 Bacteria 3592
440 Ga0105237_10181937 3300009545 Bacteria 2102
441 Ga0105237_10389713 3300009545 Bacteria 1398
442 Ga0105238_10000817 3300009551 Bacteria 32236
443 Ga0105238_10018524 3300009551 Bacteria 7086
444 Ga0105238_10018739 3300009551 Bacteria 7049
445 Ga0105238_10083247 3300009551 Bacteria 3189
446 Ga0105238_10145997 3300009551 Bacteria 2342
447 Ga0105238_10180779 3300009551 Bacteria 2086
448 Ga0105249_10024640 3300009553 Bacteria 5408
449 Ga0105249_10099872 3300009553 Bacteria 2728
450 Ga0105249_10249714 3300009553 Bacteria 1758
451 Ga0105239_10003443 3300010375 Bacteria 19378
452 Ga0105239_10024436 3300010375 Bacteria 6658
453 Ga0105239_10038542 3300010375 Bacteria 5237
454 Ga0105239_10051729 3300010375 Bacteria 4503
455 Ga0105239_10097148 3300010375 Bacteria 3255
456 Ga0105239_10259343 3300010375 Bacteria 1953
457 Ga0105246_10057554 3300011119 Bacteria 2690
458 Ga0157319_1000008 3300012497 Bacteria 315600
459 Ga0157347_1001428 3300012502 Bacteria 1871
460 Ga0157373_10004823 3300013100 Bacteria 10150
461 Ga0157373_10008907 3300013100 Bacteria 7426
462 Ga0157371_10007668 3300013102 Bacteria 8693
463 Ga0157370_10008735 3300013104 Bacteria 10897
464 Ga0157370_10032452 3300013104 Bacteria 5100
465 Ga0157370_10311775 3300013104 Bacteria 1452
466 Ga0157369_10007682 3300013105 Bacteria 12405
467 Ga0157369_10018375 3300013105 Bacteria 7840
468 Ga0157369_10021429 3300013105 Bacteria 7230
469 Ga0157369_10026832 3300013105 Bacteria 6387
470 Ga0157374_10000405 3300013296 Bacteria 39195
471 Ga0157374_10020758 3300013296 Bacteria 5832
472 Ga0157374_10078208 3300013296 Bacteria 3132
473 Ga0157374_10144974 3300013296 Bacteria 2306
474 Ga0157374_10167221 3300013296 Bacteria 2144
475 Ga0157374_10334116 3300013296 Bacteria 1503
476 Ga0157378_10008627 3300013297 Bacteria 8870
477 Ga0157378_10087901 3300013297 Bacteria 2820
478 Ga0163162_10002118 3300013306 Bacteria 18641
479 Ga0163162_10004629 3300013306 Bacteria 13259
480 Ga0163162_10020602 3300013306 Bacteria 6479
481 Ga0163162_10026350 3300013306 Bacteria 5746
482 Ga0163162_10048256 3300013306 Bacteria 4266
483 Ga0163162_10100914 3300013306 Bacteria 2978
484 Ga0163162_10113345 3300013306 Bacteria 2810
485 Ga0163162_10182405 3300013306 Bacteria 2225
486 Ga0163162_10219221 3300013306 Bacteria 2032
487 Ga0157372_10010109 3300013307 Bacteria 10024
488 Ga0157372_10015837 3300013307 Bacteria 8089
489 Ga0157372_10189038 3300013307 Bacteria 2385
490 Ga0157375_10007074 3300013308 Bacteria 9797
491 Ga0157375_10057331 3300013308 Bacteria 3849
492 Ga0157375_10488018 3300013308 Bacteria 1397
493 Ga0163163_10020056 3300014325 Bacteria 6291
494 Ga0157380_10026083 3300014326 Bacteria 4436
495 Ga0182008_10013362 3300014497 Bacteria 4317
496 Ga0182008_10048302 3300014497 Bacteria 2113
497 Ga0157377_10000075 3300014745 Bacteria 76405
498 Ga0157377_10044154 3300014745 Bacteria 2484
499 Ga0157377_10115078 3300014745 Bacteria 1622
500 Ga0157379_10006796 3300014968 Bacteria 9889
501 Ga0157379_10012230 3300014968 Bacteria 7496
502 Ga0157379_10017154 3300014968 Bacteria 6377
503 Ga0157379_10154770 3300014968 Bacteria 2068
504 Ga0157376_10005741 3300014969 Bacteria 8692
505 Ga0157376_10067109 3300014969 Bacteria 3034
506 Ga0157376_10133207 3300014969 Bacteria 2221
507 Ga0157376_10198070 3300014969 Bacteria 1846
508 Ga0182006_1011518 3300015261 Bacteria 3890
509 Ga0182007_10003324 3300015262 Bacteria 7611
510 Ga0182007_10003382 3300015262 Bacteria 7517
511 Ga0182007_10005244 3300015262 Bacteria 5722
512 Ga0182005_1000283 3300015265 Bacteria 31970
513 Ga0182005_1010533 3300015265 Bacteria 2657
514 Ga0183362_10003 3300015683 Bacteria 977584
515 Ga0163161_10003044 3300017792 Bacteria 11837
516 Ga0163161_10011045 3300017792 Bacteria 6255
517 Ga0163161_10017948 3300017792 Bacteria 4959
518 Ga0163161_10066522 3300017792 Bacteria 2632
519 Ga0163161_10105089 3300017792 Bacteria 2106
520 Ga0163161_10132337 3300017792 Bacteria 1883
521 Ga0163161_10260705 3300017792 Bacteria 1354
522 Ga0213872_10000006 3300021361 Bacteria 249845
523 Ga0213872_10000007 3300021361 Bacteria 228206
524 Ga0213872_10000085 3300021361 Bacteria 85496
525 Ga0213872_10011538 3300021361 Bacteria 4179
526 Ga0209435_100003 3300025206 Bacteria 669534
527 Ga0209784_100049 3300025224 Bacteria 195512
528 Ga0209784_100083 3300025224 Bacteria 131194
529 Ga0209566_100061 3300025225 Bacteria 195512
530 Ga0209566_100102 3300025225 Bacteria 131194
531 Ga0209674_100041 3300025226 Bacteria 396231
532 Ga0209674_100069 3300025226 Bacteria 243948
533 Ga0209674_100125 3300025226 Bacteria 131194
534 Ga0209672_100490 3300025228 Bacteria 22033
535 Ga0209147_103153 3300025229 Bacteria 3404
536 Ga0209563_100043 3300025230 Bacteria 397271
537 Ga0209563_100083 3300025230 Bacteria 195512
538 Ga0209563_100120 3300025230 Bacteria 131194
539 Ga0207427_100345 3300025231 Bacteria 30030
540 Ga0207427_100646 3300025231 Bacteria 16896
541 Ga0209437_100091 3300025233 Bacteria 243344
542 Ga0209258_100132 3300025242 Bacteria 175292
543 Ga0209258_100344 3300025242 Bacteria 68131
544 Ga0209258_100785 3300025242 Bacteria 19212
545 Ga0207425_1000797 3300025245 Bacteria 16048
546 Ga0207425_1007126 3300025245 Bacteria 2986
547 Ga0209646_1000008 3300025246 Bacteria 669534
548 Ga0209646_1000069 3300025246 Bacteria 230340
549 Ga0209646_1000723 3300025246 Bacteria 11690
550 Ga0209026_1000006 3300025250 Bacteria 677225
551 Ga0209026_1000007 3300025250 Bacteria 669534
552 Ga0209026_1003125 3300025250 Bacteria 5640
553 Ga0209677_100039 3300025253 Bacteria 243974
554 Ga0209677_100076 3300025253 Bacteria 131194
555 Ga0209677_100096 3300025253 Bacteria 99089
556 Ga0209677_101194 3300025253 Bacteria 11889
557 Ga0209677_101643 3300025253 Bacteria 9404
558 Ga0209148_1000007 3300025254 Bacteria 1592273
559 Ga0209759_1000026 3300025256 Bacteria 311743
560 Ga0209759_1000075 3300025256 Bacteria 176235
561 Ga0209759_1001215 3300025256 Bacteria 15837
562 Ga0209759_1001295 3300025256 Bacteria 14863
563 Ga0209759_1017548 3300025256 Bacteria 1761
564 Ga0209129_1000012 3300025258 Bacteria 541516
565 Ga0209129_1000084 3300025258 Bacteria 182554
566 Ga0209233_1000115 3300025261 Bacteria 243344
567 Ga0209565_1000169 3300025263 Bacteria 84839
568 Ga0209565_1000932 3300025263 Bacteria 15416
569 Ga0209565_1001971 3300025263 Bacteria 8032
570 Ga0209565_1004734 3300025263 Bacteria 4083
571 Ga0209565_1008810 3300025263 Bacteria 2612
572 Ga0209455_1000242 3300025272 Bacteria 68131
573 Ga0209673_1000009 3300025273 Bacteria 620735
574 Ga0209673_1000012 3300025273 Bacteria 579480
575 Ga0209673_1000114 3300025273 Bacteria 178557
576 Ga0209673_1001414 3300025273 Bacteria 23194
577 Ga0209673_1003881 3300025273 Bacteria 8425
578 Ga0209673_1006922 3300025273 Bacteria 5363
579 Ga0209673_1010298 3300025273 Bacteria 3948
580 Ga0209673_1014476 3300025273 Bacteria 3050
581 Ga0209673_1020689 3300025273 Bacteria 2324
582 Ga0209130_1000064 3300025284 Bacteria 196568
583 Ga0209130_1000571 3300025284 Bacteria 36074
584 Ga0209130_1000712 3300025284 Bacteria 29562
585 Ga0209130_1002101 3300025284 Bacteria 10659
586 Ga0209130_1010938 3300025284 Bacteria 2463
587 Ga0209675_1000062 3300025291 Bacteria 178557
588 Ga0209675_1000144 3300025291 Bacteria 94908
589 Ga0209675_1001716 3300025291 Bacteria 12071
590 Ga0209675_1005868 3300025291 Bacteria 5042
591 Ga0209675_1006789 3300025291 Bacteria 4520
592 Ga0209676_1000051 3300025292 Bacteria 389016
593 Ga0209676_1000415 3300025292 Bacteria 76430
594 Ga0209676_1006391 3300025292 Bacteria 5830
595 Ga0209025_1000719 3300025294 Bacteria 56292
596 Ga0209025_1000861 3300025294 Bacteria 47942
597 Ga0209025_1003734 3300025294 Bacteria 13962
598 Ga0209025_1004082 3300025294 Bacteria 13026
599 Ga0209025_1010095 3300025294 Bacteria 6452
600 Ga0209025_1021688 3300025294 Bacteria 3446
601 Ga0209025_1026809 3300025294 Bacteria 2878
602 Ga0209564_1000008 3300025295 Bacteria 953227
603 Ga0209564_1000022 3300025295 Bacteria 555109
604 Ga0209564_1000414 3300025295 Bacteria 75224
605 Ga0209564_1000613 3300025295 Bacteria 55031
606 Ga0209564_1002503 3300025295 Bacteria 14283
607 Ga0209564_1002535 3300025295 Bacteria 14099
608 Ga0209564_1007735 3300025295 Bacteria 5468
609 Ga0209758_1000099 3300025297 Bacteria 230054
610 Ga0209758_1002249 3300025297 Bacteria 20036
611 Ga0209758_1009725 3300025297 Bacteria 5909
612 Ga0209050_1000044 3300025298 Bacteria 391114
613 Ga0209050_1000052 3300025298 Bacteria 351785
614 Ga0209050_1001274 3300025298 Bacteria 28926
615 Ga0209050_1001635 3300025298 Bacteria 22939
616 Ga0209050_1001761 3300025298 Bacteria 21453
617 Ga0209050_1001765 3300025298 Bacteria 21356
618 Ga0209050_1003656 3300025298 Bacteria 11112
619 Ga0209256_1000003 3300025299 Bacteria 1661127
620 Ga0209256_1000036 3300025299 Bacteria 386664
621 Ga0209256_1000206 3300025299 Bacteria 111425
622 Ga0209256_1000239 3300025299 Bacteria 97580
623 Ga0207426_1000049 3300025302 Bacteria 401954
624 Ga0207426_1000086 3300025302 Bacteria 292089
625 Ga0207426_1000116 3300025302 Bacteria 225245
626 Ga0207426_1000346 3300025302 Bacteria 85832
627 Ga0207426_1003514 3300025302 Bacteria 8431
628 Ga0209051_1000015 3300025303 Bacteria 546798
629 Ga0209051_1000025 3300025303 Bacteria 415397
630 Ga0209051_1000031 3300025303 Bacteria 391114
631 Ga0209051_1000071 3300025303 Bacteria 210843
632 Ga0209051_1000420 3300025303 Bacteria 58383
633 Ga0209051_1000492 3300025303 Bacteria 51006
634 Ga0209051_1000752 3300025303 Bacteria 34790
635 Ga0209051_1001081 3300025303 Bacteria 25280
636 Ga0209051_1001319 3300025303 Bacteria 21686
637 Ga0209051_1002112 3300025303 Bacteria 14864
638 Ga0209051_1007962 3300025303 Bacteria 5700
639 Ga0209051_1019510 3300025303 Bacteria 2955
640 Ga0209051_1026024 3300025303 Bacteria 2368
641 Ga0209257_1000033 3300025304 Bacteria 671006
642 Ga0209257_1000037 3300025304 Bacteria 612915
643 Ga0209257_1000039 3300025304 Bacteria 591694
644 Ga0209257_1000058 3300025304 Bacteria 381686
645 Ga0209257_1000367 3300025304 Bacteria 91077
646 Ga0209257_1000719 3300025304 Bacteria 50884
647 Ga0209257_1031541 3300025304 Bacteria 1693
648 Ga0207697_10000580 3300025315 Bacteria 20841
649 Ga0207697_10004433 3300025315 Bacteria 6709
650 Ga0207697_10009395 3300025315 Bacteria 4226
651 Ga0207656_10007059 3300025321 Bacteria 4078
652 Ga0207656_10080061 3300025321 Bacteria 1466
653 Ga0207696_1001482 3300025711 Bacteria 12690
654 Ga0207655_1000477 3300025728 Bacteria 51677
655 Ga0207682_10000010 3300025893 Bacteria 85697
656 Ga0207682_10002075 3300025893 Bacteria 9079
657 Ga0207682_10002877 3300025893 Bacteria 7600
658 Ga0207682_10018734 3300025893 Bacteria 2708
659 Ga0207682_10020527 3300025893 Bacteria 2594
660 Ga0207642_10124474 3300025899 Bacteria 1335
661 Ga0207688_10000541 3300025901 Bacteria 18381
662 Ga0207688_10084320 3300025901 Bacteria 1819
663 Ga0207688_10147645 3300025901 Bacteria 1387
664 Ga0207680_10007194 3300025903 Bacteria 5411
665 Ga0207680_10017182 3300025903 Bacteria 3817
666 Ga0207680_10019704 3300025903 Bacteria 3613
667 Ga0207680_10108021 3300025903 Bacteria 1799
668 Ga0207685_10008993 3300025905 Bacteria 2880
669 Ga0207699_10106162 3300025906 Bacteria 1792
670 Ga0207645_10001138 3300025907 Bacteria 21981
671 Ga0207645_10002795 3300025907 Bacteria 13587
672 Ga0207645_10010204 3300025907 Bacteria 6456
673 Ga0207645_10020426 3300025907 Bacteria 4336
674 Ga0207645_10027702 3300025907 Bacteria 3658
675 Ga0207645_10041651 3300025907 Bacteria 2939
676 Ga0207645_10074755 3300025907 Bacteria 2169
677 Ga0207643_10000358 3300025908 Bacteria 30599
678 Ga0207643_10045783 3300025908 Bacteria 2471
679 Ga0207643_10068770 3300025908 Bacteria 2035
680 Ga0207705_10046815 3300025909 Bacteria 3109
681 Ga0207705_10062003 3300025909 Bacteria 2701
682 Ga0207684_10003773 3300025910 Bacteria 14639
683 Ga0207654_10014797 3300025911 Bacteria 4038
684 Ga0207707_10032526 3300025912 Bacteria 4565
685 Ga0207707_10050800 3300025912 Bacteria 3611
686 Ga0207707_10069151 3300025912 Bacteria 3077
687 Ga0207707_10220456 3300025912 Bacteria 1651
688 Ga0207695_10013680 3300025913 Bacteria 9661
689 Ga0207695_10080597 3300025913 Bacteria 3296
690 Ga0207695_10121591 3300025913 Bacteria 2578
691 Ga0207695_10184912 3300025913 Bacteria 2003
692 Ga0207671_10002520 3300025914 Bacteria 19532
693 Ga0207671_10017480 3300025914 Bacteria 5527
694 Ga0207693_10002709 3300025915 Bacteria 15353
695 Ga0207693_10156306 3300025915 Bacteria 1793
696 Ga0207660_10120102 3300025917 Bacteria 1989
697 Ga0207662_10012419 3300025918 Bacteria 4743
698 Ga0207657_10000329 3300025919 Bacteria 50461
699 Ga0207657_10003889 3300025919 Bacteria 15849
700 Ga0207657_10029367 3300025919 Bacteria 5006
701 Ga0207657_10041771 3300025919 Bacteria 4052
702 Ga0207657_10069270 3300025919 Bacteria 2994
703 Ga0207657_10103581 3300025919 Bacteria 2359
704 Ga0207657_10140586 3300025919 Bacteria 1973
705 Ga0207649_10003489 3300025920 Bacteria 8589
706 Ga0207649_10040363 3300025920 Bacteria 2836
707 Ga0207652_10083435 3300025921 Bacteria 2798
708 Ga0207652_10140993 3300025921 Bacteria 2155
709 Ga0207652_10143688 3300025921 Bacteria 2134
710 Ga0207681_10000593 3300025923 Bacteria 24630
711 Ga0207681_10003975 3300025923 Bacteria 9166
712 Ga0207681_10005852 3300025923 Bacteria 7537
713 Ga0207681_10011148 3300025923 Bacteria 5519
714 Ga0207681_10023399 3300025923 Bacteria 3951
715 Ga0207681_10050755 3300025923 Bacteria 2807
716 Ga0207681_10193381 3300025923 Bacteria 1558
717 Ga0207681_10221012 3300025923 Bacteria 1465
718 Ga0207694_10001061 3300025924 Bacteria 23914
719 Ga0207694_10001640 3300025924 Bacteria 18831
720 Ga0207694_10015585 3300025924 Bacteria 5732
721 Ga0207694_10053926 3300025924 Bacteria 3119
722 Ga0207694_10112853 3300025924 Bacteria 2163
723 Ga0207694_10305178 3300025924 Bacteria 1311
724 Ga0207650_10001551 3300025925 Bacteria 16459
725 Ga0207650_10002902 3300025925 Bacteria 11833
726 Ga0207650_10046033 3300025925 Bacteria 3211
727 Ga0207650_10058264 3300025925 Bacteria 2875
728 Ga0207650_10059741 3300025925 Bacteria 2843
729 Ga0207650_10071603 3300025925 Bacteria 2608
730 Ga0207650_10087964 3300025925 Bacteria 2368
731 Ga0207650_10136531 3300025925 Bacteria 1924
732 Ga0207659_10001370 3300025926 Bacteria 14544
733 Ga0207659_10002674 3300025926 Bacteria 10616
734 Ga0207659_10008500 3300025926 Bacteria 6378
735 Ga0207659_10010170 3300025926 Bacteria 5900
736 Ga0207659_10027013 3300025926 Bacteria 3881
737 Ga0207659_10045626 3300025926 Bacteria 3091
738 Ga0207659_10082147 3300025926 Bacteria 2385
739 Ga0207659_10084837 3300025926 Bacteria 2351
740 Ga0207659_10102409 3300025926 Bacteria 2161
741 Ga0207687_10011753 3300025927 Bacteria 5729
742 Ga0207687_10040982 3300025927 Bacteria 3177
743 Ga0207700_10001214 3300025928 Bacteria 14768
744 Ga0207700_10004270 3300025928 Bacteria 8400
745 Ga0207700_10237960 3300025928 Bacteria 1551
746 Ga0207664_10014950 3300025929 Bacteria 5619
747 Ga0207664_10085161 3300025929 Bacteria 2579
748 Ga0207644_10001724 3300025931 Bacteria 14137
749 Ga0207644_10002626 3300025931 Bacteria 11570
750 Ga0207644_10004468 3300025931 Bacteria 9081
751 Ga0207644_10006053 3300025931 Bacteria 7890
752 Ga0207644_10011045 3300025931 Bacteria 5966
753 Ga0207644_10017863 3300025931 Bacteria 4797
754 Ga0207644_10018741 3300025931 Bacteria 4686
755 Ga0207644_10022596 3300025931 Bacteria 4299
756 Ga0207644_10023348 3300025931 Bacteria 4235
757 Ga0207644_10049843 3300025931 Bacteria 2999
758 Ga0207644_10092516 3300025931 Bacteria 2256
759 Ga0207690_10005743 3300025932 Bacteria 7333
760 Ga0207690_10012599 3300025932 Bacteria 5063
761 Ga0207690_10014780 3300025932 Bacteria 4722
762 Ga0207690_10169038 3300025932 Bacteria 1636
763 Ga0207690_10187930 3300025932 Bacteria 1560
764 Ga0207706_10000133 3300025933 Bacteria 80935
765 Ga0207706_10007037 3300025933 Bacteria 10399
766 Ga0207706_10008413 3300025933 Bacteria 9520
767 Ga0207706_10011997 3300025933 Bacteria 7894
768 Ga0207706_10086080 3300025933 Bacteria 2763
769 Ga0207686_10000211 3300025934 Bacteria 44316
770 Ga0207686_10002504 3300025934 Bacteria 9978
771 Ga0207686_10095325 3300025934 Bacteria 1974
772 Ga0207686_10148630 3300025934 Bacteria 1628
773 Ga0207709_10000167 3300025935 Bacteria 88877
774 Ga0207709_10000625 3300025935 Bacteria 29011
775 Ga0207709_10002678 3300025935 Bacteria 11037
776 Ga0207709_10003407 3300025935 Bacteria 9496
777 Ga0207709_10078818 3300025935 Bacteria 2116
778 Ga0207709_10115924 3300025935 Bacteria 1800
779 Ga0207670_10012185 3300025936 Bacteria 5020
780 Ga0207670_10035827 3300025936 Bacteria 3222
781 Ga0207669_10008328 3300025937 Bacteria 4860
782 Ga0207669_10064387 3300025937 Bacteria 2268
783 Ga0207669_10126415 3300025937 Bacteria 1747
784 Ga0207704_10008529 3300025938 Bacteria 4908
785 Ga0207704_10012485 3300025938 Bacteria 4216
786 Ga0207704_10029819 3300025938 Bacteria 3049
787 Ga0207665_10054137 3300025939 Bacteria 2705
788 Ga0207691_10000027 3300025940 Bacteria 126502
789 Ga0207691_10001454 3300025940 Bacteria 23591
790 Ga0207691_10001835 3300025940 Bacteria 20763
791 Ga0207691_10002573 3300025940 Bacteria 17728
792 Ga0207691_10002901 3300025940 Bacteria 16713
793 Ga0207691_10004579 3300025940 Bacteria 13389
794 Ga0207691_10007782 3300025940 Bacteria 10318
795 Ga0207691_10020289 3300025940 Bacteria 6284
796 Ga0207691_10057597 3300025940 Bacteria 3536
797 Ga0207691_10145691 3300025940 Bacteria 2085
