F494426
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1504 | 583 | 1408 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100008706|Ga0068869_1000087066 |
| Length | 360 |
| Sequence | MLLELAQWLAREVRAFNVFNYITLRAVLATLTSLVISFLVGPTMIRKLTMYKIGQAVRDDGPQSHLSKAGTPTMGGALVLVAVAVTTLLWADLSNRFVWVVLLVTLGFGVVGWVDDYRKVVHRNPKGLPARVKYFWQSMIGLAAALYLAYSGTAAQTEFIVPFFKQVSYPLGIVGFVIMSYFVIVGASNAVNLTDGLDGLAIMPTVMVGSALGVFAYVAGHAVFSKYLGFPHIPGAGELTVFCAALAGAGLAFLWFNAYPAEVFMGDVGALALGAALGTIAVIVRQEIVLFIMGGVFVVETLSVVLQVASFKLTGKRIFRMAPLHHHYELKGWKENQVVVRFWIITMMLVLFGLSTLKLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 5 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 6 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 7 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 8 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 9 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 10 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 16 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 17 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 18 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 19 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 20 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 21 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 22 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 23 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 24 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 25 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 26 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 27 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 28 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 29 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 30 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 31 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 32 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 33 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 34 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 35 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 36 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 37 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 38 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 39 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 40 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 41 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 42 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 43 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 44 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 45 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 46 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 47 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 48 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 49 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 50 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 51 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 52 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 53 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 54 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 55 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 56 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 57 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 58 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 59 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 60 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 61 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 62 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 63 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 64 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 65 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 66 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 67 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 68 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 69 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 70 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 71 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 72 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 73 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 74 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 75 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 76 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 77 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 78 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 79 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 80 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 81 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 82 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 83 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 84 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 85 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 86 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 87 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 88 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 89 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 90 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 91 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 92 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 93 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 94 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 95 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 96 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 97 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 98 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 99 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 100 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 101 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 102 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 103 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 104 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 105 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 106 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 107 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 108 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 109 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 110 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 111 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 112 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 113 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 114 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 115 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 116 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 118 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 120 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 121 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 124 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 125 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 126 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 127 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 128 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 129 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 130 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 131 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 132 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 133 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 134 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 135 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 137 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 138 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 142 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 143 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 146 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 148 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 150 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 152 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 160 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 165 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 173 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 174 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 176 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 179 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 181 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 184 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 186 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 187 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 188 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 190 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 191 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 192 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 193 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 194 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 195 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 196 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 197 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 198 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 199 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 200 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 201 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 202 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 203 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 204 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 205 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 206 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 207 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 208 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 210 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 211 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 212 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 213 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 214 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 215 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 217 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 218 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 219 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 220 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 221 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 236 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 237 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 249 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 253 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 254 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 255 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 256 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 258 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 259 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 269 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 270 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 271 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 274 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 275 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 277 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 279 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 281 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 284 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 287 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 355 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 356 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 359 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 365 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 369 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 370 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 371 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 372 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 373 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 374 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 375 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 376 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 377 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 378 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 379 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 380 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 381 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 382 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 383 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 384 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 385 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 386 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 387 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 388 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 389 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 390 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 391 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 392 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 393 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 394 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 395 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 396 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 397 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 398 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 399 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 400 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 401 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 402 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 403 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 404 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 405 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 406 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 407 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 408 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 409 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 410 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 411 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 412 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 413 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 414 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 415 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 416 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 417 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 418 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 419 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 420 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 421 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 422 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 423 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 424 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 425 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 426 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 427 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 428 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 429 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 430 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 431 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 432 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 433 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 434 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 435 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 436 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 437 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 438 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 439 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 440 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 441 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 442 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 443 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 444 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 445 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 446 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 447 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 448 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 449 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 450 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 451 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 452 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 453 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 454 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 455 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 456 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 457 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 458 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 459 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 460 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 461 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 462 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 463 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 464 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 465 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 512 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 513 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 514 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 515 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 516 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 517 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 518 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 519 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 520 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 521 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 522 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 523 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 524 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 525 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 526 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 527 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 528 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 529 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 530 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 531 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 538 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 539 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 540 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 541 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 542 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 543 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 544 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 545 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 547 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 548 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 550 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 551 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 552 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 553 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 554 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 555 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 561 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 563 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 564 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 566 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 567 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 568 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 570 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 571 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 572 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 574 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 575 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 576 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 577 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 578 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 579 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 580 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 581 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 582 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 583 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.35 |
| Metatranscriptomes | 0.27 |
| Isolates | 6.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.82 |
| Nodule | 0.93 |
| Rhizoplane | 3.46 |
| Rhizosphere | 70.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1005459 | 3300001976 | Bacteria | 1659 |
| 2 | JGI24740J21852_10009841 | 3300001979 | Bacteria | 3718 |
| 3 | JGI24743J22301_10000318 | 3300001991 | Bacteria | 5268 |
| 4 | JGI25155J39150_1000029 | 3300002704 | Bacteria | 118964 |
| 5 | JGI25155J39150_1000630 | 3300002704 | Bacteria | 7245 |
| 6 | JGI25156J39149_1000062 | 3300002705 | Bacteria | 84500 |
| 7 | JGI25156J39149_1007587 | 3300002705 | Bacteria | 2827 |
| 8 | JGI25162J39368_1000063 | 3300002737 | Bacteria | 134747 |
| 9 | JGI25154J39366_1000053 | 3300002738 | Bacteria | 119466 |
| 10 | JGI25154J39366_1000980 | 3300002738 | Bacteria | 11617 |
| 11 | JGI25157J39369_1000046 | 3300002741 | Bacteria | 119470 |
| 12 | JGI25157J39369_1000148 | 3300002741 | Bacteria | 58782 |
| 13 | JGI25164J39214_1005708 | 3300002772 | Bacteria | 1337 |
| 14 | JGI25152J39213_1006001 | 3300002773 | Bacteria | 3405 |
| 15 | JGI25152J39213_1006432 | 3300002773 | Bacteria | 3210 |
| 16 | JGI25150J39212_1001852 | 3300002774 | Bacteria | 5591 |
| 17 | JGI25165J46597_1000069 | 3300003214 | Bacteria | 195460 |
| 18 | JGI25153J46596_10005062 | 3300003215 | Bacteria | 6974 |
| 19 | JGI25153J46596_10022378 | 3300003215 | Bacteria | 2331 |
| 20 | rootL2_10000966 | 3300003322 | Bacteria | 57184 |
| 21 | JGI25160J50197_1000253 | 3300003354 | Bacteria | 40838 |
| 22 | JGI25161J50226_1000046 | 3300003374 | Bacteria | 116165 |
| 23 | Ga0007409J51694_1052775 | 3300003575 | Bacteria | 2665 |
| 24 | Ga0006562J51391_1013325 | 3300003578 | Bacteria | 17825 |
| 25 | Ga0006562J51391_1013328 | 3300003578 | Bacteria | 7450 |
| 26 | Ga0006562J51391_1029542 | 3300003578 | Bacteria | 12747 |
| 27 | Ga0055538_1000034 | 3300003751 | Bacteria | 195460 |
| 28 | Ga0055538_1000051 | 3300003751 | Bacteria | 129958 |
| 29 | Ga0055539_1000044 | 3300003752 | Bacteria | 195460 |
| 30 | Ga0055539_1000076 | 3300003752 | Bacteria | 129958 |
| 31 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 32 | Ga0055533_1000055 | 3300003756 | Bacteria | 195460 |
| 33 | Ga0055533_1000082 | 3300003756 | Bacteria | 129958 |
| 34 | Ga0055525_1000066 | 3300003759 | Bacteria | 195460 |
| 35 | Ga0055525_1000109 | 3300003759 | Bacteria | 129958 |
| 36 | Ga0055525_1001112 | 3300003759 | Bacteria | 6608 |
| 37 | Ga0055527_1005163 | 3300003760 | Bacteria | 1721 |
| 38 | Ga0055535_1000934 | 3300003761 | Bacteria | 19510 |
| 39 | Ga0055542_1000051 | 3300003762 | Bacteria | 175242 |
| 40 | Ga0055529_1000333 | 3300003763 | Bacteria | 52783 |
| 41 | Ga0055526_1003822 | 3300003771 | Bacteria | 9360 |
| 42 | Ga0055526_1006065 | 3300003771 | Bacteria | 6686 |
| 43 | Ga0055526_1018229 | 3300003771 | Bacteria | 2630 |
| 44 | Ga0055537_1000320 | 3300003773 | Bacteria | 32832 |
| 45 | Ga0055537_1001534 | 3300003773 | Bacteria | 8838 |
| 46 | Ga0055537_1007598 | 3300003773 | Bacteria | 2597 |
| 47 | Ga0055524_1000044 | 3300003775 | Bacteria | 151631 |
| 48 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 49 | Ga0055536_1017883 | 3300003781 | Bacteria | 2297 |
| 50 | Ga0055534_1001482 | 3300003784 | Bacteria | 9319 |
| 51 | Ga0055534_1003391 | 3300003784 | Bacteria | 5020 |
| 52 | Ga0055534_1003755 | 3300003784 | Bacteria | 4676 |
| 53 | Ga0055528_1002526 | 3300003790 | Bacteria | 9743 |
| 54 | Ga0055528_1002727 | 3300003790 | Bacteria | 9271 |
| 55 | Ga0055528_1014474 | 3300003790 | Bacteria | 2917 |
| 56 | Ga0055528_1016568 | 3300003790 | Bacteria | 2597 |
| 57 | Ga0055530_10003990 | 3300003791 | Bacteria | 7959 |
| 58 | Ga0055530_10028740 | 3300003791 | Bacteria | 1497 |
| 59 | Ga0055540_1000019 | 3300003792 | Bacteria | 210593 |
| 60 | Ga0055540_1000116 | 3300003792 | Bacteria | 83801 |
| 61 | Ga0055540_1001799 | 3300003792 | Bacteria | 12186 |
| 62 | Ga0055540_1007088 | 3300003792 | Bacteria | 4305 |
| 63 | Ga0055540_1018406 | 3300003792 | Bacteria | 1915 |
| 64 | Ga0055540_1020148 | 3300003792 | Bacteria | 1773 |
| 65 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 66 | Ga0055531_10000250 | 3300003794 | Bacteria | 57734 |
| 67 | Ga0055531_10000360 | 3300003794 | Bacteria | 44186 |
| 68 | Ga0055531_10001074 | 3300003794 | Bacteria | 21465 |
| 69 | Ga0055531_10005011 | 3300003794 | Bacteria | 7854 |
| 70 | Ga0055541_1000032 | 3300003841 | Bacteria | 195460 |
| 71 | Ga0055541_1000053 | 3300003841 | Bacteria | 129958 |
| 72 | Ga0055543_1000404 | 3300004625 | Bacteria | 27579 |
| 73 | Ga0055543_1001848 | 3300004625 | Bacteria | 7724 |
| 74 | Ga0065165_1000080 | 3300005262 | Bacteria | 159638 |
| 75 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 76 | Ga0065165_1011617 | 3300005262 | Bacteria | 3649 |
| 77 | Ga0065714_10088736 | 3300005288 | Bacteria | 2005 |
| 78 | Ga0065704_10152799 | 3300005289 | Bacteria | 1404 |
| 79 | Ga0065712_10013487 | 3300005290 | Bacteria | 1940 |
| 80 | Ga0065715_10109100 | 3300005293 | Bacteria | 2684 |
| 81 | Ga0065715_10200115 | 3300005293 | Bacteria | 1366 |
| 82 | Ga0065707_10017403 | 3300005295 | Bacteria | 1832 |
| 83 | Ga0065707_10087447 | 3300005295 | Bacteria | 5021 |
| 84 | Ga0070676_10006671 | 3300005328 | Bacteria | 6182 |
| 85 | Ga0070676_10011485 | 3300005328 | Bacteria | 4814 |
| 86 | Ga0070676_10030468 | 3300005328 | Bacteria | 3077 |
| 87 | Ga0070676_10101322 | 3300005328 | Bacteria | 1779 |
| 88 | Ga0070683_100009064 | 3300005329 | Bacteria | 8492 |
| 89 | Ga0070683_100046656 | 3300005329 | Bacteria | 4003 |
| 90 | Ga0070683_100101987 | 3300005329 | Bacteria | 2703 |
| 91 | Ga0070690_100014678 | 3300005330 | Bacteria | 4651 |
| 92 | Ga0070670_100017831 | 3300005331 | Bacteria | 6093 |
| 93 | Ga0070670_100024246 | 3300005331 | Bacteria | 5218 |
| 94 | Ga0070670_100041714 | 3300005331 | Bacteria | 3943 |
| 95 | Ga0070670_100060294 | 3300005331 | Bacteria | 3257 |
| 96 | Ga0070670_100069385 | 3300005331 | Bacteria | 3025 |
| 97 | Ga0070677_10010696 | 3300005333 | Bacteria | 3144 |
| 98 | Ga0070677_10020993 | 3300005333 | Bacteria | 2389 |
| 99 | Ga0068869_100008706 | 3300005334 | Bacteria | 6554 |
| 100 | Ga0068869_100010988 | 3300005334 | Bacteria | 5928 |
| 101 | Ga0068869_100054844 | 3300005334 | Bacteria | 2903 |
| 102 | Ga0068869_100057452 | 3300005334 | Bacteria | 2841 |
| 103 | Ga0068869_100060701 | 3300005334 | Bacteria | 2772 |
| 104 | Ga0068869_100144839 | 3300005334 | Bacteria | 1838 |
| 105 | Ga0068869_100237443 | 3300005334 | Bacteria | 1451 |
| 106 | Ga0070666_10002017 | 3300005335 | Bacteria | 12359 |
| 107 | Ga0070666_10002085 | 3300005335 | Bacteria | 12146 |
| 108 | Ga0070666_10007234 | 3300005335 | Bacteria | 6842 |
| 109 | Ga0070666_10166859 | 3300005335 | Bacteria | 1540 |
| 110 | Ga0070666_10217006 | 3300005335 | Bacteria | 1348 |
| 111 | Ga0070680_100009175 | 3300005336 | Bacteria | 7586 |
| 112 | Ga0070680_100118137 | 3300005336 | Bacteria | 2212 |
| 113 | Ga0070682_100072046 | 3300005337 | Bacteria | 2213 |
| 114 | Ga0068868_100002479 | 3300005338 | Bacteria | 12803 |
| 115 | Ga0068868_100008720 | 3300005338 | Bacteria | 7259 |
| 116 | Ga0068868_100011294 | 3300005338 | Bacteria | 6502 |
| 117 | Ga0068868_100015252 | 3300005338 | Bacteria | 5680 |
| 118 | Ga0068868_100025044 | 3300005338 | Bacteria | 4532 |
| 119 | Ga0068868_100077031 | 3300005338 | Bacteria | 2667 |
| 120 | Ga0068868_100132339 | 3300005338 | Bacteria | 2042 |
| 121 | Ga0070660_100010146 | 3300005339 | Bacteria | 6646 |
| 122 | Ga0070660_100016617 | 3300005339 | Bacteria | 5345 |
| 123 | Ga0070660_100030279 | 3300005339 | Bacteria | 4061 |
| 124 | Ga0070660_100056082 | 3300005339 | Bacteria | 3047 |
| 125 | Ga0070660_100169243 | 3300005339 | Bacteria | 1764 |
| 126 | Ga0070689_100006450 | 3300005340 | Bacteria | 8119 |
| 127 | Ga0070689_100049233 | 3300005340 | Bacteria | 3252 |
| 128 | Ga0070661_100000438 | 3300005344 | Bacteria | 31889 |
| 129 | Ga0070661_100004052 | 3300005344 | Bacteria | 10084 |
| 130 | Ga0070661_100007525 | 3300005344 | Bacteria | 7513 |
| 131 | Ga0070661_100021533 | 3300005344 | Bacteria | 4607 |
| 132 | Ga0070661_100027172 | 3300005344 | Bacteria | 4119 |
| 133 | Ga0070661_100037457 | 3300005344 | Bacteria | 3528 |
| 134 | Ga0070661_100056385 | 3300005344 | Bacteria | 2879 |
| 135 | Ga0070661_100062540 | 3300005344 | Bacteria | 2732 |
| 136 | Ga0070661_100068487 | 3300005344 | Bacteria | 2608 |
| 137 | Ga0070661_100128680 | 3300005344 | Bacteria | 1901 |
| 138 | Ga0070668_100006235 | 3300005347 | Bacteria | 8832 |
| 139 | Ga0070668_100034620 | 3300005347 | Bacteria | 3850 |
| 140 | Ga0070668_100119179 | 3300005347 | Bacteria | 2108 |
| 141 | Ga0070669_100000836 | 3300005353 | Bacteria | 22361 |
| 142 | Ga0070669_100007603 | 3300005353 | Bacteria | 7748 |
| 143 | Ga0070675_100005877 | 3300005354 | Bacteria | 9400 |
| 144 | Ga0070675_100008456 | 3300005354 | Bacteria | 7990 |
| 145 | Ga0070675_100009844 | 3300005354 | Bacteria | 7452 |
| 146 | Ga0070675_100009921 | 3300005354 | Bacteria | 7426 |
| 147 | Ga0070675_100030409 | 3300005354 | Bacteria | 4360 |
| 148 | Ga0070675_100033037 | 3300005354 | Bacteria | 4192 |
| 149 | Ga0070675_100040122 | 3300005354 | Bacteria | 3821 |
| 150 | Ga0070675_100069679 | 3300005354 | Bacteria | 2914 |
| 151 | Ga0070675_100097175 | 3300005354 | Bacteria | 2476 |
| 152 | Ga0070675_100104043 | 3300005354 | Bacteria | 2394 |
| 153 | Ga0070675_100109297 | 3300005354 | Bacteria | 2337 |
| 154 | Ga0070675_100152851 | 3300005354 | Bacteria | 1980 |
| 155 | Ga0070675_100183000 | 3300005354 | Bacteria | 1812 |
| 156 | Ga0070671_100016262 | 3300005355 | Bacteria | 6018 |
| 157 | Ga0070671_100020139 | 3300005355 | Bacteria | 5437 |
| 158 | Ga0070671_100028811 | 3300005355 | Bacteria | 4576 |
| 159 | Ga0070671_100034619 | 3300005355 | Bacteria | 4181 |
| 160 | Ga0070671_100075349 | 3300005355 | Bacteria | 2818 |
| 161 | Ga0070671_100091607 | 3300005355 | Bacteria | 2547 |
| 162 | Ga0070671_100101544 | 3300005355 | Bacteria | 2413 |
| 163 | Ga0070674_100067268 | 3300005356 | Bacteria | 2520 |
| 164 | Ga0070674_100079454 | 3300005356 | Bacteria | 2340 |
| 165 | Ga0070673_100002109 | 3300005364 | Bacteria | 12020 |
| 166 | Ga0070673_100007014 | 3300005364 | Bacteria | 7387 |
| 167 | Ga0070673_100012438 | 3300005364 | Bacteria | 5842 |
| 168 | Ga0070673_100032447 | 3300005364 | Bacteria | 3933 |
| 169 | Ga0070673_100034161 | 3300005364 | Bacteria | 3845 |
| 170 | Ga0070673_100067153 | 3300005364 | Bacteria | 2867 |
| 171 | Ga0070688_100007417 | 3300005365 | Bacteria | 5912 |
| 172 | Ga0070688_100020548 | 3300005365 | Bacteria | 3840 |
| 173 | Ga0070688_100062864 | 3300005365 | Bacteria | 2351 |
| 174 | Ga0070659_100001517 | 3300005366 | Bacteria | 16743 |
| 175 | Ga0070659_100005912 | 3300005366 | Bacteria | 8817 |
| 176 | Ga0070659_100006674 | 3300005366 | Bacteria | 8340 |
| 177 | Ga0070659_100027105 | 3300005366 | Bacteria | 4412 |
| 178 | Ga0070659_100040928 | 3300005366 | Bacteria | 3621 |
| 179 | Ga0070659_100061022 | 3300005366 | Bacteria | 2979 |
| 180 | Ga0070659_100099618 | 3300005366 | Bacteria | 2338 |
| 181 | Ga0070667_100008976 | 3300005367 | Bacteria | 8276 |
| 182 | Ga0070667_100078199 | 3300005367 | Bacteria | 2826 |
| 183 | Ga0070667_100085453 | 3300005367 | Bacteria | 2706 |
| 184 | Ga0070714_100066057 | 3300005435 | Bacteria | 3117 |
| 185 | Ga0070713_100001286 | 3300005436 | Bacteria | 16035 |
| 186 | Ga0070713_100037564 | 3300005436 | Bacteria | 3916 |
| 187 | Ga0070713_100097345 | 3300005436 | Bacteria | 2542 |
| 188 | Ga0070710_10017813 | 3300005437 | Bacteria | 3645 |
| 189 | Ga0070711_100165078 | 3300005439 | Bacteria | 1682 |
| 190 | Ga0070705_100167164 | 3300005440 | Bacteria | 1476 |
| 191 | Ga0070700_100005556 | 3300005441 | Bacteria | 6683 |
| 192 | Ga0070700_100165449 | 3300005441 | Bacteria | 1527 |
| 193 | Ga0070708_100002113 | 3300005445 | Bacteria | 15337 |
| 194 | Ga0070708_100039865 | 3300005445 | Bacteria | 4112 |
| 195 | Ga0070663_100001569 | 3300005455 | Bacteria | 12571 |
| 196 | Ga0070663_100001571 | 3300005455 | Bacteria | 12554 |
| 197 | Ga0070663_100018838 | 3300005455 | Bacteria | 4536 |
| 198 | Ga0070663_100032139 | 3300005455 | Bacteria | 3614 |
| 199 | Ga0070663_100042377 | 3300005455 | Bacteria | 3198 |
| 200 | Ga0070678_100002034 | 3300005456 | Bacteria | 10937 |
| 201 | Ga0070678_100011593 | 3300005456 | Bacteria | 5444 |
| 202 | Ga0070678_100016983 | 3300005456 | Bacteria | 4672 |
| 203 | Ga0070678_100042434 | 3300005456 | Bacteria | 3233 |
| 204 | Ga0070678_100106891 | 3300005456 | Bacteria | 2181 |
| 205 | Ga0070662_100000797 | 3300005457 | Bacteria | 19366 |
| 206 | Ga0070662_100003074 | 3300005457 | Bacteria | 10362 |
| 207 | Ga0070662_100015946 | 3300005457 | Bacteria | 5040 |
| 208 | Ga0070662_100022556 | 3300005457 | Bacteria | 4311 |
| 209 | Ga0070662_100044324 | 3300005457 | Bacteria | 3186 |
| 210 | Ga0070662_100044744 | 3300005457 | Bacteria | 3172 |
| 211 | Ga0070681_10005522 | 3300005458 | Bacteria | 12219 |
| 212 | Ga0070681_10015862 | 3300005458 | Bacteria | 7510 |
| 213 | Ga0070681_10039054 | 3300005458 | Bacteria | 4759 |
| 214 | Ga0070681_10122983 | 3300005458 | Bacteria | 2528 |
| 215 | Ga0070681_10250846 | 3300005458 | Bacteria | 1682 |
| 216 | Ga0068867_100000072 | 3300005459 | Bacteria | 61663 |
| 217 | Ga0068867_100012146 | 3300005459 | Bacteria | 6084 |
| 218 | Ga0068867_100015998 | 3300005459 | Bacteria | 5326 |
| 219 | Ga0068867_100042119 | 3300005459 | Bacteria | 3339 |
| 220 | Ga0068867_100151478 | 3300005459 | Bacteria | 1822 |
| 221 | Ga0070685_10008232 | 3300005466 | Bacteria | 5348 |
| 222 | Ga0070706_100003148 | 3300005467 | Bacteria | 16310 |
| 223 | Ga0070679_100002623 | 3300005530 | Bacteria | 16359 |
| 224 | Ga0070679_100013959 | 3300005530 | Bacteria | 7698 |
| 225 | Ga0070679_100027132 | 3300005530 | Bacteria | 5633 |
| 226 | Ga0070684_100005280 | 3300005535 | Bacteria | 9886 |
| 227 | Ga0070684_100025049 | 3300005535 | Bacteria | 5010 |
| 228 | Ga0070684_100113710 | 3300005535 | Bacteria | 2429 |
| 229 | Ga0070684_100120705 | 3300005535 | Bacteria | 2358 |
| 230 | Ga0068853_100008733 | 3300005539 | Bacteria | 8152 |
| 231 | Ga0068853_100010500 | 3300005539 | Bacteria | 7488 |
| 232 | Ga0068853_100051363 | 3300005539 | Bacteria | 3548 |
| 233 | Ga0068853_100200788 | 3300005539 | Bacteria | 1814 |
| 234 | Ga0070672_100006178 | 3300005543 | Bacteria | 8017 |
| 235 | Ga0070672_100012097 | 3300005543 | Bacteria | 6041 |
| 236 | Ga0070672_100043693 | 3300005543 | Bacteria | 3457 |
| 237 | Ga0070672_100079220 | 3300005543 | Bacteria | 2629 |
| 238 | Ga0070672_100150738 | 3300005543 | Bacteria | 1923 |
| 239 | Ga0070686_100039757 | 3300005544 | Bacteria | 2932 |
| 240 | Ga0070696_100045688 | 3300005546 | Bacteria | 3034 |
| 241 | Ga0070665_100001671 | 3300005548 | Bacteria | 25571 |
| 242 | Ga0070665_100014514 | 3300005548 | Bacteria | 7902 |
| 243 | Ga0070665_100026041 | 3300005548 | Bacteria | 5890 |
| 244 | Ga0070665_100031464 | 3300005548 | Bacteria | 5341 |
| 245 | Ga0068855_100001947 | 3300005563 | Bacteria | 25644 |
| 246 | Ga0068855_100013553 | 3300005563 | Bacteria | 9834 |
| 247 | Ga0068855_100020007 | 3300005563 | Bacteria | 8038 |
| 248 | Ga0068855_100021278 | 3300005563 | Bacteria | 7777 |
| 249 | Ga0068855_100022085 | 3300005563 | Bacteria | 7628 |
| 250 | Ga0068855_100064929 | 3300005563 | Bacteria | 4256 |
| 251 | Ga0068855_100284948 | 3300005563 | Bacteria | 1833 |
| 252 | Ga0070664_100000572 | 3300005564 | Bacteria | 28020 |
| 253 | Ga0070664_100004505 | 3300005564 | Bacteria | 11177 |
| 254 | Ga0070664_100010523 | 3300005564 | Bacteria | 7497 |
| 255 | Ga0070664_100011975 | 3300005564 | Bacteria | 7042 |
| 256 | Ga0070664_100017181 | 3300005564 | Bacteria | 5939 |
| 257 | Ga0070664_100024891 | 3300005564 | Bacteria | 4958 |
| 258 | Ga0070664_100035428 | 3300005564 | Bacteria | 4190 |
| 259 | Ga0070664_100056592 | 3300005564 | Bacteria | 3332 |
| 260 | Ga0070664_100109582 | 3300005564 | Bacteria | 2408 |
| 261 | Ga0070664_100151381 | 3300005564 | Bacteria | 2048 |
| 262 | Ga0068857_100002092 | 3300005577 | Bacteria | 16226 |
| 263 | Ga0068857_100009749 | 3300005577 | Bacteria | 8341 |
| 264 | Ga0068857_100019562 | 3300005577 | Bacteria | 5947 |
| 265 | Ga0068857_100043710 | 3300005577 | Bacteria | 3973 |
| 266 | Ga0068854_100002901 | 3300005578 | Bacteria | 10652 |
| 267 | Ga0068854_100004679 | 3300005578 | Bacteria | 8624 |
| 268 | Ga0068854_100005922 | 3300005578 | Bacteria | 7744 |
| 269 | Ga0068854_100008715 | 3300005578 | Bacteria | 6527 |
| 270 | Ga0068854_100010091 | 3300005578 | Bacteria | 6116 |
| 271 | Ga0068854_100202106 | 3300005578 | Bacteria | 1563 |
| 272 | Ga0068856_100003475 | 3300005614 | Bacteria | 15910 |
| 273 | Ga0068856_100004714 | 3300005614 | Bacteria | 13539 |
| 274 | Ga0068856_100013533 | 3300005614 | Bacteria | 7896 |
| 275 | Ga0068856_100060225 | 3300005614 | Bacteria | 3751 |
| 276 | Ga0068856_100200213 | 3300005614 | Bacteria | 2011 |
| 277 | Ga0070702_100008273 | 3300005615 | Bacteria | 5028 |
| 278 | Ga0070702_100013368 | 3300005615 | Bacteria | 4143 |
| 279 | Ga0070702_100035799 | 3300005615 | Bacteria | 2745 |
| 280 | Ga0068852_100006367 | 3300005616 | Bacteria | 8528 |
| 281 | Ga0068852_100009785 | 3300005616 | Bacteria | 7127 |
| 282 | Ga0068852_100011377 | 3300005616 | Bacteria | 6696 |
| 283 | Ga0068852_100016444 | 3300005616 | Bacteria | 5770 |
| 284 | Ga0068852_100029219 | 3300005616 | Bacteria | 4525 |
| 285 | Ga0068852_100050451 | 3300005616 | Bacteria | 3565 |
| 286 | Ga0068852_100103957 | 3300005616 | Bacteria | 2570 |
| 287 | Ga0068852_100170849 | 3300005616 | Bacteria | 2038 |
| 288 | Ga0068852_100275515 | 3300005616 | Bacteria | 1620 |
| 289 | Ga0068859_100001759 | 3300005617 | Bacteria | 22061 |
| 290 | Ga0068859_100002838 | 3300005617 | Bacteria | 17576 |
| 291 | Ga0068859_100010805 | 3300005617 | Bacteria | 9191 |
| 292 | Ga0068859_100036303 | 3300005617 | Bacteria | 4948 |
| 293 | Ga0068859_100046656 | 3300005617 | Bacteria | 4350 |
| 294 | Ga0068859_100342822 | 3300005617 | Bacteria | 1588 |
| 295 | Ga0068864_100002362 | 3300005618 | Bacteria | 15612 |
| 296 | Ga0068864_100005230 | 3300005618 | Bacteria | 10636 |
| 297 | Ga0068864_100005322 | 3300005618 | Bacteria | 10542 |
| 298 | Ga0068864_100011034 | 3300005618 | Bacteria | 7468 |
| 299 | Ga0068864_100014018 | 3300005618 | Bacteria | 6647 |
| 300 | Ga0068864_100080310 | 3300005618 | Bacteria | 2857 |
| 301 | Ga0068864_100094802 | 3300005618 | Bacteria | 2638 |
| 302 | Ga0068864_100163016 | 3300005618 | Bacteria | 2028 |
| 303 | Ga0068866_10001400 | 3300005718 | Bacteria | 10388 |
| 304 | Ga0068866_10015287 | 3300005718 | Bacteria | 3407 |
| 305 | Ga0068861_100001649 | 3300005719 | Bacteria | 14258 |
| 306 | Ga0068861_100002141 | 3300005719 | Bacteria | 12777 |
| 307 | Ga0068861_100006425 | 3300005719 | Bacteria | 8007 |
| 308 | Ga0068861_100010613 | 3300005719 | Bacteria | 6396 |
| 309 | Ga0068861_100014120 | 3300005719 | Bacteria | 5601 |
| 310 | Ga0068861_100021452 | 3300005719 | Bacteria | 4641 |
| 311 | Ga0068851_10004000 | 3300005834 | Bacteria | 6616 |
| 312 | Ga0068851_10031226 | 3300005834 | Bacteria | 2644 |
| 313 | Ga0068851_10041079 | 3300005834 | Bacteria | 2325 |
| 314 | Ga0068870_10000981 | 3300005840 | Bacteria | 11256 |
| 315 | Ga0068870_10138090 | 3300005840 | Bacteria | 1423 |
| 316 | Ga0068863_100007421 | 3300005841 | Bacteria | 10730 |
| 317 | Ga0068863_100009748 | 3300005841 | Bacteria | 9367 |
| 318 | Ga0068863_100025176 | 3300005841 | Bacteria | 5674 |
| 319 | Ga0068863_100025192 | 3300005841 | Bacteria | 5672 |
| 320 | Ga0068863_100037649 | 3300005841 | Bacteria | 4604 |
| 321 | Ga0068863_100051872 | 3300005841 | Bacteria | 3887 |
| 322 | Ga0068863_100056582 | 3300005841 | Bacteria | 3713 |
| 323 | Ga0068863_100106534 | 3300005841 | Bacteria | 2667 |
| 324 | Ga0068863_100137817 | 3300005841 | Bacteria | 2331 |
| 325 | Ga0068863_100177019 | 3300005841 | Bacteria | 2047 |
| 326 | Ga0068858_100000947 | 3300005842 | Bacteria | 30015 |
| 327 | Ga0068858_100007512 | 3300005842 | Bacteria | 10535 |
| 328 | Ga0068858_100057393 | 3300005842 | Bacteria | 3598 |
| 329 | Ga0068858_100070827 | 3300005842 | Bacteria | 3232 |
| 330 | Ga0068858_100096548 | 3300005842 | Bacteria | 2754 |
| 331 | Ga0068860_100000590 | 3300005843 | Bacteria | 43453 |
| 332 | Ga0068860_100052167 | 3300005843 | Bacteria | 3890 |
| 333 | Ga0068860_100071631 | 3300005843 | Bacteria | 3293 |
| 334 | Ga0068860_100082698 | 3300005843 | Bacteria | 3053 |
| 335 | Ga0068860_100144366 | 3300005843 | Bacteria | 2289 |
| 336 | Ga0068862_100013089 | 3300005844 | Bacteria | 6861 |
| 337 | Ga0068862_100014282 | 3300005844 | Bacteria | 6587 |
| 338 | Ga0068862_100034543 | 3300005844 | Bacteria | 4279 |
| 339 | Ga0068862_100037384 | 3300005844 | Bacteria | 4115 |
| 340 | Ga0068862_100043174 | 3300005844 | Bacteria | 3843 |
| 341 | Ga0068862_100060042 | 3300005844 | Bacteria | 3265 |
| 342 | Ga0075365_10005740 | 3300006038 | Bacteria | 6735 |
| 343 | Ga0075365_10050093 | 3300006038 | Bacteria | 2754 |
| 344 | Ga0075365_10092652 | 3300006038 | Bacteria | 2060 |
| 345 | Ga0075365_10116201 | 3300006038 | Bacteria | 1842 |
| 346 | Ga0075365_10145844 | 3300006038 | Bacteria | 1645 |
| 347 | Ga0075368_10017820 | 3300006042 | Bacteria | 2661 |
| 348 | Ga0075368_10046679 | 3300006042 | Bacteria | 1713 |
| 349 | Ga0075364_10026805 | 3300006051 | Bacteria | 3678 |
| 350 | Ga0075364_10035233 | 3300006051 | Bacteria | 3234 |
| 351 | Ga0075432_10031116 | 3300006058 | Bacteria | 1847 |
| 352 | Ga0070716_100018621 | 3300006173 | Bacteria | 3620 |
| 353 | Ga0070716_100120684 | 3300006173 | Bacteria | 1640 |
| 354 | Ga0075362_10002448 | 3300006177 | Bacteria | 6240 |
| 355 | Ga0075362_10031931 | 3300006177 | Bacteria | 2282 |
| 356 | Ga0075362_10062616 | 3300006177 | Bacteria | 1685 |
| 357 | Ga0075367_10009399 | 3300006178 | Bacteria | 5108 |
| 358 | Ga0075367_10011488 | 3300006178 | Bacteria | 4689 |
| 359 | Ga0075367_10029375 | 3300006178 | Bacteria | 3144 |
| 360 | Ga0075367_10046968 | 3300006178 | Bacteria | 2538 |
| 361 | Ga0075366_10001777 | 3300006195 | Bacteria | 10884 |
| 362 | Ga0075366_10005505 | 3300006195 | Bacteria | 6861 |
| 363 | Ga0075366_10008469 | 3300006195 | Bacteria | 5720 |
| 364 | Ga0075366_10061854 | 3300006195 | Bacteria | 2226 |
| 365 | Ga0075366_10123098 | 3300006195 | Bacteria | 1563 |
| 366 | Ga0097621_100009497 | 3300006237 | Bacteria | 7062 |
| 367 | Ga0097621_100009981 | 3300006237 | Bacteria | 6920 |
| 368 | Ga0097621_100038502 | 3300006237 | Bacteria | 3837 |
| 369 | Ga0097621_100039883 | 3300006237 | Bacteria | 3773 |
| 370 | Ga0097621_100069465 | 3300006237 | Bacteria | 2908 |
| 371 | Ga0097621_100071592 | 3300006237 | Bacteria | 2865 |
| 372 | Ga0097621_100303580 | 3300006237 | Bacteria | 1410 |
| 373 | Ga0097621_100350519 | 3300006237 | Bacteria | 1313 |
| 374 | Ga0075370_10000547 | 3300006353 | Bacteria | 14418 |
| 375 | Ga0075370_10010371 | 3300006353 | Bacteria | 4870 |
| 376 | Ga0075370_10010601 | 3300006353 | Bacteria | 4827 |
| 377 | Ga0075370_10023495 | 3300006353 | Bacteria | 3396 |
| 378 | Ga0068871_100003477 | 3300006358 | Bacteria | 10822 |
| 379 | Ga0068871_100007404 | 3300006358 | Bacteria | 7838 |
| 380 | Ga0068871_100014944 | 3300006358 | Bacteria | 5803 |
| 381 | Ga0068871_100063179 | 3300006358 | Bacteria | 3027 |
| 382 | Ga0068871_100097689 | 3300006358 | Bacteria | 2455 |
| 383 | Ga0068871_100099589 | 3300006358 | Bacteria | 2433 |
| 384 | Ga0068871_100178021 | 3300006358 | Bacteria | 1826 |
| 385 | Ga0075434_100025677 | 3300006871 | Bacteria | 5765 |
| 386 | Ga0075429_100000199 | 3300006880 | Bacteria | 39995 |
| 387 | Ga0075429_100043639 | 3300006880 | Bacteria | 3902 |
| 388 | Ga0068865_100002420 | 3300006881 | Bacteria | 11023 |
| 389 | Ga0068865_100020119 | 3300006881 | Bacteria | 4328 |
| 390 | Ga0075436_100018851 | 3300006914 | Bacteria | 4725 |
| 391 | Ga0097620_100001759 | 3300006931 | Bacteria | 22061 |
| 392 | Ga0097620_100002838 | 3300006931 | Bacteria | 17576 |
| 393 | Ga0097620_100010805 | 3300006931 | Bacteria | 9191 |
| 394 | Ga0097620_100036302 | 3300006931 | Bacteria | 4948 |
| 395 | Ga0097620_100046656 | 3300006931 | Bacteria | 4350 |
| 396 | Ga0097620_100342816 | 3300006931 | Bacteria | 1588 |
| 397 | Ga0099824_1027880 | 3300006942 | Bacteria | 2652 |
| 398 | Ga0099823_1000108 | 3300006944 | Bacteria | 41193 |
| 399 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 400 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 401 | Ga0099826_10006960 | 3300006948 | Bacteria | 8290 |
| 402 | Ga0075435_100032473 | 3300007076 | Bacteria | 4123 |
| 403 | Ga0105244_10010566 | 3300009036 | Bacteria | 5590 |
| 404 | Ga0105250_10000294 | 3300009092 | Bacteria | 39500 |
| 405 | Ga0105240_10012066 | 3300009093 | Bacteria | 11973 |
| 406 | Ga0105240_10012882 | 3300009093 | Bacteria | 11516 |
| 407 | Ga0105240_10031744 | 3300009093 | Bacteria | 6845 |
| 408 | Ga0105240_10047500 | 3300009093 | Bacteria | 5432 |
| 409 | Ga0105240_10051763 | 3300009093 | Bacteria | 5166 |
| 410 | Ga0105240_10109992 | 3300009093 | Bacteria | 3336 |
| 411 | Ga0105240_10316966 | 3300009093 | Bacteria | 1778 |
| 412 | Ga0111539_10048149 | 3300009094 | Bacteria | 5091 |
| 413 | Ga0111539_10144488 | 3300009094 | Bacteria | 2785 |
| 414 | Ga0105245_10060559 | 3300009098 | Bacteria | 3409 |
| 415 | Ga0105245_10347878 | 3300009098 | Bacteria | 1468 |
| 416 | Ga0105245_10377880 | 3300009098 | Bacteria | 1410 |
| 417 | Ga0105245_10387134 | 3300009098 | Bacteria | 1394 |
| 418 | Ga0105243_10001108 | 3300009148 | Bacteria | 24452 |
| 419 | Ga0105243_10001868 | 3300009148 | Bacteria | 17976 |
| 420 | Ga0105243_10093394 | 3300009148 | Bacteria | 2483 |
| 421 | Ga0105243_10120540 | 3300009148 | Bacteria | 2210 |
| 422 | Ga0105243_10158622 | 3300009148 | Bacteria | 1948 |
| 423 | Ga0105243_10385206 | 3300009148 | Bacteria | 1298 |
| 424 | Ga0105241_10004716 | 3300009174 | Bacteria | 10056 |
| 425 | Ga0105241_10069834 | 3300009174 | Bacteria | 2724 |
| 426 | Ga0105241_10256939 | 3300009174 | Bacteria | 1483 |
| 427 | Ga0105242_10011479 | 3300009176 | Bacteria | 6811 |
| 428 | Ga0105242_10030183 | 3300009176 | Bacteria | 4328 |
| 429 | Ga0105242_10049864 | 3300009176 | Bacteria | 3408 |
| 430 | Ga0105242_10121374 | 3300009176 | Bacteria | 2243 |
| 431 | Ga0105242_10340321 | 3300009176 | Bacteria | 1382 |
| 432 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 433 | Ga0105248_10006109 | 3300009177 | Bacteria | 13214 |
| 434 | Ga0105248_10007313 | 3300009177 | Bacteria | 12115 |
| 435 | Ga0105248_10061200 | 3300009177 | Bacteria | 4227 |
| 436 | Ga0105248_10119810 | 3300009177 | Bacteria | 2968 |
| 437 | Ga0105248_10160069 | 3300009177 | Bacteria | 2540 |
| 438 | Ga0105237_10003214 | 3300009545 | Bacteria | 19566 |
| 439 | Ga0105237_10066737 | 3300009545 | Bacteria | 3592 |
| 440 | Ga0105237_10181937 | 3300009545 | Bacteria | 2102 |
| 441 | Ga0105237_10389713 | 3300009545 | Bacteria | 1398 |
| 442 | Ga0105238_10000817 | 3300009551 | Bacteria | 32236 |
| 443 | Ga0105238_10018524 | 3300009551 | Bacteria | 7086 |
| 444 | Ga0105238_10018739 | 3300009551 | Bacteria | 7049 |
| 445 | Ga0105238_10083247 | 3300009551 | Bacteria | 3189 |
| 446 | Ga0105238_10145997 | 3300009551 | Bacteria | 2342 |
| 447 | Ga0105238_10180779 | 3300009551 | Bacteria | 2086 |
| 448 | Ga0105249_10024640 | 3300009553 | Bacteria | 5408 |
| 449 | Ga0105249_10099872 | 3300009553 | Bacteria | 2728 |
| 450 | Ga0105249_10249714 | 3300009553 | Bacteria | 1758 |
| 451 | Ga0105239_10003443 | 3300010375 | Bacteria | 19378 |
| 452 | Ga0105239_10024436 | 3300010375 | Bacteria | 6658 |
| 453 | Ga0105239_10038542 | 3300010375 | Bacteria | 5237 |
| 454 | Ga0105239_10051729 | 3300010375 | Bacteria | 4503 |
| 455 | Ga0105239_10097148 | 3300010375 | Bacteria | 3255 |
| 456 | Ga0105239_10259343 | 3300010375 | Bacteria | 1953 |
| 457 | Ga0105246_10057554 | 3300011119 | Bacteria | 2690 |
| 458 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 459 | Ga0157347_1001428 | 3300012502 | Bacteria | 1871 |
| 460 | Ga0157373_10004823 | 3300013100 | Bacteria | 10150 |
| 461 | Ga0157373_10008907 | 3300013100 | Bacteria | 7426 |
| 462 | Ga0157371_10007668 | 3300013102 | Bacteria | 8693 |
| 463 | Ga0157370_10008735 | 3300013104 | Bacteria | 10897 |
| 464 | Ga0157370_10032452 | 3300013104 | Bacteria | 5100 |
| 465 | Ga0157370_10311775 | 3300013104 | Bacteria | 1452 |
| 466 | Ga0157369_10007682 | 3300013105 | Bacteria | 12405 |
| 467 | Ga0157369_10018375 | 3300013105 | Bacteria | 7840 |
| 468 | Ga0157369_10021429 | 3300013105 | Bacteria | 7230 |
| 469 | Ga0157369_10026832 | 3300013105 | Bacteria | 6387 |
| 470 | Ga0157374_10000405 | 3300013296 | Bacteria | 39195 |
| 471 | Ga0157374_10020758 | 3300013296 | Bacteria | 5832 |
| 472 | Ga0157374_10078208 | 3300013296 | Bacteria | 3132 |
| 473 | Ga0157374_10144974 | 3300013296 | Bacteria | 2306 |
| 474 | Ga0157374_10167221 | 3300013296 | Bacteria | 2144 |
| 475 | Ga0157374_10334116 | 3300013296 | Bacteria | 1503 |
| 476 | Ga0157378_10008627 | 3300013297 | Bacteria | 8870 |
| 477 | Ga0157378_10087901 | 3300013297 | Bacteria | 2820 |
| 478 | Ga0163162_10002118 | 3300013306 | Bacteria | 18641 |
| 479 | Ga0163162_10004629 | 3300013306 | Bacteria | 13259 |
| 480 | Ga0163162_10020602 | 3300013306 | Bacteria | 6479 |
| 481 | Ga0163162_10026350 | 3300013306 | Bacteria | 5746 |
| 482 | Ga0163162_10048256 | 3300013306 | Bacteria | 4266 |
| 483 | Ga0163162_10100914 | 3300013306 | Bacteria | 2978 |
| 484 | Ga0163162_10113345 | 3300013306 | Bacteria | 2810 |
| 485 | Ga0163162_10182405 | 3300013306 | Bacteria | 2225 |
| 486 | Ga0163162_10219221 | 3300013306 | Bacteria | 2032 |
| 487 | Ga0157372_10010109 | 3300013307 | Bacteria | 10024 |
| 488 | Ga0157372_10015837 | 3300013307 | Bacteria | 8089 |
| 489 | Ga0157372_10189038 | 3300013307 | Bacteria | 2385 |
| 490 | Ga0157375_10007074 | 3300013308 | Bacteria | 9797 |
| 491 | Ga0157375_10057331 | 3300013308 | Bacteria | 3849 |
| 492 | Ga0157375_10488018 | 3300013308 | Bacteria | 1397 |
| 493 | Ga0163163_10020056 | 3300014325 | Bacteria | 6291 |
| 494 | Ga0157380_10026083 | 3300014326 | Bacteria | 4436 |
| 495 | Ga0182008_10013362 | 3300014497 | Bacteria | 4317 |
| 496 | Ga0182008_10048302 | 3300014497 | Bacteria | 2113 |
| 497 | Ga0157377_10000075 | 3300014745 | Bacteria | 76405 |
| 498 | Ga0157377_10044154 | 3300014745 | Bacteria | 2484 |
| 499 | Ga0157377_10115078 | 3300014745 | Bacteria | 1622 |
| 500 | Ga0157379_10006796 | 3300014968 | Bacteria | 9889 |
| 501 | Ga0157379_10012230 | 3300014968 | Bacteria | 7496 |
| 502 | Ga0157379_10017154 | 3300014968 | Bacteria | 6377 |
| 503 | Ga0157379_10154770 | 3300014968 | Bacteria | 2068 |
| 504 | Ga0157376_10005741 | 3300014969 | Bacteria | 8692 |
| 505 | Ga0157376_10067109 | 3300014969 | Bacteria | 3034 |
| 506 | Ga0157376_10133207 | 3300014969 | Bacteria | 2221 |
| 507 | Ga0157376_10198070 | 3300014969 | Bacteria | 1846 |
| 508 | Ga0182006_1011518 | 3300015261 | Bacteria | 3890 |
| 509 | Ga0182007_10003324 | 3300015262 | Bacteria | 7611 |
| 510 | Ga0182007_10003382 | 3300015262 | Bacteria | 7517 |
| 511 | Ga0182007_10005244 | 3300015262 | Bacteria | 5722 |
| 512 | Ga0182005_1000283 | 3300015265 | Bacteria | 31970 |
| 513 | Ga0182005_1010533 | 3300015265 | Bacteria | 2657 |
| 514 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 515 | Ga0163161_10003044 | 3300017792 | Bacteria | 11837 |
| 516 | Ga0163161_10011045 | 3300017792 | Bacteria | 6255 |
| 517 | Ga0163161_10017948 | 3300017792 | Bacteria | 4959 |
| 518 | Ga0163161_10066522 | 3300017792 | Bacteria | 2632 |
| 519 | Ga0163161_10105089 | 3300017792 | Bacteria | 2106 |
| 520 | Ga0163161_10132337 | 3300017792 | Bacteria | 1883 |
| 521 | Ga0163161_10260705 | 3300017792 | Bacteria | 1354 |
| 522 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 523 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 524 | Ga0213872_10000085 | 3300021361 | Bacteria | 85496 |
| 525 | Ga0213872_10011538 | 3300021361 | Bacteria | 4179 |
| 526 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 527 | Ga0209784_100049 | 3300025224 | Bacteria | 195512 |
| 528 | Ga0209784_100083 | 3300025224 | Bacteria | 131194 |
| 529 | Ga0209566_100061 | 3300025225 | Bacteria | 195512 |
| 530 | Ga0209566_100102 | 3300025225 | Bacteria | 131194 |
| 531 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 532 | Ga0209674_100069 | 3300025226 | Bacteria | 243948 |
| 533 | Ga0209674_100125 | 3300025226 | Bacteria | 131194 |
| 534 | Ga0209672_100490 | 3300025228 | Bacteria | 22033 |
| 535 | Ga0209147_103153 | 3300025229 | Bacteria | 3404 |
| 536 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 537 | Ga0209563_100083 | 3300025230 | Bacteria | 195512 |
| 538 | Ga0209563_100120 | 3300025230 | Bacteria | 131194 |
| 539 | Ga0207427_100345 | 3300025231 | Bacteria | 30030 |
| 540 | Ga0207427_100646 | 3300025231 | Bacteria | 16896 |
| 541 | Ga0209437_100091 | 3300025233 | Bacteria | 243344 |
| 542 | Ga0209258_100132 | 3300025242 | Bacteria | 175292 |
| 543 | Ga0209258_100344 | 3300025242 | Bacteria | 68131 |
| 544 | Ga0209258_100785 | 3300025242 | Bacteria | 19212 |