798 Ga0207711_10000116 3300025941 Bacteria 83390
799 Ga0207711_10008341 3300025941 Bacteria 8672
800 Ga0207711_10053069 3300025941 Bacteria 3476
801 Ga0207711_10082785 3300025941 Bacteria 2806
802 Ga0207711_10114324 3300025941 Bacteria 2403
803 Ga0207711_10164693 3300025941 Bacteria 2009
804 Ga0207711_10259025 3300025941 Bacteria 1598
805 Ga0207711_10359702 3300025941 Bacteria 1348
806 Ga0207689_10001624 3300025942 Bacteria 21289
807 Ga0207689_10003361 3300025942 Bacteria 14643
808 Ga0207689_10017053 3300025942 Bacteria 6144
809 Ga0207689_10017399 3300025942 Bacteria 6084
810 Ga0207689_10018716 3300025942 Bacteria 5840
811 Ga0207689_10028908 3300025942 Bacteria 4634
812 Ga0207689_10039845 3300025942 Bacteria 3889
813 Ga0207689_10074386 3300025942 Bacteria 2791
814 Ga0207661_10006951 3300025944 Bacteria 8023
815 Ga0207661_10105552 3300025944 Bacteria 2374
816 Ga0207661_10107900 3300025944 Bacteria 2349
817 Ga0207661_10185692 3300025944 Bacteria 1819
818 Ga0207679_10004476 3300025945 Bacteria 8711
819 Ga0207679_10016114 3300025945 Bacteria 4958
820 Ga0207679_10037529 3300025945 Bacteria 3444
821 Ga0207679_10038046 3300025945 Bacteria 3425
822 Ga0207679_10045174 3300025945 Bacteria 3184
823 Ga0207679_10085817 3300025945 Bacteria 2419
824 Ga0207667_10001197 3300025949 Bacteria 32520
825 Ga0207667_10015903 3300025949 Bacteria 8521
826 Ga0207667_10027706 3300025949 Bacteria 6163
827 Ga0207667_10044540 3300025949 Bacteria 4701
828 Ga0207667_10050611 3300025949 Bacteria 4383
829 Ga0207667_10056478 3300025949 Bacteria 4124
830 Ga0207667_10060239 3300025949 Bacteria 3973
831 Ga0207667_10093968 3300025949 Bacteria 3096
832 Ga0207667_10127343 3300025949 Bacteria 2623
833 Ga0207667_10176472 3300025949 Bacteria 2195
834 Ga0207667_10189509 3300025949 Bacteria 2110
835 Ga0207651_10014005 3300025960 Bacteria 4615
836 Ga0207651_10023081 3300025960 Bacteria 3818
837 Ga0207651_10028463 3300025960 Bacteria 3525
838 Ga0207651_10113559 3300025960 Bacteria 2038
839 Ga0207651_10178666 3300025960 Bacteria 1681
840 Ga0207712_10002369 3300025961 Bacteria 12212
841 Ga0207712_10091176 3300025961 Bacteria 2244
842 Ga0207668_10014276 3300025972 Bacteria 4914
843 Ga0207668_10109124 3300025972 Bacteria 2072
844 Ga0207640_10002943 3300025981 Bacteria 9159
845 Ga0207640_10028299 3300025981 Bacteria 3425
846 Ga0207640_10042960 3300025981 Bacteria 2885
847 Ga0207658_10002879 3300025986 Bacteria 12329
848 Ga0207658_10018099 3300025986 Bacteria 4860
849 Ga0207658_10025597 3300025986 Bacteria 4132
850 Ga0207658_10029188 3300025986 Bacteria 3892
851 Ga0207658_10029755 3300025986 Bacteria 3861
852 Ga0207677_10000188 3300026023 Bacteria 49751
853 Ga0207677_10002710 3300026023 Bacteria 9339
854 Ga0207677_10002992 3300026023 Bacteria 8924
855 Ga0207677_10009054 3300026023 Bacteria 5587
856 Ga0207677_10029670 3300026023 Bacteria 3480
857 Ga0207677_10032646 3300026023 Bacteria 3349
858 Ga0207677_10040742 3300026023 Bacteria 3065
859 Ga0207703_10000806 3300026035 Bacteria 30873
860 Ga0207703_10003131 3300026035 Bacteria 13968
861 Ga0207703_10005198 3300026035 Bacteria 10519
862 Ga0207703_10031777 3300026035 Bacteria 4176
863 Ga0207703_10058280 3300026035 Bacteria 3151
864 Ga0207703_10069127 3300026035 Bacteria 2911
865 Ga0207703_10114082 3300026035 Bacteria 2310
866 Ga0207703_10137353 3300026035 Bacteria 2117
867 Ga0207639_10007106 3300026041 Bacteria 7636
868 Ga0207639_10026653 3300026041 Bacteria 4200
869 Ga0207639_10273666 3300026041 Bacteria 1482
870 Ga0207678_10001503 3300026067 Bacteria 21358
871 Ga0207678_10002200 3300026067 Bacteria 17609
872 Ga0207678_10005364 3300026067 Bacteria 11483
873 Ga0207678_10052057 3300026067 Bacteria 3533
874 Ga0207678_10149293 3300026067 Bacteria 1995
875 Ga0207708_10002089 3300026075 Bacteria 14696
876 Ga0207708_10038327 3300026075 Bacteria 3651
877 Ga0207708_10044769 3300026075 Bacteria 3372
878 Ga0207708_10054734 3300026075 Bacteria 3042
879 Ga0207702_10000305 3300026078 Bacteria 56491
880 Ga0207702_10054890 3300026078 Bacteria 3377
881 Ga0207702_10125097 3300026078 Bacteria 2307
882 Ga0207702_10245474 3300026078 Bacteria 1679
883 Ga0207641_10006528 3300026088 Bacteria 9811
884 Ga0207641_10009569 3300026088 Bacteria 7984
885 Ga0207641_10024259 3300026088 Bacteria 5000
886 Ga0207641_10033560 3300026088 Bacteria 4263
887 Ga0207641_10034850 3300026088 Bacteria 4189
888 Ga0207641_10038820 3300026088 Bacteria 3981
889 Ga0207641_10051462 3300026088 Bacteria 3488
890 Ga0207641_10054343 3300026088 Bacteria 3397
891 Ga0207641_10122259 3300026088 Bacteria 2325
892 Ga0207641_10135260 3300026088 Bacteria 2218
893 Ga0207648_10000286 3300026089 Bacteria 54985
894 Ga0207648_10000878 3300026089 Bacteria 33868
895 Ga0207648_10002947 3300026089 Bacteria 18012
896 Ga0207648_10008332 3300026089 Bacteria 10058
897 Ga0207648_10019878 3300026089 Bacteria 6061
898 Ga0207648_10051982 3300026089 Bacteria 3582
899 Ga0207648_10166579 3300026089 Bacteria 1947
900 Ga0207676_10000230 3300026095 Bacteria 48620
901 Ga0207676_10003281 3300026095 Bacteria 11501
902 Ga0207676_10004989 3300026095 Bacteria 9400
903 Ga0207676_10012098 3300026095 Bacteria 6176
904 Ga0207676_10017798 3300026095 Bacteria 5156
905 Ga0207676_10026039 3300026095 Bacteria 4345
906 Ga0207676_10036862 3300026095 Bacteria 3722
907 Ga0207676_10041475 3300026095 Bacteria 3533
908 Ga0207676_10082562 3300026095 Bacteria 2614
909 Ga0207676_10230458 3300026095 Bacteria 1655
910 Ga0207674_10000182 3300026116 Bacteria 77228
911 Ga0207674_10001017 3300026116 Bacteria 36653
912 Ga0207674_10001136 3300026116 Bacteria 34556
913 Ga0207674_10006862 3300026116 Bacteria 13352
914 Ga0207674_10034160 3300026116 Bacteria 5319
915 Ga0207674_10053331 3300026116 Bacteria 4122
916 Ga0207674_10160967 3300026116 Bacteria 2199
917 Ga0207674_10224317 3300026116 Bacteria 1828
918 Ga0207675_100001247 3300026118 Bacteria 25352
919 Ga0207675_100001372 3300026118 Bacteria 24404
920 Ga0207675_100001900 3300026118 Bacteria 20834
921 Ga0207675_100008217 3300026118 Bacteria 9835
922 Ga0207683_10000285 3300026121 Bacteria 45347
923 Ga0207683_10000364 3300026121 Bacteria 41505
924 Ga0207683_10004747 3300026121 Bacteria 11712
925 Ga0207683_10013264 3300026121 Bacteria 7026
926 Ga0207683_10013981 3300026121 Bacteria 6844
927 Ga0207683_10014056 3300026121 Bacteria 6824
928 Ga0207683_10020604 3300026121 Bacteria 5643
929 Ga0207683_10120473 3300026121 Bacteria 2355
930 Ga0207683_10128511 3300026121 Bacteria 2278
931 Ga0207698_10003503 3300026142 Bacteria 9463
932 Ga0207698_10013855 3300026142 Bacteria 5338
933 Ga0207698_10015518 3300026142 Bacteria 5102
934 Ga0207698_10041103 3300026142 Bacteria 3442
935 Ga0207698_10062786 3300026142 Bacteria 2903
936 Ga0207698_10132975 3300026142 Bacteria 2129
937 Ga0207698_10208567 3300026142 Bacteria 1756
938 Ga0209281_1000002 3300027111 Bacteria 1924012
939 Ga0209281_1000259 3300027111 Bacteria 101905
940 Ga0209389_1006219 3300027296 Bacteria 10334
941 Ga0209371_1014178 3300027312 Bacteria 2196
942 Ga0209996_1005277 3300027395 Bacteria 1655
943 Ga0209282_1000317 3300027666 Bacteria 23915
944 Ga0209971_1001210 3300027682 Bacteria 6480
945 Ga0209966_1000035 3300027695 Bacteria 56067
946 Ga0209998_10001388 3300027717 Bacteria 5875
947 Ga0209998_10011946 3300027717 Bacteria 1803
948 Ga0209813_10014738 3300027866 Bacteria 2109
949 Ga0209813_10018634 3300027866 Bacteria 1921
950 Ga0209974_10004147 3300027876 Bacteria 5179
951 Ga0209974_10019845 3300027876 Bacteria 2228
952 Ga0207428_10045043 3300027907 Bacteria 3556
953 Ga0268266_10008958 3300028379 Bacteria 8858
954 Ga0268266_10020764 3300028379 Bacteria 5599
955 Ga0268266_10023758 3300028379 Bacteria 5217
956 Ga0268266_10043406 3300028379 Bacteria 3842
957 Ga0268266_10159448 3300028379 Bacteria 2040
958 Ga0268266_10322131 3300028379 Bacteria 1447
959 Ga0268265_10046444 3300028380 Bacteria 3246
960 Ga0268265_10047325 3300028380 Bacteria 3222
961 Ga0268265_10057047 3300028380 Bacteria 2975
962 Ga0268265_10082425 3300028380 Bacteria 2543
963 Ga0268265_10152394 3300028380 Bacteria 1951
964 Ga0268265_10274078 3300028380 Bacteria 1506
965 Ga0268264_10000991 3300028381 Bacteria 28937
966 Ga0268264_10004628 3300028381 Bacteria 11687
967 Ga0268264_10010909 3300028381 Bacteria 7507
968 Ga0268264_10021947 3300028381 Bacteria 5210
969 Ga0268264_10025537 3300028381 Bacteria 4827
970 Ga0268264_10037013 3300028381 Bacteria 4021
971 Ga0268264_10064516 3300028381 Bacteria 3083
972 Ga0268264_10103146 3300028381 Bacteria 2483
973 Ga0268264_10105798 3300028381 Bacteria 2455
974 Ga0268264_10174016 3300028381 Bacteria 1949
975 Ga0265318_10001780 3300028577 Bacteria 12251
976 Ga0265336_10000013 3300028666 Bacteria 252156
977 Ga0307517_10000131 3300028786 Bacteria 113233
978 Ga0307515_10000011 3300028794 Bacteria 633903
979 Ga0307515_10000278 3300028794 Bacteria 125493
980 Ga0307515_10006352 3300028794 Bacteria 23656
981 Ga0307515_10011457 3300028794 Bacteria 16831
982 Ga0307515_10021920 3300028794 Bacteria 11296
983 Ga0307515_10028588 3300028794 Bacteria 9473
984 Ga0307515_10031517 3300028794 Bacteria 8835
985 Ga0307515_10090935 3300028794 Bacteria 3821
986 Ga0307515_10164629 3300028794 Bacteria 2242
987 Ga0307515_10251319 3300028794 Bacteria 1520
988 Ga0265324_10000193 3300029957 Bacteria 46981
989 Ga0265324_10004037 3300029957 Bacteria 6754
990 Ga0265324_10016187 3300029957 Bacteria 2729
991 Ga0268256_1007804 3300030500 Bacteria 3757
992 Ga0307511_10000005 3300030521 Bacteria 175482
993 Ga0316178_1005545 3300030735 Bacteria 6731
994 Ga0316180_1104723 3300030736 Bacteria 4397
995 Ga0265330_10000453 3300031235 Bacteria 27395
996 Ga0265330_10008628 3300031235 Bacteria 4896
997 Ga0265330_10020098 3300031235 Bacteria 3053
998 Ga0265332_10000012 3300031238 Bacteria 272641
999 Ga0265332_10000023 3300031238 Bacteria 211994
1000 Ga0265332_10001062 3300031238 Bacteria 16076
1001 Ga0265332_10001273 3300031238 Bacteria 14416
1002 Ga0265328_10002854 3300031239 Bacteria 7710
1003 Ga0265328_10011609 3300031239 Bacteria 3515
1004 Ga0265328_10027544 3300031239 Bacteria 2130
1005 Ga0265320_10022099 3300031240 Bacteria 3409
1006 Ga0265325_10001423 3300031241 Bacteria 16843
1007 Ga0265325_10007863 3300031241 Bacteria 6349
1008 Ga0265325_10022015 3300031241 Bacteria 3495
1009 Ga0265331_10001106 3300031250 Bacteria 20759
1010 Ga0265331_10001808 3300031250 Bacteria 15180
1011 Ga0265331_10001901 3300031250 Bacteria 14645
1012 Ga0265331_10006454 3300031250 Bacteria 6931
1013 Ga0265331_10011274 3300031250 Bacteria 4901
1014 Ga0265327_10000739 3300031251 Bacteria 51006
1015 Ga0265327_10001019 3300031251 Bacteria 39618
1016 Ga0265327_10004111 3300031251 Bacteria 13145
1017 Ga0265327_10004241 3300031251 Bacteria 12854
1018 Ga0265327_10005562 3300031251 Bacteria 10464
1019 Ga0265327_10005649 3300031251 Bacteria 10353
1020 Ga0265327_10022584 3300031251 Bacteria 3754
1021 Ga0265316_10000163 3300031344 Bacteria 74936
1022 Ga0265316_10081684 3300031344 Bacteria 2477
1023 Ga0307513_10000008 3300031456 Bacteria 442128
1024 Ga0307513_10000441 3300031456 Bacteria 59706
1025 Ga0307513_10012177 3300031456 Bacteria 10637
1026 Ga0307513_10019501 3300031456 Bacteria 8074
1027 Ga0307513_10113375 3300031456 Bacteria 2699
1028 Ga0307513_10124753 3300031456 Bacteria 2533
1029 Ga0307513_10172706 3300031456 Bacteria 2037
1030 Ga0307513_10186640 3300031456 Bacteria 1930
1031 Ga0307509_10000871 3300031507 Bacteria 52060
1032 Ga0307509_10016221 3300031507 Bacteria 8629
1033 Ga0307509_10165755 3300031507 Bacteria 2099
1034 Ga0307408_100000037 3300031548 Bacteria 187096
1035 Ga0307408_100000274 3300031548 Bacteria 51724
1036 Ga0307408_100005562 3300031548 Bacteria 8421
1037 Ga0307408_100014029 3300031548 Bacteria 5324
1038 Ga0307408_100043906 3300031548 Bacteria 3182
1039 Ga0307408_100146028 3300031548 Bacteria 1862
1040 Ga0307408_100158686 3300031548 Bacteria 1794
1041 Ga0265313_10054342 3300031595 Bacteria 1902
1042 Ga0307508_10000271 3300031616 Bacteria 63576
1043 Ga0307508_10000349 3300031616 Bacteria 56002
1044 Ga0307508_10262896 3300031616 Bacteria 1320
1045 Ga0307514_10000355 3300031649 Bacteria 106758
1046 Ga0307514_10000694 3300031649 Bacteria 59136
1047 Ga0307514_10011790 3300031649 Bacteria 7272
1048 Ga0316575_10011177 3300031665 Bacteria 3317
1049 Ga0265314_10000029 3300031711 Bacteria 272506
1050 Ga0265314_10000980 3300031711 Bacteria 33564
1051 Ga0265314_10003171 3300031711 Bacteria 16108
1052 Ga0265314_10014048 3300031711 Bacteria 6433
1053 Ga0265314_10046085 3300031711 Bacteria 3078
1054 Ga0265342_10004652 3300031712 Bacteria 10684
1055 Ga0265342_10013416 3300031712 Bacteria 5498
1056 Ga0316576_10002160 3300031727 Bacteria 11089
1057 Ga0307516_10001568 3300031730 Bacteria 31474
1058 Ga0307516_10001850 3300031730 Bacteria 29022
1059 Ga0307516_10004281 3300031730 Bacteria 17723
1060 Ga0307516_10004605 3300031730 Bacteria 16911
1061 Ga0307516_10004611 3300031730 Bacteria 16906
1062 Ga0307516_10054561 3300031730 Bacteria 3904
1063 Ga0307516_10082496 3300031730 Bacteria 3057
1064 Ga0307405_10016757 3300031731 Bacteria 4003
1065 Ga0307405_10033413 3300031731 Bacteria 3050
1066 Ga0307405_10095712 3300031731 Bacteria 1978
1067 Ga0307410_10020431 3300031852 Bacteria 4050
1068 Ga0307406_10001131 3300031901 Bacteria 14904
1069 Ga0307406_10001699 3300031901 Bacteria 12095
1070 Ga0307406_10022558 3300031901 Bacteria 3736
1071 Ga0307406_10098362 3300031901 Bacteria 1986
1072 Ga0307407_10006078 3300031903 Bacteria 5321
1073 Ga0307407_10112933 3300031903 Bacteria 1709
1074 Ga0307407_10129311 3300031903 Bacteria 1613
1075 Ga0307412_10011101 3300031911 Bacteria 5209
1076 Ga0307412_10023060 3300031911 Bacteria 3826
1077 Ga0307412_10025330 3300031911 Bacteria 3673
1078 Ga0307412_10034849 3300031911 Bacteria 3210
1079 Ga0307409_100009086 3300031995 Bacteria 6084
1080 Ga0307409_100041037 3300031995 Bacteria 3452
1081 Ga0307409_100105738 3300031995 Bacteria 2347
1082 Ga0307416_100013885 3300032002 Bacteria 5492
1083 Ga0307416_100045877 3300032002 Bacteria 3444
1084 Ga0307416_100144021 3300032002 Bacteria 2172
1085 Ga0307414_10069494 3300032004 Bacteria 2532
1086 Ga0307411_10000347 3300032005 Bacteria 15605
1087 Ga0307411_10096805 3300032005 Bacteria 2075
1088 Ga0316583_10019774 3300032133 Bacteria 2414
1089 Ga0307510_10030522 3300033180 Bacteria 6109
1090 Ga0307510_10053824 3300033180 Bacteria 4224
1091 Ga0373928_0012497 3300035084 Bacteria 1694
1092 Ga0373934_0030000 3300035086 Bacteria 2126
1093 Ga0373923_0015654 3300035111 Bacteria 2867
1094 Ga0373939_0000067 3300035114 Bacteria 34368
1095 Ga0373954_0110980 3300035118 Bacteria 1326
1096 Ga0373960_0000228 3300035121 Bacteria 10442
1097 Ga0316574_0027918 3300035398 Bacteria 3401
1098 Ga0373931_0007765 3300035691 Bacteria 5066
1099 Ga0373927_0003169 3300035695 Bacteria 11866
1100 Ga0373927_0004693 3300035695 Bacteria 9529
1101 Ga0373933_0072098 3300035724 Bacteria 2103
1102 Ga0373937_0033224 3300036401 Bacteria 4684
1103 Ga0373937_0084574 3300036401 Bacteria 2935
1104 Ga0373937_0098154 3300036401 Bacteria 2717
1105 Ga0373925_0012025 3300037068 Bacteria 6268
1106 Ga0373925_0047276 3300037068 Bacteria 3203
1107 Ga0373925_0287218 3300037068 Bacteria 1326
1108 Ga0395899_0004233 3300037312 Bacteria 11242
1109 Ga0395899_0064777 3300037312 Bacteria 2686
1110 Ga0395900_0000058 3300037418 Bacteria 206785
1111 Ga0395900_0001342 3300037418 Bacteria 29732
1112 Ga0395900_0004446 3300037418 Bacteria 14850
1113 Ga0395900_0014529 3300037418 Bacteria 8035
1114 Ga0395900_0023478 3300037418 Bacteria 6311
1115 Ga0395900_0326164 3300037418 Bacteria 1514
1116 Ga0395898_0000283 3300037466 Bacteria 122630
1117 Ga0395898_0004069 3300037466 Bacteria 16053
1118 Ga0395898_0006225 3300037466 Bacteria 12784
1119 Ga0395898_0013532 3300037466 Bacteria 8400
1120 Ga0395898_0164563 3300037466 Bacteria 2121
1121 Ga0395898_0365367 3300037466 Bacteria 1376
1122 Ga0395905_0000084 3300037471 Bacteria 158046
1123 Ga0395905_0000088 3300037471 Bacteria 152506
1124 Ga0395905_0000474 3300037471 Bacteria 55503
1125 Ga0395905_0005168 3300037471 Bacteria 13388
1126 Ga0395905_0022674 3300037471 Bacteria 5935
1127 Ga0395905_0037655 3300037471 Bacteria 4539
1128 Ga0395905_0093859 3300037471 Bacteria 2814
1129 Ga0395905_0096771 3300037471 Bacteria 2771
1130 Ga0395905_0113081 3300037471 Bacteria 2550
1131 Ga0395905_0188852 3300037471 Bacteria 1933
1132 Ga0395905_0349936 3300037471 Bacteria 1369
1133 Ga0395901_0002111 3300038443 Bacteria 20385
1134 Ga0395901_0004265 3300038443 Bacteria 14421
1135 Ga0395901_0014599 3300038443 Bacteria 7982
1136 Ga0395901_0049342 3300038443 Bacteria 4373
1137 Ga0395901_0157861 3300038443 Bacteria 2382
1138 Ga0395901_0200212 3300038443 Bacteria 2093
1139 Ga0436365_1408997 3300039437 Bacteria 4257
1140 Ga0436361_0019641 3300039447 Bacteria 127735
1141 Ga0436361_0056098 3300039447 Bacteria 2127
1142 Ga0436361_0163583 3300039447 Bacteria 173204
1143 Ga0436361_0237831 3300039447 Bacteria 3657
1144 Ga0436361_0374445 3300039447 Bacteria 2681
1145 Ga0436361_0484071 3300039447 Bacteria 47769
1146 Ga0436361_0797912 3300039447 Bacteria 11388
1147 Ga0439436_0001660 3300041404 Bacteria 6501
1148 Ga0439447_011775 3300041407 Bacteria 2535
1149 Ga0451789_0062679 3300041443 Bacteria 1650
1150 Ga0451791_0729747 3300041451 Bacteria 1986
1151 Ga0451800_0294366 3300041459 Bacteria 1711
1152 Ga0451802_1889696 3300041460 Bacteria 1646