| 545 | Ga0207425_1000797 | 3300025245 | Bacteria | 16048 |
| 546 | Ga0207425_1007126 | 3300025245 | Bacteria | 2986 |
| 547 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 548 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 549 | Ga0209646_1000723 | 3300025246 | Bacteria | 11690 |
| 550 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 551 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 552 | Ga0209026_1003125 | 3300025250 | Bacteria | 5640 |
| 553 | Ga0209677_100039 | 3300025253 | Bacteria | 243974 |
| 554 | Ga0209677_100076 | 3300025253 | Bacteria | 131194 |
| 555 | Ga0209677_100096 | 3300025253 | Bacteria | 99089 |
| 556 | Ga0209677_101194 | 3300025253 | Bacteria | 11889 |
| 557 | Ga0209677_101643 | 3300025253 | Bacteria | 9404 |
| 558 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 559 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 560 | Ga0209759_1000075 | 3300025256 | Bacteria | 176235 |
| 561 | Ga0209759_1001215 | 3300025256 | Bacteria | 15837 |
| 562 | Ga0209759_1001295 | 3300025256 | Bacteria | 14863 |
| 563 | Ga0209759_1017548 | 3300025256 | Bacteria | 1761 |
| 564 | Ga0209129_1000012 | 3300025258 | Bacteria | 541516 |
| 565 | Ga0209129_1000084 | 3300025258 | Bacteria | 182554 |
| 566 | Ga0209233_1000115 | 3300025261 | Bacteria | 243344 |
| 567 | Ga0209565_1000169 | 3300025263 | Bacteria | 84839 |
| 568 | Ga0209565_1000932 | 3300025263 | Bacteria | 15416 |
| 569 | Ga0209565_1001971 | 3300025263 | Bacteria | 8032 |
| 570 | Ga0209565_1004734 | 3300025263 | Bacteria | 4083 |
| 571 | Ga0209565_1008810 | 3300025263 | Bacteria | 2612 |
| 572 | Ga0209455_1000242 | 3300025272 | Bacteria | 68131 |
| 573 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 574 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 575 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 576 | Ga0209673_1001414 | 3300025273 | Bacteria | 23194 |
| 577 | Ga0209673_1003881 | 3300025273 | Bacteria | 8425 |
| 578 | Ga0209673_1006922 | 3300025273 | Bacteria | 5363 |
| 579 | Ga0209673_1010298 | 3300025273 | Bacteria | 3948 |
| 580 | Ga0209673_1014476 | 3300025273 | Bacteria | 3050 |
| 581 | Ga0209673_1020689 | 3300025273 | Bacteria | 2324 |
| 582 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 583 | Ga0209130_1000571 | 3300025284 | Bacteria | 36074 |
| 584 | Ga0209130_1000712 | 3300025284 | Bacteria | 29562 |
| 585 | Ga0209130_1002101 | 3300025284 | Bacteria | 10659 |
| 586 | Ga0209130_1010938 | 3300025284 | Bacteria | 2463 |
| 587 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 588 | Ga0209675_1000144 | 3300025291 | Bacteria | 94908 |
| 589 | Ga0209675_1001716 | 3300025291 | Bacteria | 12071 |
| 590 | Ga0209675_1005868 | 3300025291 | Bacteria | 5042 |
| 591 | Ga0209675_1006789 | 3300025291 | Bacteria | 4520 |
| 592 | Ga0209676_1000051 | 3300025292 | Bacteria | 389016 |
| 593 | Ga0209676_1000415 | 3300025292 | Bacteria | 76430 |
| 594 | Ga0209676_1006391 | 3300025292 | Bacteria | 5830 |
| 595 | Ga0209025_1000719 | 3300025294 | Bacteria | 56292 |
| 596 | Ga0209025_1000861 | 3300025294 | Bacteria | 47942 |
| 597 | Ga0209025_1003734 | 3300025294 | Bacteria | 13962 |
| 598 | Ga0209025_1004082 | 3300025294 | Bacteria | 13026 |
| 599 | Ga0209025_1010095 | 3300025294 | Bacteria | 6452 |
| 600 | Ga0209025_1021688 | 3300025294 | Bacteria | 3446 |
| 601 | Ga0209025_1026809 | 3300025294 | Bacteria | 2878 |
| 602 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 603 | Ga0209564_1000022 | 3300025295 | Bacteria | 555109 |
| 604 | Ga0209564_1000414 | 3300025295 | Bacteria | 75224 |
| 605 | Ga0209564_1000613 | 3300025295 | Bacteria | 55031 |
| 606 | Ga0209564_1002503 | 3300025295 | Bacteria | 14283 |
| 607 | Ga0209564_1002535 | 3300025295 | Bacteria | 14099 |
| 608 | Ga0209564_1007735 | 3300025295 | Bacteria | 5468 |
| 609 | Ga0209758_1000099 | 3300025297 | Bacteria | 230054 |
| 610 | Ga0209758_1002249 | 3300025297 | Bacteria | 20036 |
| 611 | Ga0209758_1009725 | 3300025297 | Bacteria | 5909 |
| 612 | Ga0209050_1000044 | 3300025298 | Bacteria | 391114 |
| 613 | Ga0209050_1000052 | 3300025298 | Bacteria | 351785 |
| 614 | Ga0209050_1001274 | 3300025298 | Bacteria | 28926 |
| 615 | Ga0209050_1001635 | 3300025298 | Bacteria | 22939 |
| 616 | Ga0209050_1001761 | 3300025298 | Bacteria | 21453 |
| 617 | Ga0209050_1001765 | 3300025298 | Bacteria | 21356 |
| 618 | Ga0209050_1003656 | 3300025298 | Bacteria | 11112 |
| 619 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 620 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 621 | Ga0209256_1000206 | 3300025299 | Bacteria | 111425 |
| 622 | Ga0209256_1000239 | 3300025299 | Bacteria | 97580 |
| 623 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 624 | Ga0207426_1000086 | 3300025302 | Bacteria | 292089 |
| 625 | Ga0207426_1000116 | 3300025302 | Bacteria | 225245 |
| 626 | Ga0207426_1000346 | 3300025302 | Bacteria | 85832 |
| 627 | Ga0207426_1003514 | 3300025302 | Bacteria | 8431 |
| 628 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 629 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 630 | Ga0209051_1000031 | 3300025303 | Bacteria | 391114 |
| 631 | Ga0209051_1000071 | 3300025303 | Bacteria | 210843 |
| 632 | Ga0209051_1000420 | 3300025303 | Bacteria | 58383 |
| 633 | Ga0209051_1000492 | 3300025303 | Bacteria | 51006 |
| 634 | Ga0209051_1000752 | 3300025303 | Bacteria | 34790 |
| 635 | Ga0209051_1001081 | 3300025303 | Bacteria | 25280 |
| 636 | Ga0209051_1001319 | 3300025303 | Bacteria | 21686 |
| 637 | Ga0209051_1002112 | 3300025303 | Bacteria | 14864 |
| 638 | Ga0209051_1007962 | 3300025303 | Bacteria | 5700 |
| 639 | Ga0209051_1019510 | 3300025303 | Bacteria | 2955 |
| 640 | Ga0209051_1026024 | 3300025303 | Bacteria | 2368 |
| 641 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 642 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 643 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 644 | Ga0209257_1000058 | 3300025304 | Bacteria | 381686 |
| 645 | Ga0209257_1000367 | 3300025304 | Bacteria | 91077 |
| 646 | Ga0209257_1000719 | 3300025304 | Bacteria | 50884 |
| 647 | Ga0209257_1031541 | 3300025304 | Bacteria | 1693 |
| 648 | Ga0207697_10000580 | 3300025315 | Bacteria | 20841 |
| 649 | Ga0207697_10004433 | 3300025315 | Bacteria | 6709 |
| 650 | Ga0207697_10009395 | 3300025315 | Bacteria | 4226 |
| 651 | Ga0207656_10007059 | 3300025321 | Bacteria | 4078 |
| 652 | Ga0207656_10080061 | 3300025321 | Bacteria | 1466 |
| 653 | Ga0207696_1001482 | 3300025711 | Bacteria | 12690 |
| 654 | Ga0207655_1000477 | 3300025728 | Bacteria | 51677 |
| 655 | Ga0207682_10000010 | 3300025893 | Bacteria | 85697 |
| 656 | Ga0207682_10002075 | 3300025893 | Bacteria | 9079 |
| 657 | Ga0207682_10002877 | 3300025893 | Bacteria | 7600 |
| 658 | Ga0207682_10018734 | 3300025893 | Bacteria | 2708 |
| 659 | Ga0207682_10020527 | 3300025893 | Bacteria | 2594 |
| 660 | Ga0207642_10124474 | 3300025899 | Bacteria | 1335 |
| 661 | Ga0207688_10000541 | 3300025901 | Bacteria | 18381 |
| 662 | Ga0207688_10084320 | 3300025901 | Bacteria | 1819 |
| 663 | Ga0207688_10147645 | 3300025901 | Bacteria | 1387 |
| 664 | Ga0207680_10007194 | 3300025903 | Bacteria | 5411 |
| 665 | Ga0207680_10017182 | 3300025903 | Bacteria | 3817 |
| 666 | Ga0207680_10019704 | 3300025903 | Bacteria | 3613 |
| 667 | Ga0207680_10108021 | 3300025903 | Bacteria | 1799 |
| 668 | Ga0207685_10008993 | 3300025905 | Bacteria | 2880 |
| 669 | Ga0207699_10106162 | 3300025906 | Bacteria | 1792 |
| 670 | Ga0207645_10001138 | 3300025907 | Bacteria | 21981 |
| 671 | Ga0207645_10002795 | 3300025907 | Bacteria | 13587 |
| 672 | Ga0207645_10010204 | 3300025907 | Bacteria | 6456 |
| 673 | Ga0207645_10020426 | 3300025907 | Bacteria | 4336 |
| 674 | Ga0207645_10027702 | 3300025907 | Bacteria | 3658 |
| 675 | Ga0207645_10041651 | 3300025907 | Bacteria | 2939 |
| 676 | Ga0207645_10074755 | 3300025907 | Bacteria | 2169 |
| 677 | Ga0207643_10000358 | 3300025908 | Bacteria | 30599 |
| 678 | Ga0207643_10045783 | 3300025908 | Bacteria | 2471 |
| 679 | Ga0207643_10068770 | 3300025908 | Bacteria | 2035 |
| 680 | Ga0207705_10046815 | 3300025909 | Bacteria | 3109 |
| 681 | Ga0207705_10062003 | 3300025909 | Bacteria | 2701 |
| 682 | Ga0207684_10003773 | 3300025910 | Bacteria | 14639 |
| 683 | Ga0207654_10014797 | 3300025911 | Bacteria | 4038 |
| 684 | Ga0207707_10032526 | 3300025912 | Bacteria | 4565 |
| 685 | Ga0207707_10050800 | 3300025912 | Bacteria | 3611 |
| 686 | Ga0207707_10069151 | 3300025912 | Bacteria | 3077 |
| 687 | Ga0207707_10220456 | 3300025912 | Bacteria | 1651 |
| 688 | Ga0207695_10013680 | 3300025913 | Bacteria | 9661 |
| 689 | Ga0207695_10080597 | 3300025913 | Bacteria | 3296 |
| 690 | Ga0207695_10121591 | 3300025913 | Bacteria | 2578 |
| 691 | Ga0207695_10184912 | 3300025913 | Bacteria | 2003 |
| 692 | Ga0207671_10002520 | 3300025914 | Bacteria | 19532 |
| 693 | Ga0207671_10017480 | 3300025914 | Bacteria | 5527 |
| 694 | Ga0207693_10002709 | 3300025915 | Bacteria | 15353 |
| 695 | Ga0207693_10156306 | 3300025915 | Bacteria | 1793 |
| 696 | Ga0207660_10120102 | 3300025917 | Bacteria | 1989 |
| 697 | Ga0207662_10012419 | 3300025918 | Bacteria | 4743 |
| 698 | Ga0207657_10000329 | 3300025919 | Bacteria | 50461 |
| 699 | Ga0207657_10003889 | 3300025919 | Bacteria | 15849 |
| 700 | Ga0207657_10029367 | 3300025919 | Bacteria | 5006 |
| 701 | Ga0207657_10041771 | 3300025919 | Bacteria | 4052 |
| 702 | Ga0207657_10069270 | 3300025919 | Bacteria | 2994 |
| 703 | Ga0207657_10103581 | 3300025919 | Bacteria | 2359 |
| 704 | Ga0207657_10140586 | 3300025919 | Bacteria | 1973 |
| 705 | Ga0207649_10003489 | 3300025920 | Bacteria | 8589 |
| 706 | Ga0207649_10040363 | 3300025920 | Bacteria | 2836 |
| 707 | Ga0207652_10083435 | 3300025921 | Bacteria | 2798 |
| 708 | Ga0207652_10140993 | 3300025921 | Bacteria | 2155 |
| 709 | Ga0207652_10143688 | 3300025921 | Bacteria | 2134 |
| 710 | Ga0207681_10000593 | 3300025923 | Bacteria | 24630 |
| 711 | Ga0207681_10003975 | 3300025923 | Bacteria | 9166 |
| 712 | Ga0207681_10005852 | 3300025923 | Bacteria | 7537 |
| 713 | Ga0207681_10011148 | 3300025923 | Bacteria | 5519 |
| 714 | Ga0207681_10023399 | 3300025923 | Bacteria | 3951 |
| 715 | Ga0207681_10050755 | 3300025923 | Bacteria | 2807 |
| 716 | Ga0207681_10193381 | 3300025923 | Bacteria | 1558 |
| 717 | Ga0207681_10221012 | 3300025923 | Bacteria | 1465 |
| 718 | Ga0207694_10001061 | 3300025924 | Bacteria | 23914 |
| 719 | Ga0207694_10001640 | 3300025924 | Bacteria | 18831 |
| 720 | Ga0207694_10015585 | 3300025924 | Bacteria | 5732 |
| 721 | Ga0207694_10053926 | 3300025924 | Bacteria | 3119 |
| 722 | Ga0207694_10112853 | 3300025924 | Bacteria | 2163 |
| 723 | Ga0207694_10305178 | 3300025924 | Bacteria | 1311 |
| 724 | Ga0207650_10001551 | 3300025925 | Bacteria | 16459 |
| 725 | Ga0207650_10002902 | 3300025925 | Bacteria | 11833 |
| 726 | Ga0207650_10046033 | 3300025925 | Bacteria | 3211 |
| 727 | Ga0207650_10058264 | 3300025925 | Bacteria | 2875 |
| 728 | Ga0207650_10059741 | 3300025925 | Bacteria | 2843 |
| 729 | Ga0207650_10071603 | 3300025925 | Bacteria | 2608 |
| 730 | Ga0207650_10087964 | 3300025925 | Bacteria | 2368 |
| 731 | Ga0207650_10136531 | 3300025925 | Bacteria | 1924 |
| 732 | Ga0207659_10001370 | 3300025926 | Bacteria | 14544 |
| 733 | Ga0207659_10002674 | 3300025926 | Bacteria | 10616 |
| 734 | Ga0207659_10008500 | 3300025926 | Bacteria | 6378 |
| 735 | Ga0207659_10010170 | 3300025926 | Bacteria | 5900 |
| 736 | Ga0207659_10027013 | 3300025926 | Bacteria | 3881 |
| 737 | Ga0207659_10045626 | 3300025926 | Bacteria | 3091 |
| 738 | Ga0207659_10082147 | 3300025926 | Bacteria | 2385 |
| 739 | Ga0207659_10084837 | 3300025926 | Bacteria | 2351 |
| 740 | Ga0207659_10102409 | 3300025926 | Bacteria | 2161 |
| 741 | Ga0207687_10011753 | 3300025927 | Bacteria | 5729 |
| 742 | Ga0207687_10040982 | 3300025927 | Bacteria | 3177 |
| 743 | Ga0207700_10001214 | 3300025928 | Bacteria | 14768 |
| 744 | Ga0207700_10004270 | 3300025928 | Bacteria | 8400 |
| 745 | Ga0207700_10237960 | 3300025928 | Bacteria | 1551 |
| 746 | Ga0207664_10014950 | 3300025929 | Bacteria | 5619 |
| 747 | Ga0207664_10085161 | 3300025929 | Bacteria | 2579 |
| 748 | Ga0207644_10001724 | 3300025931 | Bacteria | 14137 |
| 749 | Ga0207644_10002626 | 3300025931 | Bacteria | 11570 |
| 750 | Ga0207644_10004468 | 3300025931 | Bacteria | 9081 |
| 751 | Ga0207644_10006053 | 3300025931 | Bacteria | 7890 |
| 752 | Ga0207644_10011045 | 3300025931 | Bacteria | 5966 |
| 753 | Ga0207644_10017863 | 3300025931 | Bacteria | 4797 |
| 754 | Ga0207644_10018741 | 3300025931 | Bacteria | 4686 |
| 755 | Ga0207644_10022596 | 3300025931 | Bacteria | 4299 |
| 756 | Ga0207644_10023348 | 3300025931 | Bacteria | 4235 |
| 757 | Ga0207644_10049843 | 3300025931 | Bacteria | 2999 |
| 758 | Ga0207644_10092516 | 3300025931 | Bacteria | 2256 |
| 759 | Ga0207690_10005743 | 3300025932 | Bacteria | 7333 |
| 760 | Ga0207690_10012599 | 3300025932 | Bacteria | 5063 |
| 761 | Ga0207690_10014780 | 3300025932 | Bacteria | 4722 |
| 762 | Ga0207690_10169038 | 3300025932 | Bacteria | 1636 |
| 763 | Ga0207690_10187930 | 3300025932 | Bacteria | 1560 |
| 764 | Ga0207706_10000133 | 3300025933 | Bacteria | 80935 |
| 765 | Ga0207706_10007037 | 3300025933 | Bacteria | 10399 |
| 766 | Ga0207706_10008413 | 3300025933 | Bacteria | 9520 |
| 767 | Ga0207706_10011997 | 3300025933 | Bacteria | 7894 |
| 768 | Ga0207706_10086080 | 3300025933 | Bacteria | 2763 |
| 769 | Ga0207686_10000211 | 3300025934 | Bacteria | 44316 |
| 770 | Ga0207686_10002504 | 3300025934 | Bacteria | 9978 |
| 771 | Ga0207686_10095325 | 3300025934 | Bacteria | 1974 |
| 772 | Ga0207686_10148630 | 3300025934 | Bacteria | 1628 |
| 773 | Ga0207709_10000167 | 3300025935 | Bacteria | 88877 |
| 774 | Ga0207709_10000625 | 3300025935 | Bacteria | 29011 |
| 775 | Ga0207709_10002678 | 3300025935 | Bacteria | 11037 |
| 776 | Ga0207709_10003407 | 3300025935 | Bacteria | 9496 |
| 777 | Ga0207709_10078818 | 3300025935 | Bacteria | 2116 |
| 778 | Ga0207709_10115924 | 3300025935 | Bacteria | 1800 |
| 779 | Ga0207670_10012185 | 3300025936 | Bacteria | 5020 |
| 780 | Ga0207670_10035827 | 3300025936 | Bacteria | 3222 |
| 781 | Ga0207669_10008328 | 3300025937 | Bacteria | 4860 |
| 782 | Ga0207669_10064387 | 3300025937 | Bacteria | 2268 |
| 783 | Ga0207669_10126415 | 3300025937 | Bacteria | 1747 |
| 784 | Ga0207704_10008529 | 3300025938 | Bacteria | 4908 |
| 785 | Ga0207704_10012485 | 3300025938 | Bacteria | 4216 |
| 786 | Ga0207704_10029819 | 3300025938 | Bacteria | 3049 |
| 787 | Ga0207665_10054137 | 3300025939 | Bacteria | 2705 |
| 788 | Ga0207691_10000027 | 3300025940 | Bacteria | 126502 |
| 789 | Ga0207691_10001454 | 3300025940 | Bacteria | 23591 |
| 790 | Ga0207691_10001835 | 3300025940 | Bacteria | 20763 |
| 791 | Ga0207691_10002573 | 3300025940 | Bacteria | 17728 |
| 792 | Ga0207691_10002901 | 3300025940 | Bacteria | 16713 |
| 793 | Ga0207691_10004579 | 3300025940 | Bacteria | 13389 |
| 794 | Ga0207691_10007782 | 3300025940 | Bacteria | 10318 |
| 795 | Ga0207691_10020289 | 3300025940 | Bacteria | 6284 |
| 796 | Ga0207691_10057597 | 3300025940 | Bacteria | 3536 |
| 797 | Ga0207691_10145691 | 3300025940 | Bacteria | 2085 |
| 798 | Ga0207711_10000116 | 3300025941 | Bacteria | 83390 |
| 799 | Ga0207711_10008341 | 3300025941 | Bacteria | 8672 |
| 800 | Ga0207711_10053069 | 3300025941 | Bacteria | 3476 |
| 801 | Ga0207711_10082785 | 3300025941 | Bacteria | 2806 |
| 802 | Ga0207711_10114324 | 3300025941 | Bacteria | 2403 |
| 803 | Ga0207711_10164693 | 3300025941 | Bacteria | 2009 |
| 804 | Ga0207711_10259025 | 3300025941 | Bacteria | 1598 |
| 805 | Ga0207711_10359702 | 3300025941 | Bacteria | 1348 |
| 806 | Ga0207689_10001624 | 3300025942 | Bacteria | 21289 |
| 807 | Ga0207689_10003361 | 3300025942 | Bacteria | 14643 |
| 808 | Ga0207689_10017053 | 3300025942 | Bacteria | 6144 |
| 809 | Ga0207689_10017399 | 3300025942 | Bacteria | 6084 |
| 810 | Ga0207689_10018716 | 3300025942 | Bacteria | 5840 |
| 811 | Ga0207689_10028908 | 3300025942 | Bacteria | 4634 |
| 812 | Ga0207689_10039845 | 3300025942 | Bacteria | 3889 |
| 813 | Ga0207689_10074386 | 3300025942 | Bacteria | 2791 |
| 814 | Ga0207661_10006951 | 3300025944 | Bacteria | 8023 |
| 815 | Ga0207661_10105552 | 3300025944 | Bacteria | 2374 |
| 816 | Ga0207661_10107900 | 3300025944 | Bacteria | 2349 |
| 817 | Ga0207661_10185692 | 3300025944 | Bacteria | 1819 |
| 818 | Ga0207679_10004476 | 3300025945 | Bacteria | 8711 |
| 819 | Ga0207679_10016114 | 3300025945 | Bacteria | 4958 |
| 820 | Ga0207679_10037529 | 3300025945 | Bacteria | 3444 |
| 821 | Ga0207679_10038046 | 3300025945 | Bacteria | 3425 |
| 822 | Ga0207679_10045174 | 3300025945 | Bacteria | 3184 |
| 823 | Ga0207679_10085817 | 3300025945 | Bacteria | 2419 |
| 824 | Ga0207667_10001197 | 3300025949 | Bacteria | 32520 |
| 825 | Ga0207667_10015903 | 3300025949 | Bacteria | 8521 |
| 826 | Ga0207667_10027706 | 3300025949 | Bacteria | 6163 |
| 827 | Ga0207667_10044540 | 3300025949 | Bacteria | 4701 |
| 828 | Ga0207667_10050611 | 3300025949 | Bacteria | 4383 |
| 829 | Ga0207667_10056478 | 3300025949 | Bacteria | 4124 |
| 830 | Ga0207667_10060239 | 3300025949 | Bacteria | 3973 |
| 831 | Ga0207667_10093968 | 3300025949 | Bacteria | 3096 |
| 832 | Ga0207667_10127343 | 3300025949 | Bacteria | 2623 |
| 833 | Ga0207667_10176472 | 3300025949 | Bacteria | 2195 |
| 834 | Ga0207667_10189509 | 3300025949 | Bacteria | 2110 |
| 835 | Ga0207651_10014005 | 3300025960 | Bacteria | 4615 |
| 836 | Ga0207651_10023081 | 3300025960 | Bacteria | 3818 |
| 837 | Ga0207651_10028463 | 3300025960 | Bacteria | 3525 |
| 838 | Ga0207651_10113559 | 3300025960 | Bacteria | 2038 |
| 839 | Ga0207651_10178666 | 3300025960 | Bacteria | 1681 |
| 840 | Ga0207712_10002369 | 3300025961 | Bacteria | 12212 |
| 841 | Ga0207712_10091176 | 3300025961 | Bacteria | 2244 |
| 842 | Ga0207668_10014276 | 3300025972 | Bacteria | 4914 |
| 843 | Ga0207668_10109124 | 3300025972 | Bacteria | 2072 |
| 844 | Ga0207640_10002943 | 3300025981 | Bacteria | 9159 |
| 845 | Ga0207640_10028299 | 3300025981 | Bacteria | 3425 |
| 846 | Ga0207640_10042960 | 3300025981 | Bacteria | 2885 |
| 847 | Ga0207658_10002879 | 3300025986 | Bacteria | 12329 |
| 848 | Ga0207658_10018099 | 3300025986 | Bacteria | 4860 |
| 849 | Ga0207658_10025597 | 3300025986 | Bacteria | 4132 |
| 850 | Ga0207658_10029188 | 3300025986 | Bacteria | 3892 |
| 851 | Ga0207658_10029755 | 3300025986 | Bacteria | 3861 |
| 852 | Ga0207677_10000188 | 3300026023 | Bacteria | 49751 |
| 853 | Ga0207677_10002710 | 3300026023 | Bacteria | 9339 |
| 854 | Ga0207677_10002992 | 3300026023 | Bacteria | 8924 |
| 855 | Ga0207677_10009054 | 3300026023 | Bacteria | 5587 |
| 856 | Ga0207677_10029670 | 3300026023 | Bacteria | 3480 |
| 857 | Ga0207677_10032646 | 3300026023 | Bacteria | 3349 |
| 858 | Ga0207677_10040742 | 3300026023 | Bacteria | 3065 |
| 859 | Ga0207703_10000806 | 3300026035 | Bacteria | 30873 |
| 860 | Ga0207703_10003131 | 3300026035 | Bacteria | 13968 |
| 861 | Ga0207703_10005198 | 3300026035 | Bacteria | 10519 |
| 862 | Ga0207703_10031777 | 3300026035 | Bacteria | 4176 |
| 863 | Ga0207703_10058280 | 3300026035 | Bacteria | 3151 |
| 864 | Ga0207703_10069127 | 3300026035 | Bacteria | 2911 |
| 865 | Ga0207703_10114082 | 3300026035 | Bacteria | 2310 |
| 866 | Ga0207703_10137353 | 3300026035 | Bacteria | 2117 |
| 867 | Ga0207639_10007106 | 3300026041 | Bacteria | 7636 |
| 868 | Ga0207639_10026653 | 3300026041 | Bacteria | 4200 |
| 869 | Ga0207639_10273666 | 3300026041 | Bacteria | 1482 |
| 870 | Ga0207678_10001503 | 3300026067 | Bacteria | 21358 |
| 871 | Ga0207678_10002200 | 3300026067 | Bacteria | 17609 |
| 872 | Ga0207678_10005364 | 3300026067 | Bacteria | 11483 |
| 873 | Ga0207678_10052057 | 3300026067 | Bacteria | 3533 |
| 874 | Ga0207678_10149293 | 3300026067 | Bacteria | 1995 |
| 875 | Ga0207708_10002089 | 3300026075 | Bacteria | 14696 |
| 876 | Ga0207708_10038327 | 3300026075 | Bacteria | 3651 |
| 877 | Ga0207708_10044769 | 3300026075 | Bacteria | 3372 |
| 878 | Ga0207708_10054734 | 3300026075 | Bacteria | 3042 |
| 879 | Ga0207702_10000305 | 3300026078 | Bacteria | 56491 |
| 880 | Ga0207702_10054890 | 3300026078 | Bacteria | 3377 |
| 881 | Ga0207702_10125097 | 3300026078 | Bacteria | 2307 |
| 882 | Ga0207702_10245474 | 3300026078 | Bacteria | 1679 |
| 883 | Ga0207641_10006528 | 3300026088 | Bacteria | 9811 |
| 884 | Ga0207641_10009569 | 3300026088 | Bacteria | 7984 |
| 885 | Ga0207641_10024259 | 3300026088 | Bacteria | 5000 |
| 886 | Ga0207641_10033560 | 3300026088 | Bacteria | 4263 |
| 887 | Ga0207641_10034850 | 3300026088 | Bacteria | 4189 |
| 888 | Ga0207641_10038820 | 3300026088 | Bacteria | 3981 |
| 889 | Ga0207641_10051462 | 3300026088 | Bacteria | 3488 |
| 890 | Ga0207641_10054343 | 3300026088 | Bacteria | 3397 |
| 891 | Ga0207641_10122259 | 3300026088 | Bacteria | 2325 |
| 892 | Ga0207641_10135260 | 3300026088 | Bacteria | 2218 |
| 893 | Ga0207648_10000286 | 3300026089 | Bacteria | 54985 |
| 894 | Ga0207648_10000878 | 3300026089 | Bacteria | 33868 |
| 895 | Ga0207648_10002947 | 3300026089 | Bacteria | 18012 |
| 896 | Ga0207648_10008332 | 3300026089 | Bacteria | 10058 |
| 897 | Ga0207648_10019878 | 3300026089 | Bacteria | 6061 |
| 898 | Ga0207648_10051982 | 3300026089 | Bacteria | 3582 |
| 899 | Ga0207648_10166579 | 3300026089 | Bacteria | 1947 |
| 900 | Ga0207676_10000230 | 3300026095 | Bacteria | 48620 |
| 901 | Ga0207676_10003281 | 3300026095 | Bacteria | 11501 |
| 902 | Ga0207676_10004989 | 3300026095 | Bacteria | 9400 |
| 903 | Ga0207676_10012098 | 3300026095 | Bacteria | 6176 |
| 904 | Ga0207676_10017798 | 3300026095 | Bacteria | 5156 |
| 905 | Ga0207676_10026039 | 3300026095 | Bacteria | 4345 |
| 906 | Ga0207676_10036862 | 3300026095 | Bacteria | 3722 |
| 907 | Ga0207676_10041475 | 3300026095 | Bacteria | 3533 |
| 908 | Ga0207676_10082562 | 3300026095 | Bacteria | 2614 |
| 909 | Ga0207676_10230458 | 3300026095 | Bacteria | 1655 |
| 910 | Ga0207674_10000182 | 3300026116 | Bacteria | 77228 |
| 911 | Ga0207674_10001017 | 3300026116 | Bacteria | 36653 |
| 912 | Ga0207674_10001136 | 3300026116 | Bacteria | 34556 |
| 913 | Ga0207674_10006862 | 3300026116 | Bacteria | 13352 |
| 914 | Ga0207674_10034160 | 3300026116 | Bacteria | 5319 |
| 915 | Ga0207674_10053331 | 3300026116 | Bacteria | 4122 |
| 916 | Ga0207674_10160967 | 3300026116 | Bacteria | 2199 |
| 917 | Ga0207674_10224317 | 3300026116 | Bacteria | 1828 |
| 918 | Ga0207675_100001247 | 3300026118 | Bacteria | 25352 |
| 919 | Ga0207675_100001372 | 3300026118 | Bacteria | 24404 |
| 920 | Ga0207675_100001900 | 3300026118 | Bacteria | 20834 |
| 921 | Ga0207675_100008217 | 3300026118 | Bacteria | 9835 |
| 922 | Ga0207683_10000285 | 3300026121 | Bacteria | 45347 |
| 923 | Ga0207683_10000364 | 3300026121 | Bacteria | 41505 |
| 924 | Ga0207683_10004747 | 3300026121 | Bacteria | 11712 |
| 925 | Ga0207683_10013264 | 3300026121 | Bacteria | 7026 |
| 926 | Ga0207683_10013981 | 3300026121 | Bacteria | 6844 |
| 927 | Ga0207683_10014056 | 3300026121 | Bacteria | 6824 |
| 928 | Ga0207683_10020604 | 3300026121 | Bacteria | 5643 |
| 929 | Ga0207683_10120473 | 3300026121 | Bacteria | 2355 |
| 930 | Ga0207683_10128511 | 3300026121 | Bacteria | 2278 |
| 931 | Ga0207698_10003503 | 3300026142 | Bacteria | 9463 |
| 932 | Ga0207698_10013855 | 3300026142 | Bacteria | 5338 |
| 933 | Ga0207698_10015518 | 3300026142 | Bacteria | 5102 |
| 934 | Ga0207698_10041103 | 3300026142 | Bacteria | 3442 |
| 935 | Ga0207698_10062786 | 3300026142 | Bacteria | 2903 |
| 936 | Ga0207698_10132975 | 3300026142 | Bacteria | 2129 |
| 937 | Ga0207698_10208567 | 3300026142 | Bacteria | 1756 |
| 938 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 939 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 940 | Ga0209389_1006219 | 3300027296 | Bacteria | 10334 |
| 941 | Ga0209371_1014178 | 3300027312 | Bacteria | 2196 |
| 942 | Ga0209996_1005277 | 3300027395 | Bacteria | 1655 |
| 943 | Ga0209282_1000317 | 3300027666 | Bacteria | 23915 |
| 944 | Ga0209971_1001210 | 3300027682 | Bacteria | 6480 |
| 945 | Ga0209966_1000035 | 3300027695 | Bacteria | 56067 |
| 946 | Ga0209998_10001388 | 3300027717 | Bacteria | 5875 |
| 947 | Ga0209998_10011946 | 3300027717 | Bacteria | 1803 |
| 948 | Ga0209813_10014738 | 3300027866 | Bacteria | 2109 |
| 949 | Ga0209813_10018634 | 3300027866 | Bacteria | 1921 |
| 950 | Ga0209974_10004147 | 3300027876 | Bacteria | 5179 |
| 951 | Ga0209974_10019845 | 3300027876 | Bacteria | 2228 |
| 952 | Ga0207428_10045043 | 3300027907 | Bacteria | 3556 |
| 953 | Ga0268266_10008958 | 3300028379 | Bacteria | 8858 |
| 954 | Ga0268266_10020764 | 3300028379 | Bacteria | 5599 |
| 955 | Ga0268266_10023758 | 3300028379 | Bacteria | 5217 |
| 956 | Ga0268266_10043406 | 3300028379 | Bacteria | 3842 |
| 957 | Ga0268266_10159448 | 3300028379 | Bacteria | 2040 |
| 958 | Ga0268266_10322131 | 3300028379 | Bacteria | 1447 |
| 959 | Ga0268265_10046444 | 3300028380 | Bacteria | 3246 |
| 960 | Ga0268265_10047325 | 3300028380 | Bacteria | 3222 |
| 961 | Ga0268265_10057047 | 3300028380 | Bacteria | 2975 |
| 962 | Ga0268265_10082425 | 3300028380 | Bacteria | 2543 |
| 963 | Ga0268265_10152394 | 3300028380 | Bacteria | 1951 |
| 964 | Ga0268265_10274078 | 3300028380 | Bacteria | 1506 |
| 965 | Ga0268264_10000991 | 3300028381 | Bacteria | 28937 |
| 966 | Ga0268264_10004628 | 3300028381 | Bacteria | 11687 |
| 967 | Ga0268264_10010909 | 3300028381 | Bacteria | 7507 |
| 968 | Ga0268264_10021947 | 3300028381 | Bacteria | 5210 |
| 969 | Ga0268264_10025537 | 3300028381 | Bacteria | 4827 |
| 970 | Ga0268264_10037013 | 3300028381 | Bacteria | 4021 |
| 971 | Ga0268264_10064516 | 3300028381 | Bacteria | 3083 |
| 972 | Ga0268264_10103146 | 3300028381 | Bacteria | 2483 |
| 973 | Ga0268264_10105798 | 3300028381 | Bacteria | 2455 |
| 974 | Ga0268264_10174016 | 3300028381 | Bacteria | 1949 |
| 975 | Ga0265318_10001780 | 3300028577 | Bacteria | 12251 |
| 976 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 977 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 978 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 979 | Ga0307515_10000278 | 3300028794 | Bacteria | 125493 |
| 980 | Ga0307515_10006352 | 3300028794 | Bacteria | 23656 |
| 981 | Ga0307515_10011457 | 3300028794 | Bacteria | 16831 |
| 982 | Ga0307515_10021920 | 3300028794 | Bacteria | 11296 |
| 983 | Ga0307515_10028588 | 3300028794 | Bacteria | 9473 |
| 984 | Ga0307515_10031517 | 3300028794 | Bacteria | 8835 |
| 985 | Ga0307515_10090935 | 3300028794 | Bacteria | 3821 |
| 986 | Ga0307515_10164629 | 3300028794 | Bacteria | 2242 |
| 987 | Ga0307515_10251319 | 3300028794 | Bacteria | 1520 |
| 988 | Ga0265324_10000193 | 3300029957 | Bacteria | 46981 |
| 989 | Ga0265324_10004037 | 3300029957 | Bacteria | 6754 |
| 990 | Ga0265324_10016187 | 3300029957 | Bacteria | 2729 |
| 991 | Ga0268256_1007804 | 3300030500 | Bacteria | 3757 |
| 992 | Ga0307511_10000005 | 3300030521 | Bacteria | 175482 |