1153 Ga0451807_2119455 3300041486 Bacteria 1376
1154 Ga0439431_0000686 3300041997 Bacteria 7276
1155 Ga0439433_0014615 3300041999 Bacteria 1729
1156 Ga0439432_002992 3300042006 Bacteria 6292
1157 Ga0439449_0024477 3300042007 Bacteria 2256
1158 Ga0439452_003034 3300042010 Bacteria 5975
1159 Ga0439457_010969 3300042014 Bacteria 2070
1160 Ga0450911_000443 3300042115 Bacteria 13445
1161 Ga0450917_000136 3300042120 Bacteria 4783
1162 Ga0450923_001534 3300042125 Bacteria 3095
1163 Ga0450888_000009 3300042126 Bacteria 15484
1164 Ga0450890_005447 3300042127 Bacteria 1636
1165 Ga0450891_000221 3300042129 Bacteria 5747
1166 Ga0450889_000020 3300042144 Bacteria 13857
1167 Ga0450908_000326 3300042184 Bacteria 9315
1168 Ga0439434_0001164 3300042435 Bacteria 7604
1169 Ga0439459_0000359 3300042438 Bacteria 5640
1170 Ga0450918_000047 3300042531 Bacteria 24725
1171 Ga0451577_0000453 3300042876 Bacteria 71384
1172 Ga0451577_0000997 3300042876 Bacteria 41140
1173 Ga0451577_0007753 3300042876 Bacteria 10522
1174 Ga0451577_0008851 3300042876 Bacteria 9745
1175 Ga0451577_0013237 3300042876 Bacteria 7730
1176 Ga0451577_0015527 3300042876 Bacteria 7082
1177 Ga0451577_0020100 3300042876 Bacteria 6132
1178 Ga0451577_0086637 3300042876 Bacteria 2794
1179 Ga0451577_0093102 3300042876 Bacteria 2691
1180 Ga0451577_0159727 3300042876 Bacteria 2029
1181 Ga0451577_0406433 3300042876 Bacteria 1236
1182 Ga0466969_0000013 3300044656 Bacteria 111537
1183 Ga0466969_0011004 3300044656 Bacteria 4790
1184 Ga0466972_0001863 3300044658 Bacteria 10334
1185 Ga0466972_0025394 3300044658 Bacteria 2938
1186 Ga0453683_0031647 3300044673 Bacteria 3341
1187 Ga0466965_0019745 3300044683 Bacteria 3236
1188 Ga0466966_0008880 3300044684 Bacteria 6655
1189 Ga0466966_0028472 3300044684 Bacteria 3639
1190 Ga0466961_0007768 3300044693 Bacteria 6826
1191 Ga0466961_0027966 3300044693 Bacteria 3626
1192 Ga0466963_0045293 3300044694 Bacteria 2897
1193 Ga0453684_0000014 3300044712 Bacteria 993311
1194 Ga0453684_0000114 3300044712 Bacteria 356610
1195 Ga0453684_0001268 3300044712 Bacteria 75704
1196 Ga0453684_0001455 3300044712 Bacteria 67258
1197 Ga0453684_0002072 3300044712 Bacteria 50917
1198 Ga0453684_0006329 3300044712 Bacteria 22599
1199 Ga0453684_0027135 3300044712 Bacteria 8229
1200 Ga0453684_0037650 3300044712 Bacteria 6636
1201 Ga0453684_0126006 3300044712 Bacteria 3082
1202 Ga0453684_0151509 3300044712 Bacteria 2755
1203 Ga0453684_0577925 3300044712 Bacteria 1234
1204 Ga0466971_0004477 3300044719 Bacteria 6036
1205 Ga0466971_0035574 3300044719 Bacteria 2233
1206 Ga0466971_0037073 3300044719 Bacteria 2186
1207 Ga0466968_0008781 3300044735 Bacteria 3876
1208 Ga0466968_0084067 3300044735 Bacteria 1403
1209 Ga0466957_0026908 3300044842 Bacteria 3414
1210 Ga0466959_0001083 3300045049 Bacteria 16284
1211 Ga0466959_0010137 3300045049 Bacteria 6722
1212 Ga0451576_0000168 3300045051 Bacteria 165624
1213 Ga0451576_0000950 3300045051 Bacteria 54404
1214 Ga0451576_0001018 3300045051 Bacteria 51870
1215 Ga0451576_0002478 3300045051 Bacteria 27435
1216 Ga0451576_0012346 3300045051 Bacteria 9597
1217 Ga0451576_0074276 3300045051 Bacteria 3538
1218 Ga0451576_0093306 3300045051 Bacteria 3130
1219 Ga0451576_0114697 3300045051 Bacteria 2805
1220 Ga0451576_0173524 3300045051 Bacteria 2250
1221 Ga0451576_0223738 3300045051 Bacteria 1965
1222 Ga0466958_0047577 3300045836 Bacteria 2589
1223 Ga0495627_006336 3300046453 Bacteria 4646
1224 Ga0495592_0000394 3300046454 Bacteria 33973
1225 Ga0495638_0050099 3300046460 Bacteria 2609
1226 Ga0495651_0005890 3300046462 Bacteria 9351
1227 Ga0495651_0024267 3300046462 Bacteria 4719
1228 Ga0495653_0038159 3300046463 Bacteria 3770
1229 Ga0495580_0056248 3300046472 Bacteria 2771
1230 Ga0495582_0038406 3300046473 Bacteria 2634
1231 Ga0495585_0034025 3300046492 Bacteria 2881
1232 Ga0495583_0000081 3300046506 Bacteria 168304
1233 Ga0495606_0018883 3300046507 Bacteria 5154
1234 Ga0495608_0007823 3300046511 Bacteria 7520
1235 Ga0495618_0051374 3300046514 Bacteria 2604
1236 Ga0495620_0020378 3300046515 Bacteria 3239
1237 Ga0495628_0001687 3300046516 Bacteria 20156
1238 Ga0495628_0037330 3300046516 Bacteria 3895
1239 Ga0495630_0088413 3300046517 Bacteria 2340
1240 Ga0495631_0001417 3300046518 Bacteria 14572
1241 Ga0495632_0004039 3300046519 Bacteria 10130
1242 Ga0495632_0059217 3300046519 Bacteria 1864
1243 Ga0495652_0006873 3300046529 Bacteria 10532
1244 Ga0495652_0054883 3300046529 Bacteria 3390
1245 Ga0495665_0055540 3300046531 Bacteria 2090
1246 Ga0495587_0065569 3300046536 Bacteria 2120
1247 Ga0495598_0004678 3300046537 Bacteria 2982
1248 Ga0495621_0016961 3300046539 Bacteria 2346
1249 Ga0495621_0027461 3300046539 Bacteria 1927
1250 Ga0495597_0000054 3300046542 Bacteria 95390
1251 Ga0495645_0009579 3300046543 Bacteria 6776
1252 Ga0495633_0000648 3300046558 Bacteria 32320
1253 Ga0495656_0000093 3300046615 Bacteria 38558
1254 Ga0495625_0001179 3300046660 Bacteria 33575
1255 Ga0495625_0114001 3300046660 Bacteria 1845
1256 Ga0495659_0012749 3300046664 Bacteria 2729
1257 Ga0495661_0136730 3300046665 Bacteria 1337
1258 Ga0495623_0010175 3300046679 Bacteria 6086
1259 Ga0495646_0002576 3300046680 Bacteria 11150
1260 Ga0495647_0018312 3300046681 Bacteria 2491
1261 Ga0495658_0057777 3300046683 Bacteria 2217
1262 Ga0495658_0077844 3300046683 Bacteria 1940
1263 Ga0495613_0017525 3300046689 Bacteria 5332
1264 Ga0495649_0000259 3300046694 Bacteria 47236
1265 Ga0495649_0010350 3300046694 Bacteria 5509
1266 Ga0495589_0028100 3300046794 Bacteria 2841
1267 Ga0495600_0010139 3300046809 Bacteria 5842
1268 Ga0495660_0011887 3300046810 Bacteria 5051
1269 Ga0495604_0038352 3300047317 Bacteria 3769
1270 Ga0495676_0009192 3300047321 Bacteria 9006
1271 Ga0495687_003988 3300047443 Bacteria 10280
1272 Ga0495685_029083 3300047447 Bacteria 1901
1273 Ga0495593_0015464 3300047673 Bacteria 4321
1274 Ga0495602_0090521 3300048088 Bacteria 2541
1275 Ga0495602_0106125 3300048088 Bacteria 2293
1276 Ga0496100_0016181 3300048903 Bacteria 4375
1277 Ga0496100_0300598 3300048903 Bacteria 1201
1278 Ga0496101_0005514 3300048904 Bacteria 8072
1279 Ga0496101_0053871 3300048904 Bacteria 2903
1280 Ga0496102_0004520 3300048905 Bacteria 11754
1281 Ga0496102_0032029 3300048905 Bacteria 4721
1282 Ga0496102_0034690 3300048905 Bacteria 4539
1283 Ga0496102_0049796 3300048905 Bacteria 3812
1284 Ga0496103_0082067 3300048906 Bacteria 2028
1285 Ga0496104_0006818 3300048907 Bacteria 10062
1286 Ga0496104_0008511 3300048907 Bacteria 9120
1287 Ga0496104_0074178 3300048907 Bacteria 3239
1288 Ga0496105_0010653 3300048908 Bacteria 7234
1289 Ga0496105_0011125 3300048908 Bacteria 7098
1290 Ga0496105_0029503 3300048908 Bacteria 4490
1291 Ga0496105_0137152 3300048908 Bacteria 2015
1292 Ga0496106_0016006 3300048909 Bacteria 5546
1293 Ga0496106_0040487 3300048909 Bacteria 3490
1294 Ga0496106_0162620 3300048909 Bacteria 1766
1295 Ga0496107_0013245 3300048910 Bacteria 5762
1296 Ga0496108_0007483 3300048911 Bacteria 8851
1297 Ga0496108_0039907 3300048911 Bacteria 3913
1298 Ga0496108_0094360 3300048911 Bacteria 2547
1299 Ga0496108_0099050 3300048911 Bacteria 2484
1300 Ga0496108_0109731 3300048911 Bacteria 2358
1301 Ga0496108_0186221 3300048911 Bacteria 1798
1302 Ga0496108_0219376 3300048911 Bacteria 1652
1303 Ga0496109_0014083 3300048912 Bacteria 6952
1304 Ga0496109_0039783 3300048912 Bacteria 4257
1305 Ga0496109_0259035 3300048912 Bacteria 1638
1306 Ga0496110_0001672 3300048913 Bacteria 16272
1307 Ga0496110_0014509 3300048913 Bacteria 6546
1308 Ga0496110_0035733 3300048913 Bacteria 4313
1309 Ga0496110_0038769 3300048913 Bacteria 4147
1310 Ga0496110_0401453 3300048913 Bacteria 1249
1311 Ga0496111_0036928 3300048914 Bacteria 3494
1312 Ga0496111_0114604 3300048914 Bacteria 1987
1313 Ga0496111_0296124 3300048914 Bacteria 1199
1314 Ga0496112_0009399 3300048915 Bacteria 8804
1315 Ga0496112_0056645 3300048915 Bacteria 3858
1316 Ga0496114_0003046 3300048917 Bacteria 12833
1317 Ga0496114_0027685 3300048917 Bacteria 4645
1318 Ga0496114_0080163 3300048917 Bacteria 2757
1319 Ga0496114_0184760 3300048917 Bacteria 1822
1320 Ga0496117_0072509 3300048920 Bacteria 2301
1321 Ga0496118_0007613 3300048921 Bacteria 11409
1322 Ga0496118_0014026 3300048921 Bacteria 7526
1323 Ga0496121_0038603 3300048924 Bacteria 4223
1324 Ga0496121_0047496 3300048924 Bacteria 3662
1325 Ga0496122_0000383 3300048925 Bacteria 94797
1326 Ga0496122_0005655 3300048925 Bacteria 14758
1327 Ga0496123_0000249 3300048926 Bacteria 108969
1328 Ga0496124_0000088 3300048927 Bacteria 194644
1329 Ga0496124_0002378 3300048927 Bacteria 24780
1330 Ga0496125_0000319 3300048928 Bacteria 93727
1331 Ga0496125_0000785 3300048928 Bacteria 51744
1332 Ga0496125_0023666 3300048928 Bacteria 5664
1333 Ga0496125_0070059 3300048928 Bacteria 2747
1334 Ga0496126_0040916 3300048929 Bacteria 4294
1335 Ga0501031_0006723 3300049568 Bacteria 7501
1336 Ga0501034_0038720 3300049571 Bacteria 4828
1337 Ga0501034_0091769 3300049571 Bacteria 3034
1338 Ga0501043_0000009 3300049579 Bacteria 214823
1339 Ga0501046_0000022 3300049580 Bacteria 215451
1340 Ga0501047_0000021 3300049581 Bacteria 254841
1341 Ga0501047_0089232 3300049581 Bacteria 2960
1342 Ga0501075_0367934 3300049591 Bacteria 1096
1343 Ga0501198_000001 3300049649 Bacteria 234552
1344 Ga0501207_004330 3300049654 Bacteria 1925
1345 Ga0501222_000004 3300049662 Bacteria 136139
1346 Ga0501222_001282 3300049662 Bacteria 3532
1347 Ga0501222_002897 3300049662 Bacteria 2366
1348 Ga0501223_007869 3300049663 Bacteria 2176
1349 Ga0501235_003572 3300049669 Bacteria 3361
1350 Ga0501242_003578 3300049674 Bacteria 1687
1351 Ga0501253_000860 3300049683 Bacteria 2838
1352 Ga0501221_002012 3300049704 Bacteria 3388
1353 Ga0501080_0053452 3300049742 Bacteria 3761
1354 Ga0501262_000273 3300049759 Bacteria 6242
1355 Ga0501262_004596 3300049759 Bacteria 1606
1356 Ga0501267_000092 3300049764 Bacteria 5551
1357 Ga0501035_0038555 3300049822 Bacteria 4326
1358 nmdc:mga03683_39000_c1 3300050489 Bacteria 1943
1359 nmdc:mga00v17_33488_c1 3300050491 Bacteria 3044
1360 nmdc:mga0yw44_139388_c1 3300050492 Bacteria 1575
1361 nmdc:mga0yw44_9904_c1 3300050492 Bacteria 4843
1362 nmdc:mga0k408_144892_c1 3300050493 Bacteria 1414
1363 nmdc:mga0k408_2471_c1 3300050493 Bacteria 9833
1364 nmdc:mga0k408_29440_c1 3300050493 Bacteria 3126
1365 nmdc:mga0k408_3312_c1 3300050493 Bacteria 8523
1366 nmdc:mga0k408_3894_c1 3300050493 Bacteria 7911
1367 nmdc:mga0k408_4784_c1 3300050493 Bacteria 7179
1368 nmdc:mga0k408_59922_c1 3300050493 Bacteria 2212
1369 nmdc:mga04h51_36487_c1 3300050495 Bacteria 1582
1370 nmdc:mga07m45_2541_c1 3300050496 Bacteria 8566
1371 nmdc:mga07m45_2542_c1 3300050496 Bacteria 8563
1372 nmdc:mga07m45_6261_c1 3300050496 Bacteria 5824
1373 nmdc:mga07m45_6873_c1 3300050496 Bacteria 5787
1374 nmdc:mga07m45_81_c1 3300050496 Bacteria 35778
1375 nmdc:mga09592_3703_c1 3300050508 Bacteria 12323
1376 nmdc:mga08y16_28387_c1 3300050511 Bacteria 5899
1377 nmdc:mga08y16_351538_c1 3300050511 Bacteria 1514
1378 nmdc:mga0rr50_124536_c1 3300050513 Bacteria 2056
1379 nmdc:mga08x19_36678_c1 3300050514 Bacteria 3106
1380 nmdc:mga0a205_408297_c1 3300050515 Bacteria 1221
1381 nmdc:mga0sz30_35698_c1 3300050516 Bacteria 2076
1382 Ga0495601_0130708 3300053077 Bacteria 1635
1383 Ga0500610_0005499 3300053079 Bacteria 5199
1384 Ga0500635_0000011 3300053080 Bacteria 144219
1385 Ga0495619_0119029 3300053085 Bacteria 1810
1386 Ga0500578_0000652 3300053086 Bacteria 41736
1387 Ga0500583_0003338 3300053092 Bacteria 5033
1388 Ga0500651_0000067 3300053093 Bacteria 67673
1389 Ga0500651_0013435 3300053093 Bacteria 4990
1390 Ga0500571_000952 3300053110 Bacteria 12727
1391 Ga0500572_008075 3300053111 Bacteria 2452
1392 Ga0500652_000449 3300053131 Bacteria 14598
1393 Ga0500655_001229 3300053133 Bacteria 4863
1394 Ga0500658_0001880 3300053134 Bacteria 8233
1395 Ga0500658_0003426 3300053134 Bacteria 5989
1396 Ga0500559_0000446 3300053136 Bacteria 29360
1397 Ga0500568_0010475 3300053139 Bacteria 4341
1398 Ga0500604_0041079 3300053151 Bacteria 1397
1399 Ga0500616_0011165 3300053153 Bacteria 5329
1400 Ga0500619_000941 3300053154 Bacteria 4982
1401 Ga0500622_0000124 3300053156 Bacteria 81245
1402 Ga0500622_0018843 3300053156 Bacteria 3666
1403 Ga0500622_0031819 3300053156 Bacteria 2768
1404 Ga0500638_036952 3300053162 Bacteria 2369
1405 Ga0500636_0000203 3300053177 Bacteria 32197
1406 Ga0590071_003318 3300059421 Bacteria 3964
1407 Ga0590075_012517 3300059424 Bacteria 2061
1408 Ga0466962_0012811 3300061719 Bacteria 4034

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0577925 Ga0453684_0577925_69_1019 310
2 3300045051 Ga0451576_0093306 Ga0451576_0093306_2125_3075 310
3 3300017792 Ga0163161_10260705 Ga0163161_102607052 333
4 3300017792 Ga0163161_10132337 Ga0163161_101323372 334
5 3300035084 Ga0373928_0012497 Ga0373928_0012497_15_1055 340
6 3300046665 Ga0495661_0136730 Ga0495661_0136730_11_1051 340
7 3300049591 Ga0501075_0367934 Ga0501075_0367934_25_1047 340
8 3300050515 nmdc:mga0a205_408297_c1 nmdc:mga0a205_408297_c1_10_1032 340
9 3300044684 Ga0466966_0008880 Ga0466966_0008880_3841_4959 354
10 iso_pu_bacteria 2547132512 2548846769 357
11 3300031727 Ga0316576_10002160 Ga0316576_1000216011 359
12 3300035398 Ga0316574_0027918 Ga0316574_0027918_1992_3077 359
13 3300005334 Ga0068869_100008706 Ga0068869_1000087066 360
14 3300005338 Ga0068868_100132339 Ga0068868_1001323391 360
15 3300005617 Ga0068859_100002838 Ga0068859_10000283816 360
16 3300005841 Ga0068863_100051872 Ga0068863_1000518721 360
17 3300005842 Ga0068858_100070827 Ga0068858_1000708272 360
18 3300005843 Ga0068860_100071631 Ga0068860_1000716312 360
19 3300006237 Ga0097621_100071592 Ga0097621_1000715922 360
20 3300006358 Ga0068871_100007404 Ga0068871_1000074047 360
21 3300006931 Ga0097620_100002838 Ga0097620_1000028383 360
22 3300009098 Ga0105245_10347878 Ga0105245_103478782 360
23 3300009174 Ga0105241_10256939 Ga0105241_102569392 360
24 3300009177 Ga0105248_10006109 Ga0105248_100061091 360
25 3300010375 Ga0105239_10259343 Ga0105239_102593432 360
26 3300013296 Ga0157374_10334116 Ga0157374_103341162 360
27 3300013308 Ga0157375_10488018 Ga0157375_104880182 360
28 3300025942 Ga0207689_10001624 Ga0207689_100016247 360
29 3300026035 Ga0207703_10069127 Ga0207703_100691272 360
30 3300028380 Ga0268265_10057047 Ga0268265_100570473 360
31 3300036401 Ga0373937_0098154 Ga0373937_0098154_183_1265 360
32 3300042007 Ga0439449_0024477 Ga0439449_0024477_285_1394 360
33 3300005328 Ga0070676_10101322 Ga0070676_101013222 361
34 3300005329 Ga0070683_100046656 Ga0070683_1000466562 361
35 3300005331 Ga0070670_100069385 Ga0070670_1000693852 361
36 3300005334 Ga0068869_100237443 Ga0068869_1002374432 361
37 3300005335 Ga0070666_10217006 Ga0070666_102170062 361
38 3300005340 Ga0070689_100049233 Ga0070689_1000492332 361
39 3300005344 Ga0070661_100056385 Ga0070661_1000563852 361
40 3300005354 Ga0070675_100104043 Ga0070675_1001040432 361
41 3300005354 Ga0070675_100183000 Ga0070675_1001830001 361
42 3300005355 Ga0070671_100028811 Ga0070671_1000288113 361
43 3300005364 Ga0070673_100012438 Ga0070673_1000124383 361
44 3300005367 Ga0070667_100078199 Ga0070667_1000781992 361
45 3300005441 Ga0070700_100165449 Ga0070700_1001654491 361
46 3300005457 Ga0070662_100044744 Ga0070662_1000447443 361
47 3300005535 Ga0070684_100120705 Ga0070684_1001207052 361
48 3300005543 Ga0070672_100150738 Ga0070672_1001507382 361
49 3300005544 Ga0070686_100039757 Ga0070686_1000397571 361
50 3300005564 Ga0070664_100024891 Ga0070664_1000248912 361
51 3300005618 Ga0068864_100163016 Ga0068864_1001630162 361
52 3300005840 Ga0068870_10138090 Ga0068870_101380901 361
53 3300005841 Ga0068863_100037649 Ga0068863_1000376493 361
54 3300005841 Ga0068863_100177019 Ga0068863_1001770191 361
55 3300006358 Ga0068871_100014944 Ga0068871_1000149442 361
56 3300006358 Ga0068871_100178021 Ga0068871_1001780212 361
57 3300009094 Ga0111539_10144488 Ga0111539_101444881 361
58 3300009148 Ga0105243_10385206 Ga0105243_103852061 361
59 3300009176 Ga0105242_10340321 Ga0105242_103403212 361
60 3300009177 Ga0105248_10061200 Ga0105248_100612003 361
61 3300013296 Ga0157374_10144974 Ga0157374_101449742 361
62 3300013306 Ga0163162_10113345 Ga0163162_101133452 361
63 3300014745 Ga0157377_10044154 Ga0157377_100441542 361
64 3300014745 Ga0157377_10115078 Ga0157377_101150781 361
65 3300017792 Ga0163161_10066522 Ga0163161_100665223 361
66 3300025315 Ga0207697_10009395 Ga0207697_100093953 361
67 3300025321 Ga0207656_10007059 Ga0207656_100070593 361
68 3300025893 Ga0207682_10002075 Ga0207682_100020757 361
69 3300025899 Ga0207642_10124474 Ga0207642_101244741 361
70 3300025901 Ga0207688_10084320 Ga0207688_100843202 361
71 3300025903 Ga0207680_10108021 Ga0207680_101080211 361
72 3300025907 Ga0207645_10027702 Ga0207645_100277025 361
73 3300025908 Ga0207643_10068770 Ga0207643_100687703 361
74 3300025923 Ga0207681_10221012 Ga0207681_102210122 361
75 3300025925 Ga0207650_10087964 Ga0207650_100879641 361
76 3300025926 Ga0207659_10045626 Ga0207659_100456261 361
77 3300025931 Ga0207644_10017863 Ga0207644_100178633 361
78 3300025933 Ga0207706_10011997 Ga0207706_100119977 361
79 3300025937 Ga0207669_10126415 Ga0207669_101264152 361
80 3300025940 Ga0207691_10004579 Ga0207691_1000457911 361
81 3300025941 Ga0207711_10359702 Ga0207711_103597022 361
82 3300025942 Ga0207689_10017053 Ga0207689_100170535 361