| 993 | Ga0316178_1005545 | 3300030735 | Bacteria | 6731 |
| 994 | Ga0316180_1104723 | 3300030736 | Bacteria | 4397 |
| 995 | Ga0265330_10000453 | 3300031235 | Bacteria | 27395 |
| 996 | Ga0265330_10008628 | 3300031235 | Bacteria | 4896 |
| 997 | Ga0265330_10020098 | 3300031235 | Bacteria | 3053 |
| 998 | Ga0265332_10000012 | 3300031238 | Bacteria | 272641 |
| 999 | Ga0265332_10000023 | 3300031238 | Bacteria | 211994 |
| 1000 | Ga0265332_10001062 | 3300031238 | Bacteria | 16076 |
| 1001 | Ga0265332_10001273 | 3300031238 | Bacteria | 14416 |
| 1002 | Ga0265328_10002854 | 3300031239 | Bacteria | 7710 |
| 1003 | Ga0265328_10011609 | 3300031239 | Bacteria | 3515 |
| 1004 | Ga0265328_10027544 | 3300031239 | Bacteria | 2130 |
| 1005 | Ga0265320_10022099 | 3300031240 | Bacteria | 3409 |
| 1006 | Ga0265325_10001423 | 3300031241 | Bacteria | 16843 |
| 1007 | Ga0265325_10007863 | 3300031241 | Bacteria | 6349 |
| 1008 | Ga0265325_10022015 | 3300031241 | Bacteria | 3495 |
| 1009 | Ga0265331_10001106 | 3300031250 | Bacteria | 20759 |
| 1010 | Ga0265331_10001808 | 3300031250 | Bacteria | 15180 |
| 1011 | Ga0265331_10001901 | 3300031250 | Bacteria | 14645 |
| 1012 | Ga0265331_10006454 | 3300031250 | Bacteria | 6931 |
| 1013 | Ga0265331_10011274 | 3300031250 | Bacteria | 4901 |
| 1014 | Ga0265327_10000739 | 3300031251 | Bacteria | 51006 |
| 1015 | Ga0265327_10001019 | 3300031251 | Bacteria | 39618 |
| 1016 | Ga0265327_10004111 | 3300031251 | Bacteria | 13145 |
| 1017 | Ga0265327_10004241 | 3300031251 | Bacteria | 12854 |
| 1018 | Ga0265327_10005562 | 3300031251 | Bacteria | 10464 |
| 1019 | Ga0265327_10005649 | 3300031251 | Bacteria | 10353 |
| 1020 | Ga0265327_10022584 | 3300031251 | Bacteria | 3754 |
| 1021 | Ga0265316_10000163 | 3300031344 | Bacteria | 74936 |
| 1022 | Ga0265316_10081684 | 3300031344 | Bacteria | 2477 |
| 1023 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 1024 | Ga0307513_10000441 | 3300031456 | Bacteria | 59706 |
| 1025 | Ga0307513_10012177 | 3300031456 | Bacteria | 10637 |
| 1026 | Ga0307513_10019501 | 3300031456 | Bacteria | 8074 |
| 1027 | Ga0307513_10113375 | 3300031456 | Bacteria | 2699 |
| 1028 | Ga0307513_10124753 | 3300031456 | Bacteria | 2533 |
| 1029 | Ga0307513_10172706 | 3300031456 | Bacteria | 2037 |
| 1030 | Ga0307513_10186640 | 3300031456 | Bacteria | 1930 |
| 1031 | Ga0307509_10000871 | 3300031507 | Bacteria | 52060 |
| 1032 | Ga0307509_10016221 | 3300031507 | Bacteria | 8629 |
| 1033 | Ga0307509_10165755 | 3300031507 | Bacteria | 2099 |
| 1034 | Ga0307408_100000037 | 3300031548 | Bacteria | 187096 |
| 1035 | Ga0307408_100000274 | 3300031548 | Bacteria | 51724 |
| 1036 | Ga0307408_100005562 | 3300031548 | Bacteria | 8421 |
| 1037 | Ga0307408_100014029 | 3300031548 | Bacteria | 5324 |
| 1038 | Ga0307408_100043906 | 3300031548 | Bacteria | 3182 |
| 1039 | Ga0307408_100146028 | 3300031548 | Bacteria | 1862 |
| 1040 | Ga0307408_100158686 | 3300031548 | Bacteria | 1794 |
| 1041 | Ga0265313_10054342 | 3300031595 | Bacteria | 1902 |
| 1042 | Ga0307508_10000271 | 3300031616 | Bacteria | 63576 |
| 1043 | Ga0307508_10000349 | 3300031616 | Bacteria | 56002 |
| 1044 | Ga0307508_10262896 | 3300031616 | Bacteria | 1320 |
| 1045 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 1046 | Ga0307514_10000694 | 3300031649 | Bacteria | 59136 |
| 1047 | Ga0307514_10011790 | 3300031649 | Bacteria | 7272 |
| 1048 | Ga0316575_10011177 | 3300031665 | Bacteria | 3317 |
| 1049 | Ga0265314_10000029 | 3300031711 | Bacteria | 272506 |
| 1050 | Ga0265314_10000980 | 3300031711 | Bacteria | 33564 |
| 1051 | Ga0265314_10003171 | 3300031711 | Bacteria | 16108 |
| 1052 | Ga0265314_10014048 | 3300031711 | Bacteria | 6433 |
| 1053 | Ga0265314_10046085 | 3300031711 | Bacteria | 3078 |
| 1054 | Ga0265342_10004652 | 3300031712 | Bacteria | 10684 |
| 1055 | Ga0265342_10013416 | 3300031712 | Bacteria | 5498 |
| 1056 | Ga0316576_10002160 | 3300031727 | Bacteria | 11089 |
| 1057 | Ga0307516_10001568 | 3300031730 | Bacteria | 31474 |
| 1058 | Ga0307516_10001850 | 3300031730 | Bacteria | 29022 |
| 1059 | Ga0307516_10004281 | 3300031730 | Bacteria | 17723 |
| 1060 | Ga0307516_10004605 | 3300031730 | Bacteria | 16911 |
| 1061 | Ga0307516_10004611 | 3300031730 | Bacteria | 16906 |
| 1062 | Ga0307516_10054561 | 3300031730 | Bacteria | 3904 |
| 1063 | Ga0307516_10082496 | 3300031730 | Bacteria | 3057 |
| 1064 | Ga0307405_10016757 | 3300031731 | Bacteria | 4003 |
| 1065 | Ga0307405_10033413 | 3300031731 | Bacteria | 3050 |
| 1066 | Ga0307405_10095712 | 3300031731 | Bacteria | 1978 |
| 1067 | Ga0307410_10020431 | 3300031852 | Bacteria | 4050 |
| 1068 | Ga0307406_10001131 | 3300031901 | Bacteria | 14904 |
| 1069 | Ga0307406_10001699 | 3300031901 | Bacteria | 12095 |
| 1070 | Ga0307406_10022558 | 3300031901 | Bacteria | 3736 |
| 1071 | Ga0307406_10098362 | 3300031901 | Bacteria | 1986 |
| 1072 | Ga0307407_10006078 | 3300031903 | Bacteria | 5321 |
| 1073 | Ga0307407_10112933 | 3300031903 | Bacteria | 1709 |
| 1074 | Ga0307407_10129311 | 3300031903 | Bacteria | 1613 |
| 1075 | Ga0307412_10011101 | 3300031911 | Bacteria | 5209 |
| 1076 | Ga0307412_10023060 | 3300031911 | Bacteria | 3826 |
| 1077 | Ga0307412_10025330 | 3300031911 | Bacteria | 3673 |
| 1078 | Ga0307412_10034849 | 3300031911 | Bacteria | 3210 |
| 1079 | Ga0307409_100009086 | 3300031995 | Bacteria | 6084 |
| 1080 | Ga0307409_100041037 | 3300031995 | Bacteria | 3452 |
| 1081 | Ga0307409_100105738 | 3300031995 | Bacteria | 2347 |
| 1082 | Ga0307416_100013885 | 3300032002 | Bacteria | 5492 |
| 1083 | Ga0307416_100045877 | 3300032002 | Bacteria | 3444 |
| 1084 | Ga0307416_100144021 | 3300032002 | Bacteria | 2172 |
| 1085 | Ga0307414_10069494 | 3300032004 | Bacteria | 2532 |
| 1086 | Ga0307411_10000347 | 3300032005 | Bacteria | 15605 |
| 1087 | Ga0307411_10096805 | 3300032005 | Bacteria | 2075 |
| 1088 | Ga0316583_10019774 | 3300032133 | Bacteria | 2414 |
| 1089 | Ga0307510_10030522 | 3300033180 | Bacteria | 6109 |
| 1090 | Ga0307510_10053824 | 3300033180 | Bacteria | 4224 |
| 1091 | Ga0373928_0012497 | 3300035084 | Bacteria | 1694 |
| 1092 | Ga0373934_0030000 | 3300035086 | Bacteria | 2126 |
| 1093 | Ga0373923_0015654 | 3300035111 | Bacteria | 2867 |
| 1094 | Ga0373939_0000067 | 3300035114 | Bacteria | 34368 |
| 1095 | Ga0373954_0110980 | 3300035118 | Bacteria | 1326 |
| 1096 | Ga0373960_0000228 | 3300035121 | Bacteria | 10442 |
| 1097 | Ga0316574_0027918 | 3300035398 | Bacteria | 3401 |
| 1098 | Ga0373931_0007765 | 3300035691 | Bacteria | 5066 |
| 1099 | Ga0373927_0003169 | 3300035695 | Bacteria | 11866 |
| 1100 | Ga0373927_0004693 | 3300035695 | Bacteria | 9529 |
| 1101 | Ga0373933_0072098 | 3300035724 | Bacteria | 2103 |
| 1102 | Ga0373937_0033224 | 3300036401 | Bacteria | 4684 |
| 1103 | Ga0373937_0084574 | 3300036401 | Bacteria | 2935 |
| 1104 | Ga0373937_0098154 | 3300036401 | Bacteria | 2717 |
| 1105 | Ga0373925_0012025 | 3300037068 | Bacteria | 6268 |
| 1106 | Ga0373925_0047276 | 3300037068 | Bacteria | 3203 |
| 1107 | Ga0373925_0287218 | 3300037068 | Bacteria | 1326 |
| 1108 | Ga0395899_0004233 | 3300037312 | Bacteria | 11242 |
| 1109 | Ga0395899_0064777 | 3300037312 | Bacteria | 2686 |
| 1110 | Ga0395900_0000058 | 3300037418 | Bacteria | 206785 |
| 1111 | Ga0395900_0001342 | 3300037418 | Bacteria | 29732 |
| 1112 | Ga0395900_0004446 | 3300037418 | Bacteria | 14850 |
| 1113 | Ga0395900_0014529 | 3300037418 | Bacteria | 8035 |
| 1114 | Ga0395900_0023478 | 3300037418 | Bacteria | 6311 |
| 1115 | Ga0395900_0326164 | 3300037418 | Bacteria | 1514 |
| 1116 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 1117 | Ga0395898_0004069 | 3300037466 | Bacteria | 16053 |
| 1118 | Ga0395898_0006225 | 3300037466 | Bacteria | 12784 |
| 1119 | Ga0395898_0013532 | 3300037466 | Bacteria | 8400 |
| 1120 | Ga0395898_0164563 | 3300037466 | Bacteria | 2121 |
| 1121 | Ga0395898_0365367 | 3300037466 | Bacteria | 1376 |
| 1122 | Ga0395905_0000084 | 3300037471 | Bacteria | 158046 |
| 1123 | Ga0395905_0000088 | 3300037471 | Bacteria | 152506 |
| 1124 | Ga0395905_0000474 | 3300037471 | Bacteria | 55503 |
| 1125 | Ga0395905_0005168 | 3300037471 | Bacteria | 13388 |
| 1126 | Ga0395905_0022674 | 3300037471 | Bacteria | 5935 |
| 1127 | Ga0395905_0037655 | 3300037471 | Bacteria | 4539 |
| 1128 | Ga0395905_0093859 | 3300037471 | Bacteria | 2814 |
| 1129 | Ga0395905_0096771 | 3300037471 | Bacteria | 2771 |
| 1130 | Ga0395905_0113081 | 3300037471 | Bacteria | 2550 |
| 1131 | Ga0395905_0188852 | 3300037471 | Bacteria | 1933 |
| 1132 | Ga0395905_0349936 | 3300037471 | Bacteria | 1369 |
| 1133 | Ga0395901_0002111 | 3300038443 | Bacteria | 20385 |
| 1134 | Ga0395901_0004265 | 3300038443 | Bacteria | 14421 |
| 1135 | Ga0395901_0014599 | 3300038443 | Bacteria | 7982 |
| 1136 | Ga0395901_0049342 | 3300038443 | Bacteria | 4373 |
| 1137 | Ga0395901_0157861 | 3300038443 | Bacteria | 2382 |
| 1138 | Ga0395901_0200212 | 3300038443 | Bacteria | 2093 |
| 1139 | Ga0436365_1408997 | 3300039437 | Bacteria | 4257 |
| 1140 | Ga0436361_0019641 | 3300039447 | Bacteria | 127735 |
| 1141 | Ga0436361_0056098 | 3300039447 | Bacteria | 2127 |
| 1142 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 1143 | Ga0436361_0237831 | 3300039447 | Bacteria | 3657 |
| 1144 | Ga0436361_0374445 | 3300039447 | Bacteria | 2681 |
| 1145 | Ga0436361_0484071 | 3300039447 | Bacteria | 47769 |
| 1146 | Ga0436361_0797912 | 3300039447 | Bacteria | 11388 |
| 1147 | Ga0439436_0001660 | 3300041404 | Bacteria | 6501 |
| 1148 | Ga0439447_011775 | 3300041407 | Bacteria | 2535 |
| 1149 | Ga0451789_0062679 | 3300041443 | Bacteria | 1650 |
| 1150 | Ga0451791_0729747 | 3300041451 | Bacteria | 1986 |
| 1151 | Ga0451800_0294366 | 3300041459 | Bacteria | 1711 |
| 1152 | Ga0451802_1889696 | 3300041460 | Bacteria | 1646 |
| 1153 | Ga0451807_2119455 | 3300041486 | Bacteria | 1376 |
| 1154 | Ga0439431_0000686 | 3300041997 | Bacteria | 7276 |
| 1155 | Ga0439433_0014615 | 3300041999 | Bacteria | 1729 |
| 1156 | Ga0439432_002992 | 3300042006 | Bacteria | 6292 |
| 1157 | Ga0439449_0024477 | 3300042007 | Bacteria | 2256 |
| 1158 | Ga0439452_003034 | 3300042010 | Bacteria | 5975 |
| 1159 | Ga0439457_010969 | 3300042014 | Bacteria | 2070 |
| 1160 | Ga0450911_000443 | 3300042115 | Bacteria | 13445 |
| 1161 | Ga0450917_000136 | 3300042120 | Bacteria | 4783 |
| 1162 | Ga0450923_001534 | 3300042125 | Bacteria | 3095 |
| 1163 | Ga0450888_000009 | 3300042126 | Bacteria | 15484 |
| 1164 | Ga0450890_005447 | 3300042127 | Bacteria | 1636 |
| 1165 | Ga0450891_000221 | 3300042129 | Bacteria | 5747 |
| 1166 | Ga0450889_000020 | 3300042144 | Bacteria | 13857 |
| 1167 | Ga0450908_000326 | 3300042184 | Bacteria | 9315 |
| 1168 | Ga0439434_0001164 | 3300042435 | Bacteria | 7604 |
| 1169 | Ga0439459_0000359 | 3300042438 | Bacteria | 5640 |
| 1170 | Ga0450918_000047 | 3300042531 | Bacteria | 24725 |
| 1171 | Ga0451577_0000453 | 3300042876 | Bacteria | 71384 |
| 1172 | Ga0451577_0000997 | 3300042876 | Bacteria | 41140 |
| 1173 | Ga0451577_0007753 | 3300042876 | Bacteria | 10522 |
| 1174 | Ga0451577_0008851 | 3300042876 | Bacteria | 9745 |
| 1175 | Ga0451577_0013237 | 3300042876 | Bacteria | 7730 |
| 1176 | Ga0451577_0015527 | 3300042876 | Bacteria | 7082 |
| 1177 | Ga0451577_0020100 | 3300042876 | Bacteria | 6132 |
| 1178 | Ga0451577_0086637 | 3300042876 | Bacteria | 2794 |
| 1179 | Ga0451577_0093102 | 3300042876 | Bacteria | 2691 |
| 1180 | Ga0451577_0159727 | 3300042876 | Bacteria | 2029 |
| 1181 | Ga0451577_0406433 | 3300042876 | Bacteria | 1236 |
| 1182 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 1183 | Ga0466969_0011004 | 3300044656 | Bacteria | 4790 |
| 1184 | Ga0466972_0001863 | 3300044658 | Bacteria | 10334 |
| 1185 | Ga0466972_0025394 | 3300044658 | Bacteria | 2938 |
| 1186 | Ga0453683_0031647 | 3300044673 | Bacteria | 3341 |
| 1187 | Ga0466965_0019745 | 3300044683 | Bacteria | 3236 |
| 1188 | Ga0466966_0008880 | 3300044684 | Bacteria | 6655 |
| 1189 | Ga0466966_0028472 | 3300044684 | Bacteria | 3639 |
| 1190 | Ga0466961_0007768 | 3300044693 | Bacteria | 6826 |
| 1191 | Ga0466961_0027966 | 3300044693 | Bacteria | 3626 |
| 1192 | Ga0466963_0045293 | 3300044694 | Bacteria | 2897 |
| 1193 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 1194 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 1195 | Ga0453684_0001268 | 3300044712 | Bacteria | 75704 |
| 1196 | Ga0453684_0001455 | 3300044712 | Bacteria | 67258 |
| 1197 | Ga0453684_0002072 | 3300044712 | Bacteria | 50917 |
| 1198 | Ga0453684_0006329 | 3300044712 | Bacteria | 22599 |
| 1199 | Ga0453684_0027135 | 3300044712 | Bacteria | 8229 |
| 1200 | Ga0453684_0037650 | 3300044712 | Bacteria | 6636 |
| 1201 | Ga0453684_0126006 | 3300044712 | Bacteria | 3082 |
| 1202 | Ga0453684_0151509 | 3300044712 | Bacteria | 2755 |
| 1203 | Ga0453684_0577925 | 3300044712 | Bacteria | 1234 |
| 1204 | Ga0466971_0004477 | 3300044719 | Bacteria | 6036 |
| 1205 | Ga0466971_0035574 | 3300044719 | Bacteria | 2233 |
| 1206 | Ga0466971_0037073 | 3300044719 | Bacteria | 2186 |
| 1207 | Ga0466968_0008781 | 3300044735 | Bacteria | 3876 |
| 1208 | Ga0466968_0084067 | 3300044735 | Bacteria | 1403 |
| 1209 | Ga0466957_0026908 | 3300044842 | Bacteria | 3414 |
| 1210 | Ga0466959_0001083 | 3300045049 | Bacteria | 16284 |
| 1211 | Ga0466959_0010137 | 3300045049 | Bacteria | 6722 |
| 1212 | Ga0451576_0000168 | 3300045051 | Bacteria | 165624 |
| 1213 | Ga0451576_0000950 | 3300045051 | Bacteria | 54404 |
| 1214 | Ga0451576_0001018 | 3300045051 | Bacteria | 51870 |
| 1215 | Ga0451576_0002478 | 3300045051 | Bacteria | 27435 |
| 1216 | Ga0451576_0012346 | 3300045051 | Bacteria | 9597 |
| 1217 | Ga0451576_0074276 | 3300045051 | Bacteria | 3538 |
| 1218 | Ga0451576_0093306 | 3300045051 | Bacteria | 3130 |
| 1219 | Ga0451576_0114697 | 3300045051 | Bacteria | 2805 |
| 1220 | Ga0451576_0173524 | 3300045051 | Bacteria | 2250 |
| 1221 | Ga0451576_0223738 | 3300045051 | Bacteria | 1965 |
| 1222 | Ga0466958_0047577 | 3300045836 | Bacteria | 2589 |
| 1223 | Ga0495627_006336 | 3300046453 | Bacteria | 4646 |
| 1224 | Ga0495592_0000394 | 3300046454 | Bacteria | 33973 |
| 1225 | Ga0495638_0050099 | 3300046460 | Bacteria | 2609 |
| 1226 | Ga0495651_0005890 | 3300046462 | Bacteria | 9351 |
| 1227 | Ga0495651_0024267 | 3300046462 | Bacteria | 4719 |
| 1228 | Ga0495653_0038159 | 3300046463 | Bacteria | 3770 |
| 1229 | Ga0495580_0056248 | 3300046472 | Bacteria | 2771 |
| 1230 | Ga0495582_0038406 | 3300046473 | Bacteria | 2634 |
| 1231 | Ga0495585_0034025 | 3300046492 | Bacteria | 2881 |
| 1232 | Ga0495583_0000081 | 3300046506 | Bacteria | 168304 |
| 1233 | Ga0495606_0018883 | 3300046507 | Bacteria | 5154 |
| 1234 | Ga0495608_0007823 | 3300046511 | Bacteria | 7520 |
| 1235 | Ga0495618_0051374 | 3300046514 | Bacteria | 2604 |
| 1236 | Ga0495620_0020378 | 3300046515 | Bacteria | 3239 |
| 1237 | Ga0495628_0001687 | 3300046516 | Bacteria | 20156 |
| 1238 | Ga0495628_0037330 | 3300046516 | Bacteria | 3895 |
| 1239 | Ga0495630_0088413 | 3300046517 | Bacteria | 2340 |
| 1240 | Ga0495631_0001417 | 3300046518 | Bacteria | 14572 |
| 1241 | Ga0495632_0004039 | 3300046519 | Bacteria | 10130 |
| 1242 | Ga0495632_0059217 | 3300046519 | Bacteria | 1864 |
| 1243 | Ga0495652_0006873 | 3300046529 | Bacteria | 10532 |
| 1244 | Ga0495652_0054883 | 3300046529 | Bacteria | 3390 |
| 1245 | Ga0495665_0055540 | 3300046531 | Bacteria | 2090 |
| 1246 | Ga0495587_0065569 | 3300046536 | Bacteria | 2120 |
| 1247 | Ga0495598_0004678 | 3300046537 | Bacteria | 2982 |
| 1248 | Ga0495621_0016961 | 3300046539 | Bacteria | 2346 |
| 1249 | Ga0495621_0027461 | 3300046539 | Bacteria | 1927 |
| 1250 | Ga0495597_0000054 | 3300046542 | Bacteria | 95390 |
| 1251 | Ga0495645_0009579 | 3300046543 | Bacteria | 6776 |
| 1252 | Ga0495633_0000648 | 3300046558 | Bacteria | 32320 |
| 1253 | Ga0495656_0000093 | 3300046615 | Bacteria | 38558 |
| 1254 | Ga0495625_0001179 | 3300046660 | Bacteria | 33575 |
| 1255 | Ga0495625_0114001 | 3300046660 | Bacteria | 1845 |
| 1256 | Ga0495659_0012749 | 3300046664 | Bacteria | 2729 |
| 1257 | Ga0495661_0136730 | 3300046665 | Bacteria | 1337 |
| 1258 | Ga0495623_0010175 | 3300046679 | Bacteria | 6086 |
| 1259 | Ga0495646_0002576 | 3300046680 | Bacteria | 11150 |
| 1260 | Ga0495647_0018312 | 3300046681 | Bacteria | 2491 |
| 1261 | Ga0495658_0057777 | 3300046683 | Bacteria | 2217 |
| 1262 | Ga0495658_0077844 | 3300046683 | Bacteria | 1940 |
| 1263 | Ga0495613_0017525 | 3300046689 | Bacteria | 5332 |
| 1264 | Ga0495649_0000259 | 3300046694 | Bacteria | 47236 |
| 1265 | Ga0495649_0010350 | 3300046694 | Bacteria | 5509 |
| 1266 | Ga0495589_0028100 | 3300046794 | Bacteria | 2841 |
| 1267 | Ga0495600_0010139 | 3300046809 | Bacteria | 5842 |
| 1268 | Ga0495660_0011887 | 3300046810 | Bacteria | 5051 |
| 1269 | Ga0495604_0038352 | 3300047317 | Bacteria | 3769 |
| 1270 | Ga0495676_0009192 | 3300047321 | Bacteria | 9006 |
| 1271 | Ga0495687_003988 | 3300047443 | Bacteria | 10280 |
| 1272 | Ga0495685_029083 | 3300047447 | Bacteria | 1901 |
| 1273 | Ga0495593_0015464 | 3300047673 | Bacteria | 4321 |
| 1274 | Ga0495602_0090521 | 3300048088 | Bacteria | 2541 |
| 1275 | Ga0495602_0106125 | 3300048088 | Bacteria | 2293 |
| 1276 | Ga0496100_0016181 | 3300048903 | Bacteria | 4375 |
| 1277 | Ga0496100_0300598 | 3300048903 | Bacteria | 1201 |
| 1278 | Ga0496101_0005514 | 3300048904 | Bacteria | 8072 |
| 1279 | Ga0496101_0053871 | 3300048904 | Bacteria | 2903 |
| 1280 | Ga0496102_0004520 | 3300048905 | Bacteria | 11754 |
| 1281 | Ga0496102_0032029 | 3300048905 | Bacteria | 4721 |
| 1282 | Ga0496102_0034690 | 3300048905 | Bacteria | 4539 |
| 1283 | Ga0496102_0049796 | 3300048905 | Bacteria | 3812 |
| 1284 | Ga0496103_0082067 | 3300048906 | Bacteria | 2028 |
| 1285 | Ga0496104_0006818 | 3300048907 | Bacteria | 10062 |
| 1286 | Ga0496104_0008511 | 3300048907 | Bacteria | 9120 |
| 1287 | Ga0496104_0074178 | 3300048907 | Bacteria | 3239 |
| 1288 | Ga0496105_0010653 | 3300048908 | Bacteria | 7234 |
| 1289 | Ga0496105_0011125 | 3300048908 | Bacteria | 7098 |
| 1290 | Ga0496105_0029503 | 3300048908 | Bacteria | 4490 |
| 1291 | Ga0496105_0137152 | 3300048908 | Bacteria | 2015 |
| 1292 | Ga0496106_0016006 | 3300048909 | Bacteria | 5546 |
| 1293 | Ga0496106_0040487 | 3300048909 | Bacteria | 3490 |
| 1294 | Ga0496106_0162620 | 3300048909 | Bacteria | 1766 |
| 1295 | Ga0496107_0013245 | 3300048910 | Bacteria | 5762 |
| 1296 | Ga0496108_0007483 | 3300048911 | Bacteria | 8851 |
| 1297 | Ga0496108_0039907 | 3300048911 | Bacteria | 3913 |
| 1298 | Ga0496108_0094360 | 3300048911 | Bacteria | 2547 |
| 1299 | Ga0496108_0099050 | 3300048911 | Bacteria | 2484 |
| 1300 | Ga0496108_0109731 | 3300048911 | Bacteria | 2358 |
| 1301 | Ga0496108_0186221 | 3300048911 | Bacteria | 1798 |
| 1302 | Ga0496108_0219376 | 3300048911 | Bacteria | 1652 |
| 1303 | Ga0496109_0014083 | 3300048912 | Bacteria | 6952 |
| 1304 | Ga0496109_0039783 | 3300048912 | Bacteria | 4257 |
| 1305 | Ga0496109_0259035 | 3300048912 | Bacteria | 1638 |
| 1306 | Ga0496110_0001672 | 3300048913 | Bacteria | 16272 |
| 1307 | Ga0496110_0014509 | 3300048913 | Bacteria | 6546 |
| 1308 | Ga0496110_0035733 | 3300048913 | Bacteria | 4313 |
| 1309 | Ga0496110_0038769 | 3300048913 | Bacteria | 4147 |
| 1310 | Ga0496110_0401453 | 3300048913 | Bacteria | 1249 |
| 1311 | Ga0496111_0036928 | 3300048914 | Bacteria | 3494 |
| 1312 | Ga0496111_0114604 | 3300048914 | Bacteria | 1987 |
| 1313 | Ga0496111_0296124 | 3300048914 | Bacteria | 1199 |
| 1314 | Ga0496112_0009399 | 3300048915 | Bacteria | 8804 |
| 1315 | Ga0496112_0056645 | 3300048915 | Bacteria | 3858 |
| 1316 | Ga0496114_0003046 | 3300048917 | Bacteria | 12833 |
| 1317 | Ga0496114_0027685 | 3300048917 | Bacteria | 4645 |
| 1318 | Ga0496114_0080163 | 3300048917 | Bacteria | 2757 |
| 1319 | Ga0496114_0184760 | 3300048917 | Bacteria | 1822 |
| 1320 | Ga0496117_0072509 | 3300048920 | Bacteria | 2301 |
| 1321 | Ga0496118_0007613 | 3300048921 | Bacteria | 11409 |
| 1322 | Ga0496118_0014026 | 3300048921 | Bacteria | 7526 |
| 1323 | Ga0496121_0038603 | 3300048924 | Bacteria | 4223 |
| 1324 | Ga0496121_0047496 | 3300048924 | Bacteria | 3662 |
| 1325 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 1326 | Ga0496122_0005655 | 3300048925 | Bacteria | 14758 |
| 1327 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 1328 | Ga0496124_0000088 | 3300048927 | Bacteria | 194644 |
| 1329 | Ga0496124_0002378 | 3300048927 | Bacteria | 24780 |
| 1330 | Ga0496125_0000319 | 3300048928 | Bacteria | 93727 |
| 1331 | Ga0496125_0000785 | 3300048928 | Bacteria | 51744 |
| 1332 | Ga0496125_0023666 | 3300048928 | Bacteria | 5664 |
| 1333 | Ga0496125_0070059 | 3300048928 | Bacteria | 2747 |
| 1334 | Ga0496126_0040916 | 3300048929 | Bacteria | 4294 |
| 1335 | Ga0501031_0006723 | 3300049568 | Bacteria | 7501 |
| 1336 | Ga0501034_0038720 | 3300049571 | Bacteria | 4828 |
| 1337 | Ga0501034_0091769 | 3300049571 | Bacteria | 3034 |
| 1338 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 1339 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 1340 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 1341 | Ga0501047_0089232 | 3300049581 | Bacteria | 2960 |
| 1342 | Ga0501075_0367934 | 3300049591 | Bacteria | 1096 |
| 1343 | Ga0501198_000001 | 3300049649 | Bacteria | 234552 |
| 1344 | Ga0501207_004330 | 3300049654 | Bacteria | 1925 |
| 1345 | Ga0501222_000004 | 3300049662 | Bacteria | 136139 |
| 1346 | Ga0501222_001282 | 3300049662 | Bacteria | 3532 |
| 1347 | Ga0501222_002897 | 3300049662 | Bacteria | 2366 |
| 1348 | Ga0501223_007869 | 3300049663 | Bacteria | 2176 |
| 1349 | Ga0501235_003572 | 3300049669 | Bacteria | 3361 |
| 1350 | Ga0501242_003578 | 3300049674 | Bacteria | 1687 |
| 1351 | Ga0501253_000860 | 3300049683 | Bacteria | 2838 |
| 1352 | Ga0501221_002012 | 3300049704 | Bacteria | 3388 |
| 1353 | Ga0501080_0053452 | 3300049742 | Bacteria | 3761 |
| 1354 | Ga0501262_000273 | 3300049759 | Bacteria | 6242 |
| 1355 | Ga0501262_004596 | 3300049759 | Bacteria | 1606 |
| 1356 | Ga0501267_000092 | 3300049764 | Bacteria | 5551 |
| 1357 | Ga0501035_0038555 | 3300049822 | Bacteria | 4326 |
| 1358 | nmdc:mga03683_39000_c1 | 3300050489 | Bacteria | 1943 |
| 1359 | nmdc:mga00v17_33488_c1 | 3300050491 | Bacteria | 3044 |
| 1360 | nmdc:mga0yw44_139388_c1 | 3300050492 | Bacteria | 1575 |
| 1361 | nmdc:mga0yw44_9904_c1 | 3300050492 | Bacteria | 4843 |
| 1362 | nmdc:mga0k408_144892_c1 | 3300050493 | Bacteria | 1414 |
| 1363 | nmdc:mga0k408_2471_c1 | 3300050493 | Bacteria | 9833 |
| 1364 | nmdc:mga0k408_29440_c1 | 3300050493 | Bacteria | 3126 |
| 1365 | nmdc:mga0k408_3312_c1 | 3300050493 | Bacteria | 8523 |
| 1366 | nmdc:mga0k408_3894_c1 | 3300050493 | Bacteria | 7911 |
| 1367 | nmdc:mga0k408_4784_c1 | 3300050493 | Bacteria | 7179 |
| 1368 | nmdc:mga0k408_59922_c1 | 3300050493 | Bacteria | 2212 |
| 1369 | nmdc:mga04h51_36487_c1 | 3300050495 | Bacteria | 1582 |
| 1370 | nmdc:mga07m45_2541_c1 | 3300050496 | Bacteria | 8566 |
| 1371 | nmdc:mga07m45_2542_c1 | 3300050496 | Bacteria | 8563 |
| 1372 | nmdc:mga07m45_6261_c1 | 3300050496 | Bacteria | 5824 |
| 1373 | nmdc:mga07m45_6873_c1 | 3300050496 | Bacteria | 5787 |
| 1374 | nmdc:mga07m45_81_c1 | 3300050496 | Bacteria | 35778 |
| 1375 | nmdc:mga09592_3703_c1 | 3300050508 | Bacteria | 12323 |
| 1376 | nmdc:mga08y16_28387_c1 | 3300050511 | Bacteria | 5899 |
| 1377 | nmdc:mga08y16_351538_c1 | 3300050511 | Bacteria | 1514 |
| 1378 | nmdc:mga0rr50_124536_c1 | 3300050513 | Bacteria | 2056 |
| 1379 | nmdc:mga08x19_36678_c1 | 3300050514 | Bacteria | 3106 |
| 1380 | nmdc:mga0a205_408297_c1 | 3300050515 | Bacteria | 1221 |
| 1381 | nmdc:mga0sz30_35698_c1 | 3300050516 | Bacteria | 2076 |
| 1382 | Ga0495601_0130708 | 3300053077 | Bacteria | 1635 |
| 1383 | Ga0500610_0005499 | 3300053079 | Bacteria | 5199 |
| 1384 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 1385 | Ga0495619_0119029 | 3300053085 | Bacteria | 1810 |
| 1386 | Ga0500578_0000652 | 3300053086 | Bacteria | 41736 |
| 1387 | Ga0500583_0003338 | 3300053092 | Bacteria | 5033 |
| 1388 | Ga0500651_0000067 | 3300053093 | Bacteria | 67673 |
| 1389 | Ga0500651_0013435 | 3300053093 | Bacteria | 4990 |
| 1390 | Ga0500571_000952 | 3300053110 | Bacteria | 12727 |
| 1391 | Ga0500572_008075 | 3300053111 | Bacteria | 2452 |
| 1392 | Ga0500652_000449 | 3300053131 | Bacteria | 14598 |
| 1393 | Ga0500655_001229 | 3300053133 | Bacteria | 4863 |
| 1394 | Ga0500658_0001880 | 3300053134 | Bacteria | 8233 |
| 1395 | Ga0500658_0003426 | 3300053134 | Bacteria | 5989 |
| 1396 | Ga0500559_0000446 | 3300053136 | Bacteria | 29360 |
| 1397 | Ga0500568_0010475 | 3300053139 | Bacteria | 4341 |
| 1398 | Ga0500604_0041079 | 3300053151 | Bacteria | 1397 |
| 1399 | Ga0500616_0011165 | 3300053153 | Bacteria | 5329 |
| 1400 | Ga0500619_000941 | 3300053154 | Bacteria | 4982 |
| 1401 | Ga0500622_0000124 | 3300053156 | Bacteria | 81245 |
| 1402 | Ga0500622_0018843 | 3300053156 | Bacteria | 3666 |
| 1403 | Ga0500622_0031819 | 3300053156 | Bacteria | 2768 |
| 1404 | Ga0500638_036952 | 3300053162 | Bacteria | 2369 |
| 1405 | Ga0500636_0000203 | 3300053177 | Bacteria | 32197 |
| 1406 | Ga0590071_003318 | 3300059421 | Bacteria | 3964 |
| 1407 | Ga0590075_012517 | 3300059424 | Bacteria | 2061 |
| 1408 | Ga0466962_0012811 | 3300061719 | Bacteria | 4034 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0577925 | Ga0453684_0577925_69_1019 | 310 |
| 2 | 3300045051 | Ga0451576_0093306 | Ga0451576_0093306_2125_3075 | 310 |
| 3 | 3300017792 | Ga0163161_10260705 | Ga0163161_102607052 | 333 |
| 4 | 3300017792 | Ga0163161_10132337 | Ga0163161_101323372 | 334 |
| 5 | 3300035084 | Ga0373928_0012497 | Ga0373928_0012497_15_1055 | 340 |
| 6 | 3300046665 | Ga0495661_0136730 | Ga0495661_0136730_11_1051 | 340 |
| 7 | 3300049591 | Ga0501075_0367934 | Ga0501075_0367934_25_1047 | 340 |
| 8 | 3300050515 | nmdc:mga0a205_408297_c1 | nmdc:mga0a205_408297_c1_10_1032 | 340 |
| 9 | 3300044684 | Ga0466966_0008880 | Ga0466966_0008880_3841_4959 | 354 |
| 10 | iso_pu_bacteria | 2547132512 | 2548846769 | 357 |
| 11 | 3300031727 | Ga0316576_10002160 | Ga0316576_1000216011 | 359 |
| 12 | 3300035398 | Ga0316574_0027918 | Ga0316574_0027918_1992_3077 | 359 |
| 13 | 3300005334 | Ga0068869_100008706 | Ga0068869_1000087066 | 360 |
| 14 | 3300005338 | Ga0068868_100132339 | Ga0068868_1001323391 | 360 |
| 15 | 3300005617 | Ga0068859_100002838 | Ga0068859_10000283816 | 360 |
| 16 | 3300005841 | Ga0068863_100051872 | Ga0068863_1000518721 | 360 |
| 17 | 3300005842 | Ga0068858_100070827 | Ga0068858_1000708272 | 360 |
| 18 | 3300005843 | Ga0068860_100071631 | Ga0068860_1000716312 | 360 |
| 19 | 3300006237 | Ga0097621_100071592 | Ga0097621_1000715922 | 360 |
| 20 | 3300006358 | Ga0068871_100007404 | Ga0068871_1000074047 | 360 |
| 21 | 3300006931 | Ga0097620_100002838 | Ga0097620_1000028383 | 360 |
| 22 | 3300009098 | Ga0105245_10347878 | Ga0105245_103478782 | 360 |
| 23 | 3300009174 | Ga0105241_10256939 | Ga0105241_102569392 | 360 |
| 24 | 3300009177 | Ga0105248_10006109 | Ga0105248_100061091 | 360 |
| 25 | 3300010375 | Ga0105239_10259343 | Ga0105239_102593432 | 360 |
| 26 | 3300013296 | Ga0157374_10334116 | Ga0157374_103341162 | 360 |
| 27 | 3300013308 | Ga0157375_10488018 | Ga0157375_104880182 | 360 |
| 28 | 3300025942 | Ga0207689_10001624 | Ga0207689_100016247 | 360 |
| 29 | 3300026035 | Ga0207703_10069127 | Ga0207703_100691272 | 360 |
| 30 | 3300028380 | Ga0268265_10057047 | Ga0268265_100570473 | 360 |
| 31 | 3300036401 | Ga0373937_0098154 | Ga0373937_0098154_183_1265 | 360 |
| 32 | 3300042007 | Ga0439449_0024477 | Ga0439449_0024477_285_1394 | 360 |
| 33 | 3300005328 | Ga0070676_10101322 | Ga0070676_101013222 | 361 |
| 34 | 3300005329 | Ga0070683_100046656 | Ga0070683_1000466562 | 361 |
| 35 | 3300005331 | Ga0070670_100069385 | Ga0070670_1000693852 | 361 |
| 36 | 3300005334 | Ga0068869_100237443 | Ga0068869_1002374432 | 361 |
| 37 | 3300005335 | Ga0070666_10217006 | Ga0070666_102170062 | 361 |
| 38 | 3300005340 | Ga0070689_100049233 | Ga0070689_1000492332 | 361 |
| 39 | 3300005344 | Ga0070661_100056385 | Ga0070661_1000563852 | 361 |
| 40 | 3300005354 | Ga0070675_100104043 | Ga0070675_1001040432 | 361 |
| 41 | 3300005354 | Ga0070675_100183000 | Ga0070675_1001830001 | 361 |
| 42 | 3300005355 | Ga0070671_100028811 | Ga0070671_1000288113 | 361 |
| 43 | 3300005364 | Ga0070673_100012438 | Ga0070673_1000124383 | 361 |
| 44 | 3300005367 | Ga0070667_100078199 | Ga0070667_1000781992 | 361 |
| 45 | 3300005441 | Ga0070700_100165449 | Ga0070700_1001654491 | 361 |
| 46 | 3300005457 | Ga0070662_100044744 | Ga0070662_1000447443 | 361 |
| 47 | 3300005535 | Ga0070684_100120705 | Ga0070684_1001207052 | 361 |
| 48 | 3300005543 | Ga0070672_100150738 | Ga0070672_1001507382 | 361 |
| 49 | 3300005544 | Ga0070686_100039757 | Ga0070686_1000397571 | 361 |
| 50 | 3300005564 | Ga0070664_100024891 | Ga0070664_1000248912 | 361 |
| 51 | 3300005618 | Ga0068864_100163016 | Ga0068864_1001630162 | 361 |
| 52 | 3300005840 | Ga0068870_10138090 | Ga0068870_101380901 | 361 |
| 53 | 3300005841 | Ga0068863_100037649 | Ga0068863_1000376493 | 361 |
| 54 | 3300005841 | Ga0068863_100177019 | Ga0068863_1001770191 | 361 |
| 55 | 3300006358 | Ga0068871_100014944 | Ga0068871_1000149442 | 361 |
| 56 | 3300006358 | Ga0068871_100178021 | Ga0068871_1001780212 | 361 |
| 57 | 3300009094 | Ga0111539_10144488 | Ga0111539_101444881 | 361 |
| 58 | 3300009148 | Ga0105243_10385206 | Ga0105243_103852061 | 361 |
| 59 | 3300009176 | Ga0105242_10340321 | Ga0105242_103403212 | 361 |
| 60 | 3300009177 | Ga0105248_10061200 | Ga0105248_100612003 | 361 |
| 61 | 3300013296 | Ga0157374_10144974 | Ga0157374_101449742 | 361 |
| 62 | 3300013306 | Ga0163162_10113345 | Ga0163162_101133452 | 361 |
| 63 | 3300014745 | Ga0157377_10044154 | Ga0157377_100441542 | 361 |
| 64 | 3300014745 | Ga0157377_10115078 | Ga0157377_101150781 | 361 |
| 65 | 3300017792 | Ga0163161_10066522 | Ga0163161_100665223 | 361 |
| 66 | 3300025315 | Ga0207697_10009395 | Ga0207697_100093953 | 361 |
| 67 | 3300025321 | Ga0207656_10007059 | Ga0207656_100070593 | 361 |
| 68 | 3300025893 | Ga0207682_10002075 | Ga0207682_100020757 | 361 |
| 69 | 3300025899 | Ga0207642_10124474 | Ga0207642_101244741 | 361 |
| 70 | 3300025901 | Ga0207688_10084320 | Ga0207688_100843202 | 361 |
| 71 | 3300025903 | Ga0207680_10108021 | Ga0207680_101080211 | 361 |
| 72 | 3300025907 | Ga0207645_10027702 | Ga0207645_100277025 | 361 |
| 73 | 3300025908 | Ga0207643_10068770 | Ga0207643_100687703 | 361 |
| 74 | 3300025923 | Ga0207681_10221012 | Ga0207681_102210122 | 361 |
| 75 | 3300025925 | Ga0207650_10087964 | Ga0207650_100879641 | 361 |
| 76 | 3300025926 | Ga0207659_10045626 | Ga0207659_100456261 | 361 |
| 77 | 3300025931 | Ga0207644_10017863 | Ga0207644_100178633 | 361 |
| 78 | 3300025933 | Ga0207706_10011997 | Ga0207706_100119977 | 361 |
| 79 | 3300025937 | Ga0207669_10126415 | Ga0207669_101264152 | 361 |
| 80 | 3300025940 | Ga0207691_10004579 | Ga0207691_1000457911 | 361 |
| 81 | 3300025941 | Ga0207711_10359702 | Ga0207711_103597022 | 361 |
| 82 | 3300025942 | Ga0207689_10017053 | Ga0207689_100170535 | 361 |
| 83 | 3300025944 | Ga0207661_10105552 | Ga0207661_101055522 | 361 |
| 84 | 3300025960 | Ga0207651_10014005 | Ga0207651_100140052 | 361 |
| 85 | 3300025960 | Ga0207651_10178666 | Ga0207651_101786661 | 361 |
| 86 | 3300025986 | Ga0207658_10029755 | Ga0207658_100297553 | 361 |
| 87 | 3300026067 | Ga0207678_10052057 | Ga0207678_100520573 | 361 |
| 88 | 3300026075 | Ga0207708_10044769 | Ga0207708_100447693 | 361 |
| 89 | 3300026088 | Ga0207641_10122259 | Ga0207641_101222591 | 361 |
| 90 | 3300026089 | Ga0207648_10019878 | Ga0207648_100198785 | 361 |
| 91 | 3300026095 | Ga0207676_10026039 | Ga0207676_100260393 | 361 |
| 92 | 3300026121 | Ga0207683_10014056 | Ga0207683_100140562 | 361 |
| 93 | 3300026142 | Ga0207698_10015518 | Ga0207698_100155182 | 361 |
| 94 | 3300028577 | Ga0265318_10001780 | Ga0265318_100017806 | 361 |
| 95 | 3300029957 | Ga0265324_10016187 | Ga0265324_100161871 | 361 |
| 96 | 3300031235 | Ga0265330_10008628 | Ga0265330_100086282 | 361 |
| 97 | 3300031238 | Ga0265332_10001273 | Ga0265332_100012737 | 361 |
| 98 | 3300031239 | Ga0265328_10002854 | Ga0265328_100028544 | 361 |
| 99 | 3300031239 | Ga0265328_10027544 | Ga0265328_100275441 | 361 |
| 100 | 3300031240 | Ga0265320_10022099 | Ga0265320_100220992 | 361 |
| 101 | 3300031250 | Ga0265331_10001808 | Ga0265331_100018085 | 361 |
| 102 | 3300031250 | Ga0265331_10001901 | Ga0265331_100019014 | 361 |
| 103 | 3300031250 | Ga0265331_10006454 | Ga0265331_100064541 | 361 |
| 104 | 3300031250 | Ga0265331_10011274 | Ga0265331_100112743 | 361 |
| 105 | 3300031251 | Ga0265327_10000739 | Ga0265327_1000073932 | 361 |
| 106 | 3300031251 | Ga0265327_10001019 | Ga0265327_1000101923 | 361 |
| 107 | 3300031251 | Ga0265327_10004241 | Ga0265327_100042419 | 361 |
| 108 | 3300031251 | Ga0265327_10022584 | Ga0265327_100225842 | 361 |
| 109 | 3300031344 | Ga0265316_10081684 | Ga0265316_100816842 | 361 |
| 110 | 3300031595 | Ga0265313_10054342 | Ga0265313_100543422 | 361 |
| 111 | 3300031665 | Ga0316575_10011177 | Ga0316575_100111772 | 361 |
| 112 | 3300031711 | Ga0265314_10000980 | Ga0265314_100009803 | 361 |
| 113 | 3300044712 | Ga0453684_0151509 | Ga0453684_0151509_987_2111 | 361 |
| 114 | 3300045051 | Ga0451576_0114697 | Ga0451576_0114697_463_1566 | 361 |
| 115 | 3300048911 | Ga0496108_0186221 | Ga0496108_0186221_156_1241 | 361 |
| 116 | 3300048913 | Ga0496110_0001672 | Ga0496110_0001672_5427_6512 | 361 |
| 117 | 3300048914 | Ga0496111_0296124 | Ga0496111_0296124_46_1131 | 361 |
| 118 | 3300048917 | Ga0496114_0184760 | Ga0496114_0184760_705_1790 | 361 |
| 119 | 3300049571 | Ga0501034_0091769 | Ga0501034_0091769_681_1766 | 361 |
| 120 | 3300027717 | Ga0209998_10011946 | Ga0209998_100119462 | 364 |
| 121 | 3300048924 | Ga0496121_0038603 | Ga0496121_0038603_2597_3766 | 366 |
| 122 | 3300006058 | Ga0075432_10031116 | Ga0075432_100311162 | 367 |
| 123 | 3300048927 | Ga0496124_0000088 | Ga0496124_0000088_191296_192465 | 367 |
| 124 | 3300048927 | Ga0496124_0002378 | Ga0496124_0002378_15518_16699 | 367 |
| 125 | 3300048928 | Ga0496125_0000785 | Ga0496125_0000785_39528_40697 | 367 |
| 126 | 3300048929 | Ga0496126_0040916 | Ga0496126_0040916_1473_2642 | 367 |
| 127 | 3300002737 | JGI25162J39368_1000063 | JGI25162J39368_100006359 | 368 |
| 128 | 3300003214 | JGI25165J46597_1000069 | JGI25165J46597_100006959 | 368 |
| 129 | 3300003751 | Ga0055538_1000034 | Ga0055538_100003458 | 368 |
| 130 | 3300003752 | Ga0055539_1000044 | Ga0055539_100004458 | 368 |
| 131 | 3300003756 | Ga0055533_1000055 | Ga0055533_100005558 | 368 |
| 132 | 3300003759 | Ga0055525_1000066 | Ga0055525_1000066124 | 368 |
| 133 | 3300003841 | Ga0055541_1000032 | Ga0055541_1000032125 | 368 |
| 134 | 3300009093 | Ga0105240_10012882 | Ga0105240_100128826 | 368 |
| 135 | 3300014497 | Ga0182008_10048302 | Ga0182008_100483022 | 368 |
| 136 | 3300015261 | Ga0182006_1011518 | Ga0182006_10115183 | 368 |
| 137 | 3300015262 | Ga0182007_10005244 | Ga0182007_100052442 | 368 |
| 138 | 3300015265 | Ga0182005_1000283 | Ga0182005_100028316 | 368 |
| 139 | 3300025224 | Ga0209784_100049 | Ga0209784_100049124 | 368 |
| 140 | 3300025225 | Ga0209566_100061 | Ga0209566_100061124 | 368 |
| 141 | 3300025226 | Ga0209674_100069 | Ga0209674_100069173 | 368 |
| 142 | 3300025230 | Ga0209563_100083 | Ga0209563_100083124 | 368 |
| 143 | 3300025231 | Ga0207427_100345 | Ga0207427_1003459 | 368 |
| 144 | 3300025233 | Ga0209437_100091 | Ga0209437_100091172 | 368 |
| 145 | 3300025253 | Ga0209677_100039 | Ga0209677_100039173 | 368 |
| 146 | 3300025261 | Ga0209233_1000115 | Ga0209233_1000115172 | 368 |
| 147 | 3300031238 | Ga0265332_10000023 | Ga0265332_10000023137 | 368 |
| 148 | 3300046462 | Ga0495651_0005890 | Ga0495651_0005890_5316_6485 | 368 |
| 149 | 3300046462 | Ga0495651_0024267 | Ga0495651_0024267_1765_2934 | 368 |
| 150 | 3300046463 | Ga0495653_0038159 | Ga0495653_0038159_732_1901 | 368 |
| 151 | 3300046511 | Ga0495608_0007823 | Ga0495608_0007823_4034_5203 | 368 |
| 152 | 3300046514 | Ga0495618_0051374 | Ga0495618_0051374_1190_2359 | 368 |
| 153 | 3300046516 | Ga0495628_0001687 | Ga0495628_0001687_9227_10396 | 368 |
| 154 | 3300046516 | Ga0495628_0037330 | Ga0495628_0037330_1213_2382 | 368 |
| 155 | 3300046529 | Ga0495652_0006873 | Ga0495652_0006873_4198_5367 | 368 |
| 156 | 3300046529 | Ga0495652_0054883 | Ga0495652_0054883_902_2071 | 368 |
| 157 | 3300046543 | Ga0495645_0009579 | Ga0495645_0009579_5586_6755 | 368 |
| 158 | 3300046679 | Ga0495623_0010175 | Ga0495623_0010175_4250_5419 | 368 |
| 159 | 3300046680 | Ga0495646_0002576 | Ga0495646_0002576_221_1390 | 368 |
| 160 | 3300046809 | Ga0495600_0010139 | Ga0495600_0010139_1235_2404 | 368 |
| 161 | 3300047317 | Ga0495604_0038352 | Ga0495604_0038352_812_1981 | 368 |
| 162 | 3300048088 | Ga0495602_0106125 | Ga0495602_0106125_601_1770 | 368 |
| 163 | 3300048903 | Ga0496100_0300598 | Ga0496100_0300598_55_1179 | 368 |
| 164 | 3300053077 | Ga0495601_0130708 | Ga0495601_0130708_55_1224 | 368 |
| 165 | 3300053111 | Ga0500572_008075 | Ga0500572_008075_434_1603 | 368 |
| 166 | 3300053154 | Ga0500619_000941 | Ga0500619_000941_1472_2641 | 368 |
| 167 | 3300006195 | Ga0075366_10008469 | Ga0075366_100084695 | 372 |
| 168 | 3300009148 | Ga0105243_10093394 | Ga0105243_100933942 | 372 |
| 169 | 3300050493 | nmdc:mga0k408_29440_c1 | nmdc:mga0k408_29440_c1_1292_2470 | 372 |
| 170 | 3300042876 | Ga0451577_0406433 | Ga0451577_0406433_66_1220 | 374 |
| 171 | iso_pu_bacteria | 2885192300 | 2885196693 | 377 |
| 172 | iso_pu_bacteria | 2904449895 | 2904454004 | 377 |
| 173 | iso_pu_bacteria | 2904456579 | 2904459458 | 377 |
| 174 | iso_pu_bacteria | 2904541872 | 2904546112 | 377 |
| 175 | iso_pu_bacteria | 2929160207 | 2929161309 | 377 |
| 176 | iso_pu_bacteria | 2929520902 | 2929521572 | 377 |
| 177 | iso_pu_bacteria | 2511231002 | 2511243565 | 379 |
| 178 | iso_pu_bacteria | 2511231003 | 2511248893 | 379 |
| 179 | iso_pu_bacteria | 2513020051 | 2513228789 | 379 |
| 180 | iso_pu_bacteria | 2547132374 | 2548499218 | 379 |
| 181 | iso_pu_bacteria | 2548876994 | 2550696365 | 379 |
| 182 | iso_pu_bacteria | 2585428057 | 2587728311 | 379 |
| 183 | iso_pu_bacteria | 2585428058 | 2587734481 | 379 |
| 184 | iso_pu_bacteria | 2585428062 | 2587759375 | 379 |
| 185 | iso_pu_bacteria | 2588253510 | 2588295029 | 379 |
| 186 | iso_pu_bacteria | 2599185214 | 2599620880 | 379 |
| 187 | iso_pu_bacteria | 2599185226 | 2599674314 | 379 |
| 188 | iso_pu_bacteria | 2599185227 | 2599678504 | 379 |
| 189 | iso_pu_bacteria | 2599185229 | 2599690391 | 379 |
| 190 | iso_pu_bacteria | 2643221544 | 2643743242 | 379 |
| 191 | iso_pu_bacteria | 2643221570 | 2643866052 | 379 |
| 192 | iso_pu_bacteria | 2643221585 | 2643932737 | 379 |
| 193 | iso_pu_bacteria | 2643221592 | 2643971306 | 379 |
| 194 | iso_pu_bacteria | 2643221596 | 2643994049 | 379 |
| 195 | iso_pu_bacteria | 2643221603 | 2644027190 | 379 |
| 196 | iso_pu_bacteria | 2643221609 | 2644057735 | 379 |
| 197 | iso_pu_bacteria | 2643221611 | 2644072180 | 379 |
| 198 | iso_pu_bacteria | 2643221625 | 2644142052 | 379 |
| 199 | iso_pu_bacteria | 2643221628 | 2644161333 | 379 |
| 200 | iso_pu_bacteria | 2643221639 | 2644218341 | 379 |
| 201 | iso_pu_bacteria | 2643221644 | 2644243371 | 379 |
| 202 | iso_pu_bacteria | 2643221646 | 2644260232 | 379 |
| 203 | iso_pu_bacteria | 2643221648 | 2644275469 | 379 |
| 204 | iso_pu_bacteria | 2643221652 | 2644292863 | 379 |
| 205 | iso_pu_bacteria | 2643221654 | 2644303044 | 379 |
| 206 | iso_pu_bacteria | 2643221656 | 2644313987 | 379 |
| 207 | iso_pu_bacteria | 2643221658 | 2644324050 | 379 |
| 208 | iso_pu_bacteria | 2643221660 | 2644340819 | 379 |
| 209 | iso_pu_bacteria | 2643221672 | 2644400766 | 379 |
| 210 | iso_pu_bacteria | 2643221683 | 2644466005 | 379 |
| 211 | iso_pu_bacteria | 2643221717 | 2644647881 | 379 |
| 212 | iso_pu_bacteria | 2721755523 | 2722885691 | 379 |
| 213 | iso_pu_bacteria | 2738541277 | 2738720728 | 379 |
| 214 | iso_pu_bacteria | 2738541307 | 2738882328 | 379 |
| 215 | iso_pu_bacteria | 2738541337 | 2739056109 | 379 |
| 216 | iso_pu_bacteria | 2738543012 | 2739242011 | 379 |
| 217 | iso_pu_bacteria | 2738543013 | 2739251904 | 379 |
| 218 | iso_pu_bacteria | 2738543019 | 2739279927 | 379 |
| 219 | iso_pu_bacteria | 2816332133 | 2816470689 | 379 |
| 220 | iso_pu_bacteria | 2818991436 | 2819543494 | 379 |
| 221 | iso_pu_bacteria | 2818991445 | 2819594268 | 379 |
| 222 | iso_pu_bacteria | 2818991446 | 2819602003 | 379 |
| 223 | iso_pu_bacteria | 2818991449 | 2819617431 | 379 |
| 224 | iso_pu_bacteria | 2831265667 | 2831269832 | 379 |
| 225 | iso_pu_bacteria | 2831864461 | 2831869145 | 379 |
| 226 | iso_pu_bacteria | 2838054893 | 2838055150 | 379 |
| 227 | iso_pu_bacteria | 2839138175 | 2839142211 | 379 |
| 228 | iso_pu_bacteria | 2842677519 | 2842680916 | 379 |
| 229 | iso_pu_bacteria | 2842718218 | 2842721803 | 379 |
| 230 | iso_pu_bacteria | 2842733646 | 2842737614 | 379 |
| 231 | iso_pu_bacteria | 2842747753 | 2842749723 | 379 |
| 232 | iso_pu_bacteria | 2881101125 | 2881103518 | 379 |
| 233 | iso_pu_bacteria | 2884811622 | 2884814611 | 379 |
| 234 | iso_pu_bacteria | 2884836552 | 2884839604 | 379 |
| 235 | iso_pu_bacteria | 2884852848 | 2884856586 | 379 |
| 236 | iso_pu_bacteria | 2885198086 | 2885201853 | 379 |
| 237 | iso_pu_bacteria | 2885211737 | 2885215437 | 379 |
| 238 | iso_pu_bacteria | 2894023352 | 2894027386 | 379 |
| 239 | iso_pu_bacteria | 2896154374 | 2896157932 | 379 |
| 240 | iso_pu_bacteria | 2899924645 | 2899927240 | 379 |
| 241 | iso_pu_bacteria | 2904439833 | 2904442316 | 379 |
| 242 | iso_pu_bacteria | 2904479285 | 2904479535 | 379 |
| 243 | iso_pu_bacteria | 2904530477 | 2904533594 | 379 |
| 244 | iso_pu_bacteria | 2904584206 | 2904586549 | 379 |
| 245 | iso_pu_bacteria | 2904589729 | 2904591637 | 379 |
| 246 | iso_pu_bacteria | 2904601388 | 2904602225 | 379 |
| 247 | iso_pu_bacteria | 2919079590 | 2919083452 | 379 |
| 248 | iso_pu_bacteria | 2919462493 | 2919465416 | 379 |
| 249 | iso_pu_bacteria | 2919704043 | 2919706209 | 379 |
| 250 | iso_pu_bacteria | 2928037797 | 2928042845 | 379 |
| 251 | iso_pu_bacteria | 2928044640 | 2928048728 | 379 |
| 252 | iso_pu_bacteria | 2928051484 | 2928055060 | 379 |
| 253 | iso_pu_bacteria | 2928064002 | 2928068486 | 379 |
| 254 | iso_pu_bacteria | 2928070936 | 2928073608 | 379 |
| 255 | iso_pu_bacteria | 2928084124 | 2928089689 | 379 |
| 256 | iso_pu_bacteria | 2928115317 | 2928117255 | 379 |
| 257 | iso_pu_bacteria | 2932422444 | 2932425480 | 379 |
| 258 | iso_pu_bacteria | 2939631187 | 2939635913 | 379 |
| 259 | iso_pu_bacteria | 2945909444 | 2945914224 | 379 |
| 260 | iso_pu_bacteria | 2945945610 | 2945949792 | 379 |
| 261 | iso_pu_bacteria | 2945972063 | 2945973816 | 379 |
| 262 | iso_pu_bacteria | 2945984333 | 2945990393 | 379 |
| 263 | iso_pu_bacteria | 2954767861 | 2954770592 | 379 |
| 264 | iso_pu_bacteria | 2974320154 | 2974322127 | 379 |
| 265 | iso_pu_bacteria | 2990710928 | 2990714106 | 379 |
| 266 | 3300041407 | Ga0439447_011775 | Ga0439447_011775_1060_2232 | 381 |
| 267 | 3300001976 | JGI24752J21851_1005459 | JGI24752J21851_10054593 | 383 |
| 268 | 3300001979 | JGI24740J21852_10009841 | JGI24740J21852_100098412 | 383 |
| 269 | 3300001991 | JGI24743J22301_10000318 | JGI24743J22301_100003184 | 383 |
| 270 | 3300002704 | JGI25155J39150_1000029 | JGI25155J39150_100002966 | 383 |
| 271 | 3300002704 | JGI25155J39150_1000630 | JGI25155J39150_10006302 | 383 |
| 272 | 3300002705 | JGI25156J39149_1000062 | JGI25156J39149_100006237 | 383 |
| 273 | 3300002705 | JGI25156J39149_1007587 | JGI25156J39149_10075872 | 383 |
| 274 | 3300002738 | JGI25154J39366_1000053 | JGI25154J39366_100005343 | 383 |
| 275 | 3300002738 | JGI25154J39366_1000980 | JGI25154J39366_10009805 | 383 |
| 276 | 3300002741 | JGI25157J39369_1000046 | JGI25157J39369_100004666 | 383 |
| 277 | 3300002741 | JGI25157J39369_1000148 | JGI25157J39369_100014834 | 383 |
| 278 | 3300002772 | JGI25164J39214_1005708 | JGI25164J39214_10057081 | 383 |
| 279 | 3300002773 | JGI25152J39213_1006001 | JGI25152J39213_10060014 | 383 |
| 280 | 3300002773 | JGI25152J39213_1006432 | JGI25152J39213_10064322 | 383 |
| 281 | 3300002774 | JGI25150J39212_1001852 | JGI25150J39212_10018522 | 383 |
| 282 | 3300003215 | JGI25153J46596_10005062 | JGI25153J46596_100050626 | 383 |
| 283 | 3300003215 | JGI25153J46596_10022378 | JGI25153J46596_100223782 | 383 |
| 284 | 3300003322 | rootL2_10000966 | rootL2_100009669 | 383 |
| 285 | 3300003354 | JGI25160J50197_1000253 | JGI25160J50197_100025334 | 383 |
| 286 | 3300003374 | JGI25161J50226_1000046 | JGI25161J50226_100004654 | 383 |
| 287 | 3300003575 | Ga0007409J51694_1052775 | Ga0007409J51694_10527752 | 383 |
| 288 | 3300003578 | Ga0006562J51391_1013325 | Ga0006562J51391_10133256 | 383 |
| 289 | 3300003578 | Ga0006562J51391_1013328 | Ga0006562J51391_10133282 | 383 |
| 290 | 3300003578 | Ga0006562J51391_1029542 | Ga0006562J51391_10295423 | 383 |
| 291 | 3300003751 | Ga0055538_1000051 | Ga0055538_100005184 | 383 |
| 292 | 3300003752 | Ga0055539_1000076 | Ga0055539_100007684 | 383 |
| 293 | 3300003756 | Ga0055533_1000016 | Ga0055533_1000016203 | 383 |
| 294 | 3300003756 | Ga0055533_1000082 | Ga0055533_100008284 | 383 |
| 295 | 3300003759 | Ga0055525_1000109 | Ga0055525_100010984 | 383 |
| 296 | 3300003759 | Ga0055525_1001112 | Ga0055525_10011122 | 383 |
| 297 | 3300003760 | Ga0055527_1005163 | Ga0055527_10051632 | 383 |
| 298 | 3300003761 | Ga0055535_1000934 | Ga0055535_10009345 | 383 |
| 299 | 3300003762 | Ga0055542_1000051 | Ga0055542_100005194 | 383 |
| 300 | 3300003763 | Ga0055529_1000333 | Ga0055529_100033336 | 383 |
| 301 | 3300003771 | Ga0055526_1003822 | Ga0055526_10038223 | 383 |
| 302 | 3300003771 | Ga0055526_1006065 | Ga0055526_10060656 | 383 |
| 303 | 3300003771 | Ga0055526_1018229 | Ga0055526_10182292 | 383 |
| 304 | 3300003773 | Ga0055537_1000320 | Ga0055537_100032031 | 383 |
| 305 | 3300003773 | Ga0055537_1001534 | Ga0055537_10015342 | 383 |
| 306 | 3300003773 | Ga0055537_1007598 | Ga0055537_10075982 | 383 |
| 307 | 3300003775 | Ga0055524_1000044 | Ga0055524_1000044133 | 383 |
| 308 | 3300003775 | Ga0055524_1000052 | Ga0055524_100005288 | 383 |
| 309 | 3300003781 | Ga0055536_1017883 | Ga0055536_10178832 | 383 |
| 310 | 3300003784 | Ga0055534_1001482 | Ga0055534_10014826 | 383 |
| 311 | 3300003784 | Ga0055534_1003391 | Ga0055534_10033912 | 383 |
| 312 | 3300003784 | Ga0055534_1003755 | Ga0055534_10037552 | 383 |
| 313 | 3300003790 | Ga0055528_1002526 | Ga0055528_10025267 | 383 |
| 314 | 3300003790 | Ga0055528_1002727 | Ga0055528_10027273 | 383 |
| 315 | 3300003790 | Ga0055528_1014474 | Ga0055528_10144742 | 383 |
| 316 | 3300003790 | Ga0055528_1016568 | Ga0055528_10165682 | 383 |
| 317 | 3300003791 | Ga0055530_10003990 | Ga0055530_100039904 | 383 |
| 318 | 3300003791 | Ga0055530_10028740 | Ga0055530_100287402 | 383 |
| 319 | 3300003792 | Ga0055540_1000019 | Ga0055540_100001912 | 383 |
| 320 | 3300003792 | Ga0055540_1000116 | Ga0055540_100011643 | 383 |
| 321 | 3300003792 | Ga0055540_1001799 | Ga0055540_10017998 | 383 |
| 322 | 3300003792 | Ga0055540_1007088 | Ga0055540_10070883 | 383 |
| 323 | 3300003792 | Ga0055540_1018406 | Ga0055540_10184062 | 383 |
| 324 | 3300003792 | Ga0055540_1020148 | Ga0055540_10201482 | 383 |
| 325 | 3300003794 | Ga0055531_10000001 | Ga0055531_1000000193 | 383 |
| 326 | 3300003794 | Ga0055531_10000250 | Ga0055531_1000025043 | 383 |
| 327 | 3300003794 | Ga0055531_10000360 | Ga0055531_100003608 | 383 |
| 328 | 3300003794 | Ga0055531_10001074 | Ga0055531_1000107410 | 383 |
| 329 | 3300003794 | Ga0055531_10005011 | Ga0055531_100050113 | 383 |
| 330 | 3300003841 | Ga0055541_1000053 | Ga0055541_100005384 | 383 |
| 331 | 3300004625 | Ga0055543_1000404 | Ga0055543_10004048 | 383 |
| 332 | 3300004625 | Ga0055543_1001848 | Ga0055543_10018484 | 383 |
| 333 | 3300005262 | Ga0065165_1000080 | Ga0065165_1000080137 | 383 |
| 334 | 3300005262 | Ga0065165_1000101 | Ga0065165_1000101103 | 383 |
| 335 | 3300005262 | Ga0065165_1011617 | Ga0065165_10116172 | 383 |
| 336 | 3300005288 | Ga0065714_10088736 | Ga0065714_100887362 | 383 |
| 337 | 3300005289 | Ga0065704_10152799 | Ga0065704_101527991 | 383 |
| 338 | 3300005290 | Ga0065712_10013487 | Ga0065712_100134871 | 383 |
| 339 | 3300005293 | Ga0065715_10109100 | Ga0065715_101091002 | 383 |
| 340 | 3300005293 | Ga0065715_10200115 | Ga0065715_102001151 | 383 |
| 341 | 3300005295 | Ga0065707_10017403 | Ga0065707_100174031 | 383 |
| 342 | 3300005295 | Ga0065707_10087447 | Ga0065707_100874473 | 383 |
| 343 | 3300005328 | Ga0070676_10006671 | Ga0070676_100066713 | 383 |
| 344 | 3300005328 | Ga0070676_10011485 | Ga0070676_100114853 | 383 |
| 345 | 3300005328 | Ga0070676_10030468 | Ga0070676_100304682 | 383 |
| 346 | 3300005329 | Ga0070683_100009064 | Ga0070683_1000090647 | 383 |
| 347 | 3300005329 | Ga0070683_100101987 | Ga0070683_1001019872 | 383 |
| 348 | 3300005330 | Ga0070690_100014678 | Ga0070690_1000146784 | 383 |
| 349 | 3300005331 | Ga0070670_100017831 | Ga0070670_1000178312 | 383 |
| 350 | 3300005331 | Ga0070670_100024246 | Ga0070670_1000242462 | 383 |
| 351 | 3300005331 | Ga0070670_100041714 | Ga0070670_1000417142 | 383 |
| 352 | 3300005331 | Ga0070670_100060294 | Ga0070670_1000602942 | 383 |
| 353 | 3300005333 | Ga0070677_10010696 | Ga0070677_100106961 | 383 |
| 354 | 3300005333 | Ga0070677_10020993 | Ga0070677_100209932 | 383 |
| 355 | 3300005334 | Ga0068869_100010988 | Ga0068869_1000109884 | 383 |
| 356 | 3300005334 | Ga0068869_100054844 | Ga0068869_1000548442 | 383 |
| 357 | 3300005334 | Ga0068869_100057452 | Ga0068869_1000574522 | 383 |
| 358 | 3300005334 | Ga0068869_100060701 | Ga0068869_1000607012 | 383 |
| 359 | 3300005334 | Ga0068869_100144839 | Ga0068869_1001448391 | 383 |
| 360 | 3300005335 | Ga0070666_10002017 | Ga0070666_100020175 | 383 |
| 361 | 3300005335 | Ga0070666_10002085 | Ga0070666_100020856 | 383 |
| 362 | 3300005335 | Ga0070666_10007234 | Ga0070666_100072344 | 383 |
| 363 | 3300005335 | Ga0070666_10166859 | Ga0070666_101668591 | 383 |
| 364 | 3300005336 | Ga0070680_100009175 | Ga0070680_1000091753 | 383 |
| 365 | 3300005336 | Ga0070680_100118137 | Ga0070680_1001181372 | 383 |
| 366 | 3300005337 | Ga0070682_100072046 | Ga0070682_1000720461 | 383 |
| 367 | 3300005338 | Ga0068868_100002479 | Ga0068868_1000024794 | 383 |
| 368 | 3300005338 | Ga0068868_100008720 | Ga0068868_1000087202 | 383 |
| 369 | 3300005338 | Ga0068868_100011294 | Ga0068868_1000112945 | 383 |
| 370 | 3300005338 | Ga0068868_100015252 | Ga0068868_1000152523 | 383 |
| 371 | 3300005338 | Ga0068868_100025044 | Ga0068868_1000250442 | 383 |
| 372 | 3300005338 | Ga0068868_100077031 | Ga0068868_1000770312 | 383 |
| 373 | 3300005339 | Ga0070660_100010146 | Ga0070660_1000101462 | 383 |
| 374 | 3300005339 | Ga0070660_100016617 | Ga0070660_1000166174 | 383 |
| 375 | 3300005339 | Ga0070660_100030279 | Ga0070660_1000302792 | 383 |
| 376 | 3300005339 | Ga0070660_100056082 | Ga0070660_1000560822 | 383 |
| 377 | 3300005339 | Ga0070660_100169243 | Ga0070660_1001692432 | 383 |
| 378 | 3300005340 | Ga0070689_100006450 | Ga0070689_1000064503 | 383 |
| 379 | 3300005344 | Ga0070661_100000438 | Ga0070661_10000043814 | 383 |
| 380 | 3300005344 | Ga0070661_100004052 | Ga0070661_1000040522 | 383 |
| 381 | 3300005344 | Ga0070661_100007525 | Ga0070661_1000075254 | 383 |
| 382 | 3300005344 | Ga0070661_100021533 | Ga0070661_1000215333 | 383 |
| 383 | 3300005344 | Ga0070661_100027172 | Ga0070661_1000271722 | 383 |
| 384 | 3300005344 | Ga0070661_100037457 | Ga0070661_1000374572 | 383 |
| 385 | 3300005344 | Ga0070661_100062540 | Ga0070661_1000625402 | 383 |
| 386 | 3300005344 | Ga0070661_100068487 | Ga0070661_1000684872 | 383 |
| 387 | 3300005344 | Ga0070661_100128680 | Ga0070661_1001286802 | 383 |
| 388 | 3300005347 | Ga0070668_100006235 | Ga0070668_1000062353 | 383 |
| 389 | 3300005347 | Ga0070668_100034620 | Ga0070668_1000346202 | 383 |
| 390 | 3300005347 | Ga0070668_100119179 | Ga0070668_1001191792 | 383 |
| 391 | 3300005353 | Ga0070669_100000836 | Ga0070669_10000083610 | 383 |
| 392 | 3300005353 | Ga0070669_100007603 | Ga0070669_1000076033 | 383 |
| 393 | 3300005354 | Ga0070675_100005877 | Ga0070675_1000058775 | 383 |
| 394 | 3300005354 | Ga0070675_100008456 | Ga0070675_1000084564 | 383 |
| 395 | 3300005354 | Ga0070675_100009844 | Ga0070675_1000098442 | 383 |
| 396 | 3300005354 | Ga0070675_100009921 | Ga0070675_1000099211 | 383 |
| 397 | 3300005354 | Ga0070675_100030409 | Ga0070675_1000304092 | 383 |
| 398 | 3300005354 | Ga0070675_100033037 | Ga0070675_1000330372 | 383 |
| 399 | 3300005354 | Ga0070675_100040122 | Ga0070675_1000401222 | 383 |
| 400 | 3300005354 | Ga0070675_100069679 | Ga0070675_1000696792 | 383 |
| 401 | 3300005354 | Ga0070675_100097175 | Ga0070675_1000971752 | 383 |
| 402 | 3300005354 | Ga0070675_100109297 | Ga0070675_1001092972 | 383 |
| 403 | 3300005354 | Ga0070675_100152851 | Ga0070675_1001528512 | 383 |
| 404 | 3300005355 | Ga0070671_100016262 | Ga0070671_1000162624 | 383 |
| 405 | 3300005355 | Ga0070671_100020139 | Ga0070671_1000201393 | 383 |
| 406 | 3300005355 | Ga0070671_100034619 | Ga0070671_1000346192 | 383 |
| 407 | 3300005355 | Ga0070671_100075349 | Ga0070671_1000753492 | 383 |
| 408 | 3300005355 | Ga0070671_100091607 | Ga0070671_1000916071 | 383 |
| 409 | 3300005355 | Ga0070671_100101544 | Ga0070671_1001015442 | 383 |
| 410 | 3300005356 | Ga0070674_100067268 | Ga0070674_1000672682 | 383 |
| 411 | 3300005356 | Ga0070674_100079454 | Ga0070674_1000794542 | 383 |
| 412 | 3300005364 | Ga0070673_100002109 | Ga0070673_1000021095 | 383 |
| 413 | 3300005364 | Ga0070673_100007014 | Ga0070673_1000070142 | 383 |
| 414 | 3300005364 | Ga0070673_100032447 | Ga0070673_1000324472 | 383 |
| 415 | 3300005364 | Ga0070673_100034161 | Ga0070673_1000341612 | 383 |
| 416 | 3300005364 | Ga0070673_100067153 | Ga0070673_1000671533 | 383 |