83 3300025944 Ga0207661_10105552 Ga0207661_101055522 361
84 3300025960 Ga0207651_10014005 Ga0207651_100140052 361
85 3300025960 Ga0207651_10178666 Ga0207651_101786661 361
86 3300025986 Ga0207658_10029755 Ga0207658_100297553 361
87 3300026067 Ga0207678_10052057 Ga0207678_100520573 361
88 3300026075 Ga0207708_10044769 Ga0207708_100447693 361
89 3300026088 Ga0207641_10122259 Ga0207641_101222591 361
90 3300026089 Ga0207648_10019878 Ga0207648_100198785 361
91 3300026095 Ga0207676_10026039 Ga0207676_100260393 361
92 3300026121 Ga0207683_10014056 Ga0207683_100140562 361
93 3300026142 Ga0207698_10015518 Ga0207698_100155182 361
94 3300028577 Ga0265318_10001780 Ga0265318_100017806 361
95 3300029957 Ga0265324_10016187 Ga0265324_100161871 361
96 3300031235 Ga0265330_10008628 Ga0265330_100086282 361
97 3300031238 Ga0265332_10001273 Ga0265332_100012737 361
98 3300031239 Ga0265328_10002854 Ga0265328_100028544 361
99 3300031239 Ga0265328_10027544 Ga0265328_100275441 361
100 3300031240 Ga0265320_10022099 Ga0265320_100220992 361
101 3300031250 Ga0265331_10001808 Ga0265331_100018085 361
102 3300031250 Ga0265331_10001901 Ga0265331_100019014 361
103 3300031250 Ga0265331_10006454 Ga0265331_100064541 361
104 3300031250 Ga0265331_10011274 Ga0265331_100112743 361
105 3300031251 Ga0265327_10000739 Ga0265327_1000073932 361
106 3300031251 Ga0265327_10001019 Ga0265327_1000101923 361
107 3300031251 Ga0265327_10004241 Ga0265327_100042419 361
108 3300031251 Ga0265327_10022584 Ga0265327_100225842 361
109 3300031344 Ga0265316_10081684 Ga0265316_100816842 361
110 3300031595 Ga0265313_10054342 Ga0265313_100543422 361
111 3300031665 Ga0316575_10011177 Ga0316575_100111772 361
112 3300031711 Ga0265314_10000980 Ga0265314_100009803 361
113 3300044712 Ga0453684_0151509 Ga0453684_0151509_987_2111 361
114 3300045051 Ga0451576_0114697 Ga0451576_0114697_463_1566 361
115 3300048911 Ga0496108_0186221 Ga0496108_0186221_156_1241 361
116 3300048913 Ga0496110_0001672 Ga0496110_0001672_5427_6512 361
117 3300048914 Ga0496111_0296124 Ga0496111_0296124_46_1131 361
118 3300048917 Ga0496114_0184760 Ga0496114_0184760_705_1790 361
119 3300049571 Ga0501034_0091769 Ga0501034_0091769_681_1766 361
120 3300027717 Ga0209998_10011946 Ga0209998_100119462 364
121 3300048924 Ga0496121_0038603 Ga0496121_0038603_2597_3766 366
122 3300006058 Ga0075432_10031116 Ga0075432_100311162 367
123 3300048927 Ga0496124_0000088 Ga0496124_0000088_191296_192465 367
124 3300048927 Ga0496124_0002378 Ga0496124_0002378_15518_16699 367
125 3300048928 Ga0496125_0000785 Ga0496125_0000785_39528_40697 367
126 3300048929 Ga0496126_0040916 Ga0496126_0040916_1473_2642 367
127 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006359 368
128 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006959 368
129 3300003751 Ga0055538_1000034 Ga0055538_100003458 368
130 3300003752 Ga0055539_1000044 Ga0055539_100004458 368
131 3300003756 Ga0055533_1000055 Ga0055533_100005558 368
132 3300003759 Ga0055525_1000066 Ga0055525_1000066124 368
133 3300003841 Ga0055541_1000032 Ga0055541_1000032125 368
134 3300009093 Ga0105240_10012882 Ga0105240_100128826 368
135 3300014497 Ga0182008_10048302 Ga0182008_100483022 368
136 3300015261 Ga0182006_1011518 Ga0182006_10115183 368
137 3300015262 Ga0182007_10005244 Ga0182007_100052442 368
138 3300015265 Ga0182005_1000283 Ga0182005_100028316 368
139 3300025224 Ga0209784_100049 Ga0209784_100049124 368
140 3300025225 Ga0209566_100061 Ga0209566_100061124 368
141 3300025226 Ga0209674_100069 Ga0209674_100069173 368
142 3300025230 Ga0209563_100083 Ga0209563_100083124 368
143 3300025231 Ga0207427_100345 Ga0207427_1003459 368
144 3300025233 Ga0209437_100091 Ga0209437_100091172 368
145 3300025253 Ga0209677_100039 Ga0209677_100039173 368
146 3300025261 Ga0209233_1000115 Ga0209233_1000115172 368
147 3300031238 Ga0265332_10000023 Ga0265332_10000023137 368
148 3300046462 Ga0495651_0005890 Ga0495651_0005890_5316_6485 368
149 3300046462 Ga0495651_0024267 Ga0495651_0024267_1765_2934 368
150 3300046463 Ga0495653_0038159 Ga0495653_0038159_732_1901 368
151 3300046511 Ga0495608_0007823 Ga0495608_0007823_4034_5203 368
152 3300046514 Ga0495618_0051374 Ga0495618_0051374_1190_2359 368
153 3300046516 Ga0495628_0001687 Ga0495628_0001687_9227_10396 368
154 3300046516 Ga0495628_0037330 Ga0495628_0037330_1213_2382 368
155 3300046529 Ga0495652_0006873 Ga0495652_0006873_4198_5367 368
156 3300046529 Ga0495652_0054883 Ga0495652_0054883_902_2071 368
157 3300046543 Ga0495645_0009579 Ga0495645_0009579_5586_6755 368
158 3300046679 Ga0495623_0010175 Ga0495623_0010175_4250_5419 368
159 3300046680 Ga0495646_0002576 Ga0495646_0002576_221_1390 368
160 3300046809 Ga0495600_0010139 Ga0495600_0010139_1235_2404 368
161 3300047317 Ga0495604_0038352 Ga0495604_0038352_812_1981 368
162 3300048088 Ga0495602_0106125 Ga0495602_0106125_601_1770 368
163 3300048903 Ga0496100_0300598 Ga0496100_0300598_55_1179 368
164 3300053077 Ga0495601_0130708 Ga0495601_0130708_55_1224 368
165 3300053111 Ga0500572_008075 Ga0500572_008075_434_1603 368
166 3300053154 Ga0500619_000941 Ga0500619_000941_1472_2641 368
167 3300006195 Ga0075366_10008469 Ga0075366_100084695 372
168 3300009148 Ga0105243_10093394 Ga0105243_100933942 372
169 3300050493 nmdc:mga0k408_29440_c1 nmdc:mga0k408_29440_c1_1292_2470 372
170 3300042876 Ga0451577_0406433 Ga0451577_0406433_66_1220 374
171 iso_pu_bacteria 2885192300 2885196693 377
172 iso_pu_bacteria 2904449895 2904454004 377
173 iso_pu_bacteria 2904456579 2904459458 377
174 iso_pu_bacteria 2904541872 2904546112 377
175 iso_pu_bacteria 2929160207 2929161309 377
176 iso_pu_bacteria 2929520902 2929521572 377
177 iso_pu_bacteria 2511231002 2511243565 379
178 iso_pu_bacteria 2511231003 2511248893 379
179 iso_pu_bacteria 2513020051 2513228789 379
180 iso_pu_bacteria 2547132374 2548499218 379
181 iso_pu_bacteria 2548876994 2550696365 379
182 iso_pu_bacteria 2585428057 2587728311 379
183 iso_pu_bacteria 2585428058 2587734481 379
184 iso_pu_bacteria 2585428062 2587759375 379
185 iso_pu_bacteria 2588253510 2588295029 379
186 iso_pu_bacteria 2599185214 2599620880 379
187 iso_pu_bacteria 2599185226 2599674314 379
188 iso_pu_bacteria 2599185227 2599678504 379
189 iso_pu_bacteria 2599185229 2599690391 379
190 iso_pu_bacteria 2643221544 2643743242 379
191 iso_pu_bacteria 2643221570 2643866052 379
192 iso_pu_bacteria 2643221585 2643932737 379
193 iso_pu_bacteria 2643221592 2643971306 379
194 iso_pu_bacteria 2643221596 2643994049 379
195 iso_pu_bacteria 2643221603 2644027190 379
196 iso_pu_bacteria 2643221609 2644057735 379
197 iso_pu_bacteria 2643221611 2644072180 379
198 iso_pu_bacteria 2643221625 2644142052 379
199 iso_pu_bacteria 2643221628 2644161333 379
200 iso_pu_bacteria 2643221639 2644218341 379
201 iso_pu_bacteria 2643221644 2644243371 379
202 iso_pu_bacteria 2643221646 2644260232 379
203 iso_pu_bacteria 2643221648 2644275469 379
204 iso_pu_bacteria 2643221652 2644292863 379
205 iso_pu_bacteria 2643221654 2644303044 379
206 iso_pu_bacteria 2643221656 2644313987 379
207 iso_pu_bacteria 2643221658 2644324050 379
208 iso_pu_bacteria 2643221660 2644340819 379
209 iso_pu_bacteria 2643221672 2644400766 379
210 iso_pu_bacteria 2643221683 2644466005 379
211 iso_pu_bacteria 2643221717 2644647881 379
212 iso_pu_bacteria 2721755523 2722885691 379
213 iso_pu_bacteria 2738541277 2738720728 379
214 iso_pu_bacteria 2738541307 2738882328 379
215 iso_pu_bacteria 2738541337 2739056109 379
216 iso_pu_bacteria 2738543012 2739242011 379
217 iso_pu_bacteria 2738543013 2739251904 379
218 iso_pu_bacteria 2738543019 2739279927 379
219 iso_pu_bacteria 2816332133 2816470689 379
220 iso_pu_bacteria 2818991436 2819543494 379
221 iso_pu_bacteria 2818991445 2819594268 379
222 iso_pu_bacteria 2818991446 2819602003 379
223 iso_pu_bacteria 2818991449 2819617431 379
224 iso_pu_bacteria 2831265667 2831269832 379
225 iso_pu_bacteria 2831864461 2831869145 379
226 iso_pu_bacteria 2838054893 2838055150 379
227 iso_pu_bacteria 2839138175 2839142211 379
228 iso_pu_bacteria 2842677519 2842680916 379
229 iso_pu_bacteria 2842718218 2842721803 379
230 iso_pu_bacteria 2842733646 2842737614 379
231 iso_pu_bacteria 2842747753 2842749723 379
232 iso_pu_bacteria 2881101125 2881103518 379
233 iso_pu_bacteria 2884811622 2884814611 379
234 iso_pu_bacteria 2884836552 2884839604 379
235 iso_pu_bacteria 2884852848 2884856586 379
236 iso_pu_bacteria 2885198086 2885201853 379
237 iso_pu_bacteria 2885211737 2885215437 379
238 iso_pu_bacteria 2894023352 2894027386 379
239 iso_pu_bacteria 2896154374 2896157932 379
240 iso_pu_bacteria 2899924645 2899927240 379
241 iso_pu_bacteria 2904439833 2904442316 379
242 iso_pu_bacteria 2904479285 2904479535 379
243 iso_pu_bacteria 2904530477 2904533594 379
244 iso_pu_bacteria 2904584206 2904586549 379
245 iso_pu_bacteria 2904589729 2904591637 379
246 iso_pu_bacteria 2904601388 2904602225 379
247 iso_pu_bacteria 2919079590 2919083452 379
248 iso_pu_bacteria 2919462493 2919465416 379
249 iso_pu_bacteria 2919704043 2919706209 379
250 iso_pu_bacteria 2928037797 2928042845 379
251 iso_pu_bacteria 2928044640 2928048728 379
252 iso_pu_bacteria 2928051484 2928055060 379
253 iso_pu_bacteria 2928064002 2928068486 379
254 iso_pu_bacteria 2928070936 2928073608 379
255 iso_pu_bacteria 2928084124 2928089689 379
256 iso_pu_bacteria 2928115317 2928117255 379
257 iso_pu_bacteria 2932422444 2932425480 379
258 iso_pu_bacteria 2939631187 2939635913 379
259 iso_pu_bacteria 2945909444 2945914224 379
260 iso_pu_bacteria 2945945610 2945949792 379
261 iso_pu_bacteria 2945972063 2945973816 379
262 iso_pu_bacteria 2945984333 2945990393 379
263 iso_pu_bacteria 2954767861 2954770592 379
264 iso_pu_bacteria 2974320154 2974322127 379
265 iso_pu_bacteria 2990710928 2990714106 379
266 3300041407 Ga0439447_011775 Ga0439447_011775_1060_2232 381
267 3300001976 JGI24752J21851_1005459 JGI24752J21851_10054593 383
268 3300001979 JGI24740J21852_10009841 JGI24740J21852_100098412 383
269 3300001991 JGI24743J22301_10000318 JGI24743J22301_100003184 383
270 3300002704 JGI25155J39150_1000029 JGI25155J39150_100002966 383
271 3300002704 JGI25155J39150_1000630 JGI25155J39150_10006302 383
272 3300002705 JGI25156J39149_1000062 JGI25156J39149_100006237 383
273 3300002705 JGI25156J39149_1007587 JGI25156J39149_10075872 383
274 3300002738 JGI25154J39366_1000053 JGI25154J39366_100005343 383
275 3300002738 JGI25154J39366_1000980 JGI25154J39366_10009805 383
276 3300002741 JGI25157J39369_1000046 JGI25157J39369_100004666 383
277 3300002741 JGI25157J39369_1000148 JGI25157J39369_100014834 383
278 3300002772 JGI25164J39214_1005708 JGI25164J39214_10057081 383
279 3300002773 JGI25152J39213_1006001 JGI25152J39213_10060014 383
280 3300002773 JGI25152J39213_1006432 JGI25152J39213_10064322 383
281 3300002774 JGI25150J39212_1001852 JGI25150J39212_10018522 383
282 3300003215 JGI25153J46596_10005062 JGI25153J46596_100050626 383
283 3300003215 JGI25153J46596_10022378 JGI25153J46596_100223782 383
284 3300003322 rootL2_10000966 rootL2_100009669 383
285 3300003354 JGI25160J50197_1000253 JGI25160J50197_100025334 383
286 3300003374 JGI25161J50226_1000046 JGI25161J50226_100004654 383
287 3300003575 Ga0007409J51694_1052775 Ga0007409J51694_10527752 383
288 3300003578 Ga0006562J51391_1013325 Ga0006562J51391_10133256 383
289 3300003578 Ga0006562J51391_1013328 Ga0006562J51391_10133282 383
290 3300003578 Ga0006562J51391_1029542 Ga0006562J51391_10295423 383
291 3300003751 Ga0055538_1000051 Ga0055538_100005184 383
292 3300003752 Ga0055539_1000076 Ga0055539_100007684 383
293 3300003756 Ga0055533_1000016 Ga0055533_1000016203 383
294 3300003756 Ga0055533_1000082 Ga0055533_100008284 383
295 3300003759 Ga0055525_1000109 Ga0055525_100010984 383
296 3300003759 Ga0055525_1001112 Ga0055525_10011122 383
297 3300003760 Ga0055527_1005163 Ga0055527_10051632 383
298 3300003761 Ga0055535_1000934 Ga0055535_10009345 383
299 3300003762 Ga0055542_1000051 Ga0055542_100005194 383
300 3300003763 Ga0055529_1000333 Ga0055529_100033336 383
301 3300003771 Ga0055526_1003822 Ga0055526_10038223 383
302 3300003771 Ga0055526_1006065 Ga0055526_10060656 383
303 3300003771 Ga0055526_1018229 Ga0055526_10182292 383
304 3300003773 Ga0055537_1000320 Ga0055537_100032031 383
305 3300003773 Ga0055537_1001534 Ga0055537_10015342 383
306 3300003773 Ga0055537_1007598 Ga0055537_10075982 383
307 3300003775 Ga0055524_1000044 Ga0055524_1000044133 383
308 3300003775 Ga0055524_1000052 Ga0055524_100005288 383
309 3300003781 Ga0055536_1017883 Ga0055536_10178832 383
310 3300003784 Ga0055534_1001482 Ga0055534_10014826 383
311 3300003784 Ga0055534_1003391 Ga0055534_10033912 383
312 3300003784 Ga0055534_1003755 Ga0055534_10037552 383
313 3300003790 Ga0055528_1002526 Ga0055528_10025267 383
314 3300003790 Ga0055528_1002727 Ga0055528_10027273 383
315 3300003790 Ga0055528_1014474 Ga0055528_10144742 383
316 3300003790 Ga0055528_1016568 Ga0055528_10165682 383
317 3300003791 Ga0055530_10003990 Ga0055530_100039904 383
318 3300003791 Ga0055530_10028740 Ga0055530_100287402 383
319 3300003792 Ga0055540_1000019 Ga0055540_100001912 383
320 3300003792 Ga0055540_1000116 Ga0055540_100011643 383
321 3300003792 Ga0055540_1001799 Ga0055540_10017998 383
322 3300003792 Ga0055540_1007088 Ga0055540_10070883 383
323 3300003792 Ga0055540_1018406 Ga0055540_10184062 383
324 3300003792 Ga0055540_1020148 Ga0055540_10201482 383
325 3300003794 Ga0055531_10000001 Ga0055531_1000000193 383
326 3300003794 Ga0055531_10000250 Ga0055531_1000025043 383
327 3300003794 Ga0055531_10000360 Ga0055531_100003608 383
328 3300003794 Ga0055531_10001074 Ga0055531_1000107410 383
329 3300003794 Ga0055531_10005011 Ga0055531_100050113 383
330 3300003841 Ga0055541_1000053 Ga0055541_100005384 383
331 3300004625 Ga0055543_1000404 Ga0055543_10004048 383
332 3300004625 Ga0055543_1001848 Ga0055543_10018484 383
333 3300005262 Ga0065165_1000080 Ga0065165_1000080137 383
334 3300005262 Ga0065165_1000101 Ga0065165_1000101103 383
335 3300005262 Ga0065165_1011617 Ga0065165_10116172 383
336 3300005288 Ga0065714_10088736 Ga0065714_100887362 383
337 3300005289 Ga0065704_10152799 Ga0065704_101527991 383
338 3300005290 Ga0065712_10013487 Ga0065712_100134871 383
339 3300005293 Ga0065715_10109100 Ga0065715_101091002 383
340 3300005293 Ga0065715_10200115 Ga0065715_102001151 383
341 3300005295 Ga0065707_10017403 Ga0065707_100174031 383
342 3300005295 Ga0065707_10087447 Ga0065707_100874473 383
343 3300005328 Ga0070676_10006671 Ga0070676_100066713 383
344 3300005328 Ga0070676_10011485 Ga0070676_100114853 383
345 3300005328 Ga0070676_10030468 Ga0070676_100304682 383
346 3300005329 Ga0070683_100009064 Ga0070683_1000090647 383
347 3300005329 Ga0070683_100101987 Ga0070683_1001019872 383
348 3300005330 Ga0070690_100014678 Ga0070690_1000146784 383
349 3300005331 Ga0070670_100017831 Ga0070670_1000178312 383
350 3300005331 Ga0070670_100024246 Ga0070670_1000242462 383
351 3300005331 Ga0070670_100041714 Ga0070670_1000417142 383
352 3300005331 Ga0070670_100060294 Ga0070670_1000602942 383
353 3300005333 Ga0070677_10010696 Ga0070677_100106961 383
354 3300005333 Ga0070677_10020993 Ga0070677_100209932 383
355 3300005334 Ga0068869_100010988 Ga0068869_1000109884 383
356 3300005334 Ga0068869_100054844 Ga0068869_1000548442 383
357 3300005334 Ga0068869_100057452 Ga0068869_1000574522 383
358 3300005334 Ga0068869_100060701 Ga0068869_1000607012 383
359 3300005334 Ga0068869_100144839 Ga0068869_1001448391 383
360 3300005335 Ga0070666_10002017 Ga0070666_100020175 383
361 3300005335 Ga0070666_10002085 Ga0070666_100020856 383
362 3300005335 Ga0070666_10007234 Ga0070666_100072344 383
363 3300005335 Ga0070666_10166859 Ga0070666_101668591 383
364 3300005336 Ga0070680_100009175 Ga0070680_1000091753 383
365 3300005336 Ga0070680_100118137 Ga0070680_1001181372 383
366 3300005337 Ga0070682_100072046 Ga0070682_1000720461 383
367 3300005338 Ga0068868_100002479 Ga0068868_1000024794 383
368 3300005338 Ga0068868_100008720 Ga0068868_1000087202 383
369 3300005338 Ga0068868_100011294 Ga0068868_1000112945 383
370 3300005338 Ga0068868_100015252 Ga0068868_1000152523 383
371 3300005338 Ga0068868_100025044 Ga0068868_1000250442 383
372 3300005338 Ga0068868_100077031 Ga0068868_1000770312 383
373 3300005339 Ga0070660_100010146 Ga0070660_1000101462 383
374 3300005339 Ga0070660_100016617 Ga0070660_1000166174 383
375 3300005339 Ga0070660_100030279 Ga0070660_1000302792 383
376 3300005339 Ga0070660_100056082 Ga0070660_1000560822 383
377 3300005339 Ga0070660_100169243 Ga0070660_1001692432 383
378 3300005340 Ga0070689_100006450 Ga0070689_1000064503 383
379 3300005344 Ga0070661_100000438 Ga0070661_10000043814 383
380 3300005344 Ga0070661_100004052 Ga0070661_1000040522 383
381 3300005344 Ga0070661_100007525 Ga0070661_1000075254 383
382 3300005344 Ga0070661_100021533 Ga0070661_1000215333 383
383 3300005344 Ga0070661_100027172 Ga0070661_1000271722 383
384 3300005344 Ga0070661_100037457 Ga0070661_1000374572 383
385 3300005344 Ga0070661_100062540 Ga0070661_1000625402 383
386 3300005344 Ga0070661_100068487 Ga0070661_1000684872 383
387 3300005344 Ga0070661_100128680 Ga0070661_1001286802 383
388 3300005347 Ga0070668_100006235 Ga0070668_1000062353 383
389 3300005347 Ga0070668_100034620 Ga0070668_1000346202 383
390 3300005347 Ga0070668_100119179 Ga0070668_1001191792 383
391 3300005353 Ga0070669_100000836 Ga0070669_10000083610 383
392 3300005353 Ga0070669_100007603 Ga0070669_1000076033 383
393 3300005354 Ga0070675_100005877 Ga0070675_1000058775 383
394 3300005354 Ga0070675_100008456 Ga0070675_1000084564 383
395 3300005354 Ga0070675_100009844 Ga0070675_1000098442 383
396 3300005354 Ga0070675_100009921 Ga0070675_1000099211 383
397 3300005354 Ga0070675_100030409 Ga0070675_1000304092 383
398 3300005354 Ga0070675_100033037 Ga0070675_1000330372 383
399 3300005354 Ga0070675_100040122 Ga0070675_1000401222 383
400 3300005354 Ga0070675_100069679 Ga0070675_1000696792 383
401 3300005354 Ga0070675_100097175 Ga0070675_1000971752 383
402 3300005354 Ga0070675_100109297 Ga0070675_1001092972 383
403 3300005354 Ga0070675_100152851 Ga0070675_1001528512 383
404 3300005355 Ga0070671_100016262 Ga0070671_1000162624 383
405 3300005355 Ga0070671_100020139 Ga0070671_1000201393 383
406 3300005355 Ga0070671_100034619 Ga0070671_1000346192 383
407 3300005355 Ga0070671_100075349 Ga0070671_1000753492 383
408 3300005355 Ga0070671_100091607 Ga0070671_1000916071 383
409 3300005355 Ga0070671_100101544 Ga0070671_1001015442 383
410 3300005356 Ga0070674_100067268 Ga0070674_1000672682 383
411 3300005356 Ga0070674_100079454 Ga0070674_1000794542 383
412 3300005364 Ga0070673_100002109 Ga0070673_1000021095 383
413 3300005364 Ga0070673_100007014 Ga0070673_1000070142 383
414 3300005364 Ga0070673_100032447 Ga0070673_1000324472 383
415 3300005364 Ga0070673_100034161 Ga0070673_1000341612 383
416 3300005364 Ga0070673_100067153 Ga0070673_1000671533 383
417 3300005365 Ga0070688_100007417 Ga0070688_1000074173 383
418 3300005365 Ga0070688_100020548 Ga0070688_1000205482 383
419 3300005365 Ga0070688_100062864 Ga0070688_1000628642 383
420 3300005366 Ga0070659_100001517 Ga0070659_10000151711 383
421 3300005366 Ga0070659_100005912 Ga0070659_1000059127 383
422 3300005366 Ga0070659_100006674 Ga0070659_1000066748 383
423 3300005366 Ga0070659_100027105 Ga0070659_1000271053 383
424 3300005366 Ga0070659_100040928 Ga0070659_1000409282 383
425 3300005366 Ga0070659_100061022 Ga0070659_1000610222 383
426 3300005366 Ga0070659_100099618 Ga0070659_1000996181 383
427 3300005367 Ga0070667_100008976 Ga0070667_1000089764 383
428 3300005367 Ga0070667_100085453 Ga0070667_1000854532 383
429 3300005435 Ga0070714_100066057 Ga0070714_1000660571 383
430 3300005436 Ga0070713_100001286 Ga0070713_1000012864 383
431 3300005436 Ga0070713_100037564 Ga0070713_1000375642 383
432 3300005436 Ga0070713_100097345 Ga0070713_1000973452 383
433 3300005437 Ga0070710_10017813 Ga0070710_100178132 383
434 3300005439 Ga0070711_100165078 Ga0070711_1001650782 383
435 3300005440 Ga0070705_100167164 Ga0070705_1001671642 383
436 3300005441 Ga0070700_100005556 Ga0070700_1000055563 383
437 3300005445 Ga0070708_100002113 Ga0070708_1000021136 383
438 3300005445 Ga0070708_100039865 Ga0070708_1000398653 383
439 3300005455 Ga0070663_100001569 Ga0070663_1000015692 383
440 3300005455 Ga0070663_100001571 Ga0070663_1000015715 383
441 3300005455 Ga0070663_100018838 Ga0070663_1000188384 383
442 3300005455 Ga0070663_100032139 Ga0070663_1000321393 383
443 3300005455 Ga0070663_100042377 Ga0070663_1000423772 383
444 3300005456 Ga0070678_100002034 Ga0070678_1000020344 383
445 3300005456 Ga0070678_100011593 Ga0070678_1000115934 383
446 3300005456 Ga0070678_100016983 Ga0070678_1000169832 383
447 3300005456 Ga0070678_100042434 Ga0070678_1000424342 383
448 3300005456 Ga0070678_100106891 Ga0070678_1001068912 383
449 3300005457 Ga0070662_100000797 Ga0070662_10000079710 383
450 3300005457 Ga0070662_100003074 Ga0070662_1000030745 383
451 3300005457 Ga0070662_100015946 Ga0070662_1000159462 383
452 3300005457 Ga0070662_100022556 Ga0070662_1000225562 383
453 3300005457 Ga0070662_100044324 Ga0070662_1000443242 383
454 3300005458 Ga0070681_10005522 Ga0070681_100055225 383
455 3300005458 Ga0070681_10015862 Ga0070681_100158623 383
456 3300005458 Ga0070681_10039054 Ga0070681_100390542 383
457 3300005458 Ga0070681_10122983 Ga0070681_101229832 383
458 3300005458 Ga0070681_10250846 Ga0070681_102508461 383
459 3300005459 Ga0068867_100000072 Ga0068867_10000007241 383
460 3300005459 Ga0068867_100012146 Ga0068867_1000121463 383
461 3300005459 Ga0068867_100015998 Ga0068867_1000159982 383
462 3300005459 Ga0068867_100042119 Ga0068867_1000421192 383
463 3300005459 Ga0068867_100151478 Ga0068867_1001514782 383
464 3300005466 Ga0070685_10008232 Ga0070685_100082323 383
465 3300005467 Ga0070706_100003148 Ga0070706_1000031488 383
466 3300005530 Ga0070679_100002623 Ga0070679_1000026235 383
467 3300005530 Ga0070679_100013959 Ga0070679_1000139592 383
468 3300005530 Ga0070679_100027132 Ga0070679_1000271322 383
469 3300005535 Ga0070684_100005280 Ga0070684_1000052805 383
470 3300005535 Ga0070684_100025049 Ga0070684_1000250492 383
471 3300005535 Ga0070684_100113710 Ga0070684_1001137102 383
472 3300005539 Ga0068853_100008733 Ga0068853_1000087337 383
473 3300005539 Ga0068853_100010500 Ga0068853_1000105002 383
474 3300005539 Ga0068853_100051363 Ga0068853_1000513632 383
475 3300005539 Ga0068853_100200788 Ga0068853_1002007882 383
476 3300005543 Ga0070672_100006178 Ga0070672_1000061785 383
477 3300005543 Ga0070672_100012097 Ga0070672_1000120974 383
478 3300005543 Ga0070672_100043693 Ga0070672_1000436933 383
479 3300005543 Ga0070672_100079220 Ga0070672_1000792202 383
480 3300005546 Ga0070696_100045688 Ga0070696_1000456883 383
481 3300005548 Ga0070665_100001671 Ga0070665_1000016713 383
482 3300005548 Ga0070665_100014514 Ga0070665_1000145145 383
483 3300005548 Ga0070665_100026041 Ga0070665_1000260413 383
484 3300005548 Ga0070665_100031464 Ga0070665_1000314644 383
485 3300005563 Ga0068855_100001947 Ga0068855_1000019479 383
486 3300005563 Ga0068855_100013553 Ga0068855_1000135533 383
487 3300005563 Ga0068855_100020007 Ga0068855_1000200073 383
488 3300005563 Ga0068855_100021278 Ga0068855_1000212784 383
489 3300005563 Ga0068855_100022085 Ga0068855_1000220855 383
490 3300005563 Ga0068855_100064929 Ga0068855_1000649292 383
491 3300005563 Ga0068855_100284948 Ga0068855_1002849482 383
492 3300005564 Ga0070664_100000572 Ga0070664_1000005727 383
493 3300005564 Ga0070664_100004505 Ga0070664_1000045053 383
494 3300005564 Ga0070664_100010523 Ga0070664_1000105232 383
495 3300005564 Ga0070664_100011975 Ga0070664_1000119753 383
496 3300005564 Ga0070664_100017181 Ga0070664_1000171814 383
497 3300005564 Ga0070664_100035428 Ga0070664_1000354282 383
498 3300005564 Ga0070664_100056592 Ga0070664_1000565923 383
499 3300005564 Ga0070664_100109582 Ga0070664_1001095822 383
500 3300005564 Ga0070664_100151381 Ga0070664_1001513812 383
501 3300005577 Ga0068857_100002092 Ga0068857_10000209213 383
502 3300005577 Ga0068857_100009749 Ga0068857_1000097495 383
503 3300005577 Ga0068857_100019562 Ga0068857_1000195624 383
504 3300005577 Ga0068857_100043710 Ga0068857_1000437102 383
505 3300005578 Ga0068854_100002901 Ga0068854_1000029016 383
506 3300005578 Ga0068854_100004679 Ga0068854_1000046795 383
507 3300005578 Ga0068854_100005922 Ga0068854_1000059227 383
508 3300005578 Ga0068854_100008715 Ga0068854_1000087154 383
509 3300005578 Ga0068854_100010091 Ga0068854_1000100913 383
510 3300005578 Ga0068854_100202106 Ga0068854_1002021062 383
511 3300005614 Ga0068856_100003475 Ga0068856_1000034758 383
512 3300005614 Ga0068856_100004714 Ga0068856_1000047148 383
513 3300005614 Ga0068856_100013533 Ga0068856_1000135332 383
514 3300005614 Ga0068856_100060225 Ga0068856_1000602252 383
515 3300005614 Ga0068856_100200213 Ga0068856_1002002132 383
516 3300005615 Ga0070702_100008273 Ga0070702_1000082732 383
517 3300005615 Ga0070702_100013368 Ga0070702_1000133682 383
518 3300005615 Ga0070702_100035799 Ga0070702_1000357992 383
519 3300005616 Ga0068852_100006367 Ga0068852_1000063672 383
520 3300005616 Ga0068852_100009785 Ga0068852_1000097855 383
521 3300005616 Ga0068852_100011377 Ga0068852_1000113773 383
522 3300005616 Ga0068852_100016444 Ga0068852_1000164443 383
523 3300005616 Ga0068852_100029219 Ga0068852_1000292193 383
524 3300005616 Ga0068852_100050451 Ga0068852_1000504512 383
525 3300005616 Ga0068852_100103957 Ga0068852_1001039572 383
526 3300005616 Ga0068852_100170849 Ga0068852_1001708492 383
527 3300005616 Ga0068852_100275515 Ga0068852_1002755152 383
528 3300005617 Ga0068859_100001759 Ga0068859_10000175915 383
529 3300005617 Ga0068859_100010805 Ga0068859_1000108057 383
530 3300005617 Ga0068859_100036303 Ga0068859_1000363032 383
531 3300005617 Ga0068859_100046656 Ga0068859_1000466563 383
532 3300005617 Ga0068859_100342822 Ga0068859_1003428223 383
533 3300005618 Ga0068864_100002362 Ga0068864_1000023629 383
534 3300005618 Ga0068864_100005230 Ga0068864_1000052303 383
535 3300005618 Ga0068864_100005322 Ga0068864_1000053223 383
536 3300005618 Ga0068864_100011034 Ga0068864_1000110346 383
537 3300005618 Ga0068864_100014018 Ga0068864_1000140184 383
538 3300005618 Ga0068864_100080310 Ga0068864_1000803102 383
539 3300005618 Ga0068864_100094802 Ga0068864_1000948022 383
540 3300005718 Ga0068866_10001400 Ga0068866_100014002 383
541 3300005718 Ga0068866_10015287 Ga0068866_100152873 383
542 3300005719 Ga0068861_100001649 Ga0068861_1000016495 383
543 3300005719 Ga0068861_100002141 Ga0068861_1000021412 383
544 3300005719 Ga0068861_100006425 Ga0068861_1000064255 383
545 3300005719 Ga0068861_100010613 Ga0068861_1000106134 383
546 3300005719 Ga0068861_100014120 Ga0068861_1000141202 383
547 3300005719 Ga0068861_100021452 Ga0068861_1000214525 383
548 3300005834 Ga0068851_10004000 Ga0068851_100040003 383
549 3300005834 Ga0068851_10031226 Ga0068851_100312262 383
550 3300005834 Ga0068851_10041079 Ga0068851_100410792 383
551 3300005840 Ga0068870_10000981 Ga0068870_100009817 383
552 3300005841 Ga0068863_100007421 Ga0068863_1000074213 383
553 3300005841 Ga0068863_100009748 Ga0068863_1000097483 383
554 3300005841 Ga0068863_100025176 Ga0068863_1000251762 383
555 3300005841 Ga0068863_100025192 Ga0068863_1000251923 383
556 3300005841 Ga0068863_100056582 Ga0068863_1000565822 383
557 3300005841 Ga0068863_100106534 Ga0068863_1001065342 383
558 3300005841 Ga0068863_100137817 Ga0068863_1001378172 383
559 3300005842 Ga0068858_100000947 Ga0068858_1000009478 383
560 3300005842 Ga0068858_100007512 Ga0068858_1000075126 383
561 3300005842 Ga0068858_100057393 Ga0068858_1000573932 383
562 3300005842 Ga0068858_100096548 Ga0068858_1000965482 383
563 3300005843 Ga0068860_100000590 Ga0068860_10000059019 383
564 3300005843 Ga0068860_100052167 Ga0068860_1000521672 383
565 3300005843 Ga0068860_100082698 Ga0068860_1000826984 383
566 3300005843 Ga0068860_100144366 Ga0068860_1001443662 383
567 3300005844 Ga0068862_100013089 Ga0068862_1000130893 383
568 3300005844 Ga0068862_100014282 Ga0068862_1000142826 383
569 3300005844 Ga0068862_100034543 Ga0068862_1000345433 383
570 3300005844 Ga0068862_100037384 Ga0068862_1000373843 383
571 3300005844 Ga0068862_100043174 Ga0068862_1000431742 383
572 3300005844 Ga0068862_100060042 Ga0068862_1000600423 383
573 3300006038 Ga0075365_10005740 Ga0075365_100057404 383
574 3300006038 Ga0075365_10050093 Ga0075365_100500932 383
575 3300006038 Ga0075365_10092652 Ga0075365_100926521 383
576 3300006038 Ga0075365_10116201 Ga0075365_101162012 383
577 3300006038 Ga0075365_10145844 Ga0075365_101458442 383
578 3300006042 Ga0075368_10017820 Ga0075368_100178202 383
579 3300006042 Ga0075368_10046679 Ga0075368_100466792 383
580 3300006051 Ga0075364_10026805 Ga0075364_100268052 383
581 3300006051 Ga0075364_10035233 Ga0075364_100352332 383
582 3300006173 Ga0070716_100018621 Ga0070716_1000186213 383
583 3300006173 Ga0070716_100120684 Ga0070716_1001206842 383
584 3300006177 Ga0075362_10002448 Ga0075362_100024483 383
585 3300006177 Ga0075362_10031931 Ga0075362_100319312 383
586 3300006177 Ga0075362_10062616 Ga0075362_100626162 383
587 3300006178 Ga0075367_10009399 Ga0075367_100093992 383
588 3300006178 Ga0075367_10011488 Ga0075367_100114883 383
589 3300006178 Ga0075367_10029375 Ga0075367_100293752 383
590 3300006178 Ga0075367_10046968 Ga0075367_100469682 383
591 3300006195 Ga0075366_10001777 Ga0075366_100017773 383
592 3300006195 Ga0075366_10005505 Ga0075366_100055052 383
593 3300006195 Ga0075366_10061854 Ga0075366_100618542 383
594 3300006195 Ga0075366_10123098 Ga0075366_101230982 383
595 3300006237 Ga0097621_100009497 Ga0097621_1000094975 383
596 3300006237 Ga0097621_100009981 Ga0097621_1000099814 383
597 3300006237 Ga0097621_100038502 Ga0097621_1000385023 383
598 3300006237 Ga0097621_100039883 Ga0097621_1000398833 383
599 3300006237 Ga0097621_100069465 Ga0097621_1000694652 383
600 3300006237 Ga0097621_100303580 Ga0097621_1003035802 383
601 3300006237 Ga0097621_100350519 Ga0097621_1003505192 383
602 3300006353 Ga0075370_10000547 Ga0075370_100005476 383
603 3300006353 Ga0075370_10010371 Ga0075370_100103712 383
604 3300006353 Ga0075370_10010601 Ga0075370_100106013 383
605 3300006353 Ga0075370_10023495 Ga0075370_100234952 383
606 3300006358 Ga0068871_100003477 Ga0068871_1000034774 383
607 3300006358 Ga0068871_100063179 Ga0068871_1000631792 383
608 3300006358 Ga0068871_100097689 Ga0068871_1000976892 383
609 3300006358 Ga0068871_100099589 Ga0068871_1000995892 383
610 3300006871 Ga0075434_100025677 Ga0075434_1000256775 383
611 3300006880 Ga0075429_100000199 Ga0075429_10000019932 383
612 3300006880 Ga0075429_100043639 Ga0075429_1000436393 383
613 3300006881 Ga0068865_100002420 Ga0068865_1000024207 383
614 3300006881 Ga0068865_100020119 Ga0068865_1000201193 383
615 3300006914 Ga0075436_100018851 Ga0075436_1000188513 383
616 3300006931 Ga0097620_100001759 Ga0097620_1000017592 383
617 3300006931 Ga0097620_100010805 Ga0097620_1000108057 383
618 3300006931 Ga0097620_100036302 Ga0097620_1000363024 383
619 3300006931 Ga0097620_100046656 Ga0097620_1000466563 383
620 3300006931 Ga0097620_100342816 Ga0097620_1003428162 383
621 3300006942 Ga0099824_1027880 Ga0099824_10278802 383
622 3300006944 Ga0099823_1000108 Ga0099823_100010816 383
623 3300006946 Ga0079104_1000037 Ga0079104_100003734 383
624 3300006946 Ga0079104_1000206 Ga0079104_100020641 383
625 3300006948 Ga0099826_10006960 Ga0099826_100069603 383
626 3300007076 Ga0075435_100032473 Ga0075435_1000324733 383
627 3300009036 Ga0105244_10010566 Ga0105244_100105662 383
628 3300009092 Ga0105250_10000294 Ga0105250_1000029413 383
629 3300009093 Ga0105240_10012066 Ga0105240_1001206610 383
630 3300009093 Ga0105240_10031744 Ga0105240_100317442 383
631 3300009093 Ga0105240_10047500 Ga0105240_100475003 383
632 3300009093 Ga0105240_10051763 Ga0105240_100517634 383
633 3300009093 Ga0105240_10109992 Ga0105240_101099922 383
634 3300009093 Ga0105240_10316966 Ga0105240_103169662 383
635 3300009094 Ga0111539_10048149 Ga0111539_100481494 383
636 3300009098 Ga0105245_10060559 Ga0105245_100605592 383
637 3300009098 Ga0105245_10377880 Ga0105245_103778801 383
638 3300009098 Ga0105245_10387134 Ga0105245_103871342 383
639 3300009148 Ga0105243_10001108 Ga0105243_1000110811 383
640 3300009148 Ga0105243_10001868 Ga0105243_100018682 383
641 3300009148 Ga0105243_10120540 Ga0105243_101205402 383
642 3300009148 Ga0105243_10158622 Ga0105243_101586222 383
643 3300009174 Ga0105241_10004716 Ga0105241_100047166 383
644 3300009174 Ga0105241_10069834 Ga0105241_100698342 383
645 3300009176 Ga0105242_10011479 Ga0105242_100114794 383
646 3300009176 Ga0105242_10030183 Ga0105242_100301833 383
647 3300009176 Ga0105242_10049864 Ga0105242_100498643 383
648 3300009176 Ga0105242_10121374 Ga0105242_101213742 383
649 3300009177 Ga0105248_10000507 Ga0105248_1000050713 383
650 3300009177 Ga0105248_10007313 Ga0105248_100073137 383
651 3300009177 Ga0105248_10119810 Ga0105248_101198102 383
652 3300009177 Ga0105248_10160069 Ga0105248_101600692 383
653 3300009545 Ga0105237_10003214 Ga0105237_1000321410 383
654 3300009545 Ga0105237_10066737 Ga0105237_100667373 383
655 3300009545 Ga0105237_10181937 Ga0105237_101819372 383
656 3300009545 Ga0105237_10389713 Ga0105237_103897131 383
657 3300009551 Ga0105238_10000817 Ga0105238_1000081724 383
658 3300009551 Ga0105238_10018524 Ga0105238_100185244 383
659 3300009551 Ga0105238_10018739 Ga0105238_100187394 383
660 3300009551 Ga0105238_10083247 Ga0105238_100832472 383
661 3300009551 Ga0105238_10145997 Ga0105238_101459972 383
662 3300009551 Ga0105238_10180779 Ga0105238_101807792 383
663 3300009553 Ga0105249_10024640 Ga0105249_100246402 383
664 3300009553 Ga0105249_10099872 Ga0105249_100998722 383
665 3300009553 Ga0105249_10249714 Ga0105249_102497142 383
666 3300010375 Ga0105239_10003443 Ga0105239_1000344310 383
667 3300010375 Ga0105239_10024436 Ga0105239_100244363 383
668 3300010375 Ga0105239_10038542 Ga0105239_100385422 383
669 3300010375 Ga0105239_10051729 Ga0105239_100517292 383
670 3300010375 Ga0105239_10097148 Ga0105239_100971482 383
671 3300011119 Ga0105246_10057554 Ga0105246_100575542 383
672 3300012497 Ga0157319_1000008 Ga0157319_1000008105 383
673 3300012502 Ga0157347_1001428 Ga0157347_10014282 383
674 3300013100 Ga0157373_10004823 Ga0157373_100048234 383
675 3300013100 Ga0157373_10008907 Ga0157373_100089073 383
676 3300013102 Ga0157371_10007668 Ga0157371_100076684 383
677 3300013104 Ga0157370_10008735 Ga0157370_100087352 383
678 3300013104 Ga0157370_10032452 Ga0157370_100324523 383
679 3300013104 Ga0157370_10311775 Ga0157370_103117752 383
680 3300013105 Ga0157369_10007682 Ga0157369_100076823 383
681 3300013105 Ga0157369_10018375 Ga0157369_100183754 383
682 3300013105 Ga0157369_10021429 Ga0157369_100214292 383