| 417 | 3300005365 | Ga0070688_100007417 | Ga0070688_1000074173 | 383 |
| 418 | 3300005365 | Ga0070688_100020548 | Ga0070688_1000205482 | 383 |
| 419 | 3300005365 | Ga0070688_100062864 | Ga0070688_1000628642 | 383 |
| 420 | 3300005366 | Ga0070659_100001517 | Ga0070659_10000151711 | 383 |
| 421 | 3300005366 | Ga0070659_100005912 | Ga0070659_1000059127 | 383 |
| 422 | 3300005366 | Ga0070659_100006674 | Ga0070659_1000066748 | 383 |
| 423 | 3300005366 | Ga0070659_100027105 | Ga0070659_1000271053 | 383 |
| 424 | 3300005366 | Ga0070659_100040928 | Ga0070659_1000409282 | 383 |
| 425 | 3300005366 | Ga0070659_100061022 | Ga0070659_1000610222 | 383 |
| 426 | 3300005366 | Ga0070659_100099618 | Ga0070659_1000996181 | 383 |
| 427 | 3300005367 | Ga0070667_100008976 | Ga0070667_1000089764 | 383 |
| 428 | 3300005367 | Ga0070667_100085453 | Ga0070667_1000854532 | 383 |
| 429 | 3300005435 | Ga0070714_100066057 | Ga0070714_1000660571 | 383 |
| 430 | 3300005436 | Ga0070713_100001286 | Ga0070713_1000012864 | 383 |
| 431 | 3300005436 | Ga0070713_100037564 | Ga0070713_1000375642 | 383 |
| 432 | 3300005436 | Ga0070713_100097345 | Ga0070713_1000973452 | 383 |
| 433 | 3300005437 | Ga0070710_10017813 | Ga0070710_100178132 | 383 |
| 434 | 3300005439 | Ga0070711_100165078 | Ga0070711_1001650782 | 383 |
| 435 | 3300005440 | Ga0070705_100167164 | Ga0070705_1001671642 | 383 |
| 436 | 3300005441 | Ga0070700_100005556 | Ga0070700_1000055563 | 383 |
| 437 | 3300005445 | Ga0070708_100002113 | Ga0070708_1000021136 | 383 |
| 438 | 3300005445 | Ga0070708_100039865 | Ga0070708_1000398653 | 383 |
| 439 | 3300005455 | Ga0070663_100001569 | Ga0070663_1000015692 | 383 |
| 440 | 3300005455 | Ga0070663_100001571 | Ga0070663_1000015715 | 383 |
| 441 | 3300005455 | Ga0070663_100018838 | Ga0070663_1000188384 | 383 |
| 442 | 3300005455 | Ga0070663_100032139 | Ga0070663_1000321393 | 383 |
| 443 | 3300005455 | Ga0070663_100042377 | Ga0070663_1000423772 | 383 |
| 444 | 3300005456 | Ga0070678_100002034 | Ga0070678_1000020344 | 383 |
| 445 | 3300005456 | Ga0070678_100011593 | Ga0070678_1000115934 | 383 |
| 446 | 3300005456 | Ga0070678_100016983 | Ga0070678_1000169832 | 383 |
| 447 | 3300005456 | Ga0070678_100042434 | Ga0070678_1000424342 | 383 |
| 448 | 3300005456 | Ga0070678_100106891 | Ga0070678_1001068912 | 383 |
| 449 | 3300005457 | Ga0070662_100000797 | Ga0070662_10000079710 | 383 |
| 450 | 3300005457 | Ga0070662_100003074 | Ga0070662_1000030745 | 383 |
| 451 | 3300005457 | Ga0070662_100015946 | Ga0070662_1000159462 | 383 |
| 452 | 3300005457 | Ga0070662_100022556 | Ga0070662_1000225562 | 383 |
| 453 | 3300005457 | Ga0070662_100044324 | Ga0070662_1000443242 | 383 |
| 454 | 3300005458 | Ga0070681_10005522 | Ga0070681_100055225 | 383 |
| 455 | 3300005458 | Ga0070681_10015862 | Ga0070681_100158623 | 383 |
| 456 | 3300005458 | Ga0070681_10039054 | Ga0070681_100390542 | 383 |
| 457 | 3300005458 | Ga0070681_10122983 | Ga0070681_101229832 | 383 |
| 458 | 3300005458 | Ga0070681_10250846 | Ga0070681_102508461 | 383 |
| 459 | 3300005459 | Ga0068867_100000072 | Ga0068867_10000007241 | 383 |
| 460 | 3300005459 | Ga0068867_100012146 | Ga0068867_1000121463 | 383 |
| 461 | 3300005459 | Ga0068867_100015998 | Ga0068867_1000159982 | 383 |
| 462 | 3300005459 | Ga0068867_100042119 | Ga0068867_1000421192 | 383 |
| 463 | 3300005459 | Ga0068867_100151478 | Ga0068867_1001514782 | 383 |
| 464 | 3300005466 | Ga0070685_10008232 | Ga0070685_100082323 | 383 |
| 465 | 3300005467 | Ga0070706_100003148 | Ga0070706_1000031488 | 383 |
| 466 | 3300005530 | Ga0070679_100002623 | Ga0070679_1000026235 | 383 |
| 467 | 3300005530 | Ga0070679_100013959 | Ga0070679_1000139592 | 383 |
| 468 | 3300005530 | Ga0070679_100027132 | Ga0070679_1000271322 | 383 |
| 469 | 3300005535 | Ga0070684_100005280 | Ga0070684_1000052805 | 383 |
| 470 | 3300005535 | Ga0070684_100025049 | Ga0070684_1000250492 | 383 |
| 471 | 3300005535 | Ga0070684_100113710 | Ga0070684_1001137102 | 383 |
| 472 | 3300005539 | Ga0068853_100008733 | Ga0068853_1000087337 | 383 |
| 473 | 3300005539 | Ga0068853_100010500 | Ga0068853_1000105002 | 383 |
| 474 | 3300005539 | Ga0068853_100051363 | Ga0068853_1000513632 | 383 |
| 475 | 3300005539 | Ga0068853_100200788 | Ga0068853_1002007882 | 383 |
| 476 | 3300005543 | Ga0070672_100006178 | Ga0070672_1000061785 | 383 |
| 477 | 3300005543 | Ga0070672_100012097 | Ga0070672_1000120974 | 383 |
| 478 | 3300005543 | Ga0070672_100043693 | Ga0070672_1000436933 | 383 |
| 479 | 3300005543 | Ga0070672_100079220 | Ga0070672_1000792202 | 383 |
| 480 | 3300005546 | Ga0070696_100045688 | Ga0070696_1000456883 | 383 |
| 481 | 3300005548 | Ga0070665_100001671 | Ga0070665_1000016713 | 383 |
| 482 | 3300005548 | Ga0070665_100014514 | Ga0070665_1000145145 | 383 |
| 483 | 3300005548 | Ga0070665_100026041 | Ga0070665_1000260413 | 383 |
| 484 | 3300005548 | Ga0070665_100031464 | Ga0070665_1000314644 | 383 |
| 485 | 3300005563 | Ga0068855_100001947 | Ga0068855_1000019479 | 383 |
| 486 | 3300005563 | Ga0068855_100013553 | Ga0068855_1000135533 | 383 |
| 487 | 3300005563 | Ga0068855_100020007 | Ga0068855_1000200073 | 383 |
| 488 | 3300005563 | Ga0068855_100021278 | Ga0068855_1000212784 | 383 |
| 489 | 3300005563 | Ga0068855_100022085 | Ga0068855_1000220855 | 383 |
| 490 | 3300005563 | Ga0068855_100064929 | Ga0068855_1000649292 | 383 |
| 491 | 3300005563 | Ga0068855_100284948 | Ga0068855_1002849482 | 383 |
| 492 | 3300005564 | Ga0070664_100000572 | Ga0070664_1000005727 | 383 |
| 493 | 3300005564 | Ga0070664_100004505 | Ga0070664_1000045053 | 383 |
| 494 | 3300005564 | Ga0070664_100010523 | Ga0070664_1000105232 | 383 |
| 495 | 3300005564 | Ga0070664_100011975 | Ga0070664_1000119753 | 383 |
| 496 | 3300005564 | Ga0070664_100017181 | Ga0070664_1000171814 | 383 |
| 497 | 3300005564 | Ga0070664_100035428 | Ga0070664_1000354282 | 383 |
| 498 | 3300005564 | Ga0070664_100056592 | Ga0070664_1000565923 | 383 |
| 499 | 3300005564 | Ga0070664_100109582 | Ga0070664_1001095822 | 383 |
| 500 | 3300005564 | Ga0070664_100151381 | Ga0070664_1001513812 | 383 |
| 501 | 3300005577 | Ga0068857_100002092 | Ga0068857_10000209213 | 383 |
| 502 | 3300005577 | Ga0068857_100009749 | Ga0068857_1000097495 | 383 |
| 503 | 3300005577 | Ga0068857_100019562 | Ga0068857_1000195624 | 383 |
| 504 | 3300005577 | Ga0068857_100043710 | Ga0068857_1000437102 | 383 |
| 505 | 3300005578 | Ga0068854_100002901 | Ga0068854_1000029016 | 383 |
| 506 | 3300005578 | Ga0068854_100004679 | Ga0068854_1000046795 | 383 |
| 507 | 3300005578 | Ga0068854_100005922 | Ga0068854_1000059227 | 383 |
| 508 | 3300005578 | Ga0068854_100008715 | Ga0068854_1000087154 | 383 |
| 509 | 3300005578 | Ga0068854_100010091 | Ga0068854_1000100913 | 383 |
| 510 | 3300005578 | Ga0068854_100202106 | Ga0068854_1002021062 | 383 |
| 511 | 3300005614 | Ga0068856_100003475 | Ga0068856_1000034758 | 383 |
| 512 | 3300005614 | Ga0068856_100004714 | Ga0068856_1000047148 | 383 |
| 513 | 3300005614 | Ga0068856_100013533 | Ga0068856_1000135332 | 383 |
| 514 | 3300005614 | Ga0068856_100060225 | Ga0068856_1000602252 | 383 |
| 515 | 3300005614 | Ga0068856_100200213 | Ga0068856_1002002132 | 383 |
| 516 | 3300005615 | Ga0070702_100008273 | Ga0070702_1000082732 | 383 |
| 517 | 3300005615 | Ga0070702_100013368 | Ga0070702_1000133682 | 383 |
| 518 | 3300005615 | Ga0070702_100035799 | Ga0070702_1000357992 | 383 |
| 519 | 3300005616 | Ga0068852_100006367 | Ga0068852_1000063672 | 383 |
| 520 | 3300005616 | Ga0068852_100009785 | Ga0068852_1000097855 | 383 |
| 521 | 3300005616 | Ga0068852_100011377 | Ga0068852_1000113773 | 383 |
| 522 | 3300005616 | Ga0068852_100016444 | Ga0068852_1000164443 | 383 |
| 523 | 3300005616 | Ga0068852_100029219 | Ga0068852_1000292193 | 383 |
| 524 | 3300005616 | Ga0068852_100050451 | Ga0068852_1000504512 | 383 |
| 525 | 3300005616 | Ga0068852_100103957 | Ga0068852_1001039572 | 383 |
| 526 | 3300005616 | Ga0068852_100170849 | Ga0068852_1001708492 | 383 |
| 527 | 3300005616 | Ga0068852_100275515 | Ga0068852_1002755152 | 383 |
| 528 | 3300005617 | Ga0068859_100001759 | Ga0068859_10000175915 | 383 |
| 529 | 3300005617 | Ga0068859_100010805 | Ga0068859_1000108057 | 383 |
| 530 | 3300005617 | Ga0068859_100036303 | Ga0068859_1000363032 | 383 |
| 531 | 3300005617 | Ga0068859_100046656 | Ga0068859_1000466563 | 383 |
| 532 | 3300005617 | Ga0068859_100342822 | Ga0068859_1003428223 | 383 |
| 533 | 3300005618 | Ga0068864_100002362 | Ga0068864_1000023629 | 383 |
| 534 | 3300005618 | Ga0068864_100005230 | Ga0068864_1000052303 | 383 |
| 535 | 3300005618 | Ga0068864_100005322 | Ga0068864_1000053223 | 383 |
| 536 | 3300005618 | Ga0068864_100011034 | Ga0068864_1000110346 | 383 |
| 537 | 3300005618 | Ga0068864_100014018 | Ga0068864_1000140184 | 383 |
| 538 | 3300005618 | Ga0068864_100080310 | Ga0068864_1000803102 | 383 |
| 539 | 3300005618 | Ga0068864_100094802 | Ga0068864_1000948022 | 383 |
| 540 | 3300005718 | Ga0068866_10001400 | Ga0068866_100014002 | 383 |
| 541 | 3300005718 | Ga0068866_10015287 | Ga0068866_100152873 | 383 |
| 542 | 3300005719 | Ga0068861_100001649 | Ga0068861_1000016495 | 383 |
| 543 | 3300005719 | Ga0068861_100002141 | Ga0068861_1000021412 | 383 |
| 544 | 3300005719 | Ga0068861_100006425 | Ga0068861_1000064255 | 383 |
| 545 | 3300005719 | Ga0068861_100010613 | Ga0068861_1000106134 | 383 |
| 546 | 3300005719 | Ga0068861_100014120 | Ga0068861_1000141202 | 383 |
| 547 | 3300005719 | Ga0068861_100021452 | Ga0068861_1000214525 | 383 |
| 548 | 3300005834 | Ga0068851_10004000 | Ga0068851_100040003 | 383 |
| 549 | 3300005834 | Ga0068851_10031226 | Ga0068851_100312262 | 383 |
| 550 | 3300005834 | Ga0068851_10041079 | Ga0068851_100410792 | 383 |
| 551 | 3300005840 | Ga0068870_10000981 | Ga0068870_100009817 | 383 |
| 552 | 3300005841 | Ga0068863_100007421 | Ga0068863_1000074213 | 383 |
| 553 | 3300005841 | Ga0068863_100009748 | Ga0068863_1000097483 | 383 |
| 554 | 3300005841 | Ga0068863_100025176 | Ga0068863_1000251762 | 383 |
| 555 | 3300005841 | Ga0068863_100025192 | Ga0068863_1000251923 | 383 |
| 556 | 3300005841 | Ga0068863_100056582 | Ga0068863_1000565822 | 383 |
| 557 | 3300005841 | Ga0068863_100106534 | Ga0068863_1001065342 | 383 |
| 558 | 3300005841 | Ga0068863_100137817 | Ga0068863_1001378172 | 383 |
| 559 | 3300005842 | Ga0068858_100000947 | Ga0068858_1000009478 | 383 |
| 560 | 3300005842 | Ga0068858_100007512 | Ga0068858_1000075126 | 383 |
| 561 | 3300005842 | Ga0068858_100057393 | Ga0068858_1000573932 | 383 |
| 562 | 3300005842 | Ga0068858_100096548 | Ga0068858_1000965482 | 383 |
| 563 | 3300005843 | Ga0068860_100000590 | Ga0068860_10000059019 | 383 |
| 564 | 3300005843 | Ga0068860_100052167 | Ga0068860_1000521672 | 383 |
| 565 | 3300005843 | Ga0068860_100082698 | Ga0068860_1000826984 | 383 |
| 566 | 3300005843 | Ga0068860_100144366 | Ga0068860_1001443662 | 383 |
| 567 | 3300005844 | Ga0068862_100013089 | Ga0068862_1000130893 | 383 |
| 568 | 3300005844 | Ga0068862_100014282 | Ga0068862_1000142826 | 383 |
| 569 | 3300005844 | Ga0068862_100034543 | Ga0068862_1000345433 | 383 |
| 570 | 3300005844 | Ga0068862_100037384 | Ga0068862_1000373843 | 383 |
| 571 | 3300005844 | Ga0068862_100043174 | Ga0068862_1000431742 | 383 |
| 572 | 3300005844 | Ga0068862_100060042 | Ga0068862_1000600423 | 383 |
| 573 | 3300006038 | Ga0075365_10005740 | Ga0075365_100057404 | 383 |
| 574 | 3300006038 | Ga0075365_10050093 | Ga0075365_100500932 | 383 |
| 575 | 3300006038 | Ga0075365_10092652 | Ga0075365_100926521 | 383 |
| 576 | 3300006038 | Ga0075365_10116201 | Ga0075365_101162012 | 383 |
| 577 | 3300006038 | Ga0075365_10145844 | Ga0075365_101458442 | 383 |
| 578 | 3300006042 | Ga0075368_10017820 | Ga0075368_100178202 | 383 |
| 579 | 3300006042 | Ga0075368_10046679 | Ga0075368_100466792 | 383 |
| 580 | 3300006051 | Ga0075364_10026805 | Ga0075364_100268052 | 383 |
| 581 | 3300006051 | Ga0075364_10035233 | Ga0075364_100352332 | 383 |
| 582 | 3300006173 | Ga0070716_100018621 | Ga0070716_1000186213 | 383 |
| 583 | 3300006173 | Ga0070716_100120684 | Ga0070716_1001206842 | 383 |
| 584 | 3300006177 | Ga0075362_10002448 | Ga0075362_100024483 | 383 |
| 585 | 3300006177 | Ga0075362_10031931 | Ga0075362_100319312 | 383 |
| 586 | 3300006177 | Ga0075362_10062616 | Ga0075362_100626162 | 383 |
| 587 | 3300006178 | Ga0075367_10009399 | Ga0075367_100093992 | 383 |
| 588 | 3300006178 | Ga0075367_10011488 | Ga0075367_100114883 | 383 |
| 589 | 3300006178 | Ga0075367_10029375 | Ga0075367_100293752 | 383 |
| 590 | 3300006178 | Ga0075367_10046968 | Ga0075367_100469682 | 383 |
| 591 | 3300006195 | Ga0075366_10001777 | Ga0075366_100017773 | 383 |
| 592 | 3300006195 | Ga0075366_10005505 | Ga0075366_100055052 | 383 |
| 593 | 3300006195 | Ga0075366_10061854 | Ga0075366_100618542 | 383 |
| 594 | 3300006195 | Ga0075366_10123098 | Ga0075366_101230982 | 383 |
| 595 | 3300006237 | Ga0097621_100009497 | Ga0097621_1000094975 | 383 |
| 596 | 3300006237 | Ga0097621_100009981 | Ga0097621_1000099814 | 383 |
| 597 | 3300006237 | Ga0097621_100038502 | Ga0097621_1000385023 | 383 |
| 598 | 3300006237 | Ga0097621_100039883 | Ga0097621_1000398833 | 383 |
| 599 | 3300006237 | Ga0097621_100069465 | Ga0097621_1000694652 | 383 |
| 600 | 3300006237 | Ga0097621_100303580 | Ga0097621_1003035802 | 383 |
| 601 | 3300006237 | Ga0097621_100350519 | Ga0097621_1003505192 | 383 |
| 602 | 3300006353 | Ga0075370_10000547 | Ga0075370_100005476 | 383 |
| 603 | 3300006353 | Ga0075370_10010371 | Ga0075370_100103712 | 383 |
| 604 | 3300006353 | Ga0075370_10010601 | Ga0075370_100106013 | 383 |
| 605 | 3300006353 | Ga0075370_10023495 | Ga0075370_100234952 | 383 |
| 606 | 3300006358 | Ga0068871_100003477 | Ga0068871_1000034774 | 383 |
| 607 | 3300006358 | Ga0068871_100063179 | Ga0068871_1000631792 | 383 |
| 608 | 3300006358 | Ga0068871_100097689 | Ga0068871_1000976892 | 383 |
| 609 | 3300006358 | Ga0068871_100099589 | Ga0068871_1000995892 | 383 |
| 610 | 3300006871 | Ga0075434_100025677 | Ga0075434_1000256775 | 383 |
| 611 | 3300006880 | Ga0075429_100000199 | Ga0075429_10000019932 | 383 |
| 612 | 3300006880 | Ga0075429_100043639 | Ga0075429_1000436393 | 383 |
| 613 | 3300006881 | Ga0068865_100002420 | Ga0068865_1000024207 | 383 |
| 614 | 3300006881 | Ga0068865_100020119 | Ga0068865_1000201193 | 383 |
| 615 | 3300006914 | Ga0075436_100018851 | Ga0075436_1000188513 | 383 |
| 616 | 3300006931 | Ga0097620_100001759 | Ga0097620_1000017592 | 383 |
| 617 | 3300006931 | Ga0097620_100010805 | Ga0097620_1000108057 | 383 |
| 618 | 3300006931 | Ga0097620_100036302 | Ga0097620_1000363024 | 383 |
| 619 | 3300006931 | Ga0097620_100046656 | Ga0097620_1000466563 | 383 |
| 620 | 3300006931 | Ga0097620_100342816 | Ga0097620_1003428162 | 383 |
| 621 | 3300006942 | Ga0099824_1027880 | Ga0099824_10278802 | 383 |
| 622 | 3300006944 | Ga0099823_1000108 | Ga0099823_100010816 | 383 |
| 623 | 3300006946 | Ga0079104_1000037 | Ga0079104_100003734 | 383 |
| 624 | 3300006946 | Ga0079104_1000206 | Ga0079104_100020641 | 383 |
| 625 | 3300006948 | Ga0099826_10006960 | Ga0099826_100069603 | 383 |
| 626 | 3300007076 | Ga0075435_100032473 | Ga0075435_1000324733 | 383 |
| 627 | 3300009036 | Ga0105244_10010566 | Ga0105244_100105662 | 383 |
| 628 | 3300009092 | Ga0105250_10000294 | Ga0105250_1000029413 | 383 |
| 629 | 3300009093 | Ga0105240_10012066 | Ga0105240_1001206610 | 383 |
| 630 | 3300009093 | Ga0105240_10031744 | Ga0105240_100317442 | 383 |
| 631 | 3300009093 | Ga0105240_10047500 | Ga0105240_100475003 | 383 |
| 632 | 3300009093 | Ga0105240_10051763 | Ga0105240_100517634 | 383 |
| 633 | 3300009093 | Ga0105240_10109992 | Ga0105240_101099922 | 383 |
| 634 | 3300009093 | Ga0105240_10316966 | Ga0105240_103169662 | 383 |
| 635 | 3300009094 | Ga0111539_10048149 | Ga0111539_100481494 | 383 |
| 636 | 3300009098 | Ga0105245_10060559 | Ga0105245_100605592 | 383 |
| 637 | 3300009098 | Ga0105245_10377880 | Ga0105245_103778801 | 383 |
| 638 | 3300009098 | Ga0105245_10387134 | Ga0105245_103871342 | 383 |
| 639 | 3300009148 | Ga0105243_10001108 | Ga0105243_1000110811 | 383 |
| 640 | 3300009148 | Ga0105243_10001868 | Ga0105243_100018682 | 383 |
| 641 | 3300009148 | Ga0105243_10120540 | Ga0105243_101205402 | 383 |
| 642 | 3300009148 | Ga0105243_10158622 | Ga0105243_101586222 | 383 |
| 643 | 3300009174 | Ga0105241_10004716 | Ga0105241_100047166 | 383 |
| 644 | 3300009174 | Ga0105241_10069834 | Ga0105241_100698342 | 383 |
| 645 | 3300009176 | Ga0105242_10011479 | Ga0105242_100114794 | 383 |
| 646 | 3300009176 | Ga0105242_10030183 | Ga0105242_100301833 | 383 |
| 647 | 3300009176 | Ga0105242_10049864 | Ga0105242_100498643 | 383 |
| 648 | 3300009176 | Ga0105242_10121374 | Ga0105242_101213742 | 383 |
| 649 | 3300009177 | Ga0105248_10000507 | Ga0105248_1000050713 | 383 |
| 650 | 3300009177 | Ga0105248_10007313 | Ga0105248_100073137 | 383 |
| 651 | 3300009177 | Ga0105248_10119810 | Ga0105248_101198102 | 383 |
| 652 | 3300009177 | Ga0105248_10160069 | Ga0105248_101600692 | 383 |
| 653 | 3300009545 | Ga0105237_10003214 | Ga0105237_1000321410 | 383 |
| 654 | 3300009545 | Ga0105237_10066737 | Ga0105237_100667373 | 383 |
| 655 | 3300009545 | Ga0105237_10181937 | Ga0105237_101819372 | 383 |
| 656 | 3300009545 | Ga0105237_10389713 | Ga0105237_103897131 | 383 |
| 657 | 3300009551 | Ga0105238_10000817 | Ga0105238_1000081724 | 383 |
| 658 | 3300009551 | Ga0105238_10018524 | Ga0105238_100185244 | 383 |
| 659 | 3300009551 | Ga0105238_10018739 | Ga0105238_100187394 | 383 |
| 660 | 3300009551 | Ga0105238_10083247 | Ga0105238_100832472 | 383 |
| 661 | 3300009551 | Ga0105238_10145997 | Ga0105238_101459972 | 383 |
| 662 | 3300009551 | Ga0105238_10180779 | Ga0105238_101807792 | 383 |
| 663 | 3300009553 | Ga0105249_10024640 | Ga0105249_100246402 | 383 |
| 664 | 3300009553 | Ga0105249_10099872 | Ga0105249_100998722 | 383 |
| 665 | 3300009553 | Ga0105249_10249714 | Ga0105249_102497142 | 383 |
| 666 | 3300010375 | Ga0105239_10003443 | Ga0105239_1000344310 | 383 |
| 667 | 3300010375 | Ga0105239_10024436 | Ga0105239_100244363 | 383 |
| 668 | 3300010375 | Ga0105239_10038542 | Ga0105239_100385422 | 383 |
| 669 | 3300010375 | Ga0105239_10051729 | Ga0105239_100517292 | 383 |
| 670 | 3300010375 | Ga0105239_10097148 | Ga0105239_100971482 | 383 |
| 671 | 3300011119 | Ga0105246_10057554 | Ga0105246_100575542 | 383 |
| 672 | 3300012497 | Ga0157319_1000008 | Ga0157319_1000008105 | 383 |
| 673 | 3300012502 | Ga0157347_1001428 | Ga0157347_10014282 | 383 |
| 674 | 3300013100 | Ga0157373_10004823 | Ga0157373_100048234 | 383 |
| 675 | 3300013100 | Ga0157373_10008907 | Ga0157373_100089073 | 383 |
| 676 | 3300013102 | Ga0157371_10007668 | Ga0157371_100076684 | 383 |
| 677 | 3300013104 | Ga0157370_10008735 | Ga0157370_100087352 | 383 |
| 678 | 3300013104 | Ga0157370_10032452 | Ga0157370_100324523 | 383 |
| 679 | 3300013104 | Ga0157370_10311775 | Ga0157370_103117752 | 383 |
| 680 | 3300013105 | Ga0157369_10007682 | Ga0157369_100076823 | 383 |
| 681 | 3300013105 | Ga0157369_10018375 | Ga0157369_100183754 | 383 |
| 682 | 3300013105 | Ga0157369_10021429 | Ga0157369_100214292 | 383 |
| 683 | 3300013105 | Ga0157369_10026832 | Ga0157369_100268324 | 383 |
| 684 | 3300013296 | Ga0157374_10000405 | Ga0157374_1000040512 | 383 |
| 685 | 3300013296 | Ga0157374_10020758 | Ga0157374_100207583 | 383 |
| 686 | 3300013296 | Ga0157374_10078208 | Ga0157374_100782082 | 383 |
| 687 | 3300013296 | Ga0157374_10167221 | Ga0157374_101672212 | 383 |
| 688 | 3300013297 | Ga0157378_10008627 | Ga0157378_100086272 | 383 |
| 689 | 3300013297 | Ga0157378_10087901 | Ga0157378_100879013 | 383 |
| 690 | 3300013306 | Ga0163162_10002118 | Ga0163162_100021184 | 383 |
| 691 | 3300013306 | Ga0163162_10004629 | Ga0163162_100046294 | 383 |
| 692 | 3300013306 | Ga0163162_10020602 | Ga0163162_100206024 | 383 |
| 693 | 3300013306 | Ga0163162_10026350 | Ga0163162_100263502 | 383 |
| 694 | 3300013306 | Ga0163162_10048256 | Ga0163162_100482562 | 383 |
| 695 | 3300013306 | Ga0163162_10100914 | Ga0163162_101009141 | 383 |
| 696 | 3300013306 | Ga0163162_10182405 | Ga0163162_101824053 | 383 |
| 697 | 3300013306 | Ga0163162_10219221 | Ga0163162_102192212 | 383 |
| 698 | 3300013307 | Ga0157372_10010109 | Ga0157372_100101096 | 383 |
| 699 | 3300013307 | Ga0157372_10015837 | Ga0157372_100158372 | 383 |
| 700 | 3300013307 | Ga0157372_10189038 | Ga0157372_101890382 | 383 |
| 701 | 3300013308 | Ga0157375_10007074 | Ga0157375_100070748 | 383 |
| 702 | 3300013308 | Ga0157375_10057331 | Ga0157375_100573312 | 383 |
| 703 | 3300014325 | Ga0163163_10020056 | Ga0163163_100200563 | 383 |
| 704 | 3300014326 | Ga0157380_10026083 | Ga0157380_100260832 | 383 |
| 705 | 3300014497 | Ga0182008_10013362 | Ga0182008_100133622 | 383 |
| 706 | 3300014745 | Ga0157377_10000075 | Ga0157377_1000007545 | 383 |
| 707 | 3300014968 | Ga0157379_10006796 | Ga0157379_100067963 | 383 |
| 708 | 3300014968 | Ga0157379_10012230 | Ga0157379_100122303 | 383 |
| 709 | 3300014968 | Ga0157379_10017154 | Ga0157379_100171545 | 383 |
| 710 | 3300014968 | Ga0157379_10154770 | Ga0157379_101547702 | 383 |
| 711 | 3300014969 | Ga0157376_10005741 | Ga0157376_100057413 | 383 |
| 712 | 3300014969 | Ga0157376_10067109 | Ga0157376_100671092 | 383 |
| 713 | 3300014969 | Ga0157376_10133207 | Ga0157376_101332072 | 383 |
| 714 | 3300014969 | Ga0157376_10198070 | Ga0157376_101980702 | 383 |
| 715 | 3300015262 | Ga0182007_10003324 | Ga0182007_100033244 | 383 |
| 716 | 3300015262 | Ga0182007_10003382 | Ga0182007_100033822 | 383 |
| 717 | 3300015265 | Ga0182005_1010533 | Ga0182005_10105332 | 383 |
| 718 | 3300015683 | Ga0183362_10003 | Ga0183362_10003884 | 383 |
| 719 | 3300017792 | Ga0163161_10003044 | Ga0163161_100030449 | 383 |
| 720 | 3300017792 | Ga0163161_10011045 | Ga0163161_100110453 | 383 |
| 721 | 3300017792 | Ga0163161_10017948 | Ga0163161_100179483 | 383 |
| 722 | 3300017792 | Ga0163161_10105089 | Ga0163161_101050892 | 383 |
| 723 | 3300021361 | Ga0213872_10000006 | Ga0213872_1000000668 | 383 |
| 724 | 3300021361 | Ga0213872_10000007 | Ga0213872_10000007185 | 383 |
| 725 | 3300021361 | Ga0213872_10000085 | Ga0213872_1000008512 | 383 |
| 726 | 3300021361 | Ga0213872_10011538 | Ga0213872_100115382 | 383 |
| 727 | 3300025206 | Ga0209435_100003 | Ga0209435_100003214 | 383 |
| 728 | 3300025224 | Ga0209784_100083 | Ga0209784_10008386 | 383 |
| 729 | 3300025225 | Ga0209566_100102 | Ga0209566_10010286 | 383 |
| 730 | 3300025226 | Ga0209674_100041 | Ga0209674_100041182 | 383 |
| 731 | 3300025226 | Ga0209674_100125 | Ga0209674_10012586 | 383 |
| 732 | 3300025228 | Ga0209672_100490 | Ga0209672_1004902 | 383 |
| 733 | 3300025229 | Ga0209147_103153 | Ga0209147_1031533 | 383 |
| 734 | 3300025230 | Ga0209563_100043 | Ga0209563_100043182 | 383 |
| 735 | 3300025230 | Ga0209563_100120 | Ga0209563_10012086 | 383 |
| 736 | 3300025231 | Ga0207427_100646 | Ga0207427_10064610 | 383 |
| 737 | 3300025242 | Ga0209258_100132 | Ga0209258_10013293 | 383 |
| 738 | 3300025242 | Ga0209258_100344 | Ga0209258_10034422 | 383 |
| 739 | 3300025242 | Ga0209258_100785 | Ga0209258_1007858 | 383 |
| 740 | 3300025245 | Ga0207425_1000797 | Ga0207425_10007973 | 383 |
| 741 | 3300025245 | Ga0207425_1007126 | Ga0207425_10071262 | 383 |
| 742 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008214 | 383 |
| 743 | 3300025246 | Ga0209646_1000069 | Ga0209646_1000069111 | 383 |
| 744 | 3300025246 | Ga0209646_1000723 | Ga0209646_10007236 | 383 |
| 745 | 3300025250 | Ga0209026_1000006 | Ga0209026_1000006206 | 383 |
| 746 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007214 | 383 |
| 747 | 3300025250 | Ga0209026_1003125 | Ga0209026_10031253 | 383 |
| 748 | 3300025253 | Ga0209677_100076 | Ga0209677_10007686 | 383 |
| 749 | 3300025253 | Ga0209677_100096 | Ga0209677_10009685 | 383 |
| 750 | 3300025253 | Ga0209677_101194 | Ga0209677_1011944 | 383 |
| 751 | 3300025253 | Ga0209677_101643 | Ga0209677_1016433 | 383 |
| 752 | 3300025254 | Ga0209148_1000007 | Ga0209148_10000071252 | 383 |
| 753 | 3300025256 | Ga0209759_1000026 | Ga0209759_100002666 | 383 |
| 754 | 3300025256 | Ga0209759_1000075 | Ga0209759_1000075111 | 383 |
| 755 | 3300025256 | Ga0209759_1001215 | Ga0209759_10012156 | 383 |
| 756 | 3300025256 | Ga0209759_1001295 | Ga0209759_10012958 | 383 |
| 757 | 3300025256 | Ga0209759_1017548 | Ga0209759_10175482 | 383 |
| 758 | 3300025258 | Ga0209129_1000012 | Ga0209129_1000012361 | 383 |
| 759 | 3300025258 | Ga0209129_1000084 | Ga0209129_100008439 | 383 |
| 760 | 3300025263 | Ga0209565_1000169 | Ga0209565_100016937 | 383 |
| 761 | 3300025263 | Ga0209565_1000932 | Ga0209565_100093212 | 383 |
| 762 | 3300025263 | Ga0209565_1001971 | Ga0209565_10019716 | 383 |
| 763 | 3300025263 | Ga0209565_1004734 | Ga0209565_10047343 | 383 |
| 764 | 3300025263 | Ga0209565_1008810 | Ga0209565_10088102 | 383 |
| 765 | 3300025272 | Ga0209455_1000242 | Ga0209455_100024237 | 383 |
| 766 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009438 | 383 |
| 767 | 3300025273 | Ga0209673_1000012 | Ga0209673_1000012339 | 383 |
| 768 | 3300025273 | Ga0209673_1000114 | Ga0209673_100011437 | 383 |
| 769 | 3300025273 | Ga0209673_1001414 | Ga0209673_10014143 | 383 |
| 770 | 3300025273 | Ga0209673_1003881 | Ga0209673_10038815 | 383 |
| 771 | 3300025273 | Ga0209673_1006922 | Ga0209673_10069222 | 383 |
| 772 | 3300025273 | Ga0209673_1010298 | Ga0209673_10102982 | 383 |
| 773 | 3300025273 | Ga0209673_1014476 | Ga0209673_10144762 | 383 |
| 774 | 3300025273 | Ga0209673_1020689 | Ga0209673_10206892 | 383 |
| 775 | 3300025284 | Ga0209130_1000064 | Ga0209130_100006454 | 383 |
| 776 | 3300025284 | Ga0209130_1000571 | Ga0209130_10005717 | 383 |
| 777 | 3300025284 | Ga0209130_1000712 | Ga0209130_10007126 | 383 |
| 778 | 3300025284 | Ga0209130_1002101 | Ga0209130_10021018 | 383 |
| 779 | 3300025284 | Ga0209130_1010938 | Ga0209130_10109382 | 383 |
| 780 | 3300025291 | Ga0209675_1000062 | Ga0209675_100006237 | 383 |
| 781 | 3300025291 | Ga0209675_1000144 | Ga0209675_10001443 | 383 |
| 782 | 3300025291 | Ga0209675_1001716 | Ga0209675_10017164 | 383 |
| 783 | 3300025291 | Ga0209675_1005868 | Ga0209675_10058682 | 383 |
| 784 | 3300025291 | Ga0209675_1006789 | Ga0209675_10067892 | 383 |
| 785 | 3300025292 | Ga0209676_1000051 | Ga0209676_1000051203 | 383 |
| 786 | 3300025292 | Ga0209676_1000415 | Ga0209676_10004154 | 383 |
| 787 | 3300025292 | Ga0209676_1006391 | Ga0209676_10063914 | 383 |
| 788 | 3300025294 | Ga0209025_1000719 | Ga0209025_100071951 | 383 |
| 789 | 3300025294 | Ga0209025_1000861 | Ga0209025_100086142 | 383 |
| 790 | 3300025294 | Ga0209025_1003734 | Ga0209025_10037346 | 383 |
| 791 | 3300025294 | Ga0209025_1004082 | Ga0209025_10040826 | 383 |
| 792 | 3300025294 | Ga0209025_1010095 | Ga0209025_10100953 | 383 |
| 793 | 3300025294 | Ga0209025_1021688 | Ga0209025_10216882 | 383 |
| 794 | 3300025294 | Ga0209025_1026809 | Ga0209025_10268093 | 383 |
| 795 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008630 | 383 |
| 796 | 3300025295 | Ga0209564_1000022 | Ga0209564_1000022153 | 383 |
| 797 | 3300025295 | Ga0209564_1000414 | Ga0209564_10004148 | 383 |