683 3300013105 Ga0157369_10026832 Ga0157369_100268324 383
684 3300013296 Ga0157374_10000405 Ga0157374_1000040512 383
685 3300013296 Ga0157374_10020758 Ga0157374_100207583 383
686 3300013296 Ga0157374_10078208 Ga0157374_100782082 383
687 3300013296 Ga0157374_10167221 Ga0157374_101672212 383
688 3300013297 Ga0157378_10008627 Ga0157378_100086272 383
689 3300013297 Ga0157378_10087901 Ga0157378_100879013 383
690 3300013306 Ga0163162_10002118 Ga0163162_100021184 383
691 3300013306 Ga0163162_10004629 Ga0163162_100046294 383
692 3300013306 Ga0163162_10020602 Ga0163162_100206024 383
693 3300013306 Ga0163162_10026350 Ga0163162_100263502 383
694 3300013306 Ga0163162_10048256 Ga0163162_100482562 383
695 3300013306 Ga0163162_10100914 Ga0163162_101009141 383
696 3300013306 Ga0163162_10182405 Ga0163162_101824053 383
697 3300013306 Ga0163162_10219221 Ga0163162_102192212 383
698 3300013307 Ga0157372_10010109 Ga0157372_100101096 383
699 3300013307 Ga0157372_10015837 Ga0157372_100158372 383
700 3300013307 Ga0157372_10189038 Ga0157372_101890382 383
701 3300013308 Ga0157375_10007074 Ga0157375_100070748 383
702 3300013308 Ga0157375_10057331 Ga0157375_100573312 383
703 3300014325 Ga0163163_10020056 Ga0163163_100200563 383
704 3300014326 Ga0157380_10026083 Ga0157380_100260832 383
705 3300014497 Ga0182008_10013362 Ga0182008_100133622 383
706 3300014745 Ga0157377_10000075 Ga0157377_1000007545 383
707 3300014968 Ga0157379_10006796 Ga0157379_100067963 383
708 3300014968 Ga0157379_10012230 Ga0157379_100122303 383
709 3300014968 Ga0157379_10017154 Ga0157379_100171545 383
710 3300014968 Ga0157379_10154770 Ga0157379_101547702 383
711 3300014969 Ga0157376_10005741 Ga0157376_100057413 383
712 3300014969 Ga0157376_10067109 Ga0157376_100671092 383
713 3300014969 Ga0157376_10133207 Ga0157376_101332072 383
714 3300014969 Ga0157376_10198070 Ga0157376_101980702 383
715 3300015262 Ga0182007_10003324 Ga0182007_100033244 383
716 3300015262 Ga0182007_10003382 Ga0182007_100033822 383
717 3300015265 Ga0182005_1010533 Ga0182005_10105332 383
718 3300015683 Ga0183362_10003 Ga0183362_10003884 383
719 3300017792 Ga0163161_10003044 Ga0163161_100030449 383
720 3300017792 Ga0163161_10011045 Ga0163161_100110453 383
721 3300017792 Ga0163161_10017948 Ga0163161_100179483 383
722 3300017792 Ga0163161_10105089 Ga0163161_101050892 383
723 3300021361 Ga0213872_10000006 Ga0213872_1000000668 383
724 3300021361 Ga0213872_10000007 Ga0213872_10000007185 383
725 3300021361 Ga0213872_10000085 Ga0213872_1000008512 383
726 3300021361 Ga0213872_10011538 Ga0213872_100115382 383
727 3300025206 Ga0209435_100003 Ga0209435_100003214 383
728 3300025224 Ga0209784_100083 Ga0209784_10008386 383
729 3300025225 Ga0209566_100102 Ga0209566_10010286 383
730 3300025226 Ga0209674_100041 Ga0209674_100041182 383
731 3300025226 Ga0209674_100125 Ga0209674_10012586 383
732 3300025228 Ga0209672_100490 Ga0209672_1004902 383
733 3300025229 Ga0209147_103153 Ga0209147_1031533 383
734 3300025230 Ga0209563_100043 Ga0209563_100043182 383
735 3300025230 Ga0209563_100120 Ga0209563_10012086 383
736 3300025231 Ga0207427_100646 Ga0207427_10064610 383
737 3300025242 Ga0209258_100132 Ga0209258_10013293 383
738 3300025242 Ga0209258_100344 Ga0209258_10034422 383
739 3300025242 Ga0209258_100785 Ga0209258_1007858 383
740 3300025245 Ga0207425_1000797 Ga0207425_10007973 383
741 3300025245 Ga0207425_1007126 Ga0207425_10071262 383
742 3300025246 Ga0209646_1000008 Ga0209646_1000008214 383
743 3300025246 Ga0209646_1000069 Ga0209646_1000069111 383
744 3300025246 Ga0209646_1000723 Ga0209646_10007236 383
745 3300025250 Ga0209026_1000006 Ga0209026_1000006206 383
746 3300025250 Ga0209026_1000007 Ga0209026_1000007214 383
747 3300025250 Ga0209026_1003125 Ga0209026_10031253 383
748 3300025253 Ga0209677_100076 Ga0209677_10007686 383
749 3300025253 Ga0209677_100096 Ga0209677_10009685 383
750 3300025253 Ga0209677_101194 Ga0209677_1011944 383
751 3300025253 Ga0209677_101643 Ga0209677_1016433 383
752 3300025254 Ga0209148_1000007 Ga0209148_10000071252 383
753 3300025256 Ga0209759_1000026 Ga0209759_100002666 383
754 3300025256 Ga0209759_1000075 Ga0209759_1000075111 383
755 3300025256 Ga0209759_1001215 Ga0209759_10012156 383
756 3300025256 Ga0209759_1001295 Ga0209759_10012958 383
757 3300025256 Ga0209759_1017548 Ga0209759_10175482 383
758 3300025258 Ga0209129_1000012 Ga0209129_1000012361 383
759 3300025258 Ga0209129_1000084 Ga0209129_100008439 383
760 3300025263 Ga0209565_1000169 Ga0209565_100016937 383
761 3300025263 Ga0209565_1000932 Ga0209565_100093212 383
762 3300025263 Ga0209565_1001971 Ga0209565_10019716 383
763 3300025263 Ga0209565_1004734 Ga0209565_10047343 383
764 3300025263 Ga0209565_1008810 Ga0209565_10088102 383
765 3300025272 Ga0209455_1000242 Ga0209455_100024237 383
766 3300025273 Ga0209673_1000009 Ga0209673_1000009438 383
767 3300025273 Ga0209673_1000012 Ga0209673_1000012339 383
768 3300025273 Ga0209673_1000114 Ga0209673_100011437 383
769 3300025273 Ga0209673_1001414 Ga0209673_10014143 383
770 3300025273 Ga0209673_1003881 Ga0209673_10038815 383
771 3300025273 Ga0209673_1006922 Ga0209673_10069222 383
772 3300025273 Ga0209673_1010298 Ga0209673_10102982 383
773 3300025273 Ga0209673_1014476 Ga0209673_10144762 383
774 3300025273 Ga0209673_1020689 Ga0209673_10206892 383
775 3300025284 Ga0209130_1000064 Ga0209130_100006454 383
776 3300025284 Ga0209130_1000571 Ga0209130_10005717 383
777 3300025284 Ga0209130_1000712 Ga0209130_10007126 383
778 3300025284 Ga0209130_1002101 Ga0209130_10021018 383
779 3300025284 Ga0209130_1010938 Ga0209130_10109382 383
780 3300025291 Ga0209675_1000062 Ga0209675_100006237 383
781 3300025291 Ga0209675_1000144 Ga0209675_10001443 383
782 3300025291 Ga0209675_1001716 Ga0209675_10017164 383
783 3300025291 Ga0209675_1005868 Ga0209675_10058682 383
784 3300025291 Ga0209675_1006789 Ga0209675_10067892 383
785 3300025292 Ga0209676_1000051 Ga0209676_1000051203 383
786 3300025292 Ga0209676_1000415 Ga0209676_10004154 383
787 3300025292 Ga0209676_1006391 Ga0209676_10063914 383
788 3300025294 Ga0209025_1000719 Ga0209025_100071951 383
789 3300025294 Ga0209025_1000861 Ga0209025_100086142 383
790 3300025294 Ga0209025_1003734 Ga0209025_10037346 383
791 3300025294 Ga0209025_1004082 Ga0209025_10040826 383
792 3300025294 Ga0209025_1010095 Ga0209025_10100953 383
793 3300025294 Ga0209025_1021688 Ga0209025_10216882 383
794 3300025294 Ga0209025_1026809 Ga0209025_10268093 383
795 3300025295 Ga0209564_1000008 Ga0209564_1000008630 383
796 3300025295 Ga0209564_1000022 Ga0209564_1000022153 383
797 3300025295 Ga0209564_1000414 Ga0209564_10004148 383
798 3300025295 Ga0209564_1000613 Ga0209564_10006138 383
799 3300025295 Ga0209564_1002503 Ga0209564_10025039 383
800 3300025295 Ga0209564_1002535 Ga0209564_10025358 383
801 3300025295 Ga0209564_1007735 Ga0209564_10077352 383
802 3300025297 Ga0209758_1000099 Ga0209758_100009996 383
803 3300025297 Ga0209758_1002249 Ga0209758_10022499 383
804 3300025297 Ga0209758_1009725 Ga0209758_10097253 383
805 3300025298 Ga0209050_1000044 Ga0209050_1000044143 383
806 3300025298 Ga0209050_1000052 Ga0209050_100005241 383
807 3300025298 Ga0209050_1001274 Ga0209050_10012742 383
808 3300025298 Ga0209050_1001635 Ga0209050_100163511 383
809 3300025298 Ga0209050_1001761 Ga0209050_100176112 383
810 3300025298 Ga0209050_1001765 Ga0209050_100176512 383
811 3300025298 Ga0209050_1003656 Ga0209050_100365610 383
812 3300025299 Ga0209256_1000003 Ga0209256_1000003593 383
813 3300025299 Ga0209256_1000036 Ga0209256_1000036218 383
814 3300025299 Ga0209256_1000206 Ga0209256_10002068 383
815 3300025299 Ga0209256_1000239 Ga0209256_100023939 383
816 3300025302 Ga0207426_1000049 Ga0207426_1000049144 383
817 3300025302 Ga0207426_1000086 Ga0207426_100008640 383
818 3300025302 Ga0207426_1000116 Ga0207426_100011631 383
819 3300025302 Ga0207426_1000346 Ga0207426_100034639 383
820 3300025302 Ga0207426_1003514 Ga0207426_10035146 383
821 3300025303 Ga0209051_1000015 Ga0209051_1000015487 383
822 3300025303 Ga0209051_1000025 Ga0209051_1000025282 383
823 3300025303 Ga0209051_1000031 Ga0209051_1000031143 383
824 3300025303 Ga0209051_1000071 Ga0209051_1000071169 383
825 3300025303 Ga0209051_1000420 Ga0209051_100042013 383
826 3300025303 Ga0209051_1000492 Ga0209051_100049223 383
827 3300025303 Ga0209051_1000752 Ga0209051_10007525 383
828 3300025303 Ga0209051_1001081 Ga0209051_100108113 383
829 3300025303 Ga0209051_1001319 Ga0209051_100131917 383
830 3300025303 Ga0209051_1002112 Ga0209051_10021128 383
831 3300025303 Ga0209051_1007962 Ga0209051_10079624 383
832 3300025303 Ga0209051_1019510 Ga0209051_10195102 383
833 3300025303 Ga0209051_1026024 Ga0209051_10260242 383
834 3300025304 Ga0209257_1000033 Ga0209257_1000033180 383
835 3300025304 Ga0209257_1000037 Ga0209257_1000037258 383
836 3300025304 Ga0209257_1000039 Ga0209257_1000039326 383
837 3300025304 Ga0209257_1000058 Ga0209257_1000058137 383
838 3300025304 Ga0209257_1000367 Ga0209257_100036712 383
839 3300025304 Ga0209257_1000719 Ga0209257_100071943 383
840 3300025304 Ga0209257_1031541 Ga0209257_10315411 383
841 3300025315 Ga0207697_10000580 Ga0207697_1000058011 383
842 3300025315 Ga0207697_10004433 Ga0207697_100044334 383
843 3300025321 Ga0207656_10080061 Ga0207656_100800612 383
844 3300025711 Ga0207696_1001482 Ga0207696_10014824 383
845 3300025728 Ga0207655_1000477 Ga0207655_100047737 383
846 3300025893 Ga0207682_10000010 Ga0207682_1000001063 383
847 3300025893 Ga0207682_10002877 Ga0207682_100028774 383
848 3300025893 Ga0207682_10018734 Ga0207682_100187342 383
849 3300025893 Ga0207682_10020527 Ga0207682_100205272 383
850 3300025901 Ga0207688_10000541 Ga0207688_100005416 383
851 3300025901 Ga0207688_10147645 Ga0207688_101476452 383
852 3300025903 Ga0207680_10007194 Ga0207680_100071943 383
853 3300025903 Ga0207680_10017182 Ga0207680_100171823 383
854 3300025903 Ga0207680_10019704 Ga0207680_100197043 383
855 3300025905 Ga0207685_10008993 Ga0207685_100089932 383
856 3300025906 Ga0207699_10106162 Ga0207699_101061622 383
857 3300025907 Ga0207645_10001138 Ga0207645_1000113815 383
858 3300025907 Ga0207645_10002795 Ga0207645_100027958 383
859 3300025907 Ga0207645_10010204 Ga0207645_100102043 383
860 3300025907 Ga0207645_10020426 Ga0207645_100204262 383
861 3300025907 Ga0207645_10041651 Ga0207645_100416512 383
862 3300025907 Ga0207645_10074755 Ga0207645_100747552 383
863 3300025908 Ga0207643_10000358 Ga0207643_1000035815 383
864 3300025908 Ga0207643_10045783 Ga0207643_100457832 383
865 3300025909 Ga0207705_10046815 Ga0207705_100468152 383
866 3300025909 Ga0207705_10062003 Ga0207705_100620033 383
867 3300025910 Ga0207684_10003773 Ga0207684_100037738 383
868 3300025911 Ga0207654_10014797 Ga0207654_100147973 383
869 3300025912 Ga0207707_10032526 Ga0207707_100325264 383
870 3300025912 Ga0207707_10050800 Ga0207707_100508002 383
871 3300025912 Ga0207707_10069151 Ga0207707_100691512 383
872 3300025912 Ga0207707_10220456 Ga0207707_102204562 383
873 3300025913 Ga0207695_10013680 Ga0207695_100136802 383
874 3300025913 Ga0207695_10080597 Ga0207695_100805972 383
875 3300025913 Ga0207695_10121591 Ga0207695_101215912 383
876 3300025913 Ga0207695_10184912 Ga0207695_101849122 383
877 3300025914 Ga0207671_10002520 Ga0207671_100025209 383
878 3300025914 Ga0207671_10017480 Ga0207671_100174803 383
879 3300025915 Ga0207693_10002709 Ga0207693_1000270910 383
880 3300025915 Ga0207693_10156306 Ga0207693_101563062 383
881 3300025917 Ga0207660_10120102 Ga0207660_101201022 383
882 3300025918 Ga0207662_10012419 Ga0207662_100124193 383
883 3300025919 Ga0207657_10000329 Ga0207657_1000032919 383
884 3300025919 Ga0207657_10003889 Ga0207657_100038893 383
885 3300025919 Ga0207657_10029367 Ga0207657_100293675 383
886 3300025919 Ga0207657_10041771 Ga0207657_100417712 383
887 3300025919 Ga0207657_10069270 Ga0207657_100692703 383
888 3300025919 Ga0207657_10103581 Ga0207657_101035813 383
889 3300025919 Ga0207657_10140586 Ga0207657_101405862 383
890 3300025920 Ga0207649_10003489 Ga0207649_100034893 383
891 3300025920 Ga0207649_10040363 Ga0207649_100403632 383
892 3300025921 Ga0207652_10083435 Ga0207652_100834351 383
893 3300025921 Ga0207652_10140993 Ga0207652_101409932 383
894 3300025921 Ga0207652_10143688 Ga0207652_101436882 383
895 3300025923 Ga0207681_10000593 Ga0207681_100005939 383
896 3300025923 Ga0207681_10003975 Ga0207681_100039754 383
897 3300025923 Ga0207681_10005852 Ga0207681_100058523 383
898 3300025923 Ga0207681_10011148 Ga0207681_100111483 383
899 3300025923 Ga0207681_10023399 Ga0207681_100233992 383
900 3300025923 Ga0207681_10050755 Ga0207681_100507552 383
901 3300025923 Ga0207681_10193381 Ga0207681_101933812 383
902 3300025924 Ga0207694_10001061 Ga0207694_100010613 383
903 3300025924 Ga0207694_10001640 Ga0207694_100016402 383
904 3300025924 Ga0207694_10015585 Ga0207694_100155854 383
905 3300025924 Ga0207694_10053926 Ga0207694_100539262 383
906 3300025924 Ga0207694_10112853 Ga0207694_101128531 383
907 3300025924 Ga0207694_10305178 Ga0207694_103051781 383
908 3300025925 Ga0207650_10001551 Ga0207650_100015514 383
909 3300025925 Ga0207650_10002902 Ga0207650_100029023 383
910 3300025925 Ga0207650_10046033 Ga0207650_100460332 383
911 3300025925 Ga0207650_10058264 Ga0207650_100582642 383
912 3300025925 Ga0207650_10059741 Ga0207650_100597412 383
913 3300025925 Ga0207650_10071603 Ga0207650_100716032 383
914 3300025925 Ga0207650_10136531 Ga0207650_101365312 383
915 3300025926 Ga0207659_10001370 Ga0207659_100013704 383
916 3300025926 Ga0207659_10002674 Ga0207659_100026742 383
917 3300025926 Ga0207659_10008500 Ga0207659_100085002 383
918 3300025926 Ga0207659_10010170 Ga0207659_100101704 383
919 3300025926 Ga0207659_10027013 Ga0207659_100270132 383
920 3300025926 Ga0207659_10082147 Ga0207659_100821472 383
921 3300025926 Ga0207659_10084837 Ga0207659_100848372 383
922 3300025926 Ga0207659_10102409 Ga0207659_101024092 383
923 3300025927 Ga0207687_10011753 Ga0207687_100117533 383
924 3300025927 Ga0207687_10040982 Ga0207687_100409822 383
925 3300025928 Ga0207700_10001214 Ga0207700_100012144 383
926 3300025928 Ga0207700_10004270 Ga0207700_100042702 383
927 3300025928 Ga0207700_10237960 Ga0207700_102379602 383
928 3300025929 Ga0207664_10014950 Ga0207664_100149503 383
929 3300025929 Ga0207664_10085161 Ga0207664_100851612 383
930 3300025931 Ga0207644_10001724 Ga0207644_100017248 383
931 3300025931 Ga0207644_10002626 Ga0207644_1000262611 383
932 3300025931 Ga0207644_10004468 Ga0207644_100044685 383
933 3300025931 Ga0207644_10006053 Ga0207644_100060534 383
934 3300025931 Ga0207644_10011045 Ga0207644_100110453 383
935 3300025931 Ga0207644_10018741 Ga0207644_100187412 383
936 3300025931 Ga0207644_10022596 Ga0207644_100225963 383
937 3300025931 Ga0207644_10023348 Ga0207644_100233483 383
938 3300025931 Ga0207644_10049843 Ga0207644_100498432 383
939 3300025931 Ga0207644_10092516 Ga0207644_100925161 383
940 3300025932 Ga0207690_10005743 Ga0207690_100057432 383
941 3300025932 Ga0207690_10012599 Ga0207690_100125993 383
942 3300025932 Ga0207690_10014780 Ga0207690_100147802 383
943 3300025932 Ga0207690_10169038 Ga0207690_101690381 383
944 3300025932 Ga0207690_10187930 Ga0207690_101879302 383
945 3300025933 Ga0207706_10000133 Ga0207706_1000013368 383
946 3300025933 Ga0207706_10007037 Ga0207706_100070374 383
947 3300025933 Ga0207706_10008413 Ga0207706_100084137 383
948 3300025933 Ga0207706_10086080 Ga0207706_100860802 383
949 3300025934 Ga0207686_10000211 Ga0207686_100002119 383
950 3300025934 Ga0207686_10002504 Ga0207686_100025041 383
951 3300025934 Ga0207686_10095325 Ga0207686_100953252 383
952 3300025934 Ga0207686_10148630 Ga0207686_101486302 383
953 3300025935 Ga0207709_10000167 Ga0207709_1000016725 383
954 3300025935 Ga0207709_10000625 Ga0207709_1000062513 383
955 3300025935 Ga0207709_10002678 Ga0207709_100026784 383
956 3300025935 Ga0207709_10003407 Ga0207709_100034073 383
957 3300025935 Ga0207709_10078818 Ga0207709_100788182 383
958 3300025935 Ga0207709_10115924 Ga0207709_101159242 383
959 3300025936 Ga0207670_10012185 Ga0207670_100121853 383
960 3300025936 Ga0207670_10035827 Ga0207670_100358272 383
961 3300025937 Ga0207669_10008328 Ga0207669_100083284 383
962 3300025937 Ga0207669_10064387 Ga0207669_100643872 383
963 3300025938 Ga0207704_10008529 Ga0207704_100085292 383
964 3300025938 Ga0207704_10012485 Ga0207704_100124852 383
965 3300025938 Ga0207704_10029819 Ga0207704_100298192 383
966 3300025939 Ga0207665_10054137 Ga0207665_100541372 383
967 3300025940 Ga0207691_10000027 Ga0207691_1000002711 383
968 3300025940 Ga0207691_10001454 Ga0207691_1000145423 383
969 3300025940 Ga0207691_10001835 Ga0207691_100018357 383
970 3300025940 Ga0207691_10002573 Ga0207691_100025735 383
971 3300025940 Ga0207691_10002901 Ga0207691_100029018 383
972 3300025940 Ga0207691_10007782 Ga0207691_100077829 383
973 3300025940 Ga0207691_10020289 Ga0207691_100202893 383
974 3300025940 Ga0207691_10057597 Ga0207691_100575972 383
975 3300025940 Ga0207691_10145691 Ga0207691_101456912 383
976 3300025941 Ga0207711_10000116 Ga0207711_1000011628 383
977 3300025941 Ga0207711_10008341 Ga0207711_100083413 383
978 3300025941 Ga0207711_10053069 Ga0207711_100530692 383
979 3300025941 Ga0207711_10082785 Ga0207711_100827852 383
980 3300025941 Ga0207711_10114324 Ga0207711_101143242 383
981 3300025941 Ga0207711_10164693 Ga0207711_101646933 383
982 3300025941 Ga0207711_10259025 Ga0207711_102590251 383