| 798 | 3300025295 | Ga0209564_1000613 | Ga0209564_10006138 | 383 |
| 799 | 3300025295 | Ga0209564_1002503 | Ga0209564_10025039 | 383 |
| 800 | 3300025295 | Ga0209564_1002535 | Ga0209564_10025358 | 383 |
| 801 | 3300025295 | Ga0209564_1007735 | Ga0209564_10077352 | 383 |
| 802 | 3300025297 | Ga0209758_1000099 | Ga0209758_100009996 | 383 |
| 803 | 3300025297 | Ga0209758_1002249 | Ga0209758_10022499 | 383 |
| 804 | 3300025297 | Ga0209758_1009725 | Ga0209758_10097253 | 383 |
| 805 | 3300025298 | Ga0209050_1000044 | Ga0209050_1000044143 | 383 |
| 806 | 3300025298 | Ga0209050_1000052 | Ga0209050_100005241 | 383 |
| 807 | 3300025298 | Ga0209050_1001274 | Ga0209050_10012742 | 383 |
| 808 | 3300025298 | Ga0209050_1001635 | Ga0209050_100163511 | 383 |
| 809 | 3300025298 | Ga0209050_1001761 | Ga0209050_100176112 | 383 |
| 810 | 3300025298 | Ga0209050_1001765 | Ga0209050_100176512 | 383 |
| 811 | 3300025298 | Ga0209050_1003656 | Ga0209050_100365610 | 383 |
| 812 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003593 | 383 |
| 813 | 3300025299 | Ga0209256_1000036 | Ga0209256_1000036218 | 383 |
| 814 | 3300025299 | Ga0209256_1000206 | Ga0209256_10002068 | 383 |
| 815 | 3300025299 | Ga0209256_1000239 | Ga0209256_100023939 | 383 |
| 816 | 3300025302 | Ga0207426_1000049 | Ga0207426_1000049144 | 383 |
| 817 | 3300025302 | Ga0207426_1000086 | Ga0207426_100008640 | 383 |
| 818 | 3300025302 | Ga0207426_1000116 | Ga0207426_100011631 | 383 |
| 819 | 3300025302 | Ga0207426_1000346 | Ga0207426_100034639 | 383 |
| 820 | 3300025302 | Ga0207426_1003514 | Ga0207426_10035146 | 383 |
| 821 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015487 | 383 |
| 822 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025282 | 383 |
| 823 | 3300025303 | Ga0209051_1000031 | Ga0209051_1000031143 | 383 |
| 824 | 3300025303 | Ga0209051_1000071 | Ga0209051_1000071169 | 383 |
| 825 | 3300025303 | Ga0209051_1000420 | Ga0209051_100042013 | 383 |
| 826 | 3300025303 | Ga0209051_1000492 | Ga0209051_100049223 | 383 |
| 827 | 3300025303 | Ga0209051_1000752 | Ga0209051_10007525 | 383 |
| 828 | 3300025303 | Ga0209051_1001081 | Ga0209051_100108113 | 383 |
| 829 | 3300025303 | Ga0209051_1001319 | Ga0209051_100131917 | 383 |
| 830 | 3300025303 | Ga0209051_1002112 | Ga0209051_10021128 | 383 |
| 831 | 3300025303 | Ga0209051_1007962 | Ga0209051_10079624 | 383 |
| 832 | 3300025303 | Ga0209051_1019510 | Ga0209051_10195102 | 383 |
| 833 | 3300025303 | Ga0209051_1026024 | Ga0209051_10260242 | 383 |
| 834 | 3300025304 | Ga0209257_1000033 | Ga0209257_1000033180 | 383 |
| 835 | 3300025304 | Ga0209257_1000037 | Ga0209257_1000037258 | 383 |
| 836 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039326 | 383 |
| 837 | 3300025304 | Ga0209257_1000058 | Ga0209257_1000058137 | 383 |
| 838 | 3300025304 | Ga0209257_1000367 | Ga0209257_100036712 | 383 |
| 839 | 3300025304 | Ga0209257_1000719 | Ga0209257_100071943 | 383 |
| 840 | 3300025304 | Ga0209257_1031541 | Ga0209257_10315411 | 383 |
| 841 | 3300025315 | Ga0207697_10000580 | Ga0207697_1000058011 | 383 |
| 842 | 3300025315 | Ga0207697_10004433 | Ga0207697_100044334 | 383 |
| 843 | 3300025321 | Ga0207656_10080061 | Ga0207656_100800612 | 383 |
| 844 | 3300025711 | Ga0207696_1001482 | Ga0207696_10014824 | 383 |
| 845 | 3300025728 | Ga0207655_1000477 | Ga0207655_100047737 | 383 |
| 846 | 3300025893 | Ga0207682_10000010 | Ga0207682_1000001063 | 383 |
| 847 | 3300025893 | Ga0207682_10002877 | Ga0207682_100028774 | 383 |
| 848 | 3300025893 | Ga0207682_10018734 | Ga0207682_100187342 | 383 |
| 849 | 3300025893 | Ga0207682_10020527 | Ga0207682_100205272 | 383 |
| 850 | 3300025901 | Ga0207688_10000541 | Ga0207688_100005416 | 383 |
| 851 | 3300025901 | Ga0207688_10147645 | Ga0207688_101476452 | 383 |
| 852 | 3300025903 | Ga0207680_10007194 | Ga0207680_100071943 | 383 |
| 853 | 3300025903 | Ga0207680_10017182 | Ga0207680_100171823 | 383 |
| 854 | 3300025903 | Ga0207680_10019704 | Ga0207680_100197043 | 383 |
| 855 | 3300025905 | Ga0207685_10008993 | Ga0207685_100089932 | 383 |
| 856 | 3300025906 | Ga0207699_10106162 | Ga0207699_101061622 | 383 |
| 857 | 3300025907 | Ga0207645_10001138 | Ga0207645_1000113815 | 383 |
| 858 | 3300025907 | Ga0207645_10002795 | Ga0207645_100027958 | 383 |
| 859 | 3300025907 | Ga0207645_10010204 | Ga0207645_100102043 | 383 |
| 860 | 3300025907 | Ga0207645_10020426 | Ga0207645_100204262 | 383 |
| 861 | 3300025907 | Ga0207645_10041651 | Ga0207645_100416512 | 383 |
| 862 | 3300025907 | Ga0207645_10074755 | Ga0207645_100747552 | 383 |
| 863 | 3300025908 | Ga0207643_10000358 | Ga0207643_1000035815 | 383 |
| 864 | 3300025908 | Ga0207643_10045783 | Ga0207643_100457832 | 383 |
| 865 | 3300025909 | Ga0207705_10046815 | Ga0207705_100468152 | 383 |
| 866 | 3300025909 | Ga0207705_10062003 | Ga0207705_100620033 | 383 |
| 867 | 3300025910 | Ga0207684_10003773 | Ga0207684_100037738 | 383 |
| 868 | 3300025911 | Ga0207654_10014797 | Ga0207654_100147973 | 383 |
| 869 | 3300025912 | Ga0207707_10032526 | Ga0207707_100325264 | 383 |
| 870 | 3300025912 | Ga0207707_10050800 | Ga0207707_100508002 | 383 |
| 871 | 3300025912 | Ga0207707_10069151 | Ga0207707_100691512 | 383 |
| 872 | 3300025912 | Ga0207707_10220456 | Ga0207707_102204562 | 383 |
| 873 | 3300025913 | Ga0207695_10013680 | Ga0207695_100136802 | 383 |
| 874 | 3300025913 | Ga0207695_10080597 | Ga0207695_100805972 | 383 |
| 875 | 3300025913 | Ga0207695_10121591 | Ga0207695_101215912 | 383 |
| 876 | 3300025913 | Ga0207695_10184912 | Ga0207695_101849122 | 383 |
| 877 | 3300025914 | Ga0207671_10002520 | Ga0207671_100025209 | 383 |
| 878 | 3300025914 | Ga0207671_10017480 | Ga0207671_100174803 | 383 |
| 879 | 3300025915 | Ga0207693_10002709 | Ga0207693_1000270910 | 383 |
| 880 | 3300025915 | Ga0207693_10156306 | Ga0207693_101563062 | 383 |
| 881 | 3300025917 | Ga0207660_10120102 | Ga0207660_101201022 | 383 |
| 882 | 3300025918 | Ga0207662_10012419 | Ga0207662_100124193 | 383 |
| 883 | 3300025919 | Ga0207657_10000329 | Ga0207657_1000032919 | 383 |
| 884 | 3300025919 | Ga0207657_10003889 | Ga0207657_100038893 | 383 |
| 885 | 3300025919 | Ga0207657_10029367 | Ga0207657_100293675 | 383 |
| 886 | 3300025919 | Ga0207657_10041771 | Ga0207657_100417712 | 383 |
| 887 | 3300025919 | Ga0207657_10069270 | Ga0207657_100692703 | 383 |
| 888 | 3300025919 | Ga0207657_10103581 | Ga0207657_101035813 | 383 |
| 889 | 3300025919 | Ga0207657_10140586 | Ga0207657_101405862 | 383 |
| 890 | 3300025920 | Ga0207649_10003489 | Ga0207649_100034893 | 383 |
| 891 | 3300025920 | Ga0207649_10040363 | Ga0207649_100403632 | 383 |
| 892 | 3300025921 | Ga0207652_10083435 | Ga0207652_100834351 | 383 |
| 893 | 3300025921 | Ga0207652_10140993 | Ga0207652_101409932 | 383 |
| 894 | 3300025921 | Ga0207652_10143688 | Ga0207652_101436882 | 383 |
| 895 | 3300025923 | Ga0207681_10000593 | Ga0207681_100005939 | 383 |
| 896 | 3300025923 | Ga0207681_10003975 | Ga0207681_100039754 | 383 |
| 897 | 3300025923 | Ga0207681_10005852 | Ga0207681_100058523 | 383 |
| 898 | 3300025923 | Ga0207681_10011148 | Ga0207681_100111483 | 383 |
| 899 | 3300025923 | Ga0207681_10023399 | Ga0207681_100233992 | 383 |
| 900 | 3300025923 | Ga0207681_10050755 | Ga0207681_100507552 | 383 |
| 901 | 3300025923 | Ga0207681_10193381 | Ga0207681_101933812 | 383 |
| 902 | 3300025924 | Ga0207694_10001061 | Ga0207694_100010613 | 383 |
| 903 | 3300025924 | Ga0207694_10001640 | Ga0207694_100016402 | 383 |
| 904 | 3300025924 | Ga0207694_10015585 | Ga0207694_100155854 | 383 |
| 905 | 3300025924 | Ga0207694_10053926 | Ga0207694_100539262 | 383 |
| 906 | 3300025924 | Ga0207694_10112853 | Ga0207694_101128531 | 383 |
| 907 | 3300025924 | Ga0207694_10305178 | Ga0207694_103051781 | 383 |
| 908 | 3300025925 | Ga0207650_10001551 | Ga0207650_100015514 | 383 |
| 909 | 3300025925 | Ga0207650_10002902 | Ga0207650_100029023 | 383 |
| 910 | 3300025925 | Ga0207650_10046033 | Ga0207650_100460332 | 383 |
| 911 | 3300025925 | Ga0207650_10058264 | Ga0207650_100582642 | 383 |
| 912 | 3300025925 | Ga0207650_10059741 | Ga0207650_100597412 | 383 |
| 913 | 3300025925 | Ga0207650_10071603 | Ga0207650_100716032 | 383 |
| 914 | 3300025925 | Ga0207650_10136531 | Ga0207650_101365312 | 383 |
| 915 | 3300025926 | Ga0207659_10001370 | Ga0207659_100013704 | 383 |
| 916 | 3300025926 | Ga0207659_10002674 | Ga0207659_100026742 | 383 |
| 917 | 3300025926 | Ga0207659_10008500 | Ga0207659_100085002 | 383 |
| 918 | 3300025926 | Ga0207659_10010170 | Ga0207659_100101704 | 383 |
| 919 | 3300025926 | Ga0207659_10027013 | Ga0207659_100270132 | 383 |
| 920 | 3300025926 | Ga0207659_10082147 | Ga0207659_100821472 | 383 |
| 921 | 3300025926 | Ga0207659_10084837 | Ga0207659_100848372 | 383 |
| 922 | 3300025926 | Ga0207659_10102409 | Ga0207659_101024092 | 383 |
| 923 | 3300025927 | Ga0207687_10011753 | Ga0207687_100117533 | 383 |
| 924 | 3300025927 | Ga0207687_10040982 | Ga0207687_100409822 | 383 |
| 925 | 3300025928 | Ga0207700_10001214 | Ga0207700_100012144 | 383 |
| 926 | 3300025928 | Ga0207700_10004270 | Ga0207700_100042702 | 383 |
| 927 | 3300025928 | Ga0207700_10237960 | Ga0207700_102379602 | 383 |
| 928 | 3300025929 | Ga0207664_10014950 | Ga0207664_100149503 | 383 |
| 929 | 3300025929 | Ga0207664_10085161 | Ga0207664_100851612 | 383 |
| 930 | 3300025931 | Ga0207644_10001724 | Ga0207644_100017248 | 383 |
| 931 | 3300025931 | Ga0207644_10002626 | Ga0207644_1000262611 | 383 |
| 932 | 3300025931 | Ga0207644_10004468 | Ga0207644_100044685 | 383 |
| 933 | 3300025931 | Ga0207644_10006053 | Ga0207644_100060534 | 383 |
| 934 | 3300025931 | Ga0207644_10011045 | Ga0207644_100110453 | 383 |
| 935 | 3300025931 | Ga0207644_10018741 | Ga0207644_100187412 | 383 |
| 936 | 3300025931 | Ga0207644_10022596 | Ga0207644_100225963 | 383 |
| 937 | 3300025931 | Ga0207644_10023348 | Ga0207644_100233483 | 383 |
| 938 | 3300025931 | Ga0207644_10049843 | Ga0207644_100498432 | 383 |
| 939 | 3300025931 | Ga0207644_10092516 | Ga0207644_100925161 | 383 |
| 940 | 3300025932 | Ga0207690_10005743 | Ga0207690_100057432 | 383 |
| 941 | 3300025932 | Ga0207690_10012599 | Ga0207690_100125993 | 383 |
| 942 | 3300025932 | Ga0207690_10014780 | Ga0207690_100147802 | 383 |
| 943 | 3300025932 | Ga0207690_10169038 | Ga0207690_101690381 | 383 |
| 944 | 3300025932 | Ga0207690_10187930 | Ga0207690_101879302 | 383 |
| 945 | 3300025933 | Ga0207706_10000133 | Ga0207706_1000013368 | 383 |
| 946 | 3300025933 | Ga0207706_10007037 | Ga0207706_100070374 | 383 |
| 947 | 3300025933 | Ga0207706_10008413 | Ga0207706_100084137 | 383 |
| 948 | 3300025933 | Ga0207706_10086080 | Ga0207706_100860802 | 383 |
| 949 | 3300025934 | Ga0207686_10000211 | Ga0207686_100002119 | 383 |
| 950 | 3300025934 | Ga0207686_10002504 | Ga0207686_100025041 | 383 |
| 951 | 3300025934 | Ga0207686_10095325 | Ga0207686_100953252 | 383 |
| 952 | 3300025934 | Ga0207686_10148630 | Ga0207686_101486302 | 383 |
| 953 | 3300025935 | Ga0207709_10000167 | Ga0207709_1000016725 | 383 |
| 954 | 3300025935 | Ga0207709_10000625 | Ga0207709_1000062513 | 383 |
| 955 | 3300025935 | Ga0207709_10002678 | Ga0207709_100026784 | 383 |
| 956 | 3300025935 | Ga0207709_10003407 | Ga0207709_100034073 | 383 |
| 957 | 3300025935 | Ga0207709_10078818 | Ga0207709_100788182 | 383 |
| 958 | 3300025935 | Ga0207709_10115924 | Ga0207709_101159242 | 383 |
| 959 | 3300025936 | Ga0207670_10012185 | Ga0207670_100121853 | 383 |
| 960 | 3300025936 | Ga0207670_10035827 | Ga0207670_100358272 | 383 |
| 961 | 3300025937 | Ga0207669_10008328 | Ga0207669_100083284 | 383 |
| 962 | 3300025937 | Ga0207669_10064387 | Ga0207669_100643872 | 383 |
| 963 | 3300025938 | Ga0207704_10008529 | Ga0207704_100085292 | 383 |
| 964 | 3300025938 | Ga0207704_10012485 | Ga0207704_100124852 | 383 |
| 965 | 3300025938 | Ga0207704_10029819 | Ga0207704_100298192 | 383 |
| 966 | 3300025939 | Ga0207665_10054137 | Ga0207665_100541372 | 383 |
| 967 | 3300025940 | Ga0207691_10000027 | Ga0207691_1000002711 | 383 |
| 968 | 3300025940 | Ga0207691_10001454 | Ga0207691_1000145423 | 383 |
| 969 | 3300025940 | Ga0207691_10001835 | Ga0207691_100018357 | 383 |
| 970 | 3300025940 | Ga0207691_10002573 | Ga0207691_100025735 | 383 |
| 971 | 3300025940 | Ga0207691_10002901 | Ga0207691_100029018 | 383 |
| 972 | 3300025940 | Ga0207691_10007782 | Ga0207691_100077829 | 383 |
| 973 | 3300025940 | Ga0207691_10020289 | Ga0207691_100202893 | 383 |
| 974 | 3300025940 | Ga0207691_10057597 | Ga0207691_100575972 | 383 |
| 975 | 3300025940 | Ga0207691_10145691 | Ga0207691_101456912 | 383 |
| 976 | 3300025941 | Ga0207711_10000116 | Ga0207711_1000011628 | 383 |
| 977 | 3300025941 | Ga0207711_10008341 | Ga0207711_100083413 | 383 |
| 978 | 3300025941 | Ga0207711_10053069 | Ga0207711_100530692 | 383 |
| 979 | 3300025941 | Ga0207711_10082785 | Ga0207711_100827852 | 383 |
| 980 | 3300025941 | Ga0207711_10114324 | Ga0207711_101143242 | 383 |
| 981 | 3300025941 | Ga0207711_10164693 | Ga0207711_101646933 | 383 |
| 982 | 3300025941 | Ga0207711_10259025 | Ga0207711_102590251 | 383 |
| 983 | 3300025942 | Ga0207689_10003361 | Ga0207689_1000336111 | 383 |
| 984 | 3300025942 | Ga0207689_10017399 | Ga0207689_100173992 | 383 |
| 985 | 3300025942 | Ga0207689_10018716 | Ga0207689_100187163 | 383 |
| 986 | 3300025942 | Ga0207689_10028908 | Ga0207689_100289083 | 383 |
| 987 | 3300025942 | Ga0207689_10039845 | Ga0207689_100398452 | 383 |
| 988 | 3300025942 | Ga0207689_10074386 | Ga0207689_100743862 | 383 |
| 989 | 3300025944 | Ga0207661_10006951 | Ga0207661_100069513 | 383 |
| 990 | 3300025944 | Ga0207661_10107900 | Ga0207661_101079002 | 383 |
| 991 | 3300025944 | Ga0207661_10185692 | Ga0207661_101856921 | 383 |
| 992 | 3300025945 | Ga0207679_10004476 | Ga0207679_100044767 | 383 |
| 993 | 3300025945 | Ga0207679_10016114 | Ga0207679_100161143 | 383 |
| 994 | 3300025945 | Ga0207679_10037529 | Ga0207679_100375292 | 383 |
| 995 | 3300025945 | Ga0207679_10038046 | Ga0207679_100380462 | 383 |
| 996 | 3300025945 | Ga0207679_10045174 | Ga0207679_100451742 | 383 |
| 997 | 3300025945 | Ga0207679_10085817 | Ga0207679_100858172 | 383 |
| 998 | 3300025949 | Ga0207667_10001197 | Ga0207667_1000119710 | 383 |
| 999 | 3300025949 | Ga0207667_10015903 | Ga0207667_100159034 | 383 |
| 1000 | 3300025949 | Ga0207667_10027706 | Ga0207667_100277063 | 383 |
| 1001 | 3300025949 | Ga0207667_10044540 | Ga0207667_100445402 | 383 |
| 1002 | 3300025949 | Ga0207667_10050611 | Ga0207667_100506112 | 383 |
| 1003 | 3300025949 | Ga0207667_10056478 | Ga0207667_100564783 | 383 |
| 1004 | 3300025949 | Ga0207667_10060239 | Ga0207667_100602394 | 383 |
| 1005 | 3300025949 | Ga0207667_10093968 | Ga0207667_100939682 | 383 |
| 1006 | 3300025949 | Ga0207667_10127343 | Ga0207667_101273432 | 383 |
| 1007 | 3300025949 | Ga0207667_10176472 | Ga0207667_101764722 | 383 |
| 1008 | 3300025949 | Ga0207667_10189509 | Ga0207667_101895092 | 383 |
| 1009 | 3300025960 | Ga0207651_10023081 | Ga0207651_100230812 | 383 |
| 1010 | 3300025960 | Ga0207651_10028463 | Ga0207651_100284634 | 383 |
| 1011 | 3300025960 | Ga0207651_10113559 | Ga0207651_101135591 | 383 |
| 1012 | 3300025961 | Ga0207712_10002369 | Ga0207712_100023696 | 383 |
| 1013 | 3300025961 | Ga0207712_10091176 | Ga0207712_100911762 | 383 |
| 1014 | 3300025972 | Ga0207668_10014276 | Ga0207668_100142762 | 383 |
| 1015 | 3300025972 | Ga0207668_10109124 | Ga0207668_101091242 | 383 |
| 1016 | 3300025981 | Ga0207640_10002943 | Ga0207640_100029436 | 383 |
| 1017 | 3300025981 | Ga0207640_10028299 | Ga0207640_100282993 | 383 |
| 1018 | 3300025981 | Ga0207640_10042960 | Ga0207640_100429602 | 383 |
| 1019 | 3300025986 | Ga0207658_10002879 | Ga0207658_100028796 | 383 |
| 1020 | 3300025986 | Ga0207658_10018099 | Ga0207658_100180992 | 383 |
| 1021 | 3300025986 | Ga0207658_10025597 | Ga0207658_100255972 | 383 |
| 1022 | 3300025986 | Ga0207658_10029188 | Ga0207658_100291882 | 383 |
| 1023 | 3300026023 | Ga0207677_10000188 | Ga0207677_100001884 | 383 |
| 1024 | 3300026023 | Ga0207677_10002710 | Ga0207677_100027105 | 383 |
| 1025 | 3300026023 | Ga0207677_10002992 | Ga0207677_100029924 | 383 |
| 1026 | 3300026023 | Ga0207677_10009054 | Ga0207677_100090543 | 383 |
| 1027 | 3300026023 | Ga0207677_10029670 | Ga0207677_100296703 | 383 |
| 1028 | 3300026023 | Ga0207677_10032646 | Ga0207677_100326461 | 383 |
| 1029 | 3300026023 | Ga0207677_10040742 | Ga0207677_100407422 | 383 |
| 1030 | 3300026035 | Ga0207703_10000806 | Ga0207703_100008064 | 383 |
| 1031 | 3300026035 | Ga0207703_10003131 | Ga0207703_100031312 | 383 |
| 1032 | 3300026035 | Ga0207703_10005198 | Ga0207703_100051989 | 383 |
| 1033 | 3300026035 | Ga0207703_10031777 | Ga0207703_100317772 | 383 |
| 1034 | 3300026035 | Ga0207703_10058280 | Ga0207703_100582802 | 383 |
| 1035 | 3300026035 | Ga0207703_10114082 | Ga0207703_101140821 | 383 |
| 1036 | 3300026035 | Ga0207703_10137353 | Ga0207703_101373532 | 383 |
| 1037 | 3300026041 | Ga0207639_10007106 | Ga0207639_100071066 | 383 |
| 1038 | 3300026041 | Ga0207639_10026653 | Ga0207639_100266533 | 383 |
| 1039 | 3300026041 | Ga0207639_10273666 | Ga0207639_102736661 | 383 |
| 1040 | 3300026067 | Ga0207678_10001503 | Ga0207678_1000150311 | 383 |
| 1041 | 3300026067 | Ga0207678_10002200 | Ga0207678_100022005 | 383 |
| 1042 | 3300026067 | Ga0207678_10005364 | Ga0207678_100053649 | 383 |
| 1043 | 3300026067 | Ga0207678_10149293 | Ga0207678_101492932 | 383 |
| 1044 | 3300026075 | Ga0207708_10002089 | Ga0207708_100020898 | 383 |
| 1045 | 3300026075 | Ga0207708_10038327 | Ga0207708_100383272 | 383 |
| 1046 | 3300026075 | Ga0207708_10054734 | Ga0207708_100547342 | 383 |
| 1047 | 3300026078 | Ga0207702_10000305 | Ga0207702_100003059 | 383 |
| 1048 | 3300026078 | Ga0207702_10054890 | Ga0207702_100548902 | 383 |
| 1049 | 3300026078 | Ga0207702_10125097 | Ga0207702_101250972 | 383 |
| 1050 | 3300026078 | Ga0207702_10245474 | Ga0207702_102454741 | 383 |
| 1051 | 3300026088 | Ga0207641_10006528 | Ga0207641_100065289 | 383 |
| 1052 | 3300026088 | Ga0207641_10009569 | Ga0207641_100095693 | 383 |
| 1053 | 3300026088 | Ga0207641_10024259 | Ga0207641_100242592 | 383 |
| 1054 | 3300026088 | Ga0207641_10033560 | Ga0207641_100335602 | 383 |
| 1055 | 3300026088 | Ga0207641_10034850 | Ga0207641_100348502 | 383 |
| 1056 | 3300026088 | Ga0207641_10038820 | Ga0207641_100388202 | 383 |
| 1057 | 3300026088 | Ga0207641_10051462 | Ga0207641_100514622 | 383 |
| 1058 | 3300026088 | Ga0207641_10054343 | Ga0207641_100543433 | 383 |
| 1059 | 3300026088 | Ga0207641_10135260 | Ga0207641_101352601 | 383 |
| 1060 | 3300026089 | Ga0207648_10000286 | Ga0207648_1000028615 | 383 |
| 1061 | 3300026089 | Ga0207648_10000878 | Ga0207648_1000087825 | 383 |
| 1062 | 3300026089 | Ga0207648_10002947 | Ga0207648_1000294715 | 383 |
| 1063 | 3300026089 | Ga0207648_10008332 | Ga0207648_100083322 | 383 |
| 1064 | 3300026089 | Ga0207648_10051982 | Ga0207648_100519823 | 383 |
| 1065 | 3300026089 | Ga0207648_10166579 | Ga0207648_101665792 | 383 |
| 1066 | 3300026095 | Ga0207676_10000230 | Ga0207676_1000023041 | 383 |
| 1067 | 3300026095 | Ga0207676_10003281 | Ga0207676_100032814 | 383 |
| 1068 | 3300026095 | Ga0207676_10004989 | Ga0207676_100049894 | 383 |
| 1069 | 3300026095 | Ga0207676_10012098 | Ga0207676_100120983 | 383 |
| 1070 | 3300026095 | Ga0207676_10017798 | Ga0207676_100177982 | 383 |
| 1071 | 3300026095 | Ga0207676_10036862 | Ga0207676_100368623 | 383 |
| 1072 | 3300026095 | Ga0207676_10041475 | Ga0207676_100414751 | 383 |
| 1073 | 3300026095 | Ga0207676_10082562 | Ga0207676_100825622 | 383 |
| 1074 | 3300026095 | Ga0207676_10230458 | Ga0207676_102304582 | 383 |
| 1075 | 3300026116 | Ga0207674_10000182 | Ga0207674_1000018267 | 383 |
| 1076 | 3300026116 | Ga0207674_10001017 | Ga0207674_100010179 | 383 |
| 1077 | 3300026116 | Ga0207674_10001136 | Ga0207674_1000113611 | 383 |
| 1078 | 3300026116 | Ga0207674_10006862 | Ga0207674_100068621 | 383 |
| 1079 | 3300026116 | Ga0207674_10034160 | Ga0207674_100341603 | 383 |
| 1080 | 3300026116 | Ga0207674_10053331 | Ga0207674_100533313 | 383 |
| 1081 | 3300026116 | Ga0207674_10160967 | Ga0207674_101609672 | 383 |
| 1082 | 3300026116 | Ga0207674_10224317 | Ga0207674_102243172 | 383 |
| 1083 | 3300026118 | Ga0207675_100001247 | Ga0207675_1000012477 | 383 |
| 1084 | 3300026118 | Ga0207675_100001372 | Ga0207675_10000137223 | 383 |
| 1085 | 3300026118 | Ga0207675_100001900 | Ga0207675_10000190013 | 383 |
| 1086 | 3300026118 | Ga0207675_100008217 | Ga0207675_1000082172 | 383 |
| 1087 | 3300026121 | Ga0207683_10000285 | Ga0207683_1000028512 | 383 |
| 1088 | 3300026121 | Ga0207683_10000364 | Ga0207683_1000036428 | 383 |
| 1089 | 3300026121 | Ga0207683_10004747 | Ga0207683_100047474 | 383 |
| 1090 | 3300026121 | Ga0207683_10013264 | Ga0207683_100132644 | 383 |
| 1091 | 3300026121 | Ga0207683_10013981 | Ga0207683_100139813 | 383 |
| 1092 | 3300026121 | Ga0207683_10020604 | Ga0207683_100206042 | 383 |
| 1093 | 3300026121 | Ga0207683_10120473 | Ga0207683_101204732 | 383 |
| 1094 | 3300026121 | Ga0207683_10128511 | Ga0207683_101285112 | 383 |
| 1095 | 3300026142 | Ga0207698_10003503 | Ga0207698_100035036 | 383 |
| 1096 | 3300026142 | Ga0207698_10013855 | Ga0207698_100138553 | 383 |
| 1097 | 3300026142 | Ga0207698_10041103 | Ga0207698_100411033 | 383 |
| 1098 | 3300026142 | Ga0207698_10062786 | Ga0207698_100627862 | 383 |
| 1099 | 3300026142 | Ga0207698_10132975 | Ga0207698_101329752 | 383 |
| 1100 | 3300026142 | Ga0207698_10208567 | Ga0207698_102085672 | 383 |
| 1101 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002818 | 383 |
| 1102 | 3300027111 | Ga0209281_1000259 | Ga0209281_100025940 | 383 |
| 1103 | 3300027296 | Ga0209389_1006219 | Ga0209389_10062198 | 383 |
| 1104 | 3300027312 | Ga0209371_1014178 | Ga0209371_10141782 | 383 |
| 1105 | 3300027395 | Ga0209996_1005277 | Ga0209996_10052772 | 383 |
| 1106 | 3300027666 | Ga0209282_1000317 | Ga0209282_10003174 | 383 |
| 1107 | 3300027682 | Ga0209971_1001210 | Ga0209971_10012102 | 383 |
| 1108 | 3300027695 | Ga0209966_1000035 | Ga0209966_100003517 | 383 |
| 1109 | 3300027717 | Ga0209998_10001388 | Ga0209998_100013882 | 383 |
| 1110 | 3300027866 | Ga0209813_10014738 | Ga0209813_100147382 | 383 |
| 1111 | 3300027866 | Ga0209813_10018634 | Ga0209813_100186342 | 383 |
| 1112 | 3300027876 | Ga0209974_10004147 | Ga0209974_100041472 | 383 |
| 1113 | 3300027876 | Ga0209974_10019845 | Ga0209974_100198452 | 383 |
| 1114 | 3300027907 | Ga0207428_10045043 | Ga0207428_100450432 | 383 |
| 1115 | 3300028379 | Ga0268266_10008958 | Ga0268266_100089584 | 383 |
| 1116 | 3300028379 | Ga0268266_10020764 | Ga0268266_100207643 | 383 |
| 1117 | 3300028379 | Ga0268266_10023758 | Ga0268266_100237582 | 383 |
| 1118 | 3300028379 | Ga0268266_10043406 | Ga0268266_100434063 | 383 |
| 1119 | 3300028379 | Ga0268266_10159448 | Ga0268266_101594482 | 383 |
| 1120 | 3300028379 | Ga0268266_10322131 | Ga0268266_103221312 | 383 |
| 1121 | 3300028380 | Ga0268265_10046444 | Ga0268265_100464442 | 383 |
| 1122 | 3300028380 | Ga0268265_10047325 | Ga0268265_100473252 | 383 |
| 1123 | 3300028380 | Ga0268265_10082425 | Ga0268265_100824252 | 383 |
| 1124 | 3300028380 | Ga0268265_10152394 | Ga0268265_101523942 | 383 |
| 1125 | 3300028380 | Ga0268265_10274078 | Ga0268265_102740781 | 383 |
| 1126 | 3300028381 | Ga0268264_10000991 | Ga0268264_1000099116 | 383 |
| 1127 | 3300028381 | Ga0268264_10004628 | Ga0268264_100046288 | 383 |
| 1128 | 3300028381 | Ga0268264_10010909 | Ga0268264_100109093 | 383 |
| 1129 | 3300028381 | Ga0268264_10021947 | Ga0268264_100219473 | 383 |
| 1130 | 3300028381 | Ga0268264_10025537 | Ga0268264_100255372 | 383 |
| 1131 | 3300028381 | Ga0268264_10037013 | Ga0268264_100370133 | 383 |
| 1132 | 3300028381 | Ga0268264_10064516 | Ga0268264_100645162 | 383 |
| 1133 | 3300028381 | Ga0268264_10103146 | Ga0268264_101031462 | 383 |
| 1134 | 3300028381 | Ga0268264_10105798 | Ga0268264_101057982 | 383 |
| 1135 | 3300028381 | Ga0268264_10174016 | Ga0268264_101740162 | 383 |
| 1136 | 3300028666 | Ga0265336_10000013 | Ga0265336_10000013173 | 383 |
| 1137 | 3300028786 | Ga0307517_10000131 | Ga0307517_1000013131 | 383 |
| 1138 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011242 | 383 |
| 1139 | 3300028794 | Ga0307515_10000278 | Ga0307515_1000027872 | 383 |
| 1140 | 3300028794 | Ga0307515_10006352 | Ga0307515_1000635215 | 383 |
| 1141 | 3300028794 | Ga0307515_10011457 | Ga0307515_100114574 | 383 |
| 1142 | 3300028794 | Ga0307515_10021920 | Ga0307515_100219202 | 383 |
| 1143 | 3300028794 | Ga0307515_10028588 | Ga0307515_100285883 | 383 |
| 1144 | 3300028794 | Ga0307515_10031517 | Ga0307515_100315175 | 383 |
| 1145 | 3300028794 | Ga0307515_10090935 | Ga0307515_100909352 | 383 |
| 1146 | 3300028794 | Ga0307515_10164629 | Ga0307515_101646292 | 383 |
| 1147 | 3300028794 | Ga0307515_10251319 | Ga0307515_102513192 | 383 |
| 1148 | 3300029957 | Ga0265324_10000193 | Ga0265324_1000019330 | 383 |
| 1149 | 3300029957 | Ga0265324_10004037 | Ga0265324_100040373 | 383 |
| 1150 | 3300030500 | Ga0268256_1007804 | Ga0268256_10078043 | 383 |
| 1151 | 3300030521 | Ga0307511_10000005 | Ga0307511_1000000575 | 383 |
| 1152 | 3300030735 | Ga0316178_1005545 | Ga0316178_10055453 | 383 |
| 1153 | 3300030736 | Ga0316180_1104723 | Ga0316180_11047232 | 383 |
| 1154 | 3300031235 | Ga0265330_10000453 | Ga0265330_1000045312 | 383 |
| 1155 | 3300031235 | Ga0265330_10020098 | Ga0265330_100200982 | 383 |
| 1156 | 3300031238 | Ga0265332_10000012 | Ga0265332_10000012245 | 383 |
| 1157 | 3300031238 | Ga0265332_10001062 | Ga0265332_100010627 | 383 |
| 1158 | 3300031239 | Ga0265328_10011609 | Ga0265328_100116092 | 383 |
| 1159 | 3300031241 | Ga0265325_10001423 | Ga0265325_100014238 | 383 |
| 1160 | 3300031241 | Ga0265325_10007863 | Ga0265325_100078632 | 383 |
| 1161 | 3300031241 | Ga0265325_10022015 | Ga0265325_100220152 | 383 |
| 1162 | 3300031250 | Ga0265331_10001106 | Ga0265331_1000110611 | 383 |
| 1163 | 3300031251 | Ga0265327_10004111 | Ga0265327_1000411110 | 383 |
| 1164 | 3300031251 | Ga0265327_10005562 | Ga0265327_100055624 | 383 |
| 1165 | 3300031251 | Ga0265327_10005649 | Ga0265327_100056494 | 383 |
| 1166 | 3300031344 | Ga0265316_10000163 | Ga0265316_1000016328 | 383 |
| 1167 | 3300031456 | Ga0307513_10000008 | Ga0307513_10000008205 | 383 |
| 1168 | 3300031456 | Ga0307513_10000441 | Ga0307513_1000044117 | 383 |
| 1169 | 3300031456 | Ga0307513_10012177 | Ga0307513_100121777 | 383 |
| 1170 | 3300031456 | Ga0307513_10019501 | Ga0307513_100195011 | 383 |
| 1171 | 3300031456 | Ga0307513_10113375 | Ga0307513_101133752 | 383 |
| 1172 | 3300031456 | Ga0307513_10124753 | Ga0307513_101247532 | 383 |
| 1173 | 3300031456 | Ga0307513_10172706 | Ga0307513_101727062 | 383 |
| 1174 | 3300031456 | Ga0307513_10186640 | Ga0307513_101866402 | 383 |
| 1175 | 3300031507 | Ga0307509_10000871 | Ga0307509_1000087146 | 383 |
| 1176 | 3300031507 | Ga0307509_10016221 | Ga0307509_100162213 | 383 |
| 1177 | 3300031507 | Ga0307509_10165755 | Ga0307509_101657552 | 383 |
| 1178 | 3300031548 | Ga0307408_100000037 | Ga0307408_100000037110 | 383 |