983 3300025942 Ga0207689_10003361 Ga0207689_1000336111 383
984 3300025942 Ga0207689_10017399 Ga0207689_100173992 383
985 3300025942 Ga0207689_10018716 Ga0207689_100187163 383
986 3300025942 Ga0207689_10028908 Ga0207689_100289083 383
987 3300025942 Ga0207689_10039845 Ga0207689_100398452 383
988 3300025942 Ga0207689_10074386 Ga0207689_100743862 383
989 3300025944 Ga0207661_10006951 Ga0207661_100069513 383
990 3300025944 Ga0207661_10107900 Ga0207661_101079002 383
991 3300025944 Ga0207661_10185692 Ga0207661_101856921 383
992 3300025945 Ga0207679_10004476 Ga0207679_100044767 383
993 3300025945 Ga0207679_10016114 Ga0207679_100161143 383
994 3300025945 Ga0207679_10037529 Ga0207679_100375292 383
995 3300025945 Ga0207679_10038046 Ga0207679_100380462 383
996 3300025945 Ga0207679_10045174 Ga0207679_100451742 383
997 3300025945 Ga0207679_10085817 Ga0207679_100858172 383
998 3300025949 Ga0207667_10001197 Ga0207667_1000119710 383
999 3300025949 Ga0207667_10015903 Ga0207667_100159034 383
1000 3300025949 Ga0207667_10027706 Ga0207667_100277063 383
1001 3300025949 Ga0207667_10044540 Ga0207667_100445402 383
1002 3300025949 Ga0207667_10050611 Ga0207667_100506112 383
1003 3300025949 Ga0207667_10056478 Ga0207667_100564783 383
1004 3300025949 Ga0207667_10060239 Ga0207667_100602394 383
1005 3300025949 Ga0207667_10093968 Ga0207667_100939682 383
1006 3300025949 Ga0207667_10127343 Ga0207667_101273432 383
1007 3300025949 Ga0207667_10176472 Ga0207667_101764722 383
1008 3300025949 Ga0207667_10189509 Ga0207667_101895092 383
1009 3300025960 Ga0207651_10023081 Ga0207651_100230812 383
1010 3300025960 Ga0207651_10028463 Ga0207651_100284634 383
1011 3300025960 Ga0207651_10113559 Ga0207651_101135591 383
1012 3300025961 Ga0207712_10002369 Ga0207712_100023696 383
1013 3300025961 Ga0207712_10091176 Ga0207712_100911762 383
1014 3300025972 Ga0207668_10014276 Ga0207668_100142762 383
1015 3300025972 Ga0207668_10109124 Ga0207668_101091242 383
1016 3300025981 Ga0207640_10002943 Ga0207640_100029436 383
1017 3300025981 Ga0207640_10028299 Ga0207640_100282993 383
1018 3300025981 Ga0207640_10042960 Ga0207640_100429602 383
1019 3300025986 Ga0207658_10002879 Ga0207658_100028796 383
1020 3300025986 Ga0207658_10018099 Ga0207658_100180992 383
1021 3300025986 Ga0207658_10025597 Ga0207658_100255972 383
1022 3300025986 Ga0207658_10029188 Ga0207658_100291882 383
1023 3300026023 Ga0207677_10000188 Ga0207677_100001884 383
1024 3300026023 Ga0207677_10002710 Ga0207677_100027105 383
1025 3300026023 Ga0207677_10002992 Ga0207677_100029924 383
1026 3300026023 Ga0207677_10009054 Ga0207677_100090543 383
1027 3300026023 Ga0207677_10029670 Ga0207677_100296703 383
1028 3300026023 Ga0207677_10032646 Ga0207677_100326461 383
1029 3300026023 Ga0207677_10040742 Ga0207677_100407422 383
1030 3300026035 Ga0207703_10000806 Ga0207703_100008064 383
1031 3300026035 Ga0207703_10003131 Ga0207703_100031312 383
1032 3300026035 Ga0207703_10005198 Ga0207703_100051989 383
1033 3300026035 Ga0207703_10031777 Ga0207703_100317772 383
1034 3300026035 Ga0207703_10058280 Ga0207703_100582802 383
1035 3300026035 Ga0207703_10114082 Ga0207703_101140821 383
1036 3300026035 Ga0207703_10137353 Ga0207703_101373532 383
1037 3300026041 Ga0207639_10007106 Ga0207639_100071066 383
1038 3300026041 Ga0207639_10026653 Ga0207639_100266533 383
1039 3300026041 Ga0207639_10273666 Ga0207639_102736661 383
1040 3300026067 Ga0207678_10001503 Ga0207678_1000150311 383
1041 3300026067 Ga0207678_10002200 Ga0207678_100022005 383
1042 3300026067 Ga0207678_10005364 Ga0207678_100053649 383
1043 3300026067 Ga0207678_10149293 Ga0207678_101492932 383
1044 3300026075 Ga0207708_10002089 Ga0207708_100020898 383
1045 3300026075 Ga0207708_10038327 Ga0207708_100383272 383
1046 3300026075 Ga0207708_10054734 Ga0207708_100547342 383
1047 3300026078 Ga0207702_10000305 Ga0207702_100003059 383
1048 3300026078 Ga0207702_10054890 Ga0207702_100548902 383
1049 3300026078 Ga0207702_10125097 Ga0207702_101250972 383
1050 3300026078 Ga0207702_10245474 Ga0207702_102454741 383
1051 3300026088 Ga0207641_10006528 Ga0207641_100065289 383
1052 3300026088 Ga0207641_10009569 Ga0207641_100095693 383
1053 3300026088 Ga0207641_10024259 Ga0207641_100242592 383
1054 3300026088 Ga0207641_10033560 Ga0207641_100335602 383
1055 3300026088 Ga0207641_10034850 Ga0207641_100348502 383
1056 3300026088 Ga0207641_10038820 Ga0207641_100388202 383
1057 3300026088 Ga0207641_10051462 Ga0207641_100514622 383
1058 3300026088 Ga0207641_10054343 Ga0207641_100543433 383
1059 3300026088 Ga0207641_10135260 Ga0207641_101352601 383
1060 3300026089 Ga0207648_10000286 Ga0207648_1000028615 383
1061 3300026089 Ga0207648_10000878 Ga0207648_1000087825 383
1062 3300026089 Ga0207648_10002947 Ga0207648_1000294715 383
1063 3300026089 Ga0207648_10008332 Ga0207648_100083322 383
1064 3300026089 Ga0207648_10051982 Ga0207648_100519823 383
1065 3300026089 Ga0207648_10166579 Ga0207648_101665792 383
1066 3300026095 Ga0207676_10000230 Ga0207676_1000023041 383
1067 3300026095 Ga0207676_10003281 Ga0207676_100032814 383
1068 3300026095 Ga0207676_10004989 Ga0207676_100049894 383
1069 3300026095 Ga0207676_10012098 Ga0207676_100120983 383
1070 3300026095 Ga0207676_10017798 Ga0207676_100177982 383
1071 3300026095 Ga0207676_10036862 Ga0207676_100368623 383
1072 3300026095 Ga0207676_10041475 Ga0207676_100414751 383
1073 3300026095 Ga0207676_10082562 Ga0207676_100825622 383
1074 3300026095 Ga0207676_10230458 Ga0207676_102304582 383
1075 3300026116 Ga0207674_10000182 Ga0207674_1000018267 383
1076 3300026116 Ga0207674_10001017 Ga0207674_100010179 383
1077 3300026116 Ga0207674_10001136 Ga0207674_1000113611 383
1078 3300026116 Ga0207674_10006862 Ga0207674_100068621 383
1079 3300026116 Ga0207674_10034160 Ga0207674_100341603 383
1080 3300026116 Ga0207674_10053331 Ga0207674_100533313 383
1081 3300026116 Ga0207674_10160967 Ga0207674_101609672 383
1082 3300026116 Ga0207674_10224317 Ga0207674_102243172 383
1083 3300026118 Ga0207675_100001247 Ga0207675_1000012477 383
1084 3300026118 Ga0207675_100001372 Ga0207675_10000137223 383
1085 3300026118 Ga0207675_100001900 Ga0207675_10000190013 383
1086 3300026118 Ga0207675_100008217 Ga0207675_1000082172 383
1087 3300026121 Ga0207683_10000285 Ga0207683_1000028512 383
1088 3300026121 Ga0207683_10000364 Ga0207683_1000036428 383
1089 3300026121 Ga0207683_10004747 Ga0207683_100047474 383
1090 3300026121 Ga0207683_10013264 Ga0207683_100132644 383
1091 3300026121 Ga0207683_10013981 Ga0207683_100139813 383
1092 3300026121 Ga0207683_10020604 Ga0207683_100206042 383
1093 3300026121 Ga0207683_10120473 Ga0207683_101204732 383
1094 3300026121 Ga0207683_10128511 Ga0207683_101285112 383
1095 3300026142 Ga0207698_10003503 Ga0207698_100035036 383
1096 3300026142 Ga0207698_10013855 Ga0207698_100138553 383
1097 3300026142 Ga0207698_10041103 Ga0207698_100411033 383
1098 3300026142 Ga0207698_10062786 Ga0207698_100627862 383
1099 3300026142 Ga0207698_10132975 Ga0207698_101329752 383
1100 3300026142 Ga0207698_10208567 Ga0207698_102085672 383
1101 3300027111 Ga0209281_1000002 Ga0209281_1000002818 383
1102 3300027111 Ga0209281_1000259 Ga0209281_100025940 383
1103 3300027296 Ga0209389_1006219 Ga0209389_10062198 383
1104 3300027312 Ga0209371_1014178 Ga0209371_10141782 383
1105 3300027395 Ga0209996_1005277 Ga0209996_10052772 383
1106 3300027666 Ga0209282_1000317 Ga0209282_10003174 383
1107 3300027682 Ga0209971_1001210 Ga0209971_10012102 383
1108 3300027695 Ga0209966_1000035 Ga0209966_100003517 383
1109 3300027717 Ga0209998_10001388 Ga0209998_100013882 383
1110 3300027866 Ga0209813_10014738 Ga0209813_100147382 383
1111 3300027866 Ga0209813_10018634 Ga0209813_100186342 383
1112 3300027876 Ga0209974_10004147 Ga0209974_100041472 383
1113 3300027876 Ga0209974_10019845 Ga0209974_100198452 383
1114 3300027907 Ga0207428_10045043 Ga0207428_100450432 383
1115 3300028379 Ga0268266_10008958 Ga0268266_100089584 383
1116 3300028379 Ga0268266_10020764 Ga0268266_100207643 383
1117 3300028379 Ga0268266_10023758 Ga0268266_100237582 383
1118 3300028379 Ga0268266_10043406 Ga0268266_100434063 383
1119 3300028379 Ga0268266_10159448 Ga0268266_101594482 383
1120 3300028379 Ga0268266_10322131 Ga0268266_103221312 383
1121 3300028380 Ga0268265_10046444 Ga0268265_100464442 383
1122 3300028380 Ga0268265_10047325 Ga0268265_100473252 383
1123 3300028380 Ga0268265_10082425 Ga0268265_100824252 383
1124 3300028380 Ga0268265_10152394 Ga0268265_101523942 383
1125 3300028380 Ga0268265_10274078 Ga0268265_102740781 383
1126 3300028381 Ga0268264_10000991 Ga0268264_1000099116 383
1127 3300028381 Ga0268264_10004628 Ga0268264_100046288 383
1128 3300028381 Ga0268264_10010909 Ga0268264_100109093 383
1129 3300028381 Ga0268264_10021947 Ga0268264_100219473 383
1130 3300028381 Ga0268264_10025537 Ga0268264_100255372 383
1131 3300028381 Ga0268264_10037013 Ga0268264_100370133 383
1132 3300028381 Ga0268264_10064516 Ga0268264_100645162 383
1133 3300028381 Ga0268264_10103146 Ga0268264_101031462 383
1134 3300028381 Ga0268264_10105798 Ga0268264_101057982 383
1135 3300028381 Ga0268264_10174016 Ga0268264_101740162 383
1136 3300028666 Ga0265336_10000013 Ga0265336_10000013173 383
1137 3300028786 Ga0307517_10000131 Ga0307517_1000013131 383
1138 3300028794 Ga0307515_10000011 Ga0307515_10000011242 383
1139 3300028794 Ga0307515_10000278 Ga0307515_1000027872 383
1140 3300028794 Ga0307515_10006352 Ga0307515_1000635215 383
1141 3300028794 Ga0307515_10011457 Ga0307515_100114574 383
1142 3300028794 Ga0307515_10021920 Ga0307515_100219202 383
1143 3300028794 Ga0307515_10028588 Ga0307515_100285883 383
1144 3300028794 Ga0307515_10031517 Ga0307515_100315175 383
1145 3300028794 Ga0307515_10090935 Ga0307515_100909352 383
1146 3300028794 Ga0307515_10164629 Ga0307515_101646292 383
1147 3300028794 Ga0307515_10251319 Ga0307515_102513192 383
1148 3300029957 Ga0265324_10000193 Ga0265324_1000019330 383
1149 3300029957 Ga0265324_10004037 Ga0265324_100040373 383
1150 3300030500 Ga0268256_1007804 Ga0268256_10078043 383
1151 3300030521 Ga0307511_10000005 Ga0307511_1000000575 383
1152 3300030735 Ga0316178_1005545 Ga0316178_10055453 383
1153 3300030736 Ga0316180_1104723 Ga0316180_11047232 383
1154 3300031235 Ga0265330_10000453 Ga0265330_1000045312 383
1155 3300031235 Ga0265330_10020098 Ga0265330_100200982 383
1156 3300031238 Ga0265332_10000012 Ga0265332_10000012245 383
1157 3300031238 Ga0265332_10001062 Ga0265332_100010627 383
1158 3300031239 Ga0265328_10011609 Ga0265328_100116092 383
1159 3300031241 Ga0265325_10001423 Ga0265325_100014238 383
1160 3300031241 Ga0265325_10007863 Ga0265325_100078632 383
1161 3300031241 Ga0265325_10022015 Ga0265325_100220152 383
1162 3300031250 Ga0265331_10001106 Ga0265331_1000110611 383
1163 3300031251 Ga0265327_10004111 Ga0265327_1000411110 383
1164 3300031251 Ga0265327_10005562 Ga0265327_100055624 383
1165 3300031251 Ga0265327_10005649 Ga0265327_100056494 383
1166 3300031344 Ga0265316_10000163 Ga0265316_1000016328 383
1167 3300031456 Ga0307513_10000008 Ga0307513_10000008205 383
1168 3300031456 Ga0307513_10000441 Ga0307513_1000044117 383
1169 3300031456 Ga0307513_10012177 Ga0307513_100121777 383
1170 3300031456 Ga0307513_10019501 Ga0307513_100195011 383
1171 3300031456 Ga0307513_10113375 Ga0307513_101133752 383
1172 3300031456 Ga0307513_10124753 Ga0307513_101247532 383
1173 3300031456 Ga0307513_10172706 Ga0307513_101727062 383
1174 3300031456 Ga0307513_10186640 Ga0307513_101866402 383
1175 3300031507 Ga0307509_10000871 Ga0307509_1000087146 383
1176 3300031507 Ga0307509_10016221 Ga0307509_100162213 383
1177 3300031507 Ga0307509_10165755 Ga0307509_101657552 383
1178 3300031548 Ga0307408_100000037 Ga0307408_100000037110 383
1179 3300031548 Ga0307408_100000274 Ga0307408_10000027431 383
1180 3300031548 Ga0307408_100005562 Ga0307408_1000055626 383
1181 3300031548 Ga0307408_100014029 Ga0307408_1000140293 383
1182 3300031548 Ga0307408_100043906 Ga0307408_1000439062 383
1183 3300031548 Ga0307408_100146028 Ga0307408_1001460282 383
1184 3300031548 Ga0307408_100158686 Ga0307408_1001586862 383
1185 3300031616 Ga0307508_10000271 Ga0307508_100002714 383
1186 3300031616 Ga0307508_10000349 Ga0307508_1000034924 383
1187 3300031616 Ga0307508_10262896 Ga0307508_102628961 383
1188 3300031649 Ga0307514_10000355 Ga0307514_1000035559 383
1189 3300031649 Ga0307514_10000694 Ga0307514_1000069449 383
1190 3300031649 Ga0307514_10011790 Ga0307514_100117907 383
1191 3300031711 Ga0265314_10000029 Ga0265314_1000002912 383
1192 3300031711 Ga0265314_10003171 Ga0265314_100031718 383
1193 3300031711 Ga0265314_10014048 Ga0265314_100140483 383
1194 3300031711 Ga0265314_10046085 Ga0265314_100460852 383
1195 3300031712 Ga0265342_10004652 Ga0265342_100046525 383
1196 3300031712 Ga0265342_10013416 Ga0265342_100134164 383
1197 3300031730 Ga0307516_10001568 Ga0307516_1000156819 383
1198 3300031730 Ga0307516_10001850 Ga0307516_1000185017 383
1199 3300031730 Ga0307516_10004281 Ga0307516_100042814 383
1200 3300031730 Ga0307516_10004605 Ga0307516_100046056 383
1201 3300031730 Ga0307516_10004611 Ga0307516_1000461111 383
1202 3300031730 Ga0307516_10054561 Ga0307516_100545612 383
1203 3300031730 Ga0307516_10082496 Ga0307516_100824962 383
1204 3300031731 Ga0307405_10016757 Ga0307405_100167572 383
1205 3300031731 Ga0307405_10033413 Ga0307405_100334132 383
1206 3300031731 Ga0307405_10095712 Ga0307405_100957122 383
1207 3300031852 Ga0307410_10020431 Ga0307410_100204312 383
1208 3300031901 Ga0307406_10001131 Ga0307406_100011316 383
1209 3300031901 Ga0307406_10001699 Ga0307406_1000169910 383
1210 3300031901 Ga0307406_10022558 Ga0307406_100225583 383
1211 3300031901 Ga0307406_10098362 Ga0307406_100983622 383
1212 3300031903 Ga0307407_10006078 Ga0307407_100060784 383
1213 3300031903 Ga0307407_10112933 Ga0307407_101129331 383
1214 3300031903 Ga0307407_10129311 Ga0307407_101293112 383
1215 3300031911 Ga0307412_10011101 Ga0307412_100111013 383
1216 3300031911 Ga0307412_10023060 Ga0307412_100230602 383
1217 3300031911 Ga0307412_10025330 Ga0307412_100253303 383
1218 3300031911 Ga0307412_10034849 Ga0307412_100348493 383
1219 3300031995 Ga0307409_100009086 Ga0307409_1000090863 383
1220 3300031995 Ga0307409_100041037 Ga0307409_1000410372 383
1221 3300031995 Ga0307409_100105738 Ga0307409_1001057382 383
1222 3300032002 Ga0307416_100013885 Ga0307416_1000138854 383
1223 3300032002 Ga0307416_100045877 Ga0307416_1000458772 383
1224 3300032002 Ga0307416_100144021 Ga0307416_1001440212 383
1225 3300032004 Ga0307414_10069494 Ga0307414_100694942 383
1226 3300032005 Ga0307411_10000347 Ga0307411_1000034714 383
1227 3300032005 Ga0307411_10096805 Ga0307411_100968052 383
1228 3300032133 Ga0316583_10019774 Ga0316583_100197742 383
1229 3300033180 Ga0307510_10030522 Ga0307510_100305222 383
1230 3300033180 Ga0307510_10053824 Ga0307510_100538244 383
1231 3300035086 Ga0373934_0030000 Ga0373934_0030000_382_1533 383
1232 3300035111 Ga0373923_0015654 Ga0373923_0015654_534_1685 383
1233 3300035114 Ga0373939_0000067 Ga0373939_0000067_18627_19805 383
1234 3300035118 Ga0373954_0110980 Ga0373954_0110980_83_1234 383
1235 3300035121 Ga0373960_0000228 Ga0373960_0000228_3563_4741 383
1236 3300035691 Ga0373931_0007765 Ga0373931_0007765_3164_4342 383
1237 3300035695 Ga0373927_0003169 Ga0373927_0003169_5348_6499 383
1238 3300035695 Ga0373927_0004693 Ga0373927_0004693_6621_7772 383
1239 3300035724 Ga0373933_0072098 Ga0373933_0072098_538_1689 383
1240 3300036401 Ga0373937_0033224 Ga0373937_0033224_3164_4315 383
1241 3300036401 Ga0373937_0084574 Ga0373937_0084574_569_1720 383
1242 3300037068 Ga0373925_0012025 Ga0373925_0012025_3676_4857 383
1243 3300037068 Ga0373925_0047276 Ga0373925_0047276_682_1833 383
1244 3300037068 Ga0373925_0287218 Ga0373925_0287218_120_1298 383
1245 3300037312 Ga0395899_0004233 Ga0395899_0004233_4300_5478 383
1246 3300037312 Ga0395899_0064777 Ga0395899_0064777_1193_2371 383
1247 3300037418 Ga0395900_0000058 Ga0395900_0000058_148909_150090 383
1248 3300037418 Ga0395900_0001342 Ga0395900_0001342_2834_4003 383
1249 3300037418 Ga0395900_0004446 Ga0395900_0004446_8685_9863 383
1250 3300037418 Ga0395900_0014529 Ga0395900_0014529_2894_4072 383
1251 3300037418 Ga0395900_0023478 Ga0395900_0023478_1744_2922 383
1252 3300037418 Ga0395900_0326164 Ga0395900_0326164_128_1306 383
1253 3300037466 Ga0395898_0000283 Ga0395898_0000283_97303_98484 383
1254 3300037466 Ga0395898_0004069 Ga0395898_0004069_8278_9459 383
1255 3300037466 Ga0395898_0006225 Ga0395898_0006225_11014_12192 383
1256 3300037466 Ga0395898_0013532 Ga0395898_0013532_443_1621 383
1257 3300037466 Ga0395898_0164563 Ga0395898_0164563_846_2024 383
1258 3300037466 Ga0395898_0365367 Ga0395898_0365367_108_1286 383
1259 3300037471 Ga0395905_0000084 Ga0395905_0000084_3292_4470 383
1260 3300037471 Ga0395905_0000088 Ga0395905_0000088_107473_108651 383
1261 3300037471 Ga0395905_0000474 Ga0395905_0000474_33482_34660 383
1262 3300037471 Ga0395905_0005168 Ga0395905_0005168_1506_2687 383
1263 3300037471 Ga0395905_0022674 Ga0395905_0022674_3378_4559 383
1264 3300037471 Ga0395905_0037655 Ga0395905_0037655_1153_2331 383
1265 3300037471 Ga0395905_0093859 Ga0395905_0093859_1193_2371 383
1266 3300037471 Ga0395905_0096771 Ga0395905_0096771_1368_2546 383
1267 3300037471 Ga0395905_0113081 Ga0395905_0113081_256_1434 383
1268 3300037471 Ga0395905_0188852 Ga0395905_0188852_128_1309 383
1269 3300037471 Ga0395905_0349936 Ga0395905_0349936_159_1340 383
1270 3300038443 Ga0395901_0002111 Ga0395901_0002111_10484_11665 383
1271 3300038443 Ga0395901_0004265 Ga0395901_0004265_1905_3083 383
1272 3300038443 Ga0395901_0014599 Ga0395901_0014599_5373_6551 383
1273 3300038443 Ga0395901_0049342 Ga0395901_0049342_1428_2606 383
1274 3300038443 Ga0395901_0157861 Ga0395901_0157861_500_1678 383
1275 3300038443 Ga0395901_0200212 Ga0395901_0200212_818_1996 383
1276 3300039437 Ga0436365_1408997 Ga0436365_1408997_2649_3800 383
1277 3300039447 Ga0436361_0019641 Ga0436361_0019641_92701_93879 383
1278 3300039447 Ga0436361_0056098 Ga0436361_0056098_715_1884 383
1279 3300039447 Ga0436361_0163583 Ga0436361_0163583_43416_44594 383
1280 3300039447 Ga0436361_0237831 Ga0436361_0237831_1330_2511 383
1281 3300039447 Ga0436361_0374445 Ga0436361_0374445_1490_2668 383
1282 3300039447 Ga0436361_0484071 Ga0436361_0484071_25975_27153 383
1283 3300039447 Ga0436361_0797912 Ga0436361_0797912_3465_4643 383
1284 3300041404 Ga0439436_0001660 Ga0439436_0001660_2235_3413 383
1285 3300041443 Ga0451789_0062679 Ga0451789_0062679_222_1403 383
1286 3300041451 Ga0451791_0729747 Ga0451791_0729747_81_1259 383
1287 3300041459 Ga0451800_0294366 Ga0451800_0294366_443_1624 383
1288 3300041460 Ga0451802_1889696 Ga0451802_1889696_121_1299 383
1289 3300041486 Ga0451807_2119455 Ga0451807_2119455_86_1264 383
1290 3300041997 Ga0439431_0000686 Ga0439431_0000686_1093_2271 383
1291 3300041999 Ga0439433_0014615 Ga0439433_0014615_288_1466 383
1292 3300042006 Ga0439432_002992 Ga0439432_002992_1908_3086 383
1293 3300042010 Ga0439452_003034 Ga0439452_003034_2435_3613 383
1294 3300042014 Ga0439457_010969 Ga0439457_010969_129_1307 383
1295 3300042115 Ga0450911_000443 Ga0450911_000443_2586_3764 383
1296 3300042120 Ga0450917_000136 Ga0450917_000136_1514_2692 383
1297 3300042125 Ga0450923_001534 Ga0450923_001534_842_2020 383
1298 3300042126 Ga0450888_000009 Ga0450888_000009_9382_10560 383
1299 3300042127 Ga0450890_005447 Ga0450890_005447_412_1590 383
1300 3300042129 Ga0450891_000221 Ga0450891_000221_3500_4678 383
1301 3300042144 Ga0450889_000020 Ga0450889_000020_12131_13309 383
1302 3300042184 Ga0450908_000326 Ga0450908_000326_6104_7282 383
1303 3300042435 Ga0439434_0001164 Ga0439434_0001164_2044_3222 383
1304 3300042438 Ga0439459_0000359 Ga0439459_0000359_548_1726 383
1305 3300042531 Ga0450918_000047 Ga0450918_000047_7248_8429 383
1306 3300042876 Ga0451577_0000453 Ga0451577_0000453_45629_46807 383
1307 3300042876 Ga0451577_0000997 Ga0451577_0000997_21018_22187 383
1308 3300042876 Ga0451577_0007753 Ga0451577_0007753_1498_2676 383
1309 3300042876 Ga0451577_0008851 Ga0451577_0008851_28_1197 383
1310 3300042876 Ga0451577_0013237 Ga0451577_0013237_1023_2204 383
1311 3300042876 Ga0451577_0015527 Ga0451577_0015527_2779_3948 383
1312 3300042876 Ga0451577_0020100 Ga0451577_0020100_3194_4363 383
1313 3300042876 Ga0451577_0086637 Ga0451577_0086637_90_1259 383
1314 3300042876 Ga0451577_0093102 Ga0451577_0093102_1105_2274 383
1315 3300042876 Ga0451577_0159727 Ga0451577_0159727_194_1375 383
1316 3300044656 Ga0466969_0000013 Ga0466969_0000013_37053_38234 383
1317 3300044656 Ga0466969_0011004 Ga0466969_0011004_3145_4326 383
1318 3300044658 Ga0466972_0001863 Ga0466972_0001863_4375_5556 383
1319 3300044658 Ga0466972_0025394 Ga0466972_0025394_287_1468 383
1320 3300044673 Ga0453683_0031647 Ga0453683_0031647_901_2070 383
1321 3300044683 Ga0466965_0019745 Ga0466965_0019745_1435_2616 383
1322 3300044684 Ga0466966_0028472 Ga0466966_0028472_402_1589 383
1323 3300044693 Ga0466961_0007768 Ga0466961_0007768_230_1417 383
1324 3300044693 Ga0466961_0027966 Ga0466961_0027966_2379_3560 383
1325 3300044694 Ga0466963_0045293 Ga0466963_0045293_59_1240 383
1326 3300044712 Ga0453684_0000014 Ga0453684_0000014_662693_663862 383
1327 3300044712 Ga0453684_0000114 Ga0453684_0000114_211210_212379 383
1328 3300044712 Ga0453684_0001268 Ga0453684_0001268_12967_14136 383
1329 3300044712 Ga0453684_0001455 Ga0453684_0001455_59880_61049 383
1330 3300044712 Ga0453684_0002072 Ga0453684_0002072_24689_25867 383
1331 3300044712 Ga0453684_0006329 Ga0453684_0006329_19657_20826 383
1332 3300044712 Ga0453684_0027135 Ga0453684_0027135_2110_3288 383
1333 3300044712 Ga0453684_0037650 Ga0453684_0037650_123_1301 383
1334 3300044712 Ga0453684_0126006 Ga0453684_0126006_391_1560 383
1335 3300044719 Ga0466971_0004477 Ga0466971_0004477_549_1736 383
1336 3300044719 Ga0466971_0035574 Ga0466971_0035574_994_2175 383
1337 3300044719 Ga0466971_0037073 Ga0466971_0037073_714_1895 383
1338 3300044735 Ga0466968_0008781 Ga0466968_0008781_615_1802 383
1339 3300044735 Ga0466968_0084067 Ga0466968_0084067_122_1300 383
1340 3300044842 Ga0466957_0026908 Ga0466957_0026908_625_1812 383
1341 3300045049 Ga0466959_0001083 Ga0466959_0001083_8752_9933 383
1342 3300045049 Ga0466959_0010137 Ga0466959_0010137_5453_6634 383
1343 3300045051 Ga0451576_0000168 Ga0451576_0000168_39504_40673 383
1344 3300045051 Ga0451576_0000950 Ga0451576_0000950_24703_25881 383
1345 3300045051 Ga0451576_0001018 Ga0451576_0001018_15924_17093 383
1346 3300045051 Ga0451576_0002478 Ga0451576_0002478_11644_12822 383
1347 3300045051 Ga0451576_0012346 Ga0451576_0012346_4930_6111 383
1348 3300045051 Ga0451576_0074276 Ga0451576_0074276_151_1320 383
1349 3300045051 Ga0451576_0173524 Ga0451576_0173524_317_1498 383
1350 3300045051 Ga0451576_0223738 Ga0451576_0223738_148_1317 383
1351 3300045836 Ga0466958_0047577 Ga0466958_0047577_855_2042 383
1352 3300046453 Ga0495627_006336 Ga0495627_006336_2974_4152 383
1353 3300046454 Ga0495592_0000394 Ga0495592_0000394_26066_27244 383
1354 3300046460 Ga0495638_0050099 Ga0495638_0050099_25_1203 383
1355 3300046472 Ga0495580_0056248 Ga0495580_0056248_1473_2651 383
1356 3300046473 Ga0495582_0038406 Ga0495582_0038406_382_1533 383
1357 3300046492 Ga0495585_0034025 Ga0495585_0034025_457_1638 383
1358 3300046506 Ga0495583_0000081 Ga0495583_0000081_41451_42632 383
1359 3300046507 Ga0495606_0018883 Ga0495606_0018883_228_1409 383
1360 3300046515 Ga0495620_0020378 Ga0495620_0020378_1191_2369 383
1361 3300046517 Ga0495630_0088413 Ga0495630_0088413_375_1526 383
1362 3300046518 Ga0495631_0001417 Ga0495631_0001417_3945_5123 383
1363 3300046519 Ga0495632_0004039 Ga0495632_0004039_2962_4143 383
1364 3300046519 Ga0495632_0059217 Ga0495632_0059217_252_1433 383
1365 3300046531 Ga0495665_0055540 Ga0495665_0055540_11_1162 383
1366 3300046536 Ga0495587_0065569 Ga0495587_0065569_823_1974 383
1367 3300046537 Ga0495598_0004678 Ga0495598_0004678_464_1633 383
1368 3300046539 Ga0495621_0016961 Ga0495621_0016961_489_1640 383
1369 3300046539 Ga0495621_0027461 Ga0495621_0027461_73_1224 383
1370 3300046542 Ga0495597_0000054 Ga0495597_0000054_91781_92959 383
1371 3300046558 Ga0495633_0000648 Ga0495633_0000648_25925_27103 383
1372 3300046615 Ga0495656_0000093 Ga0495656_0000093_33914_35092 383
1373 3300046660 Ga0495625_0001179 Ga0495625_0001179_5562_6740 383
1374 3300046660 Ga0495625_0114001 Ga0495625_0114001_465_1643 383
1375 3300046664 Ga0495659_0012749 Ga0495659_0012749_963_2114 383
1376 3300046681 Ga0495647_0018312 Ga0495647_0018312_481_1632 383
1377 3300046683 Ga0495658_0057777 Ga0495658_0057777_628_1806 383
1378 3300046683 Ga0495658_0077844 Ga0495658_0077844_701_1852 383
1379 3300046689 Ga0495613_0017525 Ga0495613_0017525_3370_4521 383
1380 3300046694 Ga0495649_0000259 Ga0495649_0000259_41432_42613 383
1381 3300046694 Ga0495649_0010350 Ga0495649_0010350_2017_3195 383
1382 3300046794 Ga0495589_0028100 Ga0495589_0028100_1271_2449 383
1383 3300046810 Ga0495660_0011887 Ga0495660_0011887_1900_3078 383
1384 3300047321 Ga0495676_0009192 Ga0495676_0009192_6432_7610 383
1385 3300047443 Ga0495687_003988 Ga0495687_003988_91_1269 383
1386 3300047447 Ga0495685_029083 Ga0495685_029083_692_1870 383
1387 3300047673 Ga0495593_0015464 Ga0495593_0015464_2959_4137 383
1388 3300048088 Ga0495602_0090521 Ga0495602_0090521_1233_2384 383
1389 3300048903 Ga0496100_0016181 Ga0496100_0016181_2783_3934 383
1390 3300048904 Ga0496101_0005514 Ga0496101_0005514_6382_7560 383
1391 3300048904 Ga0496101_0053871 Ga0496101_0053871_1070_2221 383
1392 3300048905 Ga0496102_0004520 Ga0496102_0004520_3780_4931 383
1393 3300048905 Ga0496102_0032029 Ga0496102_0032029_2269_3447 383
1394 3300048905 Ga0496102_0034690 Ga0496102_0034690_1106_2257 383
1395 3300048905 Ga0496102_0049796 Ga0496102_0049796_55_1236 383
1396 3300048906 Ga0496103_0082067 Ga0496103_0082067_65_1216 383
1397 3300048907 Ga0496104_0006818 Ga0496104_0006818_4442_5593 383
1398 3300048907 Ga0496104_0008511 Ga0496104_0008511_171_1349 383
1399 3300048907 Ga0496104_0074178 Ga0496104_0074178_931_2112 383
1400 3300048908 Ga0496105_0010653 Ga0496105_0010653_4774_5925 383
1401 3300048908 Ga0496105_0011125 Ga0496105_0011125_2915_4093 383
1402 3300048908 Ga0496105_0029503 Ga0496105_0029503_3272_4423 383
1403 3300048908 Ga0496105_0137152 Ga0496105_0137152_790_1968 383
1404 3300048909 Ga0496106_0016006 Ga0496106_0016006_4265_5416 383
1405 3300048909 Ga0496106_0040487 Ga0496106_0040487_1251_2429 383
1406 3300048909 Ga0496106_0162620 Ga0496106_0162620_280_1431 383
1407 3300048910 Ga0496107_0013245 Ga0496107_0013245_344_1495 383
1408 3300048911 Ga0496108_0007483 Ga0496108_0007483_2298_3449 383
1409 3300048911 Ga0496108_0039907 Ga0496108_0039907_196_1347 383
1410 3300048911 Ga0496108_0094360 Ga0496108_0094360_922_2100 383
1411 3300048911 Ga0496108_0099050 Ga0496108_0099050_1140_2324 383
1412 3300048911 Ga0496108_0109731 Ga0496108_0109731_417_1568 383
1413 3300048911 Ga0496108_0219376 Ga0496108_0219376_172_1341 383
1414 3300048912 Ga0496109_0014083 Ga0496109_0014083_5772_6923 383
1415 3300048912 Ga0496109_0039783 Ga0496109_0039783_1660_2811 383
1416 3300048912 Ga0496109_0259035 Ga0496109_0259035_39_1217 383
1417 3300048913 Ga0496110_0014509 Ga0496110_0014509_4140_5291 383
1418 3300048913 Ga0496110_0035733 Ga0496110_0035733_2684_3835 383
1419 3300048913 Ga0496110_0038769 Ga0496110_0038769_1991_3169 383
1420 3300048913 Ga0496110_0401453 Ga0496110_0401453_40_1209 383
1421 3300048914 Ga0496111_0036928 Ga0496111_0036928_523_1701 383
1422 3300048914 Ga0496111_0114604 Ga0496111_0114604_556_1734 383
1423 3300048915 Ga0496112_0009399 Ga0496112_0009399_5457_6638 383
1424 3300048915 Ga0496112_0056645 Ga0496112_0056645_2677_3828 383
1425 3300048917 Ga0496114_0003046 Ga0496114_0003046_8243_9424 383
1426 3300048917 Ga0496114_0027685 Ga0496114_0027685_2895_4046 383
1427 3300048917 Ga0496114_0080163 Ga0496114_0080163_1253_2422 383
1428 3300048920 Ga0496117_0072509 Ga0496117_0072509_90_1268 383
1429 3300048921 Ga0496118_0007613 Ga0496118_0007613_8069_9247 383
1430 3300048921 Ga0496118_0014026 Ga0496118_0014026_2707_3885 383
1431 3300048924 Ga0496121_0047496 Ga0496121_0047496_209_1387 383
1432 3300048925 Ga0496122_0000383 Ga0496122_0000383_8343_9521 383
1433 3300048925 Ga0496122_0005655 Ga0496122_0005655_7592_8770 383
1434 3300048926 Ga0496123_0000249 Ga0496123_0000249_85191_86369 383
1435 3300048928 Ga0496125_0000319 Ga0496125_0000319_31752_32930 383
1436 3300048928 Ga0496125_0023666 Ga0496125_0023666_2807_3985 383
1437 3300048928 Ga0496125_0070059 Ga0496125_0070059_1391_2569 383
1438 3300049568 Ga0501031_0006723 Ga0501031_0006723_4068_5246 383
1439 3300049571 Ga0501034_0038720 Ga0501034_0038720_2181_3359 383
1440 3300049579 Ga0501043_0000009 Ga0501043_0000009_53237_54415 383
1441 3300049580 Ga0501046_0000022 Ga0501046_0000022_53226_54404 383
1442 3300049581 Ga0501047_0000021 Ga0501047_0000021_53284_54462 383
1443 3300049581 Ga0501047_0089232 Ga0501047_0089232_1279_2457 383
1444 3300049649 Ga0501198_000001 Ga0501198_000001_30443_31621 383
1445 3300049654 Ga0501207_004330 Ga0501207_004330_666_1844 383
1446 3300049662 Ga0501222_000004 Ga0501222_000004_19419_20597 383
1447 3300049662 Ga0501222_001282 Ga0501222_001282_1315_2493 383
1448 3300049662 Ga0501222_002897 Ga0501222_002897_453_1634 383
1449 3300049663 Ga0501223_007869 Ga0501223_007869_278_1456 383
1450 3300049669 Ga0501235_003572 Ga0501235_003572_1862_3040 383
1451 3300049674 Ga0501242_003578 Ga0501242_003578_139_1317 383
1452 3300049683 Ga0501253_000860 Ga0501253_000860_1615_2793 383
1453 3300049704 Ga0501221_002012 Ga0501221_002012_449_1627 383
1454 3300049742 Ga0501080_0053452 Ga0501080_0053452_1835_3013 383
1455 3300049759 Ga0501262_000273 Ga0501262_000273_534_1712 383
1456 3300049759 Ga0501262_004596 Ga0501262_004596_147_1325 383
1457 3300049764 Ga0501267_000092 Ga0501267_000092_3526_4704 383
1458 3300049822 Ga0501035_0038555 Ga0501035_0038555_1386_2564 383
1459 3300050489 nmdc:mga03683_39000_c1 nmdc:mga03683_39000_c1_411_1589 383
1460 3300050491 nmdc:mga00v17_33488_c1 nmdc:mga00v17_33488_c1_815_1993 383
1461 3300050492 nmdc:mga0yw44_139388_c1 nmdc:mga0yw44_139388_c1_295_1473 383
1462 3300050492 nmdc:mga0yw44_9904_c1 nmdc:mga0yw44_9904_c1_320_1495 383
1463 3300050493 nmdc:mga0k408_144892_c1 nmdc:mga0k408_144892_c1_214_1392 383
1464 3300050493 nmdc:mga0k408_2471_c1 nmdc:mga0k408_2471_c1_7078_8256 383
1465 3300050493 nmdc:mga0k408_3312_c1 nmdc:mga0k408_3312_c1_3634_4812 383
1466 3300050493 nmdc:mga0k408_3894_c1 nmdc:mga0k408_3894_c1_3998_5176 383
1467 3300050493 nmdc:mga0k408_4784_c1 nmdc:mga0k408_4784_c1_5484_6662 383
1468 3300050493 nmdc:mga0k408_59922_c1 nmdc:mga0k408_59922_c1_368_1546 383
1469 3300050495 nmdc:mga04h51_36487_c1 nmdc:mga04h51_36487_c1_236_1405 383
1470 3300050496 nmdc:mga07m45_2541_c1 nmdc:mga07m45_2541_c1_7327_8505 383
1471 3300050496 nmdc:mga07m45_2542_c1 nmdc:mga07m45_2542_c1_6890_8068 383
1472 3300050496 nmdc:mga07m45_6261_c1 nmdc:mga07m45_6261_c1_2731_3909 383
1473 3300050496 nmdc:mga07m45_6873_c1 nmdc:mga07m45_6873_c1_1748_2926 383
1474 3300050496 nmdc:mga07m45_81_c1 nmdc:mga07m45_81_c1_20944_22122 383
1475 3300050508 nmdc:mga09592_3703_c1 nmdc:mga09592_3703_c1_2219_3397 383
1476 3300050511 nmdc:mga08y16_28387_c1 nmdc:mga08y16_28387_c1_4008_5159 383
1477 3300050511 nmdc:mga08y16_351538_c1 nmdc:mga08y16_351538_c1_255_1433 383
1478 3300050513 nmdc:mga0rr50_124536_c1 nmdc:mga0rr50_124536_c1_14_1165 383
1479 3300050514 nmdc:mga08x19_36678_c1 nmdc:mga08x19_36678_c1_1737_2888 383
1480 3300050516 nmdc:mga0sz30_35698_c1 nmdc:mga0sz30_35698_c1_382_1551 383
1481 3300053079 Ga0500610_0005499 Ga0500610_0005499_458_1636 383
1482 3300053080 Ga0500635_0000011 Ga0500635_0000011_86705_87886 383
1483 3300053085 Ga0495619_0119029 Ga0495619_0119029_524_1702 383
1484 3300053086 Ga0500578_0000652 Ga0500578_0000652_5573_6754 383
1485 3300053092 Ga0500583_0003338 Ga0500583_0003338_771_1940 383
1486 3300053093 Ga0500651_0000067 Ga0500651_0000067_29801_30979 383
1487 3300053093 Ga0500651_0013435 Ga0500651_0013435_2229_3410 383
1488 3300053110 Ga0500571_000952 Ga0500571_000952_3525_4703 383
1489 3300053131 Ga0500652_000449 Ga0500652_000449_8830_10011 383
1490 3300053133 Ga0500655_001229 Ga0500655_001229_2380_3549 383
1491 3300053134 Ga0500658_0001880 Ga0500658_0001880_1586_2764 383
1492 3300053134 Ga0500658_0003426 Ga0500658_0003426_1158_2336 383
1493 3300053136 Ga0500559_0000446 Ga0500559_0000446_9185_10363 383
1494 3300053139 Ga0500568_0010475 Ga0500568_0010475_2965_4143 383
1495 3300053151 Ga0500604_0041079 Ga0500604_0041079_39_1208 383
1496 3300053153 Ga0500616_0011165 Ga0500616_0011165_2998_4176 383
1497 3300053156 Ga0500622_0000124 Ga0500622_0000124_5587_6768 383
1498 3300053156 Ga0500622_0018843 Ga0500622_0018843_1137_2315 383
1499 3300053156 Ga0500622_0031819 Ga0500622_0031819_140_1318 383
1500 3300053162 Ga0500638_036952 Ga0500638_036952_889_2067 383
1501 3300053177 Ga0500636_0000203 Ga0500636_0000203_5144_6313 383
1502 3300059421 Ga0590071_003318 Ga0590071_003318_2240_3421 383
1503 3300059424 Ga0590075_012517 Ga0590075_012517_753_1934 383
1504 3300061719 Ga0466962_0012811 Ga0466962_0012811_127_1314 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00953

Glycos_transf_4

Glycosyl transferase family 4

98

285

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9667 21 381
6oyz-assembly1.cif.gz_A crystal structure of mray bound to capuramycin 0.9656 25 380
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.964 24 381
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9607 25 381
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9605 21 381
ID Description Score Start End Superfamily
af_Q2G2F7_42_134_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5287 76 144 1.10.10.1740
af_Q2G2F7_42_134_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4126 76 144 1.10.10.1740
af_I1LIG9_7_170_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3507 75 174 1.20.120.1760
af_Q9BKR9_103_269_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3187 201 283 1.20.1250.20
af_Q7XKJ7_269_452_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3069 206 383 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1X0N8X3-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9907 232 383 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0071555
AF-A0A258SMQ9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9904 234 383 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0071555
AF-A0A3S1VV32-F1-model_v4 deleted 0.9887 214 366
AF-A0A3B8P9D2-F1-model_v4 deleted 0.9876 183 383
AF-A0A7C4E8B7-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) 0.9875 1 383 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555

Feature Viewer

pLDDT pTM Quality
87.11 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map