| 1179 | 3300031548 | Ga0307408_100000274 | Ga0307408_10000027431 | 383 |
| 1180 | 3300031548 | Ga0307408_100005562 | Ga0307408_1000055626 | 383 |
| 1181 | 3300031548 | Ga0307408_100014029 | Ga0307408_1000140293 | 383 |
| 1182 | 3300031548 | Ga0307408_100043906 | Ga0307408_1000439062 | 383 |
| 1183 | 3300031548 | Ga0307408_100146028 | Ga0307408_1001460282 | 383 |
| 1184 | 3300031548 | Ga0307408_100158686 | Ga0307408_1001586862 | 383 |
| 1185 | 3300031616 | Ga0307508_10000271 | Ga0307508_100002714 | 383 |
| 1186 | 3300031616 | Ga0307508_10000349 | Ga0307508_1000034924 | 383 |
| 1187 | 3300031616 | Ga0307508_10262896 | Ga0307508_102628961 | 383 |
| 1188 | 3300031649 | Ga0307514_10000355 | Ga0307514_1000035559 | 383 |
| 1189 | 3300031649 | Ga0307514_10000694 | Ga0307514_1000069449 | 383 |
| 1190 | 3300031649 | Ga0307514_10011790 | Ga0307514_100117907 | 383 |
| 1191 | 3300031711 | Ga0265314_10000029 | Ga0265314_1000002912 | 383 |
| 1192 | 3300031711 | Ga0265314_10003171 | Ga0265314_100031718 | 383 |
| 1193 | 3300031711 | Ga0265314_10014048 | Ga0265314_100140483 | 383 |
| 1194 | 3300031711 | Ga0265314_10046085 | Ga0265314_100460852 | 383 |
| 1195 | 3300031712 | Ga0265342_10004652 | Ga0265342_100046525 | 383 |
| 1196 | 3300031712 | Ga0265342_10013416 | Ga0265342_100134164 | 383 |
| 1197 | 3300031730 | Ga0307516_10001568 | Ga0307516_1000156819 | 383 |
| 1198 | 3300031730 | Ga0307516_10001850 | Ga0307516_1000185017 | 383 |
| 1199 | 3300031730 | Ga0307516_10004281 | Ga0307516_100042814 | 383 |
| 1200 | 3300031730 | Ga0307516_10004605 | Ga0307516_100046056 | 383 |
| 1201 | 3300031730 | Ga0307516_10004611 | Ga0307516_1000461111 | 383 |
| 1202 | 3300031730 | Ga0307516_10054561 | Ga0307516_100545612 | 383 |
| 1203 | 3300031730 | Ga0307516_10082496 | Ga0307516_100824962 | 383 |
| 1204 | 3300031731 | Ga0307405_10016757 | Ga0307405_100167572 | 383 |
| 1205 | 3300031731 | Ga0307405_10033413 | Ga0307405_100334132 | 383 |
| 1206 | 3300031731 | Ga0307405_10095712 | Ga0307405_100957122 | 383 |
| 1207 | 3300031852 | Ga0307410_10020431 | Ga0307410_100204312 | 383 |
| 1208 | 3300031901 | Ga0307406_10001131 | Ga0307406_100011316 | 383 |
| 1209 | 3300031901 | Ga0307406_10001699 | Ga0307406_1000169910 | 383 |
| 1210 | 3300031901 | Ga0307406_10022558 | Ga0307406_100225583 | 383 |
| 1211 | 3300031901 | Ga0307406_10098362 | Ga0307406_100983622 | 383 |
| 1212 | 3300031903 | Ga0307407_10006078 | Ga0307407_100060784 | 383 |
| 1213 | 3300031903 | Ga0307407_10112933 | Ga0307407_101129331 | 383 |
| 1214 | 3300031903 | Ga0307407_10129311 | Ga0307407_101293112 | 383 |
| 1215 | 3300031911 | Ga0307412_10011101 | Ga0307412_100111013 | 383 |
| 1216 | 3300031911 | Ga0307412_10023060 | Ga0307412_100230602 | 383 |
| 1217 | 3300031911 | Ga0307412_10025330 | Ga0307412_100253303 | 383 |
| 1218 | 3300031911 | Ga0307412_10034849 | Ga0307412_100348493 | 383 |
| 1219 | 3300031995 | Ga0307409_100009086 | Ga0307409_1000090863 | 383 |
| 1220 | 3300031995 | Ga0307409_100041037 | Ga0307409_1000410372 | 383 |
| 1221 | 3300031995 | Ga0307409_100105738 | Ga0307409_1001057382 | 383 |
| 1222 | 3300032002 | Ga0307416_100013885 | Ga0307416_1000138854 | 383 |
| 1223 | 3300032002 | Ga0307416_100045877 | Ga0307416_1000458772 | 383 |
| 1224 | 3300032002 | Ga0307416_100144021 | Ga0307416_1001440212 | 383 |
| 1225 | 3300032004 | Ga0307414_10069494 | Ga0307414_100694942 | 383 |
| 1226 | 3300032005 | Ga0307411_10000347 | Ga0307411_1000034714 | 383 |
| 1227 | 3300032005 | Ga0307411_10096805 | Ga0307411_100968052 | 383 |
| 1228 | 3300032133 | Ga0316583_10019774 | Ga0316583_100197742 | 383 |
| 1229 | 3300033180 | Ga0307510_10030522 | Ga0307510_100305222 | 383 |
| 1230 | 3300033180 | Ga0307510_10053824 | Ga0307510_100538244 | 383 |
| 1231 | 3300035086 | Ga0373934_0030000 | Ga0373934_0030000_382_1533 | 383 |
| 1232 | 3300035111 | Ga0373923_0015654 | Ga0373923_0015654_534_1685 | 383 |
| 1233 | 3300035114 | Ga0373939_0000067 | Ga0373939_0000067_18627_19805 | 383 |
| 1234 | 3300035118 | Ga0373954_0110980 | Ga0373954_0110980_83_1234 | 383 |
| 1235 | 3300035121 | Ga0373960_0000228 | Ga0373960_0000228_3563_4741 | 383 |
| 1236 | 3300035691 | Ga0373931_0007765 | Ga0373931_0007765_3164_4342 | 383 |
| 1237 | 3300035695 | Ga0373927_0003169 | Ga0373927_0003169_5348_6499 | 383 |
| 1238 | 3300035695 | Ga0373927_0004693 | Ga0373927_0004693_6621_7772 | 383 |
| 1239 | 3300035724 | Ga0373933_0072098 | Ga0373933_0072098_538_1689 | 383 |
| 1240 | 3300036401 | Ga0373937_0033224 | Ga0373937_0033224_3164_4315 | 383 |
| 1241 | 3300036401 | Ga0373937_0084574 | Ga0373937_0084574_569_1720 | 383 |
| 1242 | 3300037068 | Ga0373925_0012025 | Ga0373925_0012025_3676_4857 | 383 |
| 1243 | 3300037068 | Ga0373925_0047276 | Ga0373925_0047276_682_1833 | 383 |
| 1244 | 3300037068 | Ga0373925_0287218 | Ga0373925_0287218_120_1298 | 383 |
| 1245 | 3300037312 | Ga0395899_0004233 | Ga0395899_0004233_4300_5478 | 383 |
| 1246 | 3300037312 | Ga0395899_0064777 | Ga0395899_0064777_1193_2371 | 383 |
| 1247 | 3300037418 | Ga0395900_0000058 | Ga0395900_0000058_148909_150090 | 383 |
| 1248 | 3300037418 | Ga0395900_0001342 | Ga0395900_0001342_2834_4003 | 383 |
| 1249 | 3300037418 | Ga0395900_0004446 | Ga0395900_0004446_8685_9863 | 383 |
| 1250 | 3300037418 | Ga0395900_0014529 | Ga0395900_0014529_2894_4072 | 383 |
| 1251 | 3300037418 | Ga0395900_0023478 | Ga0395900_0023478_1744_2922 | 383 |
| 1252 | 3300037418 | Ga0395900_0326164 | Ga0395900_0326164_128_1306 | 383 |
| 1253 | 3300037466 | Ga0395898_0000283 | Ga0395898_0000283_97303_98484 | 383 |
| 1254 | 3300037466 | Ga0395898_0004069 | Ga0395898_0004069_8278_9459 | 383 |
| 1255 | 3300037466 | Ga0395898_0006225 | Ga0395898_0006225_11014_12192 | 383 |
| 1256 | 3300037466 | Ga0395898_0013532 | Ga0395898_0013532_443_1621 | 383 |
| 1257 | 3300037466 | Ga0395898_0164563 | Ga0395898_0164563_846_2024 | 383 |
| 1258 | 3300037466 | Ga0395898_0365367 | Ga0395898_0365367_108_1286 | 383 |
| 1259 | 3300037471 | Ga0395905_0000084 | Ga0395905_0000084_3292_4470 | 383 |
| 1260 | 3300037471 | Ga0395905_0000088 | Ga0395905_0000088_107473_108651 | 383 |
| 1261 | 3300037471 | Ga0395905_0000474 | Ga0395905_0000474_33482_34660 | 383 |
| 1262 | 3300037471 | Ga0395905_0005168 | Ga0395905_0005168_1506_2687 | 383 |
| 1263 | 3300037471 | Ga0395905_0022674 | Ga0395905_0022674_3378_4559 | 383 |
| 1264 | 3300037471 | Ga0395905_0037655 | Ga0395905_0037655_1153_2331 | 383 |
| 1265 | 3300037471 | Ga0395905_0093859 | Ga0395905_0093859_1193_2371 | 383 |
| 1266 | 3300037471 | Ga0395905_0096771 | Ga0395905_0096771_1368_2546 | 383 |
| 1267 | 3300037471 | Ga0395905_0113081 | Ga0395905_0113081_256_1434 | 383 |
| 1268 | 3300037471 | Ga0395905_0188852 | Ga0395905_0188852_128_1309 | 383 |
| 1269 | 3300037471 | Ga0395905_0349936 | Ga0395905_0349936_159_1340 | 383 |
| 1270 | 3300038443 | Ga0395901_0002111 | Ga0395901_0002111_10484_11665 | 383 |
| 1271 | 3300038443 | Ga0395901_0004265 | Ga0395901_0004265_1905_3083 | 383 |
| 1272 | 3300038443 | Ga0395901_0014599 | Ga0395901_0014599_5373_6551 | 383 |
| 1273 | 3300038443 | Ga0395901_0049342 | Ga0395901_0049342_1428_2606 | 383 |
| 1274 | 3300038443 | Ga0395901_0157861 | Ga0395901_0157861_500_1678 | 383 |
| 1275 | 3300038443 | Ga0395901_0200212 | Ga0395901_0200212_818_1996 | 383 |
| 1276 | 3300039437 | Ga0436365_1408997 | Ga0436365_1408997_2649_3800 | 383 |
| 1277 | 3300039447 | Ga0436361_0019641 | Ga0436361_0019641_92701_93879 | 383 |
| 1278 | 3300039447 | Ga0436361_0056098 | Ga0436361_0056098_715_1884 | 383 |
| 1279 | 3300039447 | Ga0436361_0163583 | Ga0436361_0163583_43416_44594 | 383 |
| 1280 | 3300039447 | Ga0436361_0237831 | Ga0436361_0237831_1330_2511 | 383 |
| 1281 | 3300039447 | Ga0436361_0374445 | Ga0436361_0374445_1490_2668 | 383 |
| 1282 | 3300039447 | Ga0436361_0484071 | Ga0436361_0484071_25975_27153 | 383 |
| 1283 | 3300039447 | Ga0436361_0797912 | Ga0436361_0797912_3465_4643 | 383 |
| 1284 | 3300041404 | Ga0439436_0001660 | Ga0439436_0001660_2235_3413 | 383 |
| 1285 | 3300041443 | Ga0451789_0062679 | Ga0451789_0062679_222_1403 | 383 |
| 1286 | 3300041451 | Ga0451791_0729747 | Ga0451791_0729747_81_1259 | 383 |
| 1287 | 3300041459 | Ga0451800_0294366 | Ga0451800_0294366_443_1624 | 383 |
| 1288 | 3300041460 | Ga0451802_1889696 | Ga0451802_1889696_121_1299 | 383 |
| 1289 | 3300041486 | Ga0451807_2119455 | Ga0451807_2119455_86_1264 | 383 |
| 1290 | 3300041997 | Ga0439431_0000686 | Ga0439431_0000686_1093_2271 | 383 |
| 1291 | 3300041999 | Ga0439433_0014615 | Ga0439433_0014615_288_1466 | 383 |
| 1292 | 3300042006 | Ga0439432_002992 | Ga0439432_002992_1908_3086 | 383 |
| 1293 | 3300042010 | Ga0439452_003034 | Ga0439452_003034_2435_3613 | 383 |
| 1294 | 3300042014 | Ga0439457_010969 | Ga0439457_010969_129_1307 | 383 |
| 1295 | 3300042115 | Ga0450911_000443 | Ga0450911_000443_2586_3764 | 383 |
| 1296 | 3300042120 | Ga0450917_000136 | Ga0450917_000136_1514_2692 | 383 |
| 1297 | 3300042125 | Ga0450923_001534 | Ga0450923_001534_842_2020 | 383 |
| 1298 | 3300042126 | Ga0450888_000009 | Ga0450888_000009_9382_10560 | 383 |
| 1299 | 3300042127 | Ga0450890_005447 | Ga0450890_005447_412_1590 | 383 |
| 1300 | 3300042129 | Ga0450891_000221 | Ga0450891_000221_3500_4678 | 383 |
| 1301 | 3300042144 | Ga0450889_000020 | Ga0450889_000020_12131_13309 | 383 |
| 1302 | 3300042184 | Ga0450908_000326 | Ga0450908_000326_6104_7282 | 383 |
| 1303 | 3300042435 | Ga0439434_0001164 | Ga0439434_0001164_2044_3222 | 383 |
| 1304 | 3300042438 | Ga0439459_0000359 | Ga0439459_0000359_548_1726 | 383 |
| 1305 | 3300042531 | Ga0450918_000047 | Ga0450918_000047_7248_8429 | 383 |
| 1306 | 3300042876 | Ga0451577_0000453 | Ga0451577_0000453_45629_46807 | 383 |
| 1307 | 3300042876 | Ga0451577_0000997 | Ga0451577_0000997_21018_22187 | 383 |
| 1308 | 3300042876 | Ga0451577_0007753 | Ga0451577_0007753_1498_2676 | 383 |
| 1309 | 3300042876 | Ga0451577_0008851 | Ga0451577_0008851_28_1197 | 383 |
| 1310 | 3300042876 | Ga0451577_0013237 | Ga0451577_0013237_1023_2204 | 383 |
| 1311 | 3300042876 | Ga0451577_0015527 | Ga0451577_0015527_2779_3948 | 383 |
| 1312 | 3300042876 | Ga0451577_0020100 | Ga0451577_0020100_3194_4363 | 383 |
| 1313 | 3300042876 | Ga0451577_0086637 | Ga0451577_0086637_90_1259 | 383 |
| 1314 | 3300042876 | Ga0451577_0093102 | Ga0451577_0093102_1105_2274 | 383 |
| 1315 | 3300042876 | Ga0451577_0159727 | Ga0451577_0159727_194_1375 | 383 |
| 1316 | 3300044656 | Ga0466969_0000013 | Ga0466969_0000013_37053_38234 | 383 |
| 1317 | 3300044656 | Ga0466969_0011004 | Ga0466969_0011004_3145_4326 | 383 |
| 1318 | 3300044658 | Ga0466972_0001863 | Ga0466972_0001863_4375_5556 | 383 |
| 1319 | 3300044658 | Ga0466972_0025394 | Ga0466972_0025394_287_1468 | 383 |
| 1320 | 3300044673 | Ga0453683_0031647 | Ga0453683_0031647_901_2070 | 383 |
| 1321 | 3300044683 | Ga0466965_0019745 | Ga0466965_0019745_1435_2616 | 383 |
| 1322 | 3300044684 | Ga0466966_0028472 | Ga0466966_0028472_402_1589 | 383 |
| 1323 | 3300044693 | Ga0466961_0007768 | Ga0466961_0007768_230_1417 | 383 |
| 1324 | 3300044693 | Ga0466961_0027966 | Ga0466961_0027966_2379_3560 | 383 |
| 1325 | 3300044694 | Ga0466963_0045293 | Ga0466963_0045293_59_1240 | 383 |
| 1326 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_662693_663862 | 383 |
| 1327 | 3300044712 | Ga0453684_0000114 | Ga0453684_0000114_211210_212379 | 383 |
| 1328 | 3300044712 | Ga0453684_0001268 | Ga0453684_0001268_12967_14136 | 383 |
| 1329 | 3300044712 | Ga0453684_0001455 | Ga0453684_0001455_59880_61049 | 383 |
| 1330 | 3300044712 | Ga0453684_0002072 | Ga0453684_0002072_24689_25867 | 383 |
| 1331 | 3300044712 | Ga0453684_0006329 | Ga0453684_0006329_19657_20826 | 383 |
| 1332 | 3300044712 | Ga0453684_0027135 | Ga0453684_0027135_2110_3288 | 383 |
| 1333 | 3300044712 | Ga0453684_0037650 | Ga0453684_0037650_123_1301 | 383 |
| 1334 | 3300044712 | Ga0453684_0126006 | Ga0453684_0126006_391_1560 | 383 |
| 1335 | 3300044719 | Ga0466971_0004477 | Ga0466971_0004477_549_1736 | 383 |
| 1336 | 3300044719 | Ga0466971_0035574 | Ga0466971_0035574_994_2175 | 383 |
| 1337 | 3300044719 | Ga0466971_0037073 | Ga0466971_0037073_714_1895 | 383 |
| 1338 | 3300044735 | Ga0466968_0008781 | Ga0466968_0008781_615_1802 | 383 |
| 1339 | 3300044735 | Ga0466968_0084067 | Ga0466968_0084067_122_1300 | 383 |
| 1340 | 3300044842 | Ga0466957_0026908 | Ga0466957_0026908_625_1812 | 383 |
| 1341 | 3300045049 | Ga0466959_0001083 | Ga0466959_0001083_8752_9933 | 383 |
| 1342 | 3300045049 | Ga0466959_0010137 | Ga0466959_0010137_5453_6634 | 383 |
| 1343 | 3300045051 | Ga0451576_0000168 | Ga0451576_0000168_39504_40673 | 383 |
| 1344 | 3300045051 | Ga0451576_0000950 | Ga0451576_0000950_24703_25881 | 383 |
| 1345 | 3300045051 | Ga0451576_0001018 | Ga0451576_0001018_15924_17093 | 383 |
| 1346 | 3300045051 | Ga0451576_0002478 | Ga0451576_0002478_11644_12822 | 383 |
| 1347 | 3300045051 | Ga0451576_0012346 | Ga0451576_0012346_4930_6111 | 383 |
| 1348 | 3300045051 | Ga0451576_0074276 | Ga0451576_0074276_151_1320 | 383 |
| 1349 | 3300045051 | Ga0451576_0173524 | Ga0451576_0173524_317_1498 | 383 |
| 1350 | 3300045051 | Ga0451576_0223738 | Ga0451576_0223738_148_1317 | 383 |
| 1351 | 3300045836 | Ga0466958_0047577 | Ga0466958_0047577_855_2042 | 383 |
| 1352 | 3300046453 | Ga0495627_006336 | Ga0495627_006336_2974_4152 | 383 |
| 1353 | 3300046454 | Ga0495592_0000394 | Ga0495592_0000394_26066_27244 | 383 |
| 1354 | 3300046460 | Ga0495638_0050099 | Ga0495638_0050099_25_1203 | 383 |
| 1355 | 3300046472 | Ga0495580_0056248 | Ga0495580_0056248_1473_2651 | 383 |
| 1356 | 3300046473 | Ga0495582_0038406 | Ga0495582_0038406_382_1533 | 383 |
| 1357 | 3300046492 | Ga0495585_0034025 | Ga0495585_0034025_457_1638 | 383 |
| 1358 | 3300046506 | Ga0495583_0000081 | Ga0495583_0000081_41451_42632 | 383 |
| 1359 | 3300046507 | Ga0495606_0018883 | Ga0495606_0018883_228_1409 | 383 |
| 1360 | 3300046515 | Ga0495620_0020378 | Ga0495620_0020378_1191_2369 | 383 |
| 1361 | 3300046517 | Ga0495630_0088413 | Ga0495630_0088413_375_1526 | 383 |
| 1362 | 3300046518 | Ga0495631_0001417 | Ga0495631_0001417_3945_5123 | 383 |
| 1363 | 3300046519 | Ga0495632_0004039 | Ga0495632_0004039_2962_4143 | 383 |
| 1364 | 3300046519 | Ga0495632_0059217 | Ga0495632_0059217_252_1433 | 383 |
| 1365 | 3300046531 | Ga0495665_0055540 | Ga0495665_0055540_11_1162 | 383 |
| 1366 | 3300046536 | Ga0495587_0065569 | Ga0495587_0065569_823_1974 | 383 |
| 1367 | 3300046537 | Ga0495598_0004678 | Ga0495598_0004678_464_1633 | 383 |
| 1368 | 3300046539 | Ga0495621_0016961 | Ga0495621_0016961_489_1640 | 383 |
| 1369 | 3300046539 | Ga0495621_0027461 | Ga0495621_0027461_73_1224 | 383 |
| 1370 | 3300046542 | Ga0495597_0000054 | Ga0495597_0000054_91781_92959 | 383 |
| 1371 | 3300046558 | Ga0495633_0000648 | Ga0495633_0000648_25925_27103 | 383 |
| 1372 | 3300046615 | Ga0495656_0000093 | Ga0495656_0000093_33914_35092 | 383 |
| 1373 | 3300046660 | Ga0495625_0001179 | Ga0495625_0001179_5562_6740 | 383 |
| 1374 | 3300046660 | Ga0495625_0114001 | Ga0495625_0114001_465_1643 | 383 |
| 1375 | 3300046664 | Ga0495659_0012749 | Ga0495659_0012749_963_2114 | 383 |
| 1376 | 3300046681 | Ga0495647_0018312 | Ga0495647_0018312_481_1632 | 383 |
| 1377 | 3300046683 | Ga0495658_0057777 | Ga0495658_0057777_628_1806 | 383 |
| 1378 | 3300046683 | Ga0495658_0077844 | Ga0495658_0077844_701_1852 | 383 |
| 1379 | 3300046689 | Ga0495613_0017525 | Ga0495613_0017525_3370_4521 | 383 |
| 1380 | 3300046694 | Ga0495649_0000259 | Ga0495649_0000259_41432_42613 | 383 |
| 1381 | 3300046694 | Ga0495649_0010350 | Ga0495649_0010350_2017_3195 | 383 |
| 1382 | 3300046794 | Ga0495589_0028100 | Ga0495589_0028100_1271_2449 | 383 |
| 1383 | 3300046810 | Ga0495660_0011887 | Ga0495660_0011887_1900_3078 | 383 |
| 1384 | 3300047321 | Ga0495676_0009192 | Ga0495676_0009192_6432_7610 | 383 |
| 1385 | 3300047443 | Ga0495687_003988 | Ga0495687_003988_91_1269 | 383 |
| 1386 | 3300047447 | Ga0495685_029083 | Ga0495685_029083_692_1870 | 383 |
| 1387 | 3300047673 | Ga0495593_0015464 | Ga0495593_0015464_2959_4137 | 383 |
| 1388 | 3300048088 | Ga0495602_0090521 | Ga0495602_0090521_1233_2384 | 383 |
| 1389 | 3300048903 | Ga0496100_0016181 | Ga0496100_0016181_2783_3934 | 383 |
| 1390 | 3300048904 | Ga0496101_0005514 | Ga0496101_0005514_6382_7560 | 383 |
| 1391 | 3300048904 | Ga0496101_0053871 | Ga0496101_0053871_1070_2221 | 383 |
| 1392 | 3300048905 | Ga0496102_0004520 | Ga0496102_0004520_3780_4931 | 383 |
| 1393 | 3300048905 | Ga0496102_0032029 | Ga0496102_0032029_2269_3447 | 383 |
| 1394 | 3300048905 | Ga0496102_0034690 | Ga0496102_0034690_1106_2257 | 383 |
| 1395 | 3300048905 | Ga0496102_0049796 | Ga0496102_0049796_55_1236 | 383 |
| 1396 | 3300048906 | Ga0496103_0082067 | Ga0496103_0082067_65_1216 | 383 |
| 1397 | 3300048907 | Ga0496104_0006818 | Ga0496104_0006818_4442_5593 | 383 |
| 1398 | 3300048907 | Ga0496104_0008511 | Ga0496104_0008511_171_1349 | 383 |
| 1399 | 3300048907 | Ga0496104_0074178 | Ga0496104_0074178_931_2112 | 383 |
| 1400 | 3300048908 | Ga0496105_0010653 | Ga0496105_0010653_4774_5925 | 383 |
| 1401 | 3300048908 | Ga0496105_0011125 | Ga0496105_0011125_2915_4093 | 383 |
| 1402 | 3300048908 | Ga0496105_0029503 | Ga0496105_0029503_3272_4423 | 383 |
| 1403 | 3300048908 | Ga0496105_0137152 | Ga0496105_0137152_790_1968 | 383 |
| 1404 | 3300048909 | Ga0496106_0016006 | Ga0496106_0016006_4265_5416 | 383 |
| 1405 | 3300048909 | Ga0496106_0040487 | Ga0496106_0040487_1251_2429 | 383 |
| 1406 | 3300048909 | Ga0496106_0162620 | Ga0496106_0162620_280_1431 | 383 |
| 1407 | 3300048910 | Ga0496107_0013245 | Ga0496107_0013245_344_1495 | 383 |
| 1408 | 3300048911 | Ga0496108_0007483 | Ga0496108_0007483_2298_3449 | 383 |
| 1409 | 3300048911 | Ga0496108_0039907 | Ga0496108_0039907_196_1347 | 383 |
| 1410 | 3300048911 | Ga0496108_0094360 | Ga0496108_0094360_922_2100 | 383 |
| 1411 | 3300048911 | Ga0496108_0099050 | Ga0496108_0099050_1140_2324 | 383 |
| 1412 | 3300048911 | Ga0496108_0109731 | Ga0496108_0109731_417_1568 | 383 |
| 1413 | 3300048911 | Ga0496108_0219376 | Ga0496108_0219376_172_1341 | 383 |
| 1414 | 3300048912 | Ga0496109_0014083 | Ga0496109_0014083_5772_6923 | 383 |
| 1415 | 3300048912 | Ga0496109_0039783 | Ga0496109_0039783_1660_2811 | 383 |
| 1416 | 3300048912 | Ga0496109_0259035 | Ga0496109_0259035_39_1217 | 383 |
| 1417 | 3300048913 | Ga0496110_0014509 | Ga0496110_0014509_4140_5291 | 383 |
| 1418 | 3300048913 | Ga0496110_0035733 | Ga0496110_0035733_2684_3835 | 383 |
| 1419 | 3300048913 | Ga0496110_0038769 | Ga0496110_0038769_1991_3169 | 383 |
| 1420 | 3300048913 | Ga0496110_0401453 | Ga0496110_0401453_40_1209 | 383 |
| 1421 | 3300048914 | Ga0496111_0036928 | Ga0496111_0036928_523_1701 | 383 |
| 1422 | 3300048914 | Ga0496111_0114604 | Ga0496111_0114604_556_1734 | 383 |
| 1423 | 3300048915 | Ga0496112_0009399 | Ga0496112_0009399_5457_6638 | 383 |
| 1424 | 3300048915 | Ga0496112_0056645 | Ga0496112_0056645_2677_3828 | 383 |
| 1425 | 3300048917 | Ga0496114_0003046 | Ga0496114_0003046_8243_9424 | 383 |
| 1426 | 3300048917 | Ga0496114_0027685 | Ga0496114_0027685_2895_4046 | 383 |
| 1427 | 3300048917 | Ga0496114_0080163 | Ga0496114_0080163_1253_2422 | 383 |
| 1428 | 3300048920 | Ga0496117_0072509 | Ga0496117_0072509_90_1268 | 383 |
| 1429 | 3300048921 | Ga0496118_0007613 | Ga0496118_0007613_8069_9247 | 383 |
| 1430 | 3300048921 | Ga0496118_0014026 | Ga0496118_0014026_2707_3885 | 383 |
| 1431 | 3300048924 | Ga0496121_0047496 | Ga0496121_0047496_209_1387 | 383 |
| 1432 | 3300048925 | Ga0496122_0000383 | Ga0496122_0000383_8343_9521 | 383 |
| 1433 | 3300048925 | Ga0496122_0005655 | Ga0496122_0005655_7592_8770 | 383 |
| 1434 | 3300048926 | Ga0496123_0000249 | Ga0496123_0000249_85191_86369 | 383 |
| 1435 | 3300048928 | Ga0496125_0000319 | Ga0496125_0000319_31752_32930 | 383 |
| 1436 | 3300048928 | Ga0496125_0023666 | Ga0496125_0023666_2807_3985 | 383 |
| 1437 | 3300048928 | Ga0496125_0070059 | Ga0496125_0070059_1391_2569 | 383 |
| 1438 | 3300049568 | Ga0501031_0006723 | Ga0501031_0006723_4068_5246 | 383 |
| 1439 | 3300049571 | Ga0501034_0038720 | Ga0501034_0038720_2181_3359 | 383 |
| 1440 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_53237_54415 | 383 |
| 1441 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_53226_54404 | 383 |
| 1442 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_53284_54462 | 383 |
| 1443 | 3300049581 | Ga0501047_0089232 | Ga0501047_0089232_1279_2457 | 383 |
| 1444 | 3300049649 | Ga0501198_000001 | Ga0501198_000001_30443_31621 | 383 |
| 1445 | 3300049654 | Ga0501207_004330 | Ga0501207_004330_666_1844 | 383 |
| 1446 | 3300049662 | Ga0501222_000004 | Ga0501222_000004_19419_20597 | 383 |
| 1447 | 3300049662 | Ga0501222_001282 | Ga0501222_001282_1315_2493 | 383 |
| 1448 | 3300049662 | Ga0501222_002897 | Ga0501222_002897_453_1634 | 383 |
| 1449 | 3300049663 | Ga0501223_007869 | Ga0501223_007869_278_1456 | 383 |
| 1450 | 3300049669 | Ga0501235_003572 | Ga0501235_003572_1862_3040 | 383 |
| 1451 | 3300049674 | Ga0501242_003578 | Ga0501242_003578_139_1317 | 383 |
| 1452 | 3300049683 | Ga0501253_000860 | Ga0501253_000860_1615_2793 | 383 |
| 1453 | 3300049704 | Ga0501221_002012 | Ga0501221_002012_449_1627 | 383 |
| 1454 | 3300049742 | Ga0501080_0053452 | Ga0501080_0053452_1835_3013 | 383 |
| 1455 | 3300049759 | Ga0501262_000273 | Ga0501262_000273_534_1712 | 383 |
| 1456 | 3300049759 | Ga0501262_004596 | Ga0501262_004596_147_1325 | 383 |
| 1457 | 3300049764 | Ga0501267_000092 | Ga0501267_000092_3526_4704 | 383 |
| 1458 | 3300049822 | Ga0501035_0038555 | Ga0501035_0038555_1386_2564 | 383 |
| 1459 | 3300050489 | nmdc:mga03683_39000_c1 | nmdc:mga03683_39000_c1_411_1589 | 383 |
| 1460 | 3300050491 | nmdc:mga00v17_33488_c1 | nmdc:mga00v17_33488_c1_815_1993 | 383 |
| 1461 | 3300050492 | nmdc:mga0yw44_139388_c1 | nmdc:mga0yw44_139388_c1_295_1473 | 383 |
| 1462 | 3300050492 | nmdc:mga0yw44_9904_c1 | nmdc:mga0yw44_9904_c1_320_1495 | 383 |
| 1463 | 3300050493 | nmdc:mga0k408_144892_c1 | nmdc:mga0k408_144892_c1_214_1392 | 383 |
| 1464 | 3300050493 | nmdc:mga0k408_2471_c1 | nmdc:mga0k408_2471_c1_7078_8256 | 383 |
| 1465 | 3300050493 | nmdc:mga0k408_3312_c1 | nmdc:mga0k408_3312_c1_3634_4812 | 383 |
| 1466 | 3300050493 | nmdc:mga0k408_3894_c1 | nmdc:mga0k408_3894_c1_3998_5176 | 383 |
| 1467 | 3300050493 | nmdc:mga0k408_4784_c1 | nmdc:mga0k408_4784_c1_5484_6662 | 383 |
| 1468 | 3300050493 | nmdc:mga0k408_59922_c1 | nmdc:mga0k408_59922_c1_368_1546 | 383 |
| 1469 | 3300050495 | nmdc:mga04h51_36487_c1 | nmdc:mga04h51_36487_c1_236_1405 | 383 |
| 1470 | 3300050496 | nmdc:mga07m45_2541_c1 | nmdc:mga07m45_2541_c1_7327_8505 | 383 |
| 1471 | 3300050496 | nmdc:mga07m45_2542_c1 | nmdc:mga07m45_2542_c1_6890_8068 | 383 |
| 1472 | 3300050496 | nmdc:mga07m45_6261_c1 | nmdc:mga07m45_6261_c1_2731_3909 | 383 |
| 1473 | 3300050496 | nmdc:mga07m45_6873_c1 | nmdc:mga07m45_6873_c1_1748_2926 | 383 |
| 1474 | 3300050496 | nmdc:mga07m45_81_c1 | nmdc:mga07m45_81_c1_20944_22122 | 383 |
| 1475 | 3300050508 | nmdc:mga09592_3703_c1 | nmdc:mga09592_3703_c1_2219_3397 | 383 |
| 1476 | 3300050511 | nmdc:mga08y16_28387_c1 | nmdc:mga08y16_28387_c1_4008_5159 | 383 |
| 1477 | 3300050511 | nmdc:mga08y16_351538_c1 | nmdc:mga08y16_351538_c1_255_1433 | 383 |
| 1478 | 3300050513 | nmdc:mga0rr50_124536_c1 | nmdc:mga0rr50_124536_c1_14_1165 | 383 |
| 1479 | 3300050514 | nmdc:mga08x19_36678_c1 | nmdc:mga08x19_36678_c1_1737_2888 | 383 |
| 1480 | 3300050516 | nmdc:mga0sz30_35698_c1 | nmdc:mga0sz30_35698_c1_382_1551 | 383 |
| 1481 | 3300053079 | Ga0500610_0005499 | Ga0500610_0005499_458_1636 | 383 |
| 1482 | 3300053080 | Ga0500635_0000011 | Ga0500635_0000011_86705_87886 | 383 |
| 1483 | 3300053085 | Ga0495619_0119029 | Ga0495619_0119029_524_1702 | 383 |
| 1484 | 3300053086 | Ga0500578_0000652 | Ga0500578_0000652_5573_6754 | 383 |
| 1485 | 3300053092 | Ga0500583_0003338 | Ga0500583_0003338_771_1940 | 383 |
| 1486 | 3300053093 | Ga0500651_0000067 | Ga0500651_0000067_29801_30979 | 383 |
| 1487 | 3300053093 | Ga0500651_0013435 | Ga0500651_0013435_2229_3410 | 383 |
| 1488 | 3300053110 | Ga0500571_000952 | Ga0500571_000952_3525_4703 | 383 |
| 1489 | 3300053131 | Ga0500652_000449 | Ga0500652_000449_8830_10011 | 383 |
| 1490 | 3300053133 | Ga0500655_001229 | Ga0500655_001229_2380_3549 | 383 |
| 1491 | 3300053134 | Ga0500658_0001880 | Ga0500658_0001880_1586_2764 | 383 |
| 1492 | 3300053134 | Ga0500658_0003426 | Ga0500658_0003426_1158_2336 | 383 |
| 1493 | 3300053136 | Ga0500559_0000446 | Ga0500559_0000446_9185_10363 | 383 |
| 1494 | 3300053139 | Ga0500568_0010475 | Ga0500568_0010475_2965_4143 | 383 |
| 1495 | 3300053151 | Ga0500604_0041079 | Ga0500604_0041079_39_1208 | 383 |
| 1496 | 3300053153 | Ga0500616_0011165 | Ga0500616_0011165_2998_4176 | 383 |
| 1497 | 3300053156 | Ga0500622_0000124 | Ga0500622_0000124_5587_6768 | 383 |
| 1498 | 3300053156 | Ga0500622_0018843 | Ga0500622_0018843_1137_2315 | 383 |
| 1499 | 3300053156 | Ga0500622_0031819 | Ga0500622_0031819_140_1318 | 383 |
| 1500 | 3300053162 | Ga0500638_036952 | Ga0500638_036952_889_2067 | 383 |
| 1501 | 3300053177 | Ga0500636_0000203 | Ga0500636_0000203_5144_6313 | 383 |
| 1502 | 3300059421 | Ga0590071_003318 | Ga0590071_003318_2240_3421 | 383 |
| 1503 | 3300059424 | Ga0590075_012517 | Ga0590075_012517_753_1934 | 383 |
| 1504 | 3300061719 | Ga0466962_0012811 | Ga0466962_0012811_127_1314 | 383 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oyz-assembly4.cif.gz_D | crystal structure of mray bound to capuramycin | 0.9667 | 21 | 381 |
| 6oyz-assembly1.cif.gz_A | crystal structure of mray bound to capuramycin | 0.9656 | 25 | 380 |
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.964 | 24 | 381 |
| 6oz6-assembly4.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9607 | 25 | 381 |
| 6oyz-assembly4.cif.gz_D | crystal structure of mray bound to capuramycin | 0.9605 | 21 | 381 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2F7_42_134_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.5287 | 76 | 144 | 1.10.10.1740 |
| af_Q2G2F7_42_134_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.4126 | 76 | 144 | 1.10.10.1740 |
| af_I1LIG9_7_170_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.3507 | 75 | 174 | 1.20.120.1760 |
| af_Q9BKR9_103_269_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3187 | 201 | 283 | 1.20.1250.20 |
| af_Q7XKJ7_269_452_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3069 | 206 | 383 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X0N8X3-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9907 | 232 | 383 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555 |
| AF-A0A258SMQ9-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9904 | 234 | 383 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555 |
| AF-A0A3S1VV32-F1-model_v4 | deleted | 0.9887 | 214 | 366 |
|
| AF-A0A3B8P9D2-F1-model_v4 | deleted | 0.9876 | 183 | 383 |
|
| AF-A0A7C4E8B7-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) | 0.9875 | 1 | 383 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar