F494390

General Info

Members Datasets Scaffolds Average Seq Length
1498 413 1482 154

Family's Representative Sequence

Representative Sequence 3300042003|Ga0439443_001194|Ga0439443_001194_849_1466
Length 187
Sequence MNEQRRIETEEVGEAAKPARARVTDAIPPRGGDEQARHAPGMAADARGASGETPSAAETFARKRDYLEGFISRPPRTAAEPAPVEPGGDLYEAVIDALKDIYDPEIPVNIYDLGLIYDVEITPDHHARIKMTLTTPHCPVAESMPGEVELRVGAVPGIGDAEVELVWHPPWDPQKMSDEAKLELGML

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
8 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
9 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
12 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
13 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
14 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
15 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
16 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
17 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
27 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
254 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
270 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
271 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
275 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
276 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
277 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
278 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
297 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
302 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
318 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
340 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
341 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
342 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
343 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
344 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
362 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
363 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
364 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
365 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
366 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
367 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
368 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
369 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
370 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
371 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
372 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
373 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
374 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
375 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
376 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
377 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
378 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
379 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
384 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
387 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
388 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
389 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
390 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
391 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
392 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
398 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
399 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
400 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
404 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
405 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
406 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
407 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
408 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
409 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
410 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.4
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.88
Nodule 0
Rhizoplane 1.94
Rhizosphere 85.98
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003333 3300000549 Bacteria 2163
2 JGI24736J21556_1003947 3300001904 Bacteria 2551
3 JGI24741J21665_1000079 3300001915 Bacteria 24144
4 JGI24740J21852_10046592 3300001979 Bacteria 1272
5 JGI24739J22299_10000157 3300001989 Bacteria 22040
6 JGI24739J22299_10000379 3300001989 Bacteria 15355
7 JGI24737J22298_10001199 3300001990 Bacteria 9139
8 JGI24737J22298_10001675 3300001990 Bacteria 7896
9 JGI24737J22298_10002301 3300001990 Bacteria 6792
10 JGI24743J22301_10004170 3300001991 Bacteria 2337
11 JGI24735J21928_10000880 3300002067 Bacteria 10738
12 JGI24735J21928_10003965 3300002067 Bacteria 5005
13 JGI24735J21928_10014557 3300002067 Bacteria 2462
14 JGI24735J21928_10015705 3300002067 Bacteria 2358
15 JGI24735J21928_10028292 3300002067 Bacteria 1674
16 JGI24735J21928_10059162 3300002067 Bacteria 1102
17 JGI24735J21928_10180995 3300002067 Bacteria 610
18 JGI24738J21930_10000532 3300002075 Bacteria 10892
19 JGI24744J21845_10000474 3300002077 Bacteria 7124
20 JGI24035J26624_1016265 3300002126 Bacteria 765
21 JGI24033J26618_1045984 3300002155 Bacteria 618
22 JGI24034J26672_10004861 3300002239 Bacteria 1913
23 JGI24742J22300_10042498 3300002244 Bacteria 812
24 JGI24751J29686_10000166 3300002459 Bacteria 30777
25 JGI24751J29686_10033042 3300002459 Bacteria 1073
26 JGI24751J29686_10108053 3300002459 Bacteria 582
27 JGI25152J39213_1013596 3300002773 Bacteria 1686
28 JGI25150J39212_1000416 3300002774 Bacteria 19628
29 JGI25151J46595_10010394 3300003187 Bacteria 4332
30 JGI25406J46586_10071786 3300003203 Bacteria 1084
31 JGI25165J46597_1000187 3300003214 Bacteria 93537
32 JGI25153J46596_10000153 3300003215 Bacteria 69588
33 Ga0055529_1024883 3300003763 Bacteria 740
34 Ga0055526_1004471 3300003771 Bacteria 8384
35 Ga0055537_1012294 3300003773 Bacteria 1679
36 Ga0055536_1003413 3300003781 Bacteria 8542
37 Ga0055536_1006131 3300003781 Bacteria 5687
38 Ga0055536_1058760 3300003781 Bacteria 805
39 Ga0055534_1030330 3300003784 Bacteria 836
40 Ga0055530_10000510 3300003791 Bacteria 33802
41 Ga0055530_10000526 3300003791 Bacteria 33232
42 Ga0055530_10046401 3300003791 Bacteria 1032
43 Ga0055540_1003509 3300003792 Bacteria 7545
44 Ga0055540_1005037 3300003792 Bacteria 5731
45 Ga0055531_10000319 3300003794 Bacteria 47189
46 Ga0055531_10000563 3300003794 Bacteria 32623
47 Ga0055531_10001477 3300003794 Bacteria 17291
48 Ga0055531_10002961 3300003794 Bacteria 11042
49 JGI25405J52794_10066371 3300003911 Bacteria 784
50 Ga0065165_1007081 3300005262 Bacteria 5634
51 Ga0065704_10003284 3300005289 Bacteria 6250
52 Ga0065704_10164414 3300005289 Bacteria 1332
53 Ga0065704_10447225 3300005289 Bacteria 708
54 Ga0065715_10016131 3300005293 Bacteria 1699
55 Ga0065715_10036736 3300005293 Bacteria 1567
56 Ga0065715_10191063 3300005293 Bacteria 1415
57 Ga0065715_10228925 3300005293 Bacteria 1241
58 Ga0065715_10252707 3300005293 Bacteria 1162
59 Ga0065715_10438613 3300005293 Bacteria 839
60 Ga0065707_10090212 3300005295 Bacteria 4188
61 Ga0065707_10091015 3300005295 Bacteria 4021
62 Ga0065707_10348275 3300005295 Bacteria 922
63 Ga0070658_10000003 3300005327 Bacteria 465963
64 Ga0070658_10000349 3300005327 Bacteria 40022
65 Ga0070658_10009504 3300005327 Bacteria 7810
66 Ga0070658_10068154 3300005327 Bacteria 2908
67 Ga0070658_10088787 3300005327 Bacteria 2545
68 Ga0070658_10115663 3300005327 Bacteria 2225
69 Ga0070658_10190223 3300005327 Bacteria 1730
70 Ga0070658_10234699 3300005327 Bacteria 1554
71 Ga0070658_10360151 3300005327 Bacteria 1246
72 Ga0070658_10842236 3300005327 Bacteria 797
73 Ga0070658_10897188 3300005327 Bacteria 771
74 Ga0070676_10000111 3300005328 Bacteria 29798
75 Ga0070676_10055668 3300005328 Bacteria 2335
76 Ga0070676_10056069 3300005328 Bacteria 2327
77 Ga0070683_100805470 3300005329 Bacteria 900
78 Ga0070670_100000158 3300005331 Bacteria 62049
79 Ga0070670_100003607 3300005331 Bacteria 12881
80 Ga0070670_100004093 3300005331 Bacteria 12187
81 Ga0070670_100106148 3300005331 Bacteria 2420
82 Ga0070670_100209327 3300005331 Bacteria 1695
83 Ga0070670_100291086 3300005331 Bacteria 1427
84 Ga0070677_10000501 3300005333 Bacteria 13507
85 Ga0070677_10013309 3300005333 Bacteria 2875
86 Ga0070677_10039351 3300005333 Bacteria 1855
87 Ga0070677_10148955 3300005333 Bacteria 1087
88 Ga0070677_10176907 3300005333 Bacteria 1013
89 Ga0068869_100000428 3300005334 Bacteria 22992
90 Ga0068869_100584658 3300005334 Bacteria 942
91 Ga0070666_10083448 3300005335 Bacteria 2186
92 Ga0070666_10130809 3300005335 Bacteria 1744
93 Ga0070666_10231897 3300005335 Bacteria 1304
94 Ga0070666_10292548 3300005335 Bacteria 1159
95 Ga0070666_10358016 3300005335 Bacteria 1045
96 Ga0070680_100000958 3300005336 Bacteria 20442
97 Ga0070680_100905631 3300005336 Bacteria 761
98 Ga0068868_100000242 3300005338 Bacteria 36914
99 Ga0068868_100000387 3300005338 Bacteria 29954
100 Ga0070660_100000122 3300005339 Bacteria 49000
101 Ga0070660_100000385 3300005339 Bacteria 29423
102 Ga0070660_100000511 3300005339 Bacteria 25935
103 Ga0070660_100001221 3300005339 Bacteria 17469
104 Ga0070660_100026526 3300005339 Bacteria 4314
105 Ga0070660_100091425 3300005339 Bacteria 2400
106 Ga0070660_100236225 3300005339 Bacteria 1488
107 Ga0070660_100538255 3300005339 Bacteria 974
108 Ga0070689_101420092 3300005340 Bacteria 627
109 Ga0070661_100000155 3300005344 Bacteria 56344
110 Ga0070661_100199910 3300005344 Bacteria 1527
111 Ga0070661_100234640 3300005344 Bacteria 1411
112 Ga0070692_10018822 3300005345 Bacteria 3328
113 Ga0070692_10095983 3300005345 Bacteria 1619
114 Ga0070692_10182677 3300005345 Bacteria 1217
115 Ga0070692_10305544 3300005345 Bacteria 973
116 Ga0070668_100000007 3300005347 Bacteria 150621
117 Ga0070668_100000025 3300005347 Bacteria 93131
118 Ga0070668_100000649 3300005347 Bacteria 23494
119 Ga0070668_100059315 3300005347 Bacteria 2962
120 Ga0070668_100150708 3300005347 Bacteria 1880
121 Ga0070668_100170329 3300005347 Bacteria 1773
122 Ga0070668_100195913 3300005347 Bacteria 1657
123 Ga0070668_100364050 3300005347 Bacteria 1227
124 Ga0070668_100415777 3300005347 Bacteria 1151
125 Ga0070668_100526206 3300005347 Bacteria 1026
126 Ga0070668_101372488 3300005347 Bacteria 644
127 Ga0070669_100000031 3300005353 Bacteria 154042
128 Ga0070669_100016538 3300005353 Bacteria 5265
129 Ga0070669_100034942 3300005353 Bacteria 3640
130 Ga0070669_100046272 3300005353 Bacteria 3173
131 Ga0070669_100063418 3300005353 Bacteria 2720
132 Ga0070669_100089825 3300005353 Bacteria 2302
133 Ga0070669_100382677 3300005353 Bacteria 1148
134 Ga0070669_100789169 3300005353 Bacteria 807
135 Ga0070669_100805100 3300005353 Bacteria 799
136 Ga0070669_100856207 3300005353 Bacteria 775
137 Ga0070669_100893268 3300005353 Bacteria 759
138 Ga0070675_100001982 3300005354 Bacteria 15173
139 Ga0070675_100002250 3300005354 Bacteria 14308
140 Ga0070675_100009019 3300005354 Bacteria 7746
141 Ga0070675_100015862 3300005354 Bacteria 5966
142 Ga0070675_100056390 3300005354 Bacteria 3238
143 Ga0070675_100086069 3300005354 Bacteria 2626
144 Ga0070675_100184754 3300005354 Bacteria 1804
145 Ga0070675_100376647 3300005354 Bacteria 1263
146 Ga0070675_100471879 3300005354 Bacteria 1128
147 Ga0070671_100000046 3300005355 Bacteria 84967
148 Ga0070671_100000068 3300005355 Bacteria 70220
149 Ga0070671_100001083 3300005355 Bacteria 20150
150 Ga0070671_100018037 3300005355 Bacteria 5727
151 Ga0070671_100018209 3300005355 Bacteria 5702
152 Ga0070671_100023390 3300005355 Bacteria 5058
153 Ga0070671_100036915 3300005355 Bacteria 4052
154 Ga0070671_100038465 3300005355 Bacteria 3971
155 Ga0070671_100359039 3300005355 Bacteria 1244
156 Ga0070671_100690363 3300005355 Bacteria 885
157 Ga0070671_100827649 3300005355 Bacteria 807
158 Ga0070674_100008356 3300005356 Bacteria 6162
159 Ga0070674_100048184 3300005356 Bacteria 2924
160 Ga0070674_100073683 3300005356 Bacteria 2421
161 Ga0070674_100582590 3300005356 Bacteria 943
162 Ga0070673_100000015 3300005364 Bacteria 118064
163 Ga0070673_100053271 3300005364 Bacteria 3177
164 Ga0070673_100078110 3300005364 Bacteria 2677
165 Ga0070673_100164820 3300005364 Bacteria 1887
166 Ga0070673_100649249 3300005364 Bacteria 966
167 Ga0070659_100000005 3300005366 Bacteria 259902
168 Ga0070659_100002131 3300005366 Bacteria 14106
169 Ga0070659_100017781 3300005366 Bacteria 5355
170 Ga0070659_100098528 3300005366 Bacteria 2351
171 Ga0070659_100156265 3300005366 Bacteria 1863
172 Ga0070659_100174298 3300005366 Bacteria 1763
173 Ga0070659_100175343 3300005366 Bacteria 1758
174 Ga0070659_100319964 3300005366 Bacteria 1297
175 Ga0070667_100000006 3300005367 Bacteria 336732
176 Ga0070667_100000193 3300005367 Bacteria 72859
177 Ga0070667_100012635 3300005367 Bacteria 6984
178 Ga0070667_100018227 3300005367 Bacteria 5821
179 Ga0070667_100018950 3300005367 Bacteria 5706
180 Ga0070667_100033505 3300005367 Bacteria 4294
181 Ga0070667_100250913 3300005367 Bacteria 1582
182 Ga0070667_100322795 3300005367 Bacteria 1393
183 Ga0070667_100363623 3300005367 Bacteria 1312
184 Ga0070708_100399073 3300005445 Bacteria 1297
185 Ga0070663_100150775 3300005455 Bacteria 1782
186 Ga0070663_100671072 3300005455 Bacteria 878
187 Ga0070663_100685578 3300005455 Bacteria 870
188 Ga0070678_100017979 3300005456 Bacteria 4570
189 Ga0070678_100540198 3300005456 Bacteria 1033
190 Ga0070678_100634619 3300005456 Bacteria 957
191 Ga0070678_101897167 3300005456 Bacteria 563
192 Ga0070662_100001195 3300005457 Bacteria 15948
193 Ga0070662_100002559 3300005457 Bacteria 11198
194 Ga0070662_100009859 3300005457 Bacteria 6260
195 Ga0070662_100009957 3300005457 Bacteria 6226
196 Ga0070662_100013148 3300005457 Bacteria 5502
197 Ga0070662_100155835 3300005457 Bacteria 1783
198 Ga0070662_100275603 3300005457 Bacteria 1360
199 Ga0070662_100621638 3300005457 Bacteria 910
200 Ga0070662_100697453 3300005457 Bacteria 859
201 Ga0070662_100949877 3300005457 Bacteria 735
202 Ga0070662_101160063 3300005457 Bacteria 663
203 Ga0070662_101183953 3300005457 Bacteria 657
204 Ga0070681_10030431 3300005458 Bacteria 5416
205 Ga0070681_10369166 3300005458 Bacteria 1345
206 Ga0068867_100000030 3300005459 Bacteria 86560
207 Ga0070679_100000001 3300005530 Bacteria 764811
208 Ga0070679_100060256 3300005530 Bacteria 3782
209 Ga0070679_100070254 3300005530 Bacteria 3494
210 Ga0070679_100309175 3300005530 Bacteria 1531
211 Ga0070684_100259463 3300005535 Bacteria 1590
212 Ga0068853_100008785 3300005539 Bacteria 8125
213 Ga0068853_100046035 3300005539 Bacteria 3739
214 Ga0068853_100058280 3300005539 Bacteria 3334
215 Ga0068853_100192312 3300005539 Bacteria 1854
216 Ga0068853_100333123 3300005539 Bacteria 1409
217 Ga0068853_100471867 3300005539 Bacteria 1182
218 Ga0068853_100511297 3300005539 Bacteria 1135
219 Ga0068853_100520501 3300005539 Bacteria 1124
220 Ga0068853_100638609 3300005539 Bacteria 1013
221 Ga0068853_101113256 3300005539 Bacteria 762
222 Ga0070672_100000170 3300005543 Bacteria 36164
223 Ga0070672_100001827 3300005543 Bacteria 13276
224 Ga0070672_100054222 3300005543 Bacteria 3138
225 Ga0070672_100291831 3300005543 Bacteria 1381
226 Ga0070672_100440561 3300005543 Bacteria 1121
227 Ga0070672_101282502 3300005543 Bacteria 654
228 Ga0070686_100590276 3300005544 Bacteria 874
229 Ga0070686_100727717 3300005544 Bacteria 794
230 Ga0070693_100052425 3300005547 Bacteria 2339
231 Ga0070665_100000079 3300005548 Bacteria 186925
232 Ga0070665_100000115 3300005548 Bacteria 151164
233 Ga0070665_100000168 3300005548 Bacteria 119133
234 Ga0070665_100000567 3300005548 Bacteria 51614
235 Ga0070665_100443165 3300005548 Bacteria 1308
236 Ga0070665_100496891 3300005548 Bacteria 1231
237 Ga0070665_100600147 3300005548 Bacteria 1114
238 Ga0070665_100792418 3300005548 Bacteria 961
239 Ga0070704_100422165 3300005549 Bacteria 1142
240 Ga0068855_100000079 3300005563 Bacteria 117264
241 Ga0068855_100001252 3300005563 Bacteria 31534
242 Ga0068855_100026106 3300005563 Bacteria 6988
243 Ga0068855_100187900 3300005563 Bacteria 2332
244 Ga0068855_100393047 3300005563 Bacteria 1521
245 Ga0068855_101365155 3300005563 Bacteria 731
246 Ga0070664_100001469 3300005564 Bacteria 18785
247 Ga0070664_100082258 3300005564 Bacteria 2776
248 Ga0070664_100590112 3300005564 Bacteria 1030
249 Ga0068857_100033095 3300005577 Bacteria 4571
250 Ga0068857_100046897 3300005577 Bacteria 3835
251 Ga0068857_100055560 3300005577 Bacteria 3513
252 Ga0068857_100207602 3300005577 Bacteria 1787
253 Ga0068857_100437437 3300005577 Bacteria 1221
254 Ga0068857_101260773 3300005577 Bacteria 717
255 Ga0068854_100000027 3300005578 Bacteria 117836
256 Ga0068854_100002912 3300005578 Bacteria 10618
257 Ga0068854_100012239 3300005578 Bacteria 5615
258 Ga0068854_100117055 3300005578 Bacteria 2018
259 Ga0068854_100310456 3300005578 Bacteria 1279
260 Ga0068854_101300220 3300005578 Bacteria 654
261 Ga0068856_100007880 3300005614 Bacteria 10399
262 Ga0068856_100336928 3300005614 Bacteria 1526
263 Ga0070702_100744821 3300005615 Bacteria 752
264 Ga0068852_100000447 3300005616 Bacteria 27185
265 Ga0068852_100201327 3300005616 Bacteria 1884
266 Ga0068852_100335200 3300005616 Bacteria 1473
267 Ga0068852_100683669 3300005616 Bacteria 1035
268 Ga0068852_100689913 3300005616 Bacteria 1031
269 Ga0068852_101382229 3300005616 Bacteria 726
270 Ga0068852_101478864 3300005616 Bacteria 701
271 Ga0068859_100000685 3300005617 Bacteria 34047
272 Ga0068859_100003342 3300005617 Bacteria 16314
273 Ga0068859_100015779 3300005617 Bacteria 7591
274 Ga0068859_100015892 3300005617 Bacteria 7565
275 Ga0068859_100037439 3300005617 Bacteria 4868
276 Ga0068859_100103350 3300005617 Bacteria 2907
277 Ga0068859_101094342 3300005617 Bacteria 876
278 Ga0068859_101716222 3300005617 Bacteria 694
279 Ga0068864_100000123 3300005618 Bacteria 75407
280 Ga0068864_100000480 3300005618 Bacteria 34614
281 Ga0068864_100000847 3300005618 Bacteria 25807
282 Ga0068864_100141099 3300005618 Bacteria 2173
283 Ga0068864_100468323 3300005618 Bacteria 1207
284 Ga0068861_100006738 3300005719 Bacteria 7850
285 Ga0068861_100747843 3300005719 Bacteria 913
286 Ga0068861_101508024 3300005719 Bacteria 660
287 Ga0068861_101573598 3300005719 Bacteria 647
288 Ga0068851_10040666 3300005834 Bacteria 2337
289 Ga0068851_10047555 3300005834 Bacteria 2173
290 Ga0068870_10122985 3300005840 Bacteria 1497
291 Ga0068863_100000027 3300005841 Bacteria 181884
292 Ga0068863_100001481 3300005841 Bacteria 23275
293 Ga0068863_100009665 3300005841 Bacteria 9410
294 Ga0068863_100028760 3300005841 Bacteria 5307
295 Ga0068863_100081416 3300005841 Bacteria 3067
296 Ga0068863_100191713 3300005841 Bacteria 1964
297 Ga0068858_100000137 3300005842 Bacteria 77050
298 Ga0068858_100000417 3300005842 Bacteria 44184
299 Ga0068858_100000655 3300005842 Bacteria 36151
300 Ga0068858_100001280 3300005842 Bacteria 25983
301 Ga0068860_100000074 3300005843 Bacteria 173022
302 Ga0068860_100008662 3300005843 Bacteria 10133
303 Ga0068860_100086393 3300005843 Bacteria 2985
304 Ga0068860_100112868 3300005843 Bacteria 2598
305 Ga0068860_100195788 3300005843 Bacteria 1957
306 Ga0068862_100000043 3300005844 Bacteria 164356
307 Ga0068862_100000286 3300005844 Bacteria 55798
308 Ga0068862_100003380 3300005844 Bacteria 13765
309 Ga0068862_100009116 3300005844 Bacteria 8214
310 Ga0068862_100045522 3300005844 Bacteria 3744
311 Ga0068862_100054975 3300005844 Bacteria 3409
312 Ga0068862_100081887 3300005844 Bacteria 2800
313 Ga0068862_101210179 3300005844 Bacteria 754
314 Ga0068862_101248942 3300005844 Bacteria 743
315 Ga0068862_101398227 3300005844 Bacteria 703
316 Ga0068862_101513777 3300005844 Bacteria 676
317 Ga0081455_10000392 3300005937 Bacteria 57696
318 Ga0081539_10012387 3300005985 Bacteria 6579
319 Ga0075368_10000388 3300006042 Bacteria 12955
320 Ga0075363_100333995 3300006048 Bacteria 883
321 Ga0075364_10026344 3300006051 Bacteria 3709
322 Ga0075367_10040068 3300006178 Bacteria 2734
323 Ga0097621_100058103 3300006237 Bacteria 3165
324 Ga0097621_100380793 3300006237 Bacteria 1260
325 Ga0097621_100879107 3300006237 Bacteria 834
326 Ga0075370_10003445 3300006353 Bacteria 7532
327 Ga0075370_10008159 3300006353 Bacteria 5373
328 Ga0075370_10279286 3300006353 Bacteria 992
329 Ga0068871_100008035 3300006358 Bacteria 7572
330 Ga0068871_100172341 3300006358 Bacteria 1856
331 Ga0068871_101062358 3300006358 Bacteria 756
332 Ga0075431_100292420 3300006847 Bacteria 1647
333 Ga0075434_100721426 3300006871 Bacteria 1014
334 Ga0068865_100000021 3300006881 Bacteria 103137
335 Ga0068865_100538070 3300006881 Bacteria 979
336 Ga0068865_100826707 3300006881 Bacteria 801
337 Ga0097620_100000685 3300006931 Bacteria 34047
338 Ga0097620_100003342 3300006931 Bacteria 16314
339 Ga0097620_100015779 3300006931 Bacteria 7591
340 Ga0097620_100015892 3300006931 Bacteria 7565
341 Ga0097620_100037439 3300006931 Bacteria 4868
342 Ga0097620_100103347 3300006931 Bacteria 2907
343 Ga0097620_101094399 3300006931 Bacteria 876
344 Ga0097620_101716081 3300006931 Bacteria 694
345 Ga0105250_10008687 3300009092 Bacteria 4303
346 Ga0105240_10016757 3300009093 Bacteria 9911
347 Ga0105240_10569649 3300009093 Bacteria 1251
348 Ga0111539_10305768 3300009094 Bacteria 1850
349 Ga0105245_10089647 3300009098 Bacteria 2828
350 Ga0105245_10230096 3300009098 Bacteria 1793
351 Ga0105247_10041803 3300009101 Bacteria 2805
352 Ga0105247_10360070 3300009101 Bacteria 1025
353 Ga0105243_10001112 3300009148 Bacteria 24427
354 Ga0105243_11106014 3300009148 Bacteria 801
355 Ga0105241_10002058 3300009174 Bacteria 15192
356 Ga0105241_10937703 3300009174 Bacteria 806
357 Ga0105241_11033483 3300009174 Bacteria 770
358 Ga0105241_11163857 3300009174 Bacteria 729
359 Ga0105242_10001345 3300009176 Bacteria 19409
360 Ga0105242_10115602 3300009176 Bacteria 2294
361 Ga0105248_10001364 3300009177 Bacteria 27266
362 Ga0105248_10002301 3300009177 Bacteria 21148
363 Ga0105248_10002811 3300009177 Bacteria 19328
364 Ga0105248_10019227 3300009177 Bacteria 7557
365 Ga0105248_10295757 3300009177 Bacteria 1823
366 Ga0105248_10486220 3300009177 Bacteria 1391
367 Ga0105248_10686952 3300009177 Bacteria 1155
368 Ga0105237_10077306 3300009545 Bacteria 3318
369 Ga0105237_10143831 3300009545 Bacteria 2379
370 Ga0105238_10386174 3300009551 Bacteria 1392
371 Ga0105238_10483622 3300009551 Bacteria 1237
372 Ga0105238_10902790 3300009551 Bacteria 902
373 Ga0105249_10000002 3300009553 Bacteria 376207
374 Ga0105249_10123880 3300009553 Bacteria 2459
375 Ga0105249_10137417 3300009553 Bacteria 2341
376 Ga0105249_10344297 3300009553 Bacteria 1508
377 Ga0105249_10568833 3300009553 Bacteria 1186
378 Ga0105148_102955 3300009978 Bacteria 1199
379 Ga0105239_10103047 3300010375 Bacteria 3158
380 Ga0105239_11235093 3300010375 Bacteria 861
381 Ga0105246_10004310 3300011119 Bacteria 8653
382 Ga0157373_10006944 3300013100 Bacteria 8430
383 Ga0157373_10011416 3300013100 Bacteria 6533
384 Ga0157373_10025391 3300013100 Bacteria 4286
385 Ga0157373_10044097 3300013100 Bacteria 3184
386 Ga0157373_10151978 3300013100 Bacteria 1628
387 Ga0157373_10212678 3300013100 Bacteria 1364
388 Ga0157373_10275929 3300013100 Bacteria 1191
389 Ga0157373_10322437 3300013100 Bacteria 1099
390 Ga0157373_10457907 3300013100 Bacteria 918
391 Ga0157371_10000558 3300013102 Bacteria 44161
392 Ga0157371_10006691 3300013102 Bacteria 9426
393 Ga0157371_10047545 3300013102 Bacteria 3051
394 Ga0157371_10136047 3300013102 Bacteria 1750
395 Ga0157371_10147472 3300013102 Bacteria 1677
396 Ga0157371_10530369 3300013102 Bacteria 871
397 Ga0157371_10620831 3300013102 Bacteria 805
398 Ga0157371_10767833 3300013102 Bacteria 725
399 Ga0157371_10869987 3300013102 Bacteria 682
400 Ga0157370_10001520 3300013104 Bacteria 28677
401 Ga0157370_10120289 3300013104 Bacteria 2452
402 Ga0157370_10263953 3300013104 Bacteria 1591
403 Ga0157370_10304251 3300013104 Bacteria 1471
404 Ga0157370_10323795 3300013104 Bacteria 1421
405 Ga0157370_10435606 3300013104 Bacteria 1206
406 Ga0157370_10773426 3300013104 Bacteria 874
407 Ga0157369_10000137 3300013105 Bacteria 103542
408 Ga0157369_10005976 3300013105 Bacteria 14139
409 Ga0157369_10008509 3300013105 Bacteria 11766
410 Ga0157369_10025807 3300013105 Bacteria 6518
411 Ga0157369_10103163 3300013105 Bacteria 3038
412 Ga0157369_10125134 3300013105 Bacteria 2726
413 Ga0157369_10508432 3300013105 Bacteria 1246
414 Ga0157369_11201321 3300013105 Bacteria 774
415 Ga0157374_10046682 3300013296 Bacteria 4013
416 Ga0157374_10583171 3300013296 Bacteria 1127
417 Ga0157378_10018559 3300013297 Bacteria 6113
418 Ga0157378_11916800 3300013297 Bacteria 642
419 Ga0163162_10009361 3300013306 Bacteria 9525
420 Ga0163162_10104374 3300013306 Bacteria 2929
421 Ga0163162_10137629 3300013306 Bacteria 2553
422 Ga0163162_10161621 3300013306 Bacteria 2361
423 Ga0163162_10402535 3300013306 Bacteria 1501
424 Ga0163162_10585853 3300013306 Bacteria 1242
425 Ga0157372_10003647 3300013307 Bacteria 16568
426 Ga0157372_10062824 3300013307 Bacteria 4162
427 Ga0157372_10125441 3300013307 Bacteria 2951
428 Ga0157372_10177007 3300013307 Bacteria 2469
429 Ga0157372_10379538 3300013307 Bacteria 1647
430 Ga0157372_10806964 3300013307 Bacteria 1090
431 Ga0157372_10825167 3300013307 Bacteria 1077
432 Ga0157372_10962040 3300013307 Bacteria 990
433 Ga0157372_11223144 3300013307 Bacteria 868
434 Ga0157372_11713578 3300013307 Bacteria 723
435 Ga0157372_11976795 3300013307 Bacteria 670
436 Ga0157375_10002223 3300013308 Bacteria 16796
437 Ga0157375_10191240 3300013308 Bacteria 2201
438 Ga0157375_10251389 3300013308 Bacteria 1928
439 Ga0157375_11718467 3300013308 Bacteria 743
440 Ga0163163_10000307 3300014325 Bacteria 48168
441 Ga0163163_10009391 3300014325 Bacteria 8731
442 Ga0163163_10396923 3300014325 Bacteria 1437
443 Ga0163163_10682094 3300014325 Bacteria 1091
444 Ga0163163_10804138 3300014325 Bacteria 1004
445 Ga0163163_11626519 3300014325 Bacteria 707
446 Ga0157380_10000040 3300014326 Bacteria 76401
447 Ga0157380_10009741 3300014326 Bacteria 6895
448 Ga0157380_10130787 3300014326 Bacteria 2141
449 Ga0157380_10335812 3300014326 Bacteria 1407
450 Ga0182008_10416910 3300014497 Bacteria 724
451 Ga0157377_10130303 3300014745 Bacteria 1535
452 Ga0157377_10519416 3300014745 Bacteria 836
453 Ga0157377_10706156 3300014745 Bacteria 733
454 Ga0157379_10011314 3300014968 Bacteria 7778
455 Ga0157376_10000078 3300014969 Bacteria 72879
456 Ga0157376_11474643 3300014969 Bacteria 713
457 Ga0183363_1004 3300015690 Bacteria 416766
458 Ga0163161_10026055 3300017792 Bacteria 4142
459 Ga0163161_10028824 3300017792 Bacteria 3944
460 Ga0163161_10032811 3300017792 Bacteria 3709
461 Ga0163161_10166076 3300017792 Bacteria 1685
462 Ga0163161_10233578 3300017792 Bacteria 1428
463 Ga0163161_10256005 3300017792 Bacteria 1366
464 Ga0163161_10749918 3300017792 Bacteria 817
465 Ga0163161_11131813 3300017792 Bacteria 674
466 Ga0163161_11293530 3300017792 Bacteria 634
467 Ga0197907_11444725 3300020069 Bacteria 763
468 Ga0206356_10395973 3300020070 Bacteria 2976
469 Ga0206356_11873308 3300020070 Bacteria 671
470 Ga0206352_10690969 3300020078 Bacteria 663
471 Ga0206353_10195071 3300020082 Bacteria 905
472 Ga0213873_10000026 3300021358 Bacteria 74525
473 Ga0213876_10000149 3300021384 Bacteria 74548
474 Ga0213876_10000371 3300021384 Bacteria 38154
475 Ga0213876_10041444 3300021384 Bacteria 2433
476 Ga0224712_10462518 3300022467 Bacteria 610
477 Ga0207427_100584 3300025231 Bacteria 18382
478 Ga0209437_122573 3300025233 Bacteria 736
479 Ga0207425_1000019 3300025245 Bacteria 399942
480 Ga0207425_1020371 3300025245 Bacteria 1419
481 Ga0209148_1000061 3300025254 Bacteria 349575
482 Ga0209148_1002009 3300025254 Bacteria 7965
483 Ga0209129_1006020 3300025258 Bacteria 4069
484 Ga0209233_1000003 3300025261 Bacteria 1607366
485 Ga0209565_1000089 3300025263 Bacteria 150511
486 Ga0209565_1014518 3300025263 Bacteria 1805
487 Ga0207666_1028753 3300025271 Bacteria 845
488 Ga0209455_1000383 3300025272 Bacteria 39626
489 Ga0209673_1017774 3300025273 Bacteria 2611
490 Ga0209675_1000137 3300025291 Bacteria 98902
491 Ga0209676_1000138 3300025292 Bacteria 178932
492 Ga0209676_1000883 3300025292 Bacteria 38382
493 Ga0209676_1001128 3300025292 Bacteria 29355
494 Ga0209676_1003578 3300025292 Bacteria 9386
495 Ga0209676_1059610 3300025292 Bacteria 957
496 Ga0209025_1000304 3300025294 Bacteria 109508
497 Ga0209025_1037422 3300025294 Bacteria 2153
498 Ga0209564_1000686 3300025295 Bacteria 49885
499 Ga0209564_1035551 3300025295 Bacteria 1441
500 Ga0209758_1000019 3300025297 Bacteria 743682
501 Ga0209050_1000001 3300025298 Bacteria 3563507
502 Ga0209050_1000010 3300025298 Bacteria 980454
503 Ga0209050_1001243 3300025298 Bacteria 29491
504 Ga0209050_1006198 3300025298 Bacteria 7174
505 Ga0209050_1007401 3300025298 Bacteria 6166
506 Ga0209050_1053928 3300025298 Bacteria 995
507 Ga0209051_1000309 3300025303 Bacteria 76449
508 Ga0209257_1000027 3300025304 Bacteria 703541
509 Ga0209257_1000250 3300025304 Bacteria 124024
510 Ga0209257_1000603 3300025304 Bacteria 59325
511 Ga0209257_1003048 3300025304 Bacteria 15115
512 Ga0209257_1003101 3300025304 Bacteria 14890
513 Ga0209257_1006641 3300025304 Bacteria 7352
514 Ga0207697_10012170 3300025315 Bacteria 3617
515 Ga0207697_10031163 3300025315 Bacteria 2182
516 Ga0207697_10062757 3300025315 Bacteria 1548
517 Ga0207656_10031667 3300025321 Bacteria 2193
518 Ga0207656_10052406 3300025321 Bacteria 1767
519 Ga0207682_10001448 3300025893 Bacteria 10955
520 Ga0207682_10355840 3300025893 Bacteria 690
521 Ga0207710_10023671 3300025900 Bacteria 2640
522 Ga0207710_10270140 3300025900 Bacteria 854
523 Ga0207688_10105600 3300025901 Bacteria 1630
524 Ga0207688_10474667 3300025901 Bacteria 781
525 Ga0207680_10005365 3300025903 Bacteria 6121
526 Ga0207680_10116533 3300025903 Bacteria 1741
527 Ga0207680_10476841 3300025903 Bacteria 887
528 Ga0207680_10526975 3300025903 Bacteria 843
529 Ga0207647_10009613 3300025904 Bacteria 6866
530 Ga0207647_10011142 3300025904 Bacteria 6316
531 Ga0207647_10013095 3300025904 Bacteria 5763
532 Ga0207647_10116095 3300025904 Bacteria 1580
533 Ga0207647_10165295 3300025904 Bacteria 1290
534 Ga0207647_10193197 3300025904 Bacteria 1179
535 Ga0207647_10247766 3300025904 Bacteria 1022
536 Ga0207647_10303635 3300025904 Bacteria 909
537 Ga0207645_10008246 3300025907 Bacteria 7285
538 Ga0207645_10044562 3300025907 Bacteria 2839
539 Ga0207645_10061671 3300025907 Bacteria 2395
540 Ga0207645_10306956 3300025907 Bacteria 1057
541 Ga0207705_10000005 3300025909 Bacteria 673478
542 Ga0207705_10000025 3300025909 Bacteria 259826
543 Ga0207705_10000030 3300025909 Bacteria 239341
544 Ga0207705_10000143 3300025909 Bacteria 76756
545 Ga0207705_10000190 3300025909 Bacteria 62546
546 Ga0207705_10003278 3300025909 Bacteria 12329
547 Ga0207705_10029863 3300025909 Bacteria 3887
548 Ga0207705_10030549 3300025909 Bacteria 3844
549 Ga0207705_10081335 3300025909 Bacteria 2361
550 Ga0207705_10099905 3300025909 Bacteria 2134
551 Ga0207705_10146844 3300025909 Bacteria 1765
552 Ga0207705_10186776 3300025909 Bacteria 1566
553 Ga0207705_11241794 3300025909 Bacteria 571
554 Ga0207654_10185478 3300025911 Bacteria 1360
555 Ga0207707_10026465 3300025912 Bacteria 5070
556 Ga0207707_10046883 3300025912 Bacteria 3764
557 Ga0207707_10164823 3300025912 Bacteria 1937
558 Ga0207695_10004964 3300025913 Bacteria 17910
559 Ga0207695_10354148 3300025913 Bacteria 1355
560 Ga0207695_10390953 3300025913 Bacteria 1276
561 Ga0207695_10672144 3300025913 Bacteria 916
562 Ga0207671_10008873 3300025914 Bacteria 8466
563 Ga0207671_10027697 3300025914 Bacteria 4236
564 Ga0207660_10000972 3300025917 Bacteria 18963
565 Ga0207660_10098697 3300025917 Bacteria 2179
566 Ga0207660_10398930 3300025917 Bacteria 1108
567 Ga0207657_10000407 3300025919 Bacteria 45521
568 Ga0207657_10000832 3300025919 Bacteria 32589
569 Ga0207657_10001735 3300025919 Bacteria 23492
570 Ga0207657_10008599 3300025919 Bacteria 10338
571 Ga0207657_10015232 3300025919 Bacteria 7458
572 Ga0207657_10048797 3300025919 Bacteria 3694
573 Ga0207657_10066155 3300025919 Bacteria 3077
574 Ga0207657_10097322 3300025919 Bacteria 2447
575 Ga0207657_10097816 3300025919 Bacteria 2440
576 Ga0207657_10126354 3300025919 Bacteria 2100
577 Ga0207657_10459546 3300025919 Bacteria 999
578 Ga0207657_10577195 3300025919 Bacteria 878
579 Ga0207657_10800935 3300025919 Bacteria 728
580 Ga0207649_10000016 3300025920 Bacteria 243843
581 Ga0207649_10001000 3300025920 Bacteria 17495
582 Ga0207649_10286783 3300025920 Bacteria 1199
583 Ga0207649_10713604 3300025920 Bacteria 778
584 Ga0207649_10775960 3300025920 Bacteria 747
585 Ga0207649_11221239 3300025920 Bacteria 594
586 Ga0207652_10000002 3300025921 Bacteria 878035
587 Ga0207652_10039973 3300025921 Bacteria 3982
588 Ga0207652_10362625 3300025921 Bacteria 1308
589 Ga0207652_11393876 3300025921 Bacteria 604
590 Ga0207681_10000014 3300025923 Bacteria 353422
591 Ga0207681_10021994 3300025923 Bacteria 4062
592 Ga0207681_10030478 3300025923 Bacteria 3517
593 Ga0207681_10061301 3300025923 Bacteria 2585
594 Ga0207681_10075950 3300025923 Bacteria 2358
595 Ga0207681_10102207 3300025923 Bacteria 2069
596 Ga0207681_10282739 3300025923 Bacteria 1307
597 Ga0207681_10301854 3300025923 Bacteria 1267
598 Ga0207681_10349944 3300025923 Bacteria 1182
599 Ga0207681_10365845 3300025923 Bacteria 1158
600 Ga0207681_10383823 3300025923 Bacteria 1131
601 Ga0207681_10502319 3300025923 Bacteria 993
602 Ga0207681_10518074 3300025923 Bacteria 978
603 Ga0207681_10694504 3300025923 Bacteria 846
604 Ga0207681_11438304 3300025923 Bacteria 578
605 Ga0207694_10016029 3300025924 Bacteria 5654
606 Ga0207694_10212076 3300025924 Bacteria 1578
607 Ga0207694_10254974 3300025924 Bacteria 1436
608 Ga0207694_10328973 3300025924 Bacteria 1262
609 Ga0207694_10382941 3300025924 Bacteria 1168
610 Ga0207694_10527346 3300025924 Bacteria 990
611 Ga0207694_11640831 3300025924 Bacteria 541
612 Ga0207650_10000015 3300025925 Bacteria 369173
613 Ga0207650_10001533 3300025925 Bacteria 16559
614 Ga0207650_10020863 3300025925 Bacteria 4627
615 Ga0207650_10099622 3300025925 Bacteria 2234
616 Ga0207650_10105761 3300025925 Bacteria 2173
617 Ga0207650_10211933 3300025925 Bacteria 1556
618 Ga0207650_10316048 3300025925 Bacteria 1278
619 Ga0207650_10469281 3300025925 Bacteria 1049
620 Ga0207650_10554679 3300025925 Bacteria 963
621 Ga0207650_10565917 3300025925 Bacteria 954
622 Ga0207650_10603530 3300025925 Bacteria 923
623 Ga0207650_11049559 3300025925 Bacteria 693
624 Ga0207650_11318735 3300025925 Bacteria 614
625 Ga0207650_11393860 3300025925 Bacteria 596
626 Ga0207659_10004323 3300025926 Bacteria 8589
627 Ga0207659_10008288 3300025926 Bacteria 6443
628 Ga0207659_10011691 3300025926 Bacteria 5554
629 Ga0207659_10040952 3300025926 Bacteria 3243
630 Ga0207659_10110673 3300025926 Bacteria 2087
631 Ga0207659_10167834 3300025926 Bacteria 1729
632 Ga0207659_10175755 3300025926 Bacteria 1692
633 Ga0207659_10607975 3300025926 Bacteria 932
634 Ga0207687_10000683 3300025927 Bacteria 22873
635 Ga0207687_10057747 3300025927 Bacteria 2727
636 Ga0207687_10067528 3300025927 Bacteria 2544
637 Ga0207687_10282961 3300025927 Bacteria 1330
638 Ga0207644_10000098 3300025931 Bacteria 63062
639 Ga0207644_10013892 3300025931 Bacteria 5379
640 Ga0207644_10019602 3300025931 Bacteria 4591
641 Ga0207644_10038753 3300025931 Bacteria 3359
642 Ga0207644_10057346 3300025931 Bacteria 2812
643 Ga0207644_10209581 3300025931 Bacteria 1540
644 Ga0207644_10533404 3300025931 Bacteria 970
645 Ga0207690_10000002 3300025932 Bacteria 807473
646 Ga0207690_10001554 3300025932 Bacteria 14378
647 Ga0207690_10068260 3300025932 Bacteria 2442
648 Ga0207690_10090750 3300025932 Bacteria 2158
649 Ga0207690_10126691 3300025932 Bacteria 1863
650 Ga0207690_10429814 3300025932 Bacteria 1058
651 Ga0207690_10604744 3300025932 Bacteria 895
652 Ga0207690_11357505 3300025932 Bacteria 594
653 Ga0207706_10000299 3300025933 Bacteria 53751
654 Ga0207706_10009297 3300025933 Bacteria 9025
655 Ga0207706_10017508 3300025933 Bacteria 6459
656 Ga0207706_10038677 3300025933 Bacteria 4232
657 Ga0207706_10044628 3300025933 Bacteria 3929
658 Ga0207706_10047011 3300025933 Bacteria 3820
659 Ga0207706_10084827 3300025933 Bacteria 2785
660 Ga0207706_10115718 3300025933 Bacteria 2358
661 Ga0207706_10228795 3300025933 Bacteria 1627
662 Ga0207706_10333385 3300025933 Bacteria 1320
663 Ga0207706_10771657 3300025933 Bacteria 818
664 Ga0207706_10846019 3300025933 Bacteria 775
665 Ga0207686_10010225 3300025934 Bacteria 5103
666 Ga0207686_10522826 3300025934 Bacteria 924
667 Ga0207709_10000118 3300025935 Bacteria 122125
668 Ga0207669_10064384 3300025937 Bacteria 2268
669 Ga0207669_10409654 3300025937 Bacteria 1064
670 Ga0207669_11248865 3300025937 Bacteria 630
671 Ga0207704_10000027 3300025938 Bacteria 122372
672 Ga0207704_10425500 3300025938 Bacteria 1054
673 Ga0207704_10638267 3300025938 Bacteria 876
674 Ga0207691_10000765 3300025940 Bacteria 31799
675 Ga0207691_10014990 3300025940 Bacteria 7379
676 Ga0207691_10035929 3300025940 Bacteria 4593
677 Ga0207691_10125936 3300025940 Bacteria 2267
678 Ga0207691_10164099 3300025940 Bacteria 1947
679 Ga0207691_10288264 3300025940 Bacteria 1412
680 Ga0207691_10381693 3300025940 Bacteria 1203
681 Ga0207711_10000917 3300025941 Bacteria 28411
682 Ga0207711_10001243 3300025941 Bacteria 24174
683 Ga0207711_10001332 3300025941 Bacteria 23354
684 Ga0207711_11248071 3300025941 Bacteria 685
685 Ga0207689_10000309 3300025942 Bacteria 44940
686 Ga0207689_10342030 3300025942 Bacteria 1243
687 Ga0207689_10673590 3300025942 Bacteria 872
688 Ga0207661_10740497 3300025944 Bacteria 904
689 Ga0207679_10008128 3300025945 Bacteria 6674
690 Ga0207679_10155817 3300025945 Bacteria 1865
691 Ga0207679_10425914 3300025945 Bacteria 1172
692 Ga0207679_11123238 3300025945 Bacteria 721
693 Ga0207667_10000035 3300025949 Bacteria 301056
694 Ga0207667_10001479 3300025949 Bacteria 29480
695 Ga0207667_10032281 3300025949 Bacteria 5644
696 Ga0207667_10056324 3300025949 Bacteria 4130
697 Ga0207667_10100914 3300025949 Bacteria 2977
698 Ga0207667_10369894 3300025949 Bacteria 1461
699 Ga0207667_10444962 3300025949 Bacteria 1317
700 Ga0207651_10000016 3300025960 Bacteria 122094
701 Ga0207651_10016674 3300025960 Bacteria 4313
702 Ga0207651_10020708 3300025960 Bacteria 3977
703 Ga0207651_10039183 3300025960 Bacteria 3122
704 Ga0207651_10053889 3300025960 Bacteria 2752
705 Ga0207651_10079646 3300025960 Bacteria 2354
706 Ga0207651_10088403 3300025960 Bacteria 2259
707 Ga0207712_10000002 3300025961 Bacteria 706628
708 Ga0207712_10074531 3300025961 Bacteria 2451
709 Ga0207712_10224948 3300025961 Bacteria 1502
710 Ga0207712_10288068 3300025961 Bacteria 1343
711 Ga0207712_10978701 3300025961 Bacteria 750
712 Ga0207668_10000009 3300025972 Bacteria 188071
713 Ga0207668_10000161 3300025972 Bacteria 46772
714 Ga0207668_10000574 3300025972 Bacteria 23000
715 Ga0207668_10000704 3300025972 Bacteria 20478
716 Ga0207668_10002721 3300025972 Bacteria 10348
717 Ga0207668_10028897 3300025972 Bacteria 3630
718 Ga0207668_10034340 3300025972 Bacteria 3367
719 Ga0207668_10066229 3300025972 Bacteria 2560
720 Ga0207668_10066683 3300025972 Bacteria 2552
721 Ga0207668_10208728 3300025972 Bacteria 1561
722 Ga0207668_10311923 3300025972 Bacteria 1302
723 Ga0207668_10734230 3300025972 Bacteria 870
724 Ga0207640_10000085 3300025981 Bacteria 73838
725 Ga0207640_10001049 3300025981 Bacteria 15289
726 Ga0207640_10060676 3300025981 Bacteria 2501
727 Ga0207640_10109389 3300025981 Bacteria 1955
728 Ga0207640_10186562 3300025981 Bacteria 1560
729 Ga0207640_11004801 3300025981 Bacteria 734
730 Ga0207658_10000010 3300025986 Bacteria 240224
731 Ga0207658_10000042 3300025986 Bacteria 134223
732 Ga0207658_10000512 3300025986 Bacteria 35351
733 Ga0207658_10010272 3300025986 Bacteria 6360
734 Ga0207658_10029984 3300025986 Bacteria 3848
735 Ga0207658_10030906 3300025986 Bacteria 3798
736 Ga0207658_10092749 3300025986 Bacteria 2346
737 Ga0207658_10191313 3300025986 Bacteria 1701
738 Ga0207658_11065924 3300025986 Bacteria 738
739 Ga0207677_10000100 3300026023 Bacteria 70908
740 Ga0207677_10000171 3300026023 Bacteria 51383
741 Ga0207703_10000330 3300026035 Bacteria 51662
742 Ga0207703_10001633 3300026035 Bacteria 20216
743 Ga0207703_10005667 3300026035 Bacteria 10025
744 Ga0207703_10015617 3300026035 Bacteria 5923
745 Ga0207639_10000323 3300026041 Bacteria 33257
746 Ga0207639_10015067 3300026041 Bacteria 5445
747 Ga0207639_10018857 3300026041 Bacteria 4910
748 Ga0207639_10019004 3300026041 Bacteria 4893
749 Ga0207639_10131154 3300026041 Bacteria 2075
750 Ga0207639_10161654 3300026041 Bacteria 1888
751 Ga0207639_10192741 3300026041 Bacteria 1742
752 Ga0207639_10330174 3300026041 Bacteria 1357
753 Ga0207639_10348550 3300026041 Bacteria 1322
754 Ga0207639_10441627 3300026041 Bacteria 1180
755 Ga0207639_10594651 3300026041 Bacteria 1020
756 Ga0207639_10837237 3300026041 Bacteria 858
757 Ga0207639_12268210 3300026041 Bacteria 504
758 Ga0207678_10000068 3300026067 Bacteria 81610
759 Ga0207678_10001182 3300026067 Bacteria 23937
760 Ga0207678_10041242 3300026067 Bacteria 4002
761 Ga0207678_10083741 3300026067 Bacteria 2728
762 Ga0207678_10184195 3300026067 Bacteria 1783
763 Ga0207678_10235742 3300026067 Bacteria 1567
764 Ga0207678_10365237 3300026067 Bacteria 1246
765 Ga0207678_10461979 3300026067 Bacteria 1104
766 Ga0207678_10591877 3300026067 Bacteria 972
767 Ga0207678_10747791 3300026067 Bacteria 862
768 Ga0207708_10791015 3300026075 Bacteria 816
769 Ga0207702_10001343 3300026078 Bacteria 24595
770 Ga0207702_10009303 3300026078 Bacteria 8255
771 Ga0207702_10017653 3300026078 Bacteria 5904
772 Ga0207702_10033258 3300026078 Bacteria 4306
773 Ga0207702_10203201 3300026078 Bacteria 1838
774 Ga0207702_10632255 3300026078 Bacteria 1052
775 Ga0207641_10000045 3300026088 Bacteria 181882
776 Ga0207641_10000046 3300026088 Bacteria 180836
777 Ga0207641_10000502 3300026088 Bacteria 44127
778 Ga0207641_10000648 3300026088 Bacteria 37849
779 Ga0207641_10002294 3300026088 Bacteria 17795
780 Ga0207641_10007534 3300026088 Bacteria 9055
781 Ga0207641_10012935 3300026088 Bacteria 6847
782 Ga0207641_10054395 3300026088 Bacteria 3396
783 Ga0207641_10544279 3300026088 Bacteria 1131
784 Ga0207641_10608571 3300026088 Bacteria 1070
785 Ga0207648_10000116 3300026089 Bacteria 77755
786 Ga0207648_10008755 3300026089 Bacteria 9754
787 Ga0207676_10000021 3300026095 Bacteria 296572
788 Ga0207676_10016538 3300026095 Bacteria 5341
789 Ga0207676_10071181 3300026095 Bacteria 2791
790 Ga0207676_10078103 3300026095 Bacteria 2680
791 Ga0207676_10152251 3300026095 Bacteria 1993
792 Ga0207676_10293459 3300026095 Bacteria 1482
793 Ga0207676_11024649 3300026095 Bacteria 814
794 Ga0207674_10026530 3300026116 Bacteria 6149
795 Ga0207674_10045558 3300026116 Bacteria 4510
796 Ga0207674_10068656 3300026116 Bacteria 3567
797 Ga0207674_10140417 3300026116 Bacteria 2375
798 Ga0207674_10254932 3300026116 Bacteria 1701
799 Ga0207674_10510032 3300026116 Bacteria 1162
800 Ga0207675_100011968 3300026118 Bacteria 8108
801 Ga0207675_100014486 3300026118 Bacteria 7350
802 Ga0207675_100039788 3300026118 Bacteria 4388
803 Ga0207675_100135661 3300026118 Bacteria 2335
804 Ga0207675_101490432 3300026118 Bacteria 697
805 Ga0207683_10046758 3300026121 Bacteria 3789
806 Ga0207683_10188073 3300026121 Bacteria 1874
807 Ga0207683_10373124 3300026121 Bacteria 1311
808 Ga0207683_10689305 3300026121 Bacteria 947
809 Ga0207698_10000746 3300026142 Bacteria 18863
810 Ga0207698_10012096 3300026142 Bacteria 5630
811 Ga0207698_10197045 3300026142 Bacteria 1800
812 Ga0207698_10280443 3300026142 Bacteria 1541
813 Ga0207698_10358738 3300026142 Bacteria 1380
814 Ga0207698_10479909 3300026142 Bacteria 1206
815 Ga0209967_1004839 3300027364 Bacteria 1800
816 Ga0209970_1007728 3300027614 Bacteria 1763
817 Ga0209983_1005081 3300027665 Bacteria 2741
818 Ga0209983_1056324 3300027665 Bacteria 865
819 Ga0209813_10000172 3300027866 Bacteria 21011
820 Ga0209974_10010160 3300027876 Bacteria 3179
821 Ga0209974_10039020 3300027876 Bacteria 1579
822 Ga0209974_10119293 3300027876 Bacteria 933
823 Ga0209974_10324567 3300027876 Bacteria 593
824 Ga0207428_10176052 3300027907 Bacteria 1618
825 Ga0268266_10000015 3300028379 Bacteria 630629
826 Ga0268266_10000130 3300028379 Bacteria 147912
827 Ga0268266_10000486 3300028379 Bacteria 56915
828 Ga0268266_10000573 3300028379 Bacteria 50799
829 Ga0268266_10014935 3300028379 Bacteria 6668
830 Ga0268266_10085215 3300028379 Bacteria 2760
831 Ga0268266_10230132 3300028379 Bacteria 1707
832 Ga0268266_10416978 3300028379 Bacteria 1272
833 Ga0268266_10657572 3300028379 Bacteria 1009
834 Ga0268265_10000013 3300028380 Bacteria 341536
835 Ga0268265_10000231 3300028380 Bacteria 63731
836 Ga0268265_10000324 3300028380 Bacteria 52110
837 Ga0268265_10011100 3300028380 Bacteria 6087
838 Ga0268265_10057429 3300028380 Bacteria 2966
839 Ga0268265_10102892 3300028380 Bacteria 2311
840 Ga0268265_10247232 3300028380 Bacteria 1577
841 Ga0268265_10277997 3300028380 Bacteria 1497
842 Ga0268265_11121176 3300028380 Bacteria 782
843 Ga0268265_11199530 3300028380 Bacteria 756
844 Ga0268265_11811369 3300028380 Bacteria 617
845 Ga0268265_11837781 3300028380 Bacteria 612
846 Ga0268264_10000070 3300028381 Bacteria 268524
847 Ga0268264_10000410 3300028381 Bacteria 60680
848 Ga0268264_10000418 3300028381 Bacteria 59942
849 Ga0268264_10000539 3300028381 Bacteria 47920
850 Ga0268264_10005789 3300028381 Bacteria 10479
851 Ga0268264_10031237 3300028381 Bacteria 4367
852 Ga0268264_10438302 3300028381 Bacteria 1263
853 Ga0268264_10610096 3300028381 Bacteria 1076
854 Ga0268264_10903906 3300028381 Bacteria 886
855 Ga0316176_1000705 3300030732 Bacteria 1831
856 Ga0307513_10185192 3300031456 Bacteria 1940
857 Ga0307513_10310592 3300031456 Bacteria 1339
858 Ga0307408_100001159 3300031548 Bacteria 20050
859 Ga0307408_100016656 3300031548 Bacteria 4911
860 Ga0307408_100033445 3300031548 Bacteria 3592
861 Ga0307408_100041334 3300031548 Bacteria 3268
862 Ga0307408_100063630 3300031548 Bacteria 2699
863 Ga0307408_100089857 3300031548 Bacteria 2316
864 Ga0307408_100125044 3300031548 Bacteria 1998
865 Ga0307408_100356372 3300031548 Bacteria 1243
866 Ga0307408_100362664 3300031548 Bacteria 1233
867 Ga0307408_100381625 3300031548 Bacteria 1205
868 Ga0307408_100565976 3300031548 Bacteria 1005
869 Ga0307408_100727833 3300031548 Bacteria 894
870 Ga0307408_101190148 3300031548 Bacteria 710
871 Ga0307408_101246240 3300031548 Bacteria 695
872 Ga0307408_101474894 3300031548 Bacteria 642
873 Ga0307408_101766218 3300031548 Bacteria 591
874 Ga0307408_102142702 3300031548 Bacteria 539
875 Ga0307405_10000240 3300031731 Bacteria 19933
876 Ga0307405_10000472 3300031731 Bacteria 15121
877 Ga0307405_10011163 3300031731 Bacteria 4691
878 Ga0307405_10016052 3300031731 Bacteria 4073
879 Ga0307405_10017649 3300031731 Bacteria 3922
880 Ga0307405_10022731 3300031731 Bacteria 3551
881 Ga0307405_10031735 3300031731 Bacteria 3113
882 Ga0307405_10086936 3300031731 Bacteria 2059
883 Ga0307405_10099628 3300031731 Bacteria 1945
884 Ga0307405_10256154 3300031731 Bacteria 1304
885 Ga0307405_10288256 3300031731 Bacteria 1239
886 Ga0307405_10356464 3300031731 Bacteria 1130
887 Ga0307405_10384625 3300031731 Bacteria 1093
888 Ga0307405_10413324 3300031731 Bacteria 1059
889 Ga0307405_10430211 3300031731 Bacteria 1041
890 Ga0307405_10569828 3300031731 Bacteria 919
891 Ga0307405_11152486 3300031731 Bacteria 668
892 Ga0307413_10000171 3300031824 Bacteria 18223
893 Ga0307413_10000456 3300031824 Bacteria 13342
894 Ga0307413_10000616 3300031824 Bacteria 11983
895 Ga0307413_10019059 3300031824 Bacteria 3615
896 Ga0307413_10023856 3300031824 Bacteria 3322
897 Ga0307413_10027487 3300031824 Bacteria 3153
898 Ga0307413_10056462 3300031824 Bacteria 2395
899 Ga0307413_10078049 3300031824 Bacteria 2111
900 Ga0307413_10096898 3300031824 Bacteria 1938
901 Ga0307413_10097652 3300031824 Bacteria 1932
902 Ga0307413_10132492 3300031824 Bacteria 1708
903 Ga0307413_10168181 3300031824 Bacteria 1548
904 Ga0307413_10219547 3300031824 Bacteria 1387
905 Ga0307413_10259832 3300031824 Bacteria 1294
906 Ga0307413_10279657 3300031824 Bacteria 1254
907 Ga0307413_10336377 3300031824 Bacteria 1159
908 Ga0307413_10471696 3300031824 Bacteria 1001
909 Ga0307413_10778006 3300031824 Bacteria 802
910 Ga0307413_10870565 3300031824 Bacteria 763
911 Ga0307413_10886191 3300031824 Bacteria 757
912 Ga0307413_11107394 3300031824 Bacteria 684
913 Ga0307413_11342699 3300031824 Bacteria 627
914 Ga0307410_10000393 3300031852 Bacteria 17209
915 Ga0307410_10002578 3300031852 Bacteria 8796
916 Ga0307410_10006997 3300031852 Bacteria 6138
917 Ga0307410_10008532 3300031852 Bacteria 5688
918 Ga0307410_10016045 3300031852 Bacteria 4455
919 Ga0307410_10045082 3300031852 Bacteria 2933
920 Ga0307410_10061629 3300031852 Bacteria 2567
921 Ga0307410_10064380 3300031852 Bacteria 2519
922 Ga0307410_10161675 3300031852 Bacteria 1678
923 Ga0307410_10219009 3300031852 Bacteria 1463
924 Ga0307410_10228266 3300031852 Bacteria 1436
925 Ga0307410_10321222 3300031852 Bacteria 1228
926 Ga0307410_10438174 3300031852 Bacteria 1063
927 Ga0307410_10525665 3300031852 Bacteria 977
928 Ga0307410_10583158 3300031852 Bacteria 931
929 Ga0307410_10600292 3300031852 Bacteria 918
930 Ga0307410_10603762 3300031852 Bacteria 916
931 Ga0307410_11235745 3300031852 Bacteria 652
932 Ga0307410_11324365 3300031852 Bacteria 630
933 Ga0307406_10005210 3300031901 Bacteria 7104
934 Ga0307406_10011286 3300031901 Bacteria 5066
935 Ga0307406_10039192 3300031901 Bacteria 2938
936 Ga0307406_10041271 3300031901 Bacteria 2874
937 Ga0307406_10070333 3300031901 Bacteria 2291
938 Ga0307406_10075223 3300031901 Bacteria 2227
939 Ga0307406_10078663 3300031901 Bacteria 2185
940 Ga0307406_10218364 3300031901 Bacteria 1415
941 Ga0307406_10225324 3300031901 Bacteria 1396
942 Ga0307406_10240568 3300031901 Bacteria 1357
943 Ga0307406_10454337 3300031901 Bacteria 1028
944 Ga0307406_10659882 3300031901 Bacteria 869
945 Ga0307406_10674308 3300031901 Bacteria 861
946 Ga0307406_10756021 3300031901 Bacteria 816
947 Ga0307406_10822830 3300031901 Bacteria 785
948 Ga0307406_11046730 3300031901 Bacteria 702
949 Ga0307406_11174102 3300031901 Bacteria 665
950 Ga0307407_10000541 3300031903 Bacteria 11794
951 Ga0307407_10003078 3300031903 Bacteria 6731
952 Ga0307407_10004230 3300031903 Bacteria 6057
953 Ga0307407_10007478 3300031903 Bacteria 4949
954 Ga0307407_10017174 3300031903 Bacteria 3623
955 Ga0307407_10061866 3300031903 Bacteria 2190
956 Ga0307407_10077532 3300031903 Bacteria 1999
957 Ga0307407_10138863 3300031903 Bacteria 1565
958 Ga0307407_10161683 3300031903 Bacteria 1466
959 Ga0307407_10193103 3300031903 Bacteria 1359
960 Ga0307407_10226649 3300031903 Bacteria 1267
961 Ga0307407_10257525 3300031903 Bacteria 1199
962 Ga0307407_10556979 3300031903 Bacteria 848
963 Ga0307407_10705575 3300031903 Bacteria 760
964 Ga0307407_10725562 3300031903 Bacteria 750
965 Ga0307407_10772825 3300031903 Bacteria 729
966 Ga0307407_10843606 3300031903 Bacteria 700
967 Ga0307412_10000248 3300031911 Bacteria 35008
968 Ga0307412_10003751 3300031911 Bacteria 8445
969 Ga0307412_10019655 3300031911 Bacteria 4096
970 Ga0307412_10024284 3300031911 Bacteria 3741
971 Ga0307412_10216818 3300031911 Bacteria 1464
972 Ga0307412_10299098 3300031911 Bacteria 1271
973 Ga0307412_10302333 3300031911 Bacteria 1265
974 Ga0307412_10304265 3300031911 Bacteria 1261
975 Ga0307412_10368995 3300031911 Bacteria 1158
976 Ga0307412_10388345 3300031911 Bacteria 1132
977 Ga0307412_10389842 3300031911 Bacteria 1130
978 Ga0307412_10504474 3300031911 Bacteria 1008
979 Ga0307412_10651185 3300031911 Bacteria 898
980 Ga0307412_10672295 3300031911 Bacteria 886
981 Ga0307412_10776631 3300031911 Bacteria 829
982 Ga0307412_10828845 3300031911 Bacteria 805
983 Ga0307412_11049214 3300031911 Bacteria 723
984 Ga0307412_11137841 3300031911 Bacteria 696
985 Ga0307412_11584500 3300031911 Bacteria 597
986 Ga0307412_11820384 3300031911 Bacteria 560
987 Ga0307409_100000418 3300031995 Bacteria 18065
988 Ga0307409_100006369 3300031995 Bacteria 6927
989 Ga0307409_100016495 3300031995 Bacteria 4888
990 Ga0307409_100044516 3300031995 Bacteria 3343
991 Ga0307409_100057300 3300031995 Bacteria 3018
992 Ga0307409_100082143 3300031995 Bacteria 2607
993 Ga0307409_100138111 3300031995 Bacteria 2095
994 Ga0307409_100157527 3300031995 Bacteria 1981
995 Ga0307409_100161011 3300031995 Bacteria 1962
996 Ga0307409_100221471 3300031995 Bacteria 1708
997 Ga0307409_100263778 3300031995 Bacteria 1582
998 Ga0307409_100345533 3300031995 Bacteria 1402
999 Ga0307409_100351714 3300031995 Bacteria 1390
1000 Ga0307409_100353658 3300031995 Bacteria 1387
1001 Ga0307409_100419489 3300031995 Bacteria 1283
1002 Ga0307409_100469972 3300031995 Bacteria 1218
1003 Ga0307409_100522217 3300031995 Bacteria 1160
1004 Ga0307409_100625558 3300031995 Bacteria 1067
1005 Ga0307409_101204246 3300031995 Bacteria 781
1006 Ga0307409_101234591 3300031995 Bacteria 771
1007 Ga0307409_101463038 3300031995 Bacteria 710
1008 Ga0307409_101841097 3300031995 Bacteria 634
1009 Ga0307409_102259518 3300031995 Bacteria 573
1010 Ga0307416_100001470 3300032002 Bacteria 12838
1011 Ga0307416_100001974 3300032002 Bacteria 11501
1012 Ga0307416_100003475 3300032002 Bacteria 9255
1013 Ga0307416_100004905 3300032002 Bacteria 8147
1014 Ga0307416_100043277 3300032002 Bacteria 3524
1015 Ga0307416_100102321 3300032002 Bacteria 2497
1016 Ga0307416_100207932 3300032002 Bacteria 1864
1017 Ga0307416_100270621 3300032002 Bacteria 1667
1018 Ga0307416_100272205 3300032002 Bacteria 1663
1019 Ga0307416_100290346 3300032002 Bacteria 1619
1020 Ga0307416_100651303 3300032002 Bacteria 1138
1021 Ga0307416_100998690 3300032002 Bacteria 940
1022 Ga0307416_101094416 3300032002 Bacteria 901
1023 Ga0307416_101549791 3300032002 Bacteria 768
1024 Ga0307416_101762504 3300032002 Bacteria 723
1025 Ga0307416_101892888 3300032002 Bacteria 700
1026 Ga0307416_102197064 3300032002 Bacteria 653
1027 Ga0307416_102318339 3300032002 Bacteria 637
1028 Ga0307416_102564368 3300032002 Bacteria 608
1029 Ga0307414_10000095 3300032004 Bacteria 67330
1030 Ga0307414_10001025 3300032004 Bacteria 14261
1031 Ga0307414_10002328 3300032004 Bacteria 9923
1032 Ga0307414_10003301 3300032004 Bacteria 8603
1033 Ga0307414_10006463 3300032004 Bacteria 6537
1034 Ga0307414_10006871 3300032004 Bacteria 6367
1035 Ga0307414_10008907 3300032004 Bacteria 5731
1036 Ga0307414_10010462 3300032004 Bacteria 5384
1037 Ga0307414_10019929 3300032004 Bacteria 4168
1038 Ga0307414_10020612 3300032004 Bacteria 4113
1039 Ga0307414_10021323 3300032004 Bacteria 4062
1040 Ga0307414_10033451 3300032004 Bacteria 3399
1041 Ga0307414_10040471 3300032004 Bacteria 3148
1042 Ga0307414_10042447 3300032004 Bacteria 3090
1043 Ga0307414_10053960 3300032004 Bacteria 2806
1044 Ga0307414_10069094 3300032004 Bacteria 2538
1045 Ga0307414_10072279 3300032004 Bacteria 2491
1046 Ga0307414_10079602 3300032004 Bacteria 2393
1047 Ga0307414_10112131 3300032004 Bacteria 2078
1048 Ga0307414_10119886 3300032004 Bacteria 2020
1049 Ga0307414_10133299 3300032004 Bacteria 1932
1050 Ga0307414_10195016 3300032004 Bacteria 1642
1051 Ga0307414_10255013 3300032004 Bacteria 1460
1052 Ga0307414_10255259 3300032004 Bacteria 1460
1053 Ga0307414_10266199 3300032004 Bacteria 1433
1054 Ga0307414_10315990 3300032004 Bacteria 1327
1055 Ga0307414_10317232 3300032004 Bacteria 1325
1056 Ga0307414_10324168 3300032004 Bacteria 1312
1057 Ga0307414_10378487 3300032004 Bacteria 1223
1058 Ga0307414_10408530 3300032004 Bacteria 1181
1059 Ga0307414_10626984 3300032004 Bacteria 967
1060 Ga0307414_10682889 3300032004 Bacteria 928
1061 Ga0307414_10698392 3300032004 Bacteria 918
1062 Ga0307414_10730084 3300032004 Bacteria 899
1063 Ga0307414_10895371 3300032004 Bacteria 813
1064 Ga0307414_10909385 3300032004 Bacteria 807
1065 Ga0307414_11301636 3300032004 Bacteria 674
1066 Ga0307414_11498989 3300032004 Bacteria 628
1067 Ga0307414_11829477 3300032004 Bacteria 567
1068 Ga0307411_10001520 3300032005 Bacteria 9552
1069 Ga0307411_10001702 3300032005 Bacteria 9227
1070 Ga0307411_10005922 3300032005 Bacteria 6070
1071 Ga0307411_10006216 3300032005 Bacteria 5950
1072 Ga0307411_10015612 3300032005 Bacteria 4272
1073 Ga0307411_10023982 3300032005 Bacteria 3627
1074 Ga0307411_10026563 3300032005 Bacteria 3487
1075 Ga0307411_10032195 3300032005 Bacteria 3237
1076 Ga0307411_10042911 3300032005 Bacteria 2890
1077 Ga0307411_10064909 3300032005 Bacteria 2446
1078 Ga0307411_10080940 3300032005 Bacteria 2235
1079 Ga0307411_10087319 3300032005 Bacteria 2166
1080 Ga0307411_10093478 3300032005 Bacteria 2106
1081 Ga0307411_10120689 3300032005 Bacteria 1896
1082 Ga0307411_10161096 3300032005 Bacteria 1680
1083 Ga0307411_10162794 3300032005 Bacteria 1673
1084 Ga0307411_10164409 3300032005 Bacteria 1666
1085 Ga0307411_10172295 3300032005 Bacteria 1633
1086 Ga0307411_10203177 3300032005 Bacteria 1524
1087 Ga0307411_10231071 3300032005 Bacteria 1441
1088 Ga0307411_10241255 3300032005 Bacteria 1415
1089 Ga0307411_10258286 3300032005 Bacteria 1374
1090 Ga0307411_10282803 3300032005 Bacteria 1321
1091 Ga0307411_10402034 3300032005 Bacteria 1132
1092 Ga0307411_10519597 3300032005 Bacteria 1010
1093 Ga0307411_10676258 3300032005 Bacteria 896
1094 Ga0307411_10721764 3300032005 Bacteria 870
1095 Ga0307411_10768569 3300032005 Bacteria 845
1096 Ga0307411_10788767 3300032005 Bacteria 835
1097 Ga0307411_10842447 3300032005 Bacteria 810
1098 Ga0307411_10951097 3300032005 Bacteria 766
1099 Ga0307411_11304274 3300032005 Bacteria 661
1100 Ga0307415_100007620 3300032126 Bacteria 5935
1101 Ga0307415_100014987 3300032126 Bacteria 4575
1102 Ga0307415_100017172 3300032126 Bacteria 4332
1103 Ga0307415_100021579 3300032126 Bacteria 3961
1104 Ga0307415_100117068 3300032126 Bacteria 1989
1105 Ga0307415_100121998 3300032126 Bacteria 1956
1106 Ga0307415_100222382 3300032126 Bacteria 1514
1107 Ga0307415_100323607 3300032126 Bacteria 1287
1108 Ga0307415_100344218 3300032126 Bacteria 1252
1109 Ga0307415_100383910 3300032126 Bacteria 1194
1110 Ga0307415_100461041 3300032126 Bacteria 1101
1111 Ga0307415_100471256 3300032126 Bacteria 1091
1112 Ga0307415_100589835 3300032126 Bacteria 987
1113 Ga0307415_100666522 3300032126 Bacteria 934
1114 Ga0307415_100800671 3300032126 Bacteria 860
1115 Ga0307415_101099160 3300032126 Bacteria 744
1116 Ga0307415_101511964 3300032126 Bacteria 642
1117 Ga0307415_101982859 3300032126 Bacteria 566
1118 Ga0395899_0000737 3300037312 Bacteria 32666
1119 Ga0395899_0013803 3300037312 Bacteria 6174
1120 Ga0395899_0074724 3300037312 Bacteria 2475
1121 Ga0395899_0157054 3300037312 Bacteria 1609
1122 Ga0395899_0182067 3300037312 Bacteria 1474
1123 Ga0395899_0226370 3300037312 Bacteria 1293
1124 Ga0395899_0271552 3300037312 Bacteria 1156
1125 Ga0395900_0000364 3300037418 Bacteria 65068
1126 Ga0395900_0005528 3300037418 Bacteria 13234
1127 Ga0395900_0039490 3300037418 Bacteria 4863
1128 Ga0395900_0076977 3300037418 Bacteria 3427
1129 Ga0395900_0134354 3300037418 Bacteria 2534
1130 Ga0395900_0192872 3300037418 Bacteria 2065
1131 Ga0395900_0290108 3300037418 Bacteria 1625
1132 Ga0395900_0374662 3300037418 Bacteria 1392
1133 Ga0395900_0392343 3300037418 Bacteria 1354
1134 Ga0395900_0449306 3300037418 Bacteria 1245
1135 Ga0395900_0649916 3300037418 Bacteria 991
1136 Ga0395898_0015156 3300037466 Bacteria 7912
1137 Ga0395898_0225961 3300037466 Bacteria 1785
1138 Ga0395898_0398442 3300037466 Bacteria 1312
1139 Ga0395898_0477277 3300037466 Bacteria 1186
1140 Ga0395898_1559206 3300037466 Bacteria 585
1141 Ga0395905_0000500 3300037471 Bacteria 53853
1142 Ga0395905_0089793 3300037471 Bacteria 2880
1143 Ga0395905_0377430 3300037471 Bacteria 1311
1144 Ga0395905_1638071 3300037471 Bacteria 548
1145 Ga0436364_0098112 3300037853 Bacteria 2155
1146 Ga0436364_1172012 3300037853 Bacteria 2138
1147 Ga0395901_0000181 3300038443 Bacteria 81816
1148 Ga0395901_0000209 3300038443 Bacteria 73635
1149 Ga0395901_0027750 3300038443 Bacteria 5821
1150 Ga0395901_0043660 3300038443 Bacteria 4649
1151 Ga0395901_0670874 3300038443 Bacteria 1037
1152 Ga0237819_00528 3300038705 Bacteria 12798
1153 Ga0237816_00113 3300039145 Bacteria 6051
1154 Ga0436365_0049535 3300039437 Bacteria 3995
1155 Ga0436365_0072488 3300039437 Bacteria 1570
1156 Ga0436365_0083543 3300039437 Bacteria 85224
1157 Ga0436365_0175085 3300039437 Bacteria 528
1158 Ga0436365_1025078 3300039437 Bacteria 33251
1159 Ga0436365_1660687 3300039437 Bacteria 1607
1160 Ga0436365_1912201 3300039437 Bacteria 1812
1161 Ga0436363_0030425 3300039450 Bacteria 844
1162 Ga0436363_0468499 3300039450 Bacteria 1033
1163 Ga0436363_0564025 3300039450 Bacteria 843
1164 Ga0436363_0908780 3300039450 Bacteria 1410
1165 Ga0436362_0376260 3300039453 Bacteria 74620
1166 Ga0439438_110082 3300041405 Bacteria 665
1167 Ga0439465_0161375 3300041413 Bacteria 804
1168 Ga0439465_0256057 3300041413 Bacteria 648
1169 Ga0451807_1464321 3300041486 Bacteria 1083
1170 Ga0451839_0351685 3300041496 Bacteria 807
1171 Ga0451853_1673430 3300041512 Bacteria 795
1172 Ga0439443_001194 3300042003 Bacteria 2773
1173 Ga0439445_0000195 3300042004 Bacteria 10998
1174 Ga0439448_0012175 3300042005 Bacteria 2570
1175 Ga0439448_0018040 3300042005 Bacteria 2158
1176 Ga0439432_098896 3300042006 Bacteria 874
1177 Ga0439449_0060483 3300042007 Bacteria 1398
1178 Ga0439455_0001228 3300042012 Bacteria 4194
1179 Ga0439455_0001341 3300042012 Bacteria 4062
1180 Ga0439455_0054782 3300042012 Bacteria 1048
1181 Ga0450920_037897 3300042122 Bacteria 958
1182 Ga0450923_009175 3300042125 Bacteria 1724
1183 Ga0439458_0001461 3300042157 Bacteria 5956
1184 Ga0439458_0002748 3300042157 Bacteria 4241
1185 Ga0439464_0008150 3300042439 Bacteria 2747
1186 Ga0451577_0380072 3300042876 Bacteria 1282
1187 Ga0466969_0003129 3300044656 Bacteria 8815
1188 Ga0466972_0000848 3300044658 Bacteria 14650
1189 Ga0466965_0178091 3300044683 Bacteria 1121
1190 Ga0466966_0000072 3300044684 Bacteria 65377
1191 Ga0466966_0236099 3300044684 Bacteria 1102
1192 Ga0466966_0364166 3300044684 Bacteria 868
1193 Ga0466961_0040734 3300044693 Bacteria 2977
1194 Ga0466961_0179466 3300044693 Bacteria 1315
1195 Ga0466961_0337171 3300044693 Bacteria 918
1196 Ga0466963_0002946 3300044694 Bacteria 9617
1197 Ga0466963_0017348 3300044694 Bacteria 4487
1198 Ga0466971_0001663 3300044719 Bacteria 9396
1199 Ga0466971_0012663 3300044719 Bacteria 3699
1200 Ga0466971_0688683 3300044719 Bacteria 513
1201 Ga0466968_0125705 3300044735 Bacteria 1163
1202 Ga0466970_0002808 3300044765 Bacteria 8406
1203 Ga0466970_0197118 3300044765 Bacteria 1120
1204 Ga0466957_0001327 3300044842 Bacteria 12910
1205 Ga0466957_0049413 3300044842 Bacteria 2557
1206 Ga0466957_0506691 3300044842 Bacteria 837
1207 Ga0466960_0002697 3300044901 Bacteria 6708
1208 Ga0466959_0006960 3300045049 Bacteria 7901
1209 Ga0466959_0085446 3300045049 Bacteria 2270
1210 Ga0466959_0244498 3300045049 Bacteria 1238
1211 Ga0466959_0379469 3300045049 Bacteria 962
1212 Ga0466958_0002556 3300045836 Bacteria 9180
1213 Ga0466958_0057446 3300045836 Bacteria 2364
1214 Ga0466967_0057376 3300045976 Bacteria 3437
1215 Ga0466967_0263387 3300045976 Bacteria 1650
1216 Ga0466967_0671267 3300045976 Bacteria 1026
1217 Ga0495617_010266 3300046452 Bacteria 3206
1218 Ga0495617_010616 3300046452 Bacteria 3154
1219 Ga0495627_000336 3300046453 Bacteria 44344
1220 Ga0495627_025157 3300046453 Bacteria 1932
1221 Ga0495638_0000068 3300046460 Bacteria 167596
1222 Ga0495650_0000915 3300046471 Bacteria 34702
1223 Ga0495584_0018184 3300046491 Bacteria 3574
1224 Ga0495584_0388565 3300046491 Bacteria 709
1225 Ga0495585_0228508 3300046492 Bacteria 936
1226 Ga0495583_0000279 3300046506 Bacteria 82827
1227 Ga0495583_0001108 3300046506 Bacteria 29781
1228 Ga0495606_0000121 3300046507 Bacteria 132126
1229 Ga0495610_0000083 3300046512 Bacteria 112946
1230 Ga0495616_0054067 3300046513 Bacteria 1993
1231 Ga0495616_0197352 3300046513 Bacteria 886
1232 Ga0495632_0000023 3300046519 Bacteria 180933
1233 Ga0495632_0000730 3300046519 Bacteria 29768
1234 Ga0495632_0115259 3300046519 Bacteria 1259
1235 Ga0495637_0000836 3300046520 Bacteria 20354
1236 Ga0495637_0010624 3300046520 Bacteria 4446
1237 Ga0495637_0027991 3300046520 Bacteria 2519
1238 Ga0495643_0000038 3300046522 Bacteria 236010
1239 Ga0495643_0028472 3300046522 Bacteria 3132
1240 Ga0495643_0168387 3300046522 Bacteria 1073
1241 Ga0495644_0141842 3300046523 Bacteria 918
1242 Ga0495648_0000046 3300046524 Bacteria 167725
1243 Ga0495663_0000019 3300046525 Bacteria 129361
1244 Ga0495663_0018242 3300046525 Bacteria 1997
1245 Ga0495663_0036906 3300046525 Bacteria 1472
1246 Ga0495663_0051402 3300046525 Bacteria 1277
1247 Ga0495663_0261645 3300046525 Bacteria 616
1248 Ga0495642_0012730 3300046528 Bacteria 3246
1249 Ga0495654_0021570 3300046530 Bacteria 3350
1250 Ga0495654_0051371 3300046530 Bacteria 2012
1251 Ga0495598_0007096 3300046537 Bacteria 2556
1252 Ga0495598_0028173 3300046537 Bacteria 1556
1253 Ga0495621_0047771 3300046539 Bacteria 1522
1254 Ga0495621_0063300 3300046539 Bacteria 1347
1255 Ga0495621_0071079 3300046539 Bacteria 1282
1256 Ga0495621_0095353 3300046539 Bacteria 1126
1257 Ga0495597_0020470 3300046542 Bacteria 3081
1258 Ga0495633_0000568 3300046558 Bacteria 35912
1259 Ga0495633_0000772 3300046558 Bacteria 28691
1260 Ga0495633_0017963 3300046558 Bacteria 3599
1261 Ga0495633_0054335 3300046558 Bacteria 1884
1262 Ga0495633_0071686 3300046558 Bacteria 1616
1263 Ga0495633_0130320 3300046558 Bacteria 1164
1264 Ga0495633_0136534 3300046558 Bacteria 1134
1265 Ga0495633_0187619 3300046558 Bacteria 951
1266 Ga0495668_0000031 3300046616 Bacteria 256576
1267 Ga0495668_0008602 3300046616 Bacteria 6348
1268 Ga0495668_0014493 3300046616 Bacteria 4620
1269 Ga0495668_0022968 3300046616 Bacteria 3562
1270 Ga0495668_0065423 3300046616 Bacteria 2001
1271 Ga0495668_0528661 3300046616 Bacteria 650
1272 Ga0495611_0051546 3300046648 Bacteria 1855
1273 Ga0495625_0001296 3300046660 Bacteria 31375
1274 Ga0495625_0024634 3300046660 Bacteria 4577
1275 Ga0495625_0044441 3300046660 Bacteria 3216
1276 Ga0495625_0093717 3300046660 Bacteria 2073
1277 Ga0495625_0127438 3300046660 Bacteria 1727
1278 Ga0495625_0244112 3300046660 Bacteria 1168
1279 Ga0495659_0003471 3300046664 Bacteria 5030
1280 Ga0495661_0114128 3300046665 Bacteria 1501
1281 Ga0495669_0008648 3300046684 Bacteria 4284
1282 Ga0495669_0175812 3300046684 Bacteria 1019
1283 Ga0495670_0015072 3300046691 Bacteria 3803
1284 Ga0495670_0026037 3300046691 Bacteria 2895
1285 Ga0495670_0145092 3300046691 Bacteria 1243
1286 Ga0495670_0184790 3300046691 Bacteria 1101
1287 Ga0495671_0000027 3300046692 Bacteria 236011
1288 Ga0495671_0000204 3300046692 Bacteria 52130
1289 Ga0495636_0254770 3300047318 Bacteria 813
1290 Ga0495687_048593 3300047443 Bacteria 1819
1291 Ga0495677_0027213 3300047445 Bacteria 2075
1292 Ga0495677_0042749 3300047445 Bacteria 1660
1293 Ga0495677_0054416 3300047445 Bacteria 1476
1294 Ga0495677_0114459 3300047445 Bacteria 1026
1295 Ga0495677_0288156 3300047445 Bacteria 645
1296 Ga0495673_0000110 3300047469 Bacteria 166127
1297 Ga0495673_0008745 3300047469 Bacteria 5658
1298 Ga0495681_0000279 3300047470 Bacteria 40888
1299 Ga0495681_0001314 3300047470 Bacteria 18798
1300 Ga0495686_0000063 3300047472 Bacteria 228575
1301 Ga0495686_0002251 3300047472 Bacteria 18609
1302 Ga0495686_0005836 3300047472 Bacteria 9601
1303 Ga0495686_0010783 3300047472 Bacteria 6480
1304 Ga0495686_0033894 3300047472 Bacteria 3292
1305 Ga0495686_0234464 3300047472 Bacteria 1038
1306 Ga0496102_0253452 3300048905 Bacteria 1659
1307 Ga0496102_0416986 3300048905 Bacteria 1261
1308 Ga0496103_0019468 3300048906 Bacteria 4078
1309 Ga0496103_0457665 3300048906 Bacteria 818
1310 Ga0496103_0646563 3300048906 Bacteria 672
1311 Ga0496104_0009597 3300048907 Bacteria 8616
1312 Ga0496104_0440934 3300048907 Bacteria 1214
1313 Ga0496107_0239847 3300048910 Bacteria 1349
1314 Ga0496108_0001376 3300048911 Bacteria 19132
1315 Ga0496108_0091845 3300048911 Bacteria 2581
1316 Ga0496108_0155471 3300048911 Bacteria 1975
1317 Ga0496109_0051517 3300048912 Bacteria 3750
1318 Ga0496109_0105837 3300048912 Bacteria 2613
1319 Ga0496109_0151485 3300048912 Bacteria 2171
1320 Ga0496109_0378570 3300048912 Bacteria 1337
1321 Ga0496109_0689600 3300048912 Bacteria 959
1322 Ga0496110_0015811 3300048913 Bacteria 6292
1323 Ga0496110_0035091 3300048913 Bacteria 4349
1324 Ga0496110_0046851 3300048913 Bacteria 3783
1325 Ga0496110_0506538 3300048913 Bacteria 1099
1326 Ga0496110_0536987 3300048913 Bacteria 1063
1327 Ga0496111_0026586 3300048914 Bacteria 4088
1328 Ga0496111_0080284 3300048914 Bacteria 2380
1329 Ga0496111_0436900 3300048914 Bacteria 966
1330 Ga0496113_0060335 3300048916 Bacteria 2859
1331 Ga0496114_0041466 3300048917 Bacteria 3815
1332 Ga0496114_0680074 3300048917 Bacteria 903
1333 Ga0496115_0007525 3300048918 Bacteria 8020
1334 Ga0496116_0023996 3300048919 Bacteria 4524
1335 Ga0496117_0024831 3300048920 Bacteria 4725
1336 Ga0496118_0001805 3300048921 Bacteria 30834
1337 Ga0496118_0037339 3300048921 Bacteria 3911
1338 Ga0496118_0043906 3300048921 Bacteria 3507
1339 Ga0496119_0141551 3300048922 Bacteria 1298
1340 Ga0496119_0243789 3300048922 Bacteria 909
1341 Ga0496120_0043987 3300048923 Bacteria 2597
1342 Ga0496121_0000997 3300048924 Bacteria 50601
1343 Ga0496121_0165979 3300048924 Bacteria 1609
1344 Ga0496121_0168726 3300048924 Bacteria 1592
1345 Ga0496121_0198435 3300048924 Bacteria 1432
1346 Ga0496121_0749263 3300048924 Bacteria 581
1347 Ga0496122_0002248 3300048925 Bacteria 27991
1348 Ga0496122_0014017 3300048925 Bacteria 7787
1349 Ga0496122_0054104 3300048925 Bacteria 3018
1350 Ga0496122_0115718 3300048925 Bacteria 1746
1351 Ga0496122_0457334 3300048925 Bacteria 631
1352 Ga0496123_0010997 3300048926 Bacteria 7907
1353 Ga0496123_0016203 3300048926 Bacteria 6068
1354 Ga0496123_0090115 3300048926 Bacteria 1825
1355 Ga0496123_0098348 3300048926 Bacteria 1711
1356 Ga0496123_0126146 3300048926 Bacteria 1428
1357 Ga0496123_0192535 3300048926 Bacteria 1053
1358 Ga0496123_0309935 3300048926 Bacteria 749
1359 Ga0496124_0004445 3300048927 Bacteria 16344
1360 Ga0496124_0006449 3300048927 Bacteria 12776
1361 Ga0496124_0089483 3300048927 Bacteria 2513
1362 Ga0496124_0176056 3300048927 Bacteria 1651
1363 Ga0496124_0257291 3300048927 Bacteria 1287
1364 Ga0496124_0357971 3300048927 Bacteria 1029
1365 Ga0496125_0024159 3300048928 Bacteria 5593
1366 Ga0496125_0028356 3300048928 Bacteria 5059
1367 Ga0496125_0038468 3300048928 Bacteria 4139
1368 Ga0496125_0044314 3300048928 Bacteria 3764
1369 Ga0496125_0063249 3300048928 Bacteria 2952
1370 Ga0496125_0069512 3300048928 Bacteria 2763
1371 Ga0496125_0183332 3300048928 Bacteria 1392
1372 Ga0496125_0205003 3300048928 Bacteria 1287
1373 Ga0496125_0282035 3300048928 Bacteria 1028
1374 Ga0496126_0004496 3300048929 Bacteria 16639
1375 Ga0496126_0135286 3300048929 Bacteria 2126
1376 Ga0496126_0150721 3300048929 Bacteria 1993
1377 Ga0496126_0155810 3300048929 Bacteria 1955
1378 Ga0496126_0223604 3300048929 Bacteria 1580
1379 Ga0496126_0545939 3300048929 Bacteria 920
1380 Ga0496126_0744365 3300048929 Bacteria 757
1381 Ga0496126_0862034 3300048929 Bacteria 690
1382 Ga0495678_039007 3300049459 Bacteria 1918
1383 Ga0495678_049583 3300049459 Bacteria 1631
1384 Ga0495678_063757 3300049459 Bacteria 1375
1385 Ga0501031_0146688 3300049568 Bacteria 1542
1386 Ga0501032_0039347 3300049569 Bacteria 3216
1387 Ga0501032_0154725 3300049569 Bacteria 1507
1388 Ga0501033_0013767 3300049570 Bacteria 6152
1389 Ga0501033_0158359 3300049570 Bacteria 1631
1390 Ga0501034_0280845 3300049571 Bacteria 1604
1391 Ga0501034_0391430 3300049571 Bacteria 1314
1392 Ga0501034_0434750 3300049571 Bacteria 1232
1393 Ga0501034_0796263 3300049571 Bacteria 838
1394 Ga0501036_0014604 3300049572 Bacteria 6541
1395 Ga0501037_0216908 3300049573 Bacteria 1347
1396 Ga0501038_0016778 3300049574 Bacteria 6631
1397 Ga0501038_0272248 3300049574 Bacteria 1335
1398 Ga0501039_0037093 3300049575 Bacteria 3762
1399 Ga0501039_0352777 3300049575 Bacteria 1156
1400 Ga0501043_0216648 3300049579 Bacteria 1482
1401 Ga0501043_0549691 3300049579 Bacteria 858
1402 Ga0501047_0047680 3300049581 Bacteria 4138
1403 Ga0501047_0491022 3300049581 Bacteria 1055
1404 Ga0501048_0203136 3300049582 Bacteria 1405
1405 Ga0501069_0008325 3300049585 Bacteria 5447
1406 Ga0501070_0053026 3300049586 Bacteria 3365
1407 Ga0501070_0508978 3300049586 Bacteria 967
1408 Ga0501074_0547961 3300049590 Bacteria 819
1409 Ga0501202_053900 3300049652 Bacteria 896
1410 Ga0501209_056656 3300049656 Bacteria 1083
1411 Ga0501223_000086 3300049663 Bacteria 27446
1412 Ga0501233_127371 3300049668 Bacteria 693
1413 Ga0501235_031439 3300049669 Bacteria 1199
1414 Ga0501236_003714 3300049670 Bacteria 1788
1415 Ga0501239_033246 3300049672 Bacteria 686
1416 Ga0501247_039281 3300049677 Bacteria 672
1417 Ga0501249_000613 3300049679 Bacteria 8247
1418 Ga0501249_009214 3300049679 Bacteria 2053
1419 Ga0501253_163566 3300049683 Bacteria 569
1420 Ga0501258_013324 3300049687 Bacteria 902
1421 Ga0501225_0000034 3300049705 Bacteria 46629
1422 Ga0501225_0031454 3300049705 Bacteria 1460
1423 Ga0501225_0059899 3300049705 Bacteria 1070
1424 Ga0501225_0307412 3300049705 Bacteria 538
1425 Ga0501245_003097 3300049708 Bacteria 2245
1426 Ga0501083_0541440 3300049744 Bacteria 758
1427 Ga0501262_003014 3300049759 Bacteria 1921
1428 Ga0501267_023087 3300049764 Bacteria 697
1429 Ga0501268_001525 3300049765 Bacteria 2900
1430 Ga0501273_028951 3300049770 Bacteria 781
1431 Ga0501282_027731 3300049778 Bacteria 640
1432 Ga0501035_0012319 3300049822 Bacteria 7906
1433 Ga0501035_0586439 3300049822 Bacteria 910
1434 Ga0501044_0011936 3300049823 Bacteria 9414
1435 nmdc:mga00v17_51035_c1 3300050491 Bacteria 2515
1436 nmdc:mga06z11_2653_c1 3300050494 Bacteria 6856
1437 nmdc:mga04h51_984_c1 3300050495 Bacteria 6592
1438 nmdc:mga07m45_27501_c1 3300050496 Bacteria 1746
1439 nmdc:mga08y16_231553_c1 3300050511 Bacteria 1911
1440 nmdc:mga08y16_440190_c1 3300050511 Bacteria 1330
1441 nmdc:mga0n895_1182676_c1 3300050512 Bacteria 739
1442 nmdc:mga0n895_519567_c1 3300050512 Bacteria 1198
1443 Ga0500643_000235 3300053087 Bacteria 51395
1444 Ga0500643_004868 3300053087 Bacteria 5925
1445 Ga0500643_016270 3300053087 Bacteria 2523
1446 Ga0500643_022236 3300053087 Bacteria 2044
1447 Ga0500647_0069216 3300053091 Bacteria 1697
1448 Ga0500641_0145271 3300053096 Bacteria 1025
1449 Ga0500569_085988 3300053109 Bacteria 1012
1450 Ga0500592_000173 3300053116 Bacteria 12743
1451 Ga0500592_000506 3300053116 Bacteria 6438
1452 Ga0500642_0028041 3300053130 Bacteria 2318
1453 Ga0500655_000166 3300053133 Bacteria 16190
1454 Ga0500658_0000105 3300053134 Bacteria 38951
1455 Ga0500559_0025680 3300053136 Bacteria 2507
1456 Ga0500568_0003922 3300053139 Bacteria 8099
1457 Ga0500568_0008217 3300053139 Bacteria 5052
1458 Ga0500577_0038540 3300053142 Bacteria 1727
1459 Ga0500590_002808 3300053148 Bacteria 7863
1460 Ga0500604_0000095 3300053151 Bacteria 28336
1461 Ga0500604_0121521 3300053151 Bacteria 873
1462 Ga0500616_0000267 3300053153 Bacteria 78217
1463 Ga0500616_0204319 3300053153 Bacteria 873
1464 Ga0500622_0003191 3300053156 Bacteria 11187
1465 Ga0500622_0130928 3300053156 Bacteria 1206
1466 Ga0500624_000101 3300053157 Bacteria 41193
1467 Ga0500627_0000543 3300053158 Bacteria 10139
1468 Ga0500627_0000898 3300053158 Bacteria 7977
1469 Ga0500627_0001084 3300053158 Bacteria 7425
1470 Ga0500639_046557 3300053163 Bacteria 2267
1471 Ga0500636_0000447 3300053177 Bacteria 22672
1472 Ga0500570_000639 3300053724 Bacteria 14134
1473 Ga0500645_051176 3300053730 Bacteria 1205
1474 Ga0500645_081191 3300053730 Bacteria 925
1475 Ga0500587_000737 3300053739 Bacteria 4212
1476 Ga0590074_013153 3300059423 Bacteria 1396
1477 Ga0501082_0159656 3300060353 Bacteria 1959
1478 Ga0466962_0006091 3300061719 Bacteria 5800
1479 Ga0466962_0011134 3300061719 Bacteria 4329
1480 Ga0466962_0075501 3300061719 Bacteria 1610
1481 Ga0466962_0091485 3300061719 Bacteria 1458
1482 Ga0466962_0155786 3300061719 Bacteria 1109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0205003 Ga0496125_0205003_443_928 125
2 3300049668 Ga0501233_127371 Ga0501233_127371_278_676 129
3 3300025944 Ga0207661_10740497 Ga0207661_107404971 135
4 3300046513 Ga0495616_0054067 Ga0495616_0054067_1133_1597 138
5 3300031731 Ga0307405_10000472 Ga0307405_1000047211 142
6 3300031911 Ga0307412_10019655 Ga0307412_100196554 142
7 3300048927 Ga0496124_0357971 Ga0496124_0357971_163_681 143
8 3300048928 Ga0496125_0063249 Ga0496125_0063249_1216_1734 143
9 3300048929 Ga0496126_0150721 Ga0496126_0150721_441_959 143
10 3300003794 Ga0055531_10002961 Ga0055531_100029618 144
11 3300005355 Ga0070671_100038465 Ga0070671_1000384652 144
12 3300025298 Ga0209050_1006198 Ga0209050_10061988 144
13 3300025304 Ga0209257_1000250 Ga0209257_100025020 144
14 3300025931 Ga0207644_10019602 Ga0207644_100196025 144
15 3300046660 Ga0495625_0001296 Ga0495625_0001296_26580_27062 144
16 3300053139 Ga0500568_0003922 Ga0500568_0003922_3762_4244 144
17 3300005331 Ga0070670_100106148 Ga0070670_1001061481 145
18 3300005347 Ga0070668_100195913 Ga0070668_1001959132 145
19 3300005367 Ga0070667_100363623 Ga0070667_1003636232 145
20 3300005617 Ga0068859_101094342 Ga0068859_1010943422 145
21 3300005842 Ga0068858_100001280 Ga0068858_10000128012 145
22 3300006931 Ga0097620_101094399 Ga0097620_1010943992 145
23 3300009177 Ga0105248_10295757 Ga0105248_102957572 145
24 3300025925 Ga0207650_11393860 Ga0207650_113938601 145
25 3300025972 Ga0207668_10066229 Ga0207668_100662293 145
26 3300026035 Ga0207703_10005667 Ga0207703_100056677 145
27 3300048911 Ga0496108_0091845 Ga0496108_0091845_1170_1649 145
28 3300048912 Ga0496109_0105837 Ga0496109_0105837_921_1400 145
29 3300048913 Ga0496110_0046851 Ga0496110_0046851_1990_2469 145
30 3300048917 Ga0496114_0041466 Ga0496114_0041466_2992_3471 145
31 3300048929 Ga0496126_0004496 Ga0496126_0004496_3687_4166 145
32 3300049759 Ga0501262_003014 Ga0501262_003014_722_1177 145
33 iso_pu_bacteria 2946787523 2946789194 145
34 3300001990 JGI24737J22298_10001675 JGI24737J22298_100016753 146
35 3300002067 JGI24735J21928_10028292 JGI24735J21928_100282922 146
36 3300002077 JGI24744J21845_10000474 JGI24744J21845_100004749 146
37 3300002155 JGI24033J26618_1045984 JGI24033J26618_10459841 146
38 3300002244 JGI24742J22300_10042498 JGI24742J22300_100424981 146
39 3300005327 Ga0070658_10000349 Ga0070658_1000034920 146
40 3300005328 Ga0070676_10055668 Ga0070676_100556682 146
41 3300005339 Ga0070660_100001221 Ga0070660_10000122116 146
42 3300005353 Ga0070669_100382677 Ga0070669_1003826772 146
43 3300005354 Ga0070675_100001982 Ga0070675_10000198220 146
44 3300005354 Ga0070675_100184754 Ga0070675_1001847543 146
45 3300005355 Ga0070671_100036915 Ga0070671_1000369156 146
46 3300005455 Ga0070663_100150775 Ga0070663_1001507753 146
47 3300005456 Ga0070678_100017979 Ga0070678_1000179796 146
48 3300005457 Ga0070662_100621638 Ga0070662_1006216382 146
49 3300005539 Ga0068853_100008785 Ga0068853_1000087859 146
50 3300005543 Ga0070672_100054222 Ga0070672_1000542222 146
51 3300005563 Ga0068855_100026106 Ga0068855_1000261062 146
52 3300005578 Ga0068854_100002912 Ga0068854_1000029123 146
53 3300005719 Ga0068861_101508024 Ga0068861_1015080242 146
54 3300006881 Ga0068865_100826707 Ga0068865_1008267072 146
55 3300009093 Ga0105240_10016757 Ga0105240_1001675712 146
56 3300009174 Ga0105241_11163857 Ga0105241_111638572 146
57 3300013100 Ga0157373_10275929 Ga0157373_102759292 146
58 3300013102 Ga0157371_10006691 Ga0157371_100066912 146
59 3300013105 Ga0157369_10008509 Ga0157369_100085099 146
60 3300013105 Ga0157369_10025807 Ga0157369_100258073 146
61 3300013307 Ga0157372_10379538 Ga0157372_103795382 146
62 3300015690 Ga0183363_1004 Ga0183363_1004278 146
63 3300022467 Ga0224712_10462518 Ga0224712_104625182 146
64 3300025893 Ga0207682_10355840 Ga0207682_103558401 146
65 3300025904 Ga0207647_10116095 Ga0207647_101160952 146
66 3300025904 Ga0207647_10303635 Ga0207647_103036352 146
67 3300025907 Ga0207645_10044562 Ga0207645_100445622 146
68 3300025909 Ga0207705_10000143 Ga0207705_1000014328 146
69 3300025913 Ga0207695_10004964 Ga0207695_1000496411 146
70 3300025919 Ga0207657_10066155 Ga0207657_100661552 146
71 3300025923 Ga0207681_10518074 Ga0207681_105180741 146
72 3300025924 Ga0207694_10527346 Ga0207694_105273462 146
73 3300025926 Ga0207659_10040952 Ga0207659_100409525 146
74 3300025926 Ga0207659_10607975 Ga0207659_106079752 146
75 3300025931 Ga0207644_10209581 Ga0207644_102095812 146
76 3300025932 Ga0207690_10429814 Ga0207690_104298142 146
77 3300025933 Ga0207706_10771657 Ga0207706_107716572 146
78 3300025938 Ga0207704_10638267 Ga0207704_106382672 146
79 3300025940 Ga0207691_10035929 Ga0207691_100359293 146
80 3300025949 Ga0207667_10444962 Ga0207667_104449623 146
81 3300025960 Ga0207651_10079646 Ga0207651_100796462 146
82 3300025981 Ga0207640_10001049 Ga0207640_1000104917 146
83 3300026041 Ga0207639_10018857 Ga0207639_100188575 146
84 3300026067 Ga0207678_10184195 Ga0207678_101841952 146
85 3300026078 Ga0207702_10033258 Ga0207702_100332582 146
86 3300026078 Ga0207702_10632255 Ga0207702_106322553 146
87 3300026121 Ga0207683_10046758 Ga0207683_100467584 146
88 3300026142 Ga0207698_10012096 Ga0207698_100120965 146
89 3300037418 Ga0395900_0392343 Ga0395900_0392343_260_709 146
90 3300044656 Ga0466969_0003129 Ga0466969_0003129_7005_7454 146
91 3300044684 Ga0466966_0364166 Ga0466966_0364166_400_849 146
92 3300044693 Ga0466961_0040734 Ga0466961_0040734_92_541 146
93 3300044719 Ga0466971_0688683 Ga0466971_0688683_12_461 146
94 3300045049 Ga0466959_0085446 Ga0466959_0085446_400_849 146
95 3300061719 Ga0466962_0075501 Ga0466962_0075501_381_830 146
96 iso_pu_bacteria 2582581305 2585261746 146
97 iso_pu_bacteria 2643221560 2643822095 146
98 iso_pu_bacteria 2643221563 2643833439 146
99 iso_pu_bacteria 2643221608 2644054366 146
100 iso_pu_bacteria 2852653556 2852654620 146
101 iso_pu_bacteria 2852680915 2852682125 146
102 3300001904 JGI24736J21556_1003947 JGI24736J21556_10039472 147
103 3300001979 JGI24740J21852_10046592 JGI24740J21852_100465922 147
104 3300003214 JGI25165J46597_1000187 JGI25165J46597_100018720 147
105 3300005327 Ga0070658_10009504 Ga0070658_100095047 147
106 3300005335 Ga0070666_10358016 Ga0070666_103580162 147
107 3300005336 Ga0070680_100905631 Ga0070680_1009056312 147
108 3300005339 Ga0070660_100026526 Ga0070660_1000265263 147
109 3300005339 Ga0070660_100538255 Ga0070660_1005382552 147
110 3300005344 Ga0070661_100199910 Ga0070661_1001999102 147
111 3300005345 Ga0070692_10095983 Ga0070692_100959833 147
112 3300005345 Ga0070692_10182677 Ga0070692_101826772 147
113 3300005345 Ga0070692_10305544 Ga0070692_103055441 147
114 3300005347 Ga0070668_100526206 Ga0070668_1005262062 147
115 3300005353 Ga0070669_100046272 Ga0070669_1000462722 147
116 3300005366 Ga0070659_100156265 Ga0070659_1001562652 147
117 3300005367 Ga0070667_100250913 Ga0070667_1002509132 147
118 3300005455 Ga0070663_100671072 Ga0070663_1006710722 147
119 3300005530 Ga0070679_100309175 Ga0070679_1003091753 147
120 3300005539 Ga0068853_101113256 Ga0068853_1011132562 147
121 3300005548 Ga0070665_100000079 Ga0070665_10000007931 147
122 3300005563 Ga0068855_100000079 Ga0068855_10000007980 147
123 3300005563 Ga0068855_101365155 Ga0068855_1013651551 147
124 3300005577 Ga0068857_100055560 Ga0068857_1000555602 147
125 3300005578 Ga0068854_100012239 Ga0068854_1000122392 147
126 3300005614 Ga0068856_100007880 Ga0068856_1000078806 147
127 3300005616 Ga0068852_100201327 Ga0068852_1002013272 147
128 3300005841 Ga0068863_100191713 Ga0068863_1001917132 147
129 3300005844 Ga0068862_100045522 Ga0068862_1000455225 147
130 3300009177 Ga0105248_10019227 Ga0105248_100192278 147
131 3300009545 Ga0105237_10143831 Ga0105237_101438312 147
132 3300009978 Ga0105148_102955 Ga0105148_1029553 147
133 3300010375 Ga0105239_11235093 Ga0105239_112350932 147
134 3300013100 Ga0157373_10006944 Ga0157373_100069447 147
135 3300013100 Ga0157373_10457907 Ga0157373_104579072 147
136 3300013102 Ga0157371_10000558 Ga0157371_1000055843 147
137 3300013102 Ga0157371_10147472 Ga0157371_101474722 147
138 3300013102 Ga0157371_10530369 Ga0157371_105303692 147
139 3300013102 Ga0157371_10620831 Ga0157371_106208312 147
140 3300013102 Ga0157371_10767833 Ga0157371_107678332 147
141 3300013104 Ga0157370_10263953 Ga0157370_102639532 147
142 3300013104 Ga0157370_10773426 Ga0157370_107734262 147
143 3300013105 Ga0157369_10000137 Ga0157369_1000013779 147
144 3300013296 Ga0157374_10583171 Ga0157374_105831712 147
145 3300013307 Ga0157372_10125441 Ga0157372_101254414 147
146 3300020069 Ga0197907_11444725 Ga0197907_114447252 147
147 3300020078 Ga0206352_10690969 Ga0206352_106909691 147
148 3300020082 Ga0206353_10195071 Ga0206353_101950711 147
149 3300025231 Ga0207427_100584 Ga0207427_1005842 147
150 3300025233 Ga0209437_122573 Ga0209437_1225732 147
151 3300025261 Ga0209233_1000003 Ga0209233_100000320 147
152 3300025909 Ga0207705_10000030 Ga0207705_10000030192 147
153 3300025909 Ga0207705_10000190 Ga0207705_1000019058 147
154 3300025909 Ga0207705_10003278 Ga0207705_100032783 147
155 3300025909 Ga0207705_10029863 Ga0207705_100298633 147
156 3300025912 Ga0207707_10164823 Ga0207707_101648232 147
157 3300025913 Ga0207695_10354148 Ga0207695_103541482 147
158 3300025917 Ga0207660_10398930 Ga0207660_103989302 147
159 3300025919 Ga0207657_10000407 Ga0207657_1000040744 147
160 3300025919 Ga0207657_10048797 Ga0207657_100487972 147
161 3300025919 Ga0207657_10800935 Ga0207657_108009352 147
162 3300025920 Ga0207649_10001000 Ga0207649_1000100010 147
163 3300025921 Ga0207652_10362625 Ga0207652_103626252 147
164 3300025923 Ga0207681_10383823 Ga0207681_103838232 147
165 3300025924 Ga0207694_10382941 Ga0207694_103829412 147
166 3300025932 Ga0207690_10126691 Ga0207690_101266913 147
167 3300025949 Ga0207667_10001479 Ga0207667_1000147918 147
168 3300025949 Ga0207667_10056324 Ga0207667_100563244 147
169 3300025949 Ga0207667_10100914 Ga0207667_101009143 147
170 3300025972 Ga0207668_10000704 Ga0207668_100007046 147
171 3300025986 Ga0207658_10029984 Ga0207658_100299846 147
172 3300025986 Ga0207658_10092749 Ga0207658_100927492 147
173 3300026041 Ga0207639_10161654 Ga0207639_101616542 147
174 3300026067 Ga0207678_10041242 Ga0207678_100412422 147
175 3300026067 Ga0207678_10235742 Ga0207678_102357422 147
176 3300026067 Ga0207678_10747791 Ga0207678_107477912 147
177 3300026078 Ga0207702_10009303 Ga0207702_100093036 147
178 3300026078 Ga0207702_10017653 Ga0207702_100176537 147
179 3300026088 Ga0207641_10007534 Ga0207641_100075344 147
180 3300026088 Ga0207641_10012935 Ga0207641_100129354 147
181 3300026116 Ga0207674_10068656 Ga0207674_100686562 147
182 3300028379 Ga0268266_10000573 Ga0268266_1000057333 147
183 3300028379 Ga0268266_10416978 Ga0268266_104169782 147
184 3300028380 Ga0268265_10102892 Ga0268265_101028924 147
185 3300031548 Ga0307408_100033445 Ga0307408_1000334454 147
186 3300031731 Ga0307405_10413324 Ga0307405_104133243 147
187 3300031824 Ga0307413_10168181 Ga0307413_101681812 147
188 3300031824 Ga0307413_11107394 Ga0307413_111073941 147
189 3300031852 Ga0307410_10008532 Ga0307410_100085324 147
190 3300031852 Ga0307410_10603762 Ga0307410_106037622 147
191 3300031901 Ga0307406_10005210 Ga0307406_100052105 147
192 3300031903 Ga0307407_10138863 Ga0307407_101388632 147
193 3300031911 Ga0307412_10024284 Ga0307412_100242844 147
194 3300031995 Ga0307409_100057300 Ga0307409_1000573004 147
195 3300031995 Ga0307409_100345533 Ga0307409_1003455333 147
196 3300032002 Ga0307416_100001470 Ga0307416_10000147010 147
197 3300032002 Ga0307416_102564368 Ga0307416_1025643682 147
198 3300032004 Ga0307414_11498989 Ga0307414_114989891 147
199 3300037312 Ga0395899_0000737 Ga0395899_0000737_9663_10115 147
200 3300037312 Ga0395899_0013803 Ga0395899_0013803_984_1436 147
201 3300037312 Ga0395899_0074724 Ga0395899_0074724_1931_2383 147
202 3300037312 Ga0395899_0182067 Ga0395899_0182067_983_1435 147
203 3300037312 Ga0395899_0226370 Ga0395899_0226370_562_1014 147
204 3300037312 Ga0395899_0271552 Ga0395899_0271552_252_704 147
205 3300037418 Ga0395900_0000364 Ga0395900_0000364_1137_1589 147
206 3300037418 Ga0395900_0039490 Ga0395900_0039490_1510_1962 147
207 3300037418 Ga0395900_0076977 Ga0395900_0076977_42_494 147
208 3300037418 Ga0395900_0192872 Ga0395900_0192872_271_723 147
209 3300037418 Ga0395900_0374662 Ga0395900_0374662_661_1113 147
210 3300037418 Ga0395900_0449306 Ga0395900_0449306_661_1113 147
211 3300037418 Ga0395900_0649916 Ga0395900_0649916_359_811 147
212 3300037466 Ga0395898_0015156 Ga0395898_0015156_3272_3724 147
213 3300037466 Ga0395898_0225961 Ga0395898_0225961_1025_1477 147
214 3300037466 Ga0395898_0398442 Ga0395898_0398442_465_917 147
215 3300037466 Ga0395898_0477277 Ga0395898_0477277_342_794 147
216 3300037466 Ga0395898_1559206 Ga0395898_1559206_81_533 147
217 3300037471 Ga0395905_0377430 Ga0395905_0377430_674_1126 147
218 3300037471 Ga0395905_1638071 Ga0395905_1638071_29_481 147
219 3300038443 Ga0395901_0000209 Ga0395901_0000209_63480_63932 147
220 3300038443 Ga0395901_0027750 Ga0395901_0027750_3279_3731 147
221 3300038443 Ga0395901_0670874 Ga0395901_0670874_93_545 147
222 3300044684 Ga0466966_0000072 Ga0466966_0000072_57730_58182 147
223 3300044684 Ga0466966_0236099 Ga0466966_0236099_400_852 147
224 3300044693 Ga0466961_0337171 Ga0466961_0337171_92_544 147
225 3300044694 Ga0466963_0002946 Ga0466963_0002946_7053_7505 147
226 3300044719 Ga0466971_0001663 Ga0466971_0001663_2565_3017 147
227 3300044765 Ga0466970_0002808 Ga0466970_0002808_499_951 147
228 3300044842 Ga0466957_0001327 Ga0466957_0001327_10964_11416 147
229 3300045049 Ga0466959_0006960 Ga0466959_0006960_7050_7502 147
230 3300045836 Ga0466958_0002556 Ga0466958_0002556_7050_7502 147
231 3300045976 Ga0466967_0263387 Ga0466967_0263387_300_779 147
232 3300048920 Ga0496117_0024831 Ga0496117_0024831_1559_2011 147
233 3300048921 Ga0496118_0001805 Ga0496118_0001805_2616_3068 147
234 3300048924 Ga0496121_0749263 Ga0496121_0749263_69_521 147
235 3300061719 Ga0466962_0006091 Ga0466962_0006091_5283_5735 147
236 iso_pu_bacteria 2775507255 2778125471 147
237 iso_pu_bacteria 8054302542 8054303950 147
238 3300005293 Ga0065715_10036736 Ga0065715_100367362 148
239 3300005293 Ga0065715_10438613 Ga0065715_104386132 148
240 3300005327 Ga0070658_10190223 Ga0070658_101902232 148
241 3300005327 Ga0070658_10234699 Ga0070658_102346992 148
242 3300005333 Ga0070677_10039351 Ga0070677_100393513 148
243 3300005333 Ga0070677_10176907 Ga0070677_101769072 148
244 3300005334 Ga0068869_100584658 Ga0068869_1005846582 148
245 3300005335 Ga0070666_10130809 Ga0070666_101308092 148
246 3300005344 Ga0070661_100234640 Ga0070661_1002346402 148
247 3300005347 Ga0070668_100059315 Ga0070668_1000593154 148
248 3300005353 Ga0070669_100034942 Ga0070669_1000349424 148
249 3300005353 Ga0070669_100063418 Ga0070669_1000634182 148
250 3300005354 Ga0070675_100002250 Ga0070675_1000022508 148
251 3300005354 Ga0070675_100376647 Ga0070675_1003766472 148
252 3300005354 Ga0070675_100471879 Ga0070675_1004718792 148
253 3300005355 Ga0070671_100001083 Ga0070671_10000108322 148
254 3300005355 Ga0070671_100023390 Ga0070671_1000233904 148
255 3300005355 Ga0070671_100827649 Ga0070671_1008276492 148
256 3300005356 Ga0070674_100073683 Ga0070674_1000736834 148
257 3300005364 Ga0070673_100053271 Ga0070673_1000532713 148
258 3300005364 Ga0070673_100078110 Ga0070673_1000781102 148
259 3300005366 Ga0070659_100017781 Ga0070659_1000177816 148
260 3300005366 Ga0070659_100175343 Ga0070659_1001753432 148
261 3300005366 Ga0070659_100319964 Ga0070659_1003199642 148
262 3300005367 Ga0070667_100018950 Ga0070667_1000189502 148
263 3300005367 Ga0070667_100033505 Ga0070667_1000335056 148
264 3300005367 Ga0070667_100322795 Ga0070667_1003227953 148
265 3300005455 Ga0070663_100685578 Ga0070663_1006855782 148
266 3300005456 Ga0070678_100634619 Ga0070678_1006346192 148
267 3300005456 Ga0070678_101897167 Ga0070678_1018971671 148
268 3300005457 Ga0070662_100001195 Ga0070662_1000011953 148
269 3300005457 Ga0070662_100009957 Ga0070662_1000099572 148
270 3300005457 Ga0070662_100013148 Ga0070662_1000131486 148
271 3300005458 Ga0070681_10369166 Ga0070681_103691662 148
272 3300005530 Ga0070679_100060256 Ga0070679_1000602562 148
273 3300005530 Ga0070679_100070254 Ga0070679_1000702545 148
274 3300005543 Ga0070672_100001827 Ga0070672_10000182710 148
275 3300005543 Ga0070672_100291831 Ga0070672_1002918312 148
276 3300005548 Ga0070665_100600147 Ga0070665_1006001472 148
277 3300005564 Ga0070664_100001469 Ga0070664_1000014695 148
278 3300005564 Ga0070664_100082258 Ga0070664_1000822582 148
279 3300005578 Ga0068854_100310456 Ga0068854_1003104562 148
280 3300005616 Ga0068852_101382229 Ga0068852_1013822292 148
281 3300005617 Ga0068859_100000685 Ga0068859_1000006855 148
282 3300005618 Ga0068864_100000847 Ga0068864_1000008478 148
283 3300005841 Ga0068863_100009665 Ga0068863_1000096657 148
284 3300005842 Ga0068858_100000655 Ga0068858_1000006556 148
285 3300005844 Ga0068862_101513777 Ga0068862_1015137772 148
286 3300006353 Ga0075370_10279286 Ga0075370_102792862 148
287 3300006931 Ga0097620_100000685 Ga0097620_10000068528 148
288 3300009092 Ga0105250_10008687 Ga0105250_100086875 148
289 3300009101 Ga0105247_10360070 Ga0105247_103600702 148
290 3300009148 Ga0105243_11106014 Ga0105243_111060142 148
291 3300009174 Ga0105241_11033483 Ga0105241_110334831 148
292 3300009177 Ga0105248_10001364 Ga0105248_1000136412 148
293 3300009177 Ga0105248_10002811 Ga0105248_100028116 148
294 3300009177 Ga0105248_10686952 Ga0105248_106869522 148
295 3300013100 Ga0157373_10025391 Ga0157373_100253912 148
296 3300013100 Ga0157373_10044097 Ga0157373_100440972 148
297 3300013102 Ga0157371_10047545 Ga0157371_100475454 148
298 3300013105 Ga0157369_10103163 Ga0157369_101031633 148
299 3300013297 Ga0157378_11916800 Ga0157378_119168001 148
300 3300013306 Ga0163162_10009361 Ga0163162_1000936112 148
301 3300013306 Ga0163162_10585853 Ga0163162_105858533 148
302 3300013308 Ga0157375_10191240 Ga0157375_101912404 148
303 3300014325 Ga0163163_10000307 Ga0163163_1000030725 148
304 3300014745 Ga0157377_10706156 Ga0157377_107061562 148
305 3300014968 Ga0157379_10011314 Ga0157379_100113148 148
306 3300017792 Ga0163161_10166076 Ga0163161_101660762 148
307 3300017792 Ga0163161_11293530 Ga0163161_112935302 148
308 3300025900 Ga0207710_10270140 Ga0207710_102701402 148
309 3300025901 Ga0207688_10474667 Ga0207688_104746672 148
310 3300025909 Ga0207705_10146844 Ga0207705_101468442 148
311 3300025909 Ga0207705_10186776 Ga0207705_101867762 148
312 3300025912 Ga0207707_10046883 Ga0207707_100468833 148
313 3300025913 Ga0207695_10672144 Ga0207695_106721442 148
314 3300025917 Ga0207660_10098697 Ga0207660_100986972 148
315 3300025920 Ga0207649_10286783 Ga0207649_102867832 148
316 3300025921 Ga0207652_10039973 Ga0207652_100399733 148
317 3300025921 Ga0207652_11393876 Ga0207652_113938761 148
318 3300025923 Ga0207681_10021994 Ga0207681_100219942 148
319 3300025923 Ga0207681_10301854 Ga0207681_103018542 148
320 3300025923 Ga0207681_11438304 Ga0207681_114383041 148
321 3300025925 Ga0207650_10020863 Ga0207650_100208631 148
322 3300025925 Ga0207650_10469281 Ga0207650_104692812 148
323 3300025926 Ga0207659_10008288 Ga0207659_100082887 148
324 3300025926 Ga0207659_10167834 Ga0207659_101678342 148
325 3300025926 Ga0207659_10175755 Ga0207659_101757553 148
326 3300025931 Ga0207644_10013892 Ga0207644_100138924 148
327 3300025931 Ga0207644_10038753 Ga0207644_100387534 148
328 3300025932 Ga0207690_10604744 Ga0207690_106047442 148
329 3300025933 Ga0207706_10000299 Ga0207706_1000029954 148
330 3300025933 Ga0207706_10038677 Ga0207706_100386772 148
331 3300025933 Ga0207706_10044628 Ga0207706_100446282 148
332 3300025933 Ga0207706_10846019 Ga0207706_108460191 148
333 3300025937 Ga0207669_11248865 Ga0207669_112488651 148
334 3300025940 Ga0207691_10014990 Ga0207691_100149902 148
335 3300025940 Ga0207691_10164099 Ga0207691_101640994 148
336 3300025940 Ga0207691_10288264 Ga0207691_102882642 148
337 3300025941 Ga0207711_10001243 Ga0207711_1000124326 148
338 3300025942 Ga0207689_10342030 Ga0207689_103420302 148
339 3300025945 Ga0207679_10008128 Ga0207679_100081287 148
340 3300025945 Ga0207679_10425914 Ga0207679_104259143 148
341 3300025960 Ga0207651_10016674 Ga0207651_100166744 148
342 3300025960 Ga0207651_10053889 Ga0207651_100538895 148
343 3300025972 Ga0207668_10066683 Ga0207668_100666832 148
344 3300025986 Ga0207658_10010272 Ga0207658_100102725 148
345 3300025986 Ga0207658_10030906 Ga0207658_100309063 148
346 3300026035 Ga0207703_10015617 Ga0207703_100156176 148
347 3300026041 Ga0207639_12268210 Ga0207639_122682101 148
348 3300026067 Ga0207678_10365237 Ga0207678_103652373 148
349 3300026067 Ga0207678_10591877 Ga0207678_105918773 148
350 3300026088 Ga0207641_10000502 Ga0207641_1000050222 148
351 3300026088 Ga0207641_10608571 Ga0207641_106085712 148
352 3300026095 Ga0207676_10071181 Ga0207676_100711812 148
353 3300026095 Ga0207676_10078103 Ga0207676_100781031 148
354 3300026095 Ga0207676_10293459 Ga0207676_102934592 148
355 3300026116 Ga0207674_10045558 Ga0207674_100455586 148
356 3300026121 Ga0207683_10373124 Ga0207683_103731242 148
357 3300026121 Ga0207683_10689305 Ga0207683_106893052 148
358 3300027364 Ga0209967_1004839 Ga0209967_10048393 148
359 3300028379 Ga0268266_10014935 Ga0268266_1001493510 148
360 3300028380 Ga0268265_10247232 Ga0268265_102472323 148
361 3300028381 Ga0268264_10000410 Ga0268264_1000041036 148
362 3300028381 Ga0268264_10000418 Ga0268264_1000041830 148
363 3300031548 Ga0307408_100001159 Ga0307408_10000115912 148
364 3300031548 Ga0307408_100125044 Ga0307408_1001250443 148
365 3300031548 Ga0307408_101190148 Ga0307408_1011901482 148
366 3300031731 Ga0307405_10000240 Ga0307405_1000024013 148
367 3300031731 Ga0307405_10086936 Ga0307405_100869364 148
368 3300031731 Ga0307405_10356464 Ga0307405_103564642 148
369 3300031731 Ga0307405_11152486 Ga0307405_111524861 148
370 3300031824 Ga0307413_10000616 Ga0307413_1000061610 148
371 3300031824 Ga0307413_10027487 Ga0307413_100274875 148
372 3300031824 Ga0307413_10870565 Ga0307413_108705652 148
373 3300031824 Ga0307413_11342699 Ga0307413_113426991 148
374 3300031852 Ga0307410_10006997 Ga0307410_100069973 148
375 3300031852 Ga0307410_10016045 Ga0307410_100160453 148
376 3300031852 Ga0307410_10600292 Ga0307410_106002922 148
377 3300031901 Ga0307406_10011286 Ga0307406_100112867 148
378 3300031901 Ga0307406_10039192 Ga0307406_100391923 148
379 3300031901 Ga0307406_10078663 Ga0307406_100786633 148
380 3300031901 Ga0307406_10756021 Ga0307406_107560212 148
381 3300031903 Ga0307407_10000541 Ga0307407_1000054114 148
382 3300031903 Ga0307407_10161683 Ga0307407_101616831 148
383 3300031911 Ga0307412_10000248 Ga0307412_1000024814 148
384 3300031911 Ga0307412_11137841 Ga0307412_111378412 148
385 3300031995 Ga0307409_100006369 Ga0307409_1000063693 148
386 3300031995 Ga0307409_100016495 Ga0307409_1000164952 148
387 3300031995 Ga0307409_100161011 Ga0307409_1001610112 148
388 3300031995 Ga0307409_100419489 Ga0307409_1004194892 148
389 3300031995 Ga0307409_101234591 Ga0307409_1012345911 148
390 3300031995 Ga0307409_101463038 Ga0307409_1014630382 148
391 3300032002 Ga0307416_100001974 Ga0307416_1000019744 148
392 3300032002 Ga0307416_100102321 Ga0307416_1001023212 148
393 3300032002 Ga0307416_100290346 Ga0307416_1002903462 148
394 3300032004 Ga0307414_10006463 Ga0307414_100064633 148
395 3300032004 Ga0307414_10008907 Ga0307414_100089078 148
396 3300032004 Ga0307414_10112131 Ga0307414_101121312 148
397 3300032004 Ga0307414_10266199 Ga0307414_102661992 148
398 3300032004 Ga0307414_10909385 Ga0307414_109093852 148
399 3300032005 Ga0307411_10001520 Ga0307411_1000152010 148
400 3300032005 Ga0307411_10005922 Ga0307411_100059227 148
401 3300032005 Ga0307411_10032195 Ga0307411_100321955 148
402 3300032005 Ga0307411_10172295 Ga0307411_101722954 148
403 3300032005 Ga0307411_10282803 Ga0307411_102828032 148
404 3300032005 Ga0307411_10676258 Ga0307411_106762582 148
405 3300032005 Ga0307411_10721764 Ga0307411_107217641 148
406 3300032005 Ga0307411_10768569 Ga0307411_107685691 148
407 3300032005 Ga0307411_10788767 Ga0307411_107887672 148
408 3300032126 Ga0307415_100014987 Ga0307415_1000149873 148
409 3300032126 Ga0307415_100117068 Ga0307415_1001170682 148
410 3300032126 Ga0307415_100121998 Ga0307415_1001219984 148
411 3300032126 Ga0307415_100222382 Ga0307415_1002223822 148
412 3300032126 Ga0307415_100344218 Ga0307415_1003442182 148
413 3300032126 Ga0307415_101099160 Ga0307415_1010991601 148
414 3300041413 Ga0439465_0161375 Ga0439465_0161375_122_577 148
415 3300041512 Ga0451853_1673430 Ga0451853_1673430_41_496 148
416 3300042006 Ga0439432_098896 Ga0439432_098896_373_828 148
417 3300042007 Ga0439449_0060483 Ga0439449_0060483_42_497 148
418 3300042439 Ga0439464_0008150 Ga0439464_0008150_1301_1756 148
419 3300042876 Ga0451577_0380072 Ga0451577_0380072_769_1224 148
420 3300046492 Ga0495585_0228508 Ga0495585_0228508_245_700 148
421 3300046523 Ga0495644_0141842 Ga0495644_0141842_378_833 148
422 3300046525 Ga0495663_0018242 Ga0495663_0018242_1248_1703 148
423 3300046537 Ga0495598_0007096 Ga0495598_0007096_1824_2279 148
424 3300046539 Ga0495621_0047771 Ga0495621_0047771_450_905 148
425 3300046558 Ga0495633_0017963 Ga0495633_0017963_2776_3231 148
426 3300046616 Ga0495668_0014493 Ga0495668_0014493_60_515 148
427 3300046684 Ga0495669_0008648 Ga0495669_0008648_96_551 148
428 3300046684 Ga0495669_0175812 Ga0495669_0175812_202_663 148
429 3300046691 Ga0495670_0026037 Ga0495670_0026037_727_1182 148
430 3300047445 Ga0495677_0054416 Ga0495677_0054416_145_600 148
431 3300047445 Ga0495677_0114459 Ga0495677_0114459_360_815 148
432 3300048905 Ga0496102_0416986 Ga0496102_0416986_577_1032 148
433 3300048906 Ga0496103_0457665 Ga0496103_0457665_190_645 148
434 3300048910 Ga0496107_0239847 Ga0496107_0239847_337_792 148
435 3300048911 Ga0496108_0155471 Ga0496108_0155471_1241_1696 148
436 3300048912 Ga0496109_0378570 Ga0496109_0378570_505_963 148
437 3300048912 Ga0496109_0689600 Ga0496109_0689600_177_632 148
438 3300048913 Ga0496110_0506538 Ga0496110_0506538_14_469 148
439 3300049679 Ga0501249_000613 Ga0501249_000613_3727_4233 148
440 3300049744 Ga0501083_0541440 Ga0501083_0541440_65_529 148
441 3300053134 Ga0500658_0000105 Ga0500658_0000105_25475_25930 148
442 3300059423 Ga0590074_013153 Ga0590074_013153_178_633 148
443 iso_pu_bacteria 2818991466 2819715914 148
444 iso_pu_bacteria 2928526807 2928529956 148
445 iso_pu_bacteria 2928968154 2928970623 148
446 3300003203 JGI25406J46586_10071786 JGI25406J46586_100717861 149
447 3300003781 Ga0055536_1003413 Ga0055536_10034134 149
448 3300005293 Ga0065715_10191063 Ga0065715_101910632 149
449 3300005293 Ga0065715_10228925 Ga0065715_102289252 149
450 3300005327 Ga0070658_10068154 Ga0070658_100681542 149
451 3300005331 Ga0070670_100291086 Ga0070670_1002910863 149
452 3300005338 Ga0068868_100000242 Ga0068868_10000024211 149
453 3300005339 Ga0070660_100000511 Ga0070660_10000051121 149
454 3300005347 Ga0070668_100415777 Ga0070668_1004157772 149
455 3300005347 Ga0070668_101372488 Ga0070668_1013724881 149
456 3300005353 Ga0070669_100089825 Ga0070669_1000898252 149
457 3300005353 Ga0070669_100789169 Ga0070669_1007891691 149
458 3300005354 Ga0070675_100056390 Ga0070675_1000563904 149
459 3300005355 Ga0070671_100690363 Ga0070671_1006903631 149
460 3300005364 Ga0070673_100649249 Ga0070673_1006492492 149
461 3300005366 Ga0070659_100000005 Ga0070659_100000005156 149
462 3300005445 Ga0070708_100399073 Ga0070708_1003990732 149
463 3300005539 Ga0068853_100333123 Ga0068853_1003331232 149
464 3300005548 Ga0070665_100443165 Ga0070665_1004431652 149
465 3300005548 Ga0070665_100792418 Ga0070665_1007924182 149
466 3300005844 Ga0068862_101210179 Ga0068862_1012101791 149
467 3300005985 Ga0081539_10012387 Ga0081539_100123879 149
468 3300006847 Ga0075431_100292420 Ga0075431_1002924203 149
469 3300006871 Ga0075434_100721426 Ga0075434_1007214262 149
470 3300014497 Ga0182008_10416910 Ga0182008_104169101 149
471 3300017792 Ga0163161_10749918 Ga0163161_107499182 149
472 3300025292 Ga0209676_1000138 Ga0209676_100013877 149
473 3300025298 Ga0209050_1007401 Ga0209050_10074013 149
474 3300025919 Ga0207657_10001735 Ga0207657_1000173521 149
475 3300025920 Ga0207649_10775960 Ga0207649_107759602 149
476 3300025923 Ga0207681_10030478 Ga0207681_100304783 149
477 3300025923 Ga0207681_10075950 Ga0207681_100759503 149
478 3300025923 Ga0207681_10694504 Ga0207681_106945042 149
479 3300025925 Ga0207650_10211933 Ga0207650_102119334 149
480 3300025925 Ga0207650_10565917 Ga0207650_105659172 149
481 3300025925 Ga0207650_11049559 Ga0207650_110495592 149
482 3300025925 Ga0207650_11318735 Ga0207650_113187352 149
483 3300025926 Ga0207659_10011691 Ga0207659_100116915 149
484 3300025927 Ga0207687_10057747 Ga0207687_100577473 149
485 3300025932 Ga0207690_10000002 Ga0207690_10000002801 149
486 3300025932 Ga0207690_10090750 Ga0207690_100907503 149
487 3300025960 Ga0207651_10020708 Ga0207651_100207085 149
488 3300025960 Ga0207651_10088403 Ga0207651_100884032 149
489 3300025972 Ga0207668_10208728 Ga0207668_102087282 149
490 3300025981 Ga0207640_10186562 Ga0207640_101865621 149
491 3300026023 Ga0207677_10000100 Ga0207677_100001002 149
492 3300026041 Ga0207639_10594651 Ga0207639_105946512 149
493 3300027614 Ga0209970_1007728 Ga0209970_10077282 149
494 3300027665 Ga0209983_1056324 Ga0209983_10563242 149
495 3300027876 Ga0209974_10039020 Ga0209974_100390202 149
496 3300027876 Ga0209974_10119293 Ga0209974_101192931 149
497 3300027876 Ga0209974_10324567 Ga0209974_103245671 149
498 3300028379 Ga0268266_10230132 Ga0268266_102301322 149
499 3300028380 Ga0268265_11199530 Ga0268265_111995302 149
500 3300030732 Ga0316176_1000705 Ga0316176_10007053 149
501 3300031548 Ga0307408_100016656 Ga0307408_1000166566 149
502 3300031548 Ga0307408_100063630 Ga0307408_1000636304 149
503 3300031548 Ga0307408_100356372 Ga0307408_1003563723 149
504 3300031548 Ga0307408_100362664 Ga0307408_1003626642 149
505 3300031548 Ga0307408_100727833 Ga0307408_1007278332 149
506 3300031548 Ga0307408_101246240 Ga0307408_1012462402 149
507 3300031548 Ga0307408_101474894 Ga0307408_1014748942 149
508 3300031548 Ga0307408_101766218 Ga0307408_1017662182 149
509 3300031548 Ga0307408_102142702 Ga0307408_1021427021 149
510 3300031731 Ga0307405_10011163 Ga0307405_100111633 149
511 3300031731 Ga0307405_10017649 Ga0307405_100176494 149
512 3300031731 Ga0307405_10031735 Ga0307405_100317353 149
513 3300031731 Ga0307405_10099628 Ga0307405_100996284 149
514 3300031731 Ga0307405_10384625 Ga0307405_103846251 149
515 3300031731 Ga0307405_10430211 Ga0307405_104302112 149
516 3300031731 Ga0307405_10569828 Ga0307405_105698281 149
517 3300031824 Ga0307413_10000171 Ga0307413_1000017122 149
518 3300031824 Ga0307413_10000456 Ga0307413_1000045615 149
519 3300031824 Ga0307413_10019059 Ga0307413_100190595 149
520 3300031824 Ga0307413_10056462 Ga0307413_100564623 149
521 3300031824 Ga0307413_10078049 Ga0307413_100780494 149
522 3300031824 Ga0307413_10097652 Ga0307413_100976522 149
523 3300031824 Ga0307413_10132492 Ga0307413_101324922 149
524 3300031824 Ga0307413_10219547 Ga0307413_102195472 149
525 3300031824 Ga0307413_10259832 Ga0307413_102598322 149
526 3300031824 Ga0307413_10279657 Ga0307413_102796572 149
527 3300031824 Ga0307413_10336377 Ga0307413_103363773 149
528 3300031824 Ga0307413_10471696 Ga0307413_104716961 149
529 3300031824 Ga0307413_10778006 Ga0307413_107780061 149
530 3300031852 Ga0307410_10000393 Ga0307410_100003937 149
531 3300031852 Ga0307410_10002578 Ga0307410_100025789 149
532 3300031852 Ga0307410_10061629 Ga0307410_100616292 149
533 3300031852 Ga0307410_10064380 Ga0307410_100643803 149
534 3300031852 Ga0307410_10219009 Ga0307410_102190092 149
535 3300031852 Ga0307410_10228266 Ga0307410_102282662 149
536 3300031852 Ga0307410_10438174 Ga0307410_104381742 149
537 3300031852 Ga0307410_11235745 Ga0307410_112357452 149
538 3300031852 Ga0307410_11324365 Ga0307410_113243651 149
539 3300031901 Ga0307406_10070333 Ga0307406_100703332 149
540 3300031901 Ga0307406_10075223 Ga0307406_100752233 149
541 3300031901 Ga0307406_10218364 Ga0307406_102183642 149
542 3300031901 Ga0307406_10240568 Ga0307406_102405682 149
543 3300031901 Ga0307406_10659882 Ga0307406_106598822 149
544 3300031901 Ga0307406_10822830 Ga0307406_108228302 149
545 3300031903 Ga0307407_10004230 Ga0307407_100042305 149
546 3300031903 Ga0307407_10007478 Ga0307407_100074781 149
547 3300031903 Ga0307407_10017174 Ga0307407_100171744 149
548 3300031903 Ga0307407_10061866 Ga0307407_100618662 149
549 3300031903 Ga0307407_10193103 Ga0307407_101931033 149
550 3300031903 Ga0307407_10226649 Ga0307407_102266492 149
551 3300031903 Ga0307407_10556979 Ga0307407_105569792 149
552 3300031903 Ga0307407_10725562 Ga0307407_107255622 149
553 3300031903 Ga0307407_10772825 Ga0307407_107728252 149
554 3300031911 Ga0307412_10003751 Ga0307412_100037517 149
555 3300031911 Ga0307412_10299098 Ga0307412_102990982 149
556 3300031911 Ga0307412_10304265 Ga0307412_103042652 149
557 3300031911 Ga0307412_10368995 Ga0307412_103689952 149
558 3300031911 Ga0307412_10388345 Ga0307412_103883453 149
559 3300031911 Ga0307412_10504474 Ga0307412_105044742 149
560 3300031911 Ga0307412_10776631 Ga0307412_107766312 149
561 3300031911 Ga0307412_11049214 Ga0307412_110492141 149
562 3300031911 Ga0307412_11584500 Ga0307412_115845002 149
563 3300031995 Ga0307409_100000418 Ga0307409_1000004184 149
564 3300031995 Ga0307409_100044516 Ga0307409_1000445165 149
565 3300031995 Ga0307409_100082143 Ga0307409_1000821432 149
566 3300031995 Ga0307409_100157527 Ga0307409_1001575272 149
567 3300031995 Ga0307409_100351714 Ga0307409_1003517142 149
568 3300031995 Ga0307409_100353658 Ga0307409_1003536582 149
569 3300031995 Ga0307409_100469972 Ga0307409_1004699722 149
570 3300031995 Ga0307409_100522217 Ga0307409_1005222172 149
571 3300031995 Ga0307409_101841097 Ga0307409_1018410971 149
572 3300031995 Ga0307409_102259518 Ga0307409_1022595181 149
573 3300032002 Ga0307416_100003475 Ga0307416_1000034756 149
574 3300032002 Ga0307416_100270621 Ga0307416_1002706212 149
575 3300032002 Ga0307416_100651303 Ga0307416_1006513032 149
576 3300032002 Ga0307416_100998690 Ga0307416_1009986902 149
577 3300032002 Ga0307416_101549791 Ga0307416_1015497912 149
578 3300032002 Ga0307416_102197064 Ga0307416_1021970642 149
579 3300032004 Ga0307414_10001025 Ga0307414_1000102517 149
580 3300032004 Ga0307414_10002328 Ga0307414_100023283 149
581 3300032004 Ga0307414_10003301 Ga0307414_100033012 149
582 3300032004 Ga0307414_10006871 Ga0307414_100068714 149
583 3300032004 Ga0307414_10010462 Ga0307414_100104622 149
584 3300032004 Ga0307414_10040471 Ga0307414_100404713 149
585 3300032004 Ga0307414_10053960 Ga0307414_100539603 149
586 3300032004 Ga0307414_10072279 Ga0307414_100722794 149
587 3300032004 Ga0307414_10119886 Ga0307414_101198862 149
588 3300032004 Ga0307414_10195016 Ga0307414_101950162 149
589 3300032004 Ga0307414_10255013 Ga0307414_102550132 149
590 3300032004 Ga0307414_10315990 Ga0307414_103159903 149
591 3300032004 Ga0307414_10317232 Ga0307414_103172322 149
592 3300032004 Ga0307414_10324168 Ga0307414_103241682 149
593 3300032004 Ga0307414_10378487 Ga0307414_103784873 149
594 3300032004 Ga0307414_10408530 Ga0307414_104085302 149
595 3300032004 Ga0307414_10682889 Ga0307414_106828892 149
596 3300032004 Ga0307414_10730084 Ga0307414_107300842 149
597 3300032004 Ga0307414_11829477 Ga0307414_118294771 149
598 3300032005 Ga0307411_10001702 Ga0307411_1000170210 149
599 3300032005 Ga0307411_10006216 Ga0307411_100062166 149
600 3300032005 Ga0307411_10015612 Ga0307411_100156122 149
601 3300032005 Ga0307411_10026563 Ga0307411_100265632 149
602 3300032005 Ga0307411_10042911 Ga0307411_100429113 149
603 3300032005 Ga0307411_10064909 Ga0307411_100649092 149
604 3300032005 Ga0307411_10087319 Ga0307411_100873193 149
605 3300032005 Ga0307411_10093478 Ga0307411_100934782 149
606 3300032005 Ga0307411_10120689 Ga0307411_101206892 149
607 3300032005 Ga0307411_10162794 Ga0307411_101627942 149
608 3300032005 Ga0307411_10164409 Ga0307411_101644092 149
609 3300032005 Ga0307411_10231071 Ga0307411_102310711 149
610 3300032005 Ga0307411_10258286 Ga0307411_102582862 149
611 3300032005 Ga0307411_10402034 Ga0307411_104020342 149
612 3300032005 Ga0307411_10842447 Ga0307411_108424472 149
613 3300032005 Ga0307411_10951097 Ga0307411_109510971 149
614 3300032005 Ga0307411_11304274 Ga0307411_113042742 149
615 3300032126 Ga0307415_100017172 Ga0307415_1000171727 149
616 3300032126 Ga0307415_100021579 Ga0307415_1000215794 149
617 3300032126 Ga0307415_100323607 Ga0307415_1003236072 149
618 3300032126 Ga0307415_100461041 Ga0307415_1004610412 149
619 3300032126 Ga0307415_100471256 Ga0307415_1004712562 149
620 3300032126 Ga0307415_100589835 Ga0307415_1005898352 149
621 3300032126 Ga0307415_100800671 Ga0307415_1008006712 149
622 3300032126 Ga0307415_101511964 Ga0307415_1015119642 149
623 3300032126 Ga0307415_101982859 Ga0307415_1019828591 149
624 3300037312 Ga0395899_0157054 Ga0395899_0157054_1118_1576 149
625 3300037418 Ga0395900_0005528 Ga0395900_0005528_11204_11662 149
626 3300037471 Ga0395905_0000500 Ga0395905_0000500_29196_29654 149
627 3300038443 Ga0395901_0000181 Ga0395901_0000181_31219_31677 149
628 3300039437 Ga0436365_0175085 Ga0436365_0175085_14_469 149
629 3300042004 Ga0439445_0000195 Ga0439445_0000195_8465_8926 149
630 3300046453 Ga0495627_000336 Ga0495627_000336_33787_34248 149
631 3300046520 Ga0495637_0027991 Ga0495637_0027991_1264_1725 149
632 3300046522 Ga0495643_0028472 Ga0495643_0028472_2164_2628 149
633 3300046542 Ga0495597_0020470 Ga0495597_0020470_1322_1786 149
634 3300046558 Ga0495633_0136534 Ga0495633_0136534_215_676 149
635 3300046558 Ga0495633_0187619 Ga0495633_0187619_297_761 149
636 3300046616 Ga0495668_0065423 Ga0495668_0065423_143_604 149
637 3300046616 Ga0495668_0528661 Ga0495668_0528661_139_603 149
638 3300046660 Ga0495625_0093717 Ga0495625_0093717_923_1387 149
639 3300047472 Ga0495686_0010783 Ga0495686_0010783_3158_3625 149
640 3300049652 Ga0501202_053900 Ga0501202_053900_371_829 149
641 3300049656 Ga0501209_056656 Ga0501209_056656_544_1002 149
642 3300049670 Ga0501236_003714 Ga0501236_003714_887_1339 149
643 3300049687 Ga0501258_013324 Ga0501258_013324_392_853 149
644 3300049705 Ga0501225_0059899 Ga0501225_0059899_405_857 149
645 3300049705 Ga0501225_0307412 Ga0501225_0307412_14_472 149
646 3300049708 Ga0501245_003097 Ga0501245_003097_1544_1996 149
647 3300049764 Ga0501267_023087 Ga0501267_023087_176_634 149
648 3300049778 Ga0501282_027731 Ga0501282_027731_157_609 149
649 3300050512 nmdc:mga0n895_519567_c1 nmdc:mga0n895_519567_c1_292_753 149
650 3300053091 Ga0500647_0069216 Ga0500647_0069216_1218_1682 149
651 3300053096 Ga0500641_0145271 Ga0500641_0145271_268_732 149
652 3300053109 Ga0500569_085988 Ga0500569_085988_411_872 149
653 3300053130 Ga0500642_0028041 Ga0500642_0028041_332_796 149
654 3300053133 Ga0500655_000166 Ga0500655_000166_15074_15535 149
655 3300053136 Ga0500559_0025680 Ga0500559_0025680_1641_2108 149
656 3300053148 Ga0500590_002808 Ga0500590_002808_468_932 149
657 3300053156 Ga0500622_0003191 Ga0500622_0003191_401_865 149
658 3300053163 Ga0500639_046557 Ga0500639_046557_1286_1750 149
659 3300053724 Ga0500570_000639 Ga0500570_000639_1202_1666 149
660 3300053730 Ga0500645_051176 Ga0500645_051176_274_738 149
661 iso_pu_bacteria 2895880812 2895881090 149
662 3300003781 Ga0055536_1006131 Ga0055536_10061316 150
663 3300003784 Ga0055534_1030330 Ga0055534_10303302 150
664 3300003791 Ga0055530_10000510 Ga0055530_1000051010 150
665 3300003791 Ga0055530_10000526 Ga0055530_1000052622 150
666 3300003794 Ga0055531_10000319 Ga0055531_1000031922 150
667 3300003794 Ga0055531_10000563 Ga0055531_100005638 150
668 3300003794 Ga0055531_10001477 Ga0055531_100014777 150
669 3300005262 Ga0065165_1007081 Ga0065165_10070817 150
670 3300005289 Ga0065704_10003284 Ga0065704_100032842 150
671 3300005353 Ga0070669_100856207 Ga0070669_1008562071 150
672 3300005548 Ga0070665_100000115 Ga0070665_10000011536 150
673 3300005577 Ga0068857_100046897 Ga0068857_1000468974 150
674 3300005617 Ga0068859_100015779 Ga0068859_1000157792 150
675 3300006931 Ga0097620_100015779 Ga0097620_1000157792 150
676 3300009551 Ga0105238_10386174 Ga0105238_103861742 150
677 3300014325 Ga0163163_10804138 Ga0163163_108041382 150
678 3300025245 Ga0207425_1020371 Ga0207425_10203713 150
679 3300025291 Ga0209675_1000137 Ga0209675_100013739 150
680 3300025292 Ga0209676_1000883 Ga0209676_100088326 150
681 3300025292 Ga0209676_1001128 Ga0209676_100112821 150
682 3300025292 Ga0209676_1059610 Ga0209676_10596102 150
683 3300025294 Ga0209025_1037422 Ga0209025_10374222 150
684 3300025298 Ga0209050_1000010 Ga0209050_1000010739 150
685 3300025298 Ga0209050_1001243 Ga0209050_100124318 150
686 3300025304 Ga0209257_1000027 Ga0209257_1000027381 150
687 3300025304 Ga0209257_1000603 Ga0209257_100060351 150
688 3300025304 Ga0209257_1006641 Ga0209257_10066418 150
689 3300025923 Ga0207681_10365845 Ga0207681_103658451 150
690 3300025941 Ga0207711_10000917 Ga0207711_1000091721 150
691 3300025942 Ga0207689_10673590 Ga0207689_106735901 150
692 3300028379 Ga0268266_10000015 Ga0268266_10000015484 150
693 3300028379 Ga0268266_10085215 Ga0268266_100852153 150
694 3300031824 Ga0307413_10886191 Ga0307413_108861912 150
695 3300031901 Ga0307406_10674308 Ga0307406_106743082 150
696 3300031901 Ga0307406_11046730 Ga0307406_110467302 150
697 3300031911 Ga0307412_10302333 Ga0307412_103023332 150
698 3300031995 Ga0307409_100625558 Ga0307409_1006255582 150
699 3300032004 Ga0307414_10000095 Ga0307414_1000009516 150
700 3300032004 Ga0307414_10019929 Ga0307414_100199293 150
701 3300032004 Ga0307414_10020612 Ga0307414_100206122 150
702 3300032004 Ga0307414_10021323 Ga0307414_100213235 150
703 3300032004 Ga0307414_10033451 Ga0307414_100334516 150
704 3300032004 Ga0307414_10069094 Ga0307414_100690944 150
705 3300032004 Ga0307414_10079602 Ga0307414_100796023 150
706 3300032004 Ga0307414_11301636 Ga0307414_113016362 150
707 3300032005 Ga0307411_10080940 Ga0307411_100809402 150
708 3300032005 Ga0307411_10203177 Ga0307411_102031774 150
709 3300039437 Ga0436365_1660687 Ga0436365_1660687_942_1406 150
710 3300039450 Ga0436363_0468499 Ga0436363_0468499_366_818 150
711 3300041486 Ga0451807_1464321 Ga0451807_1464321_409_891 150
712 3300046507 Ga0495606_0000121 Ga0495606_0000121_2535_2999 150
713 3300046522 Ga0495643_0168387 Ga0495643_0168387_392_862 150
714 3300046525 Ga0495663_0051402 Ga0495663_0051402_690_1160 150
715 3300046530 Ga0495654_0051371 Ga0495654_0051371_700_1194 150
716 3300046616 Ga0495668_0000031 Ga0495668_0000031_23346_23828 150
717 3300046660 Ga0495625_0244112 Ga0495625_0244112_14_484 150
718 3300047472 Ga0495686_0000063 Ga0495686_0000063_195064_195522 150
719 3300047472 Ga0495686_0002251 Ga0495686_0002251_2870_3340 150
720 3300048911 Ga0496108_0001376 Ga0496108_0001376_15037_15501 150
721 3300048914 Ga0496111_0436900 Ga0496111_0436900_232_696 150
722 3300048921 Ga0496118_0043906 Ga0496118_0043906_739_1197 150
723 3300048922 Ga0496119_0141551 Ga0496119_0141551_423_884 150
724 3300048922 Ga0496119_0243789 Ga0496119_0243789_208_675 150
725 3300048923 Ga0496120_0043987 Ga0496120_0043987_233_694 150
726 3300048924 Ga0496121_0000997 Ga0496121_0000997_26438_26902 150
727 3300048924 Ga0496121_0165979 Ga0496121_0165979_219_680 150
728 3300048925 Ga0496122_0002248 Ga0496122_0002248_3582_4037 150
729 3300048926 Ga0496123_0010997 Ga0496123_0010997_7153_7608 150
730 3300048927 Ga0496124_0004445 Ga0496124_0004445_3731_4186 150
731 3300048928 Ga0496125_0024159 Ga0496125_0024159_1829_2296 150
732 3300048928 Ga0496125_0028356 Ga0496125_0028356_2691_3155 150
733 3300048928 Ga0496125_0282035 Ga0496125_0282035_233_694 150
734 3300048929 Ga0496126_0155810 Ga0496126_0155810_370_852 150
735 3300048929 Ga0496126_0545939 Ga0496126_0545939_126_587 150
736 3300049568 Ga0501031_0146688 Ga0501031_0146688_247_717 150
737 3300049569 Ga0501032_0039347 Ga0501032_0039347_1599_2069 150
738 3300049570 Ga0501033_0013767 Ga0501033_0013767_1148_1618 150
739 3300049571 Ga0501034_0280845 Ga0501034_0280845_511_981 150
740 3300049572 Ga0501036_0014604 Ga0501036_0014604_4523_4993 150
741 3300049573 Ga0501037_0216908 Ga0501037_0216908_544_1014 150
742 3300049574 Ga0501038_0016778 Ga0501038_0016778_4120_4590 150
743 3300049575 Ga0501039_0037093 Ga0501039_0037093_477_947 150
744 3300049579 Ga0501043_0216648 Ga0501043_0216648_552_1022 150
745 3300049581 Ga0501047_0047680 Ga0501047_0047680_2040_2510 150
746 3300049582 Ga0501048_0203136 Ga0501048_0203136_440_910 150
747 3300049822 Ga0501035_0012319 Ga0501035_0012319_3735_4205 150
748 3300049823 Ga0501044_0011936 Ga0501044_0011936_49_519 150
749 3300053087 Ga0500643_016270 Ga0500643_016270_1319_1786 150
750 3300053142 Ga0500577_0038540 Ga0500577_0038540_1030_1494 150
751 3300053158 Ga0500627_0000543 Ga0500627_0000543_4033_4527 150
752 iso_pu_bacteria 2643221605 2644040265 150
753 3300001989 JGI24739J22299_10000157 JGI24739J22299_1000015719 151
754 3300001990 JGI24737J22298_10001199 JGI24737J22298_100011993 151
755 3300001991 JGI24743J22301_10004170 JGI24743J22301_100041701 151
756 3300002067 JGI24735J21928_10014557 JGI24735J21928_100145573 151
757 3300002067 JGI24735J21928_10015705 JGI24735J21928_100157051 151
758 3300002075 JGI24738J21930_10000532 JGI24738J21930_100005327 151
759 3300002239 JGI24034J26672_10004861 JGI24034J26672_100048612 151
760 3300002459 JGI24751J29686_10033042 JGI24751J29686_100330422 151
761 3300003763 Ga0055529_1024883 Ga0055529_10248832 151
762 3300005327 Ga0070658_10000003 Ga0070658_10000003280 151
763 3300005327 Ga0070658_10088787 Ga0070658_100887873 151
764 3300005328 Ga0070676_10000111 Ga0070676_100001114 151
765 3300005331 Ga0070670_100003607 Ga0070670_10000360710 151
766 3300005334 Ga0068869_100000428 Ga0068869_10000042823 151
767 3300005335 Ga0070666_10083448 Ga0070666_100834482 151
768 3300005338 Ga0068868_100000387 Ga0068868_10000038727 151
769 3300005339 Ga0070660_100000122 Ga0070660_10000012215 151
770 3300005345 Ga0070692_10018822 Ga0070692_100188224 151
771 3300005347 Ga0070668_100000007 Ga0070668_10000000712 151
772 3300005347 Ga0070668_100000025 Ga0070668_10000002594 151
773 3300005353 Ga0070669_100893268 Ga0070669_1008932681 151
774 3300005354 Ga0070675_100015862 Ga0070675_1000158622 151
775 3300005355 Ga0070671_100000046 Ga0070671_10000004610 151
776 3300005355 Ga0070671_100000068 Ga0070671_10000006854 151
777 3300005355 Ga0070671_100018209 Ga0070671_1000182092 151
778 3300005356 Ga0070674_100008356 Ga0070674_1000083561 151
779 3300005364 Ga0070673_100000015 Ga0070673_10000001568 151
780 3300005366 Ga0070659_100002131 Ga0070659_10000213114 151
781 3300005366 Ga0070659_100174298 Ga0070659_1001742985 151
782 3300005367 Ga0070667_100000006 Ga0070667_100000006239 151
783 3300005457 Ga0070662_100009859 Ga0070662_1000098593 151
784 3300005457 Ga0070662_100697453 Ga0070662_1006974532 151
785 3300005459 Ga0068867_100000030 Ga0068867_10000003014 151
786 3300005547 Ga0070693_100052425 Ga0070693_1000524252 151
787 3300005564 Ga0070664_100590112 Ga0070664_1005901122 151
788 3300005615 Ga0070702_100744821 Ga0070702_1007448212 151
789 3300005617 Ga0068859_100015892 Ga0068859_10001589210 151
790 3300005617 Ga0068859_100103350 Ga0068859_1001033503 151
791 3300005841 Ga0068863_100000027 Ga0068863_100000027115 151
792 3300005841 Ga0068863_100028760 Ga0068863_1000287603 151
793 3300005842 Ga0068858_100000417 Ga0068858_10000041722 151
794 3300005843 Ga0068860_100000074 Ga0068860_10000007480 151
795 3300005844 Ga0068862_100000286 Ga0068862_10000028625 151
796 3300005844 Ga0068862_100081887 Ga0068862_1000818872 151
797 3300005844 Ga0068862_101248942 Ga0068862_1012489422 151
798 3300006237 Ga0097621_100879107 Ga0097621_1008791072 151
799 3300006881 Ga0068865_100000021 Ga0068865_10000002169 151
800 3300006931 Ga0097620_100015892 Ga0097620_1000158922 151
801 3300006931 Ga0097620_100103347 Ga0097620_1001033473 151
802 3300009098 Ga0105245_10230096 Ga0105245_102300962 151
803 3300009148 Ga0105243_10001112 Ga0105243_100011126 151
804 3300009176 Ga0105242_10001345 Ga0105242_100013459 151
805 3300011119 Ga0105246_10004310 Ga0105246_100043102 151
806 3300013100 Ga0157373_10212678 Ga0157373_102126782 151
807 3300013102 Ga0157371_10869987 Ga0157371_108699871 151
808 3300013104 Ga0157370_10001520 Ga0157370_1000152022 151
809 3300013104 Ga0157370_10323795 Ga0157370_103237952 151
810 3300013105 Ga0157369_10005976 Ga0157369_100059769 151
811 3300013296 Ga0157374_10046682 Ga0157374_100466826 151
812 3300013306 Ga0163162_10137629 Ga0163162_101376294 151
813 3300013307 Ga0157372_10003647 Ga0157372_100036476 151
814 3300013307 Ga0157372_10062824 Ga0157372_100628243 151
815 3300013307 Ga0157372_10177007 Ga0157372_101770073 151
816 3300013307 Ga0157372_11713578 Ga0157372_117135781 151
817 3300013307 Ga0157372_11976795 Ga0157372_119767952 151
818 3300013308 Ga0157375_10002223 Ga0157375_1000222319 151
819 3300013308 Ga0157375_11718467 Ga0157375_117184672 151
820 3300014325 Ga0163163_10396923 Ga0163163_103969233 151
821 3300014325 Ga0163163_11626519 Ga0163163_116265192 151
822 3300014969 Ga0157376_10000078 Ga0157376_1000007829 151
823 3300017792 Ga0163161_11131813 Ga0163161_111318132 151
824 3300021358 Ga0213873_10000026 Ga0213873_1000002672 151
825 3300021384 Ga0213876_10000149 Ga0213876_100001494 151
826 3300021384 Ga0213876_10000371 Ga0213876_1000037110 151
827 3300021384 Ga0213876_10041444 Ga0213876_100414442 151
828 3300025254 Ga0209148_1002009 Ga0209148_10020096 151
829 3300025272 Ga0209455_1000383 Ga0209455_100038329 151
830 3300025315 Ga0207697_10031163 Ga0207697_100311632 151
831 3300025903 Ga0207680_10116533 Ga0207680_101165331 151
832 3300025903 Ga0207680_10476841 Ga0207680_104768411 151
833 3300025904 Ga0207647_10011142 Ga0207647_100111426 151
834 3300025904 Ga0207647_10193197 Ga0207647_101931973 151
835 3300025904 Ga0207647_10247766 Ga0207647_102477662 151
836 3300025907 Ga0207645_10008246 Ga0207645_100082466 151
837 3300025909 Ga0207705_10000005 Ga0207705_10000005282 151
838 3300025909 Ga0207705_10030549 Ga0207705_100305493 151
839 3300025919 Ga0207657_10000832 Ga0207657_1000083224 151
840 3300025919 Ga0207657_10097816 Ga0207657_100978163 151
841 3300025919 Ga0207657_10459546 Ga0207657_104595462 151
842 3300025923 Ga0207681_10102207 Ga0207681_101022071 151
843 3300025925 Ga0207650_10099622 Ga0207650_100996224 151
844 3300025926 Ga0207659_10004323 Ga0207659_100043233 151
845 3300025927 Ga0207687_10000683 Ga0207687_1000068321 151
846 3300025927 Ga0207687_10067528 Ga0207687_100675282 151
847 3300025931 Ga0207644_10000098 Ga0207644_1000009830 151
848 3300025932 Ga0207690_10001554 Ga0207690_1000155415 151
849 3300025933 Ga0207706_10333385 Ga0207706_103333852 151
850 3300025934 Ga0207686_10010225 Ga0207686_100102252 151
851 3300025935 Ga0207709_10000118 Ga0207709_1000011873 151
852 3300025937 Ga0207669_10064384 Ga0207669_100643842 151
853 3300025938 Ga0207704_10000027 Ga0207704_1000002773 151
854 3300025942 Ga0207689_10000309 Ga0207689_1000030930 151
855 3300025945 Ga0207679_11123238 Ga0207679_111232382 151
856 3300025960 Ga0207651_10000016 Ga0207651_1000001673 151
857 3300025961 Ga0207712_10288068 Ga0207712_102880682 151
858 3300025972 Ga0207668_10000009 Ga0207668_10000009165 151
859 3300025972 Ga0207668_10000574 Ga0207668_1000057416 151
860 3300025986 Ga0207658_10000010 Ga0207658_10000010236 151
861 3300026023 Ga0207677_10000171 Ga0207677_1000017131 151
862 3300026035 Ga0207703_10001633 Ga0207703_1000163321 151
863 3300026041 Ga0207639_10019004 Ga0207639_100190044 151
864 3300026067 Ga0207678_10083741 Ga0207678_100837414 151
865 3300026088 Ga0207641_10000045 Ga0207641_1000004561 151
866 3300026088 Ga0207641_10002294 Ga0207641_1000229417 151
867 3300026088 Ga0207641_10544279 Ga0207641_105442792 151
868 3300026089 Ga0207648_10000116 Ga0207648_100001163 151
869 3300026116 Ga0207674_10510032 Ga0207674_105100323 151
870 3300026118 Ga0207675_100011968 Ga0207675_1000119684 151
871 3300028380 Ga0268265_10000324 Ga0268265_1000032415 151
872 3300028380 Ga0268265_11121176 Ga0268265_111211762 151
873 3300028380 Ga0268265_11837781 Ga0268265_118377812 151
874 3300028381 Ga0268264_10000070 Ga0268264_10000070176 151
875 3300028381 Ga0268264_10031237 Ga0268264_100312371 151
876 3300031731 Ga0307405_10022731 Ga0307405_100227313 151
877 3300031852 Ga0307410_10321222 Ga0307410_103212223 151
878 3300031852 Ga0307410_10583158 Ga0307410_105831582 151
879 3300031903 Ga0307407_10257525 Ga0307407_102575252 151
880 3300031911 Ga0307412_10216818 Ga0307412_102168182 151
881 3300031911 Ga0307412_11820384 Ga0307412_118203841 151
882 3300031995 Ga0307409_100221471 Ga0307409_1002214712 151
883 3300032002 Ga0307416_100207932 Ga0307416_1002079322 151
884 3300032002 Ga0307416_101762504 Ga0307416_1017625042 151
885 3300032002 Ga0307416_101892888 Ga0307416_1018928882 151
886 3300032004 Ga0307414_10698392 Ga0307414_106983922 151
887 3300032005 Ga0307411_10161096 Ga0307411_101610962 151
888 3300032126 Ga0307415_100007620 Ga0307415_1000076202 151
889 3300037418 Ga0395900_0134354 Ga0395900_0134354_824_1297 151
890 3300037471 Ga0395905_0089793 Ga0395905_0089793_977_1450 151
891 3300038443 Ga0395901_0043660 Ga0395901_0043660_2070_2543 151
892 3300039437 Ga0436365_0083543 Ga0436365_0083543_42573_43028 151
893 3300039437 Ga0436365_1025078 Ga0436365_1025078_30565_31020 151
894 3300039437 Ga0436365_1912201 Ga0436365_1912201_920_1375 151
895 3300039453 Ga0436362_0376260 Ga0436362_0376260_71934_72389 151
896 3300042012 Ga0439455_0054782 Ga0439455_0054782_357_824 151
897 3300044694 Ga0466963_0017348 Ga0466963_0017348_618_1079 151
898 3300044719 Ga0466971_0012663 Ga0466971_0012663_1980_2441 151
899 3300044842 Ga0466957_0049413 Ga0466957_0049413_1744_2205 151
900 3300045049 Ga0466959_0379469 Ga0466959_0379469_435_896 151
901 3300045836 Ga0466958_0057446 Ga0466958_0057446_1150_1611 151
902 3300045976 Ga0466967_0057376 Ga0466967_0057376_2314_2775 151
903 3300046530 Ga0495654_0021570 Ga0495654_0021570_2423_2884 151
904 3300047443 Ga0495687_048593 Ga0495687_048593_386_853 151
905 3300047472 Ga0495686_0234464 Ga0495686_0234464_299_754 151
906 3300048929 Ga0496126_0744365 Ga0496126_0744365_42_512 151
907 3300049570 Ga0501033_0158359 Ga0501033_0158359_355_837 151
908 3300049571 Ga0501034_0391430 Ga0501034_0391430_589_1044 151
909 3300049581 Ga0501047_0491022 Ga0501047_0491022_70_537 151
910 3300049586 Ga0501070_0508978 Ga0501070_0508978_298_798 151
911 3300049672 Ga0501239_033246 Ga0501239_033246_155_619 151
912 3300049677 Ga0501247_039281 Ga0501247_039281_70_534 151
913 3300049679 Ga0501249_009214 Ga0501249_009214_1267_1731 151
914 3300049683 Ga0501253_163566 Ga0501253_163566_25_489 151
915 3300049705 Ga0501225_0031454 Ga0501225_0031454_207_671 151
916 3300049765 Ga0501268_001525 Ga0501268_001525_160_624 151
917 3300049770 Ga0501273_028951 Ga0501273_028951_50_517 151
918 3300049822 Ga0501035_0586439 Ga0501035_0586439_436_897 151
919 3300053087 Ga0500643_004868 Ga0500643_004868_3357_3824 151
920 3300053116 Ga0500592_000173 Ga0500592_000173_3528_3989 151
921 3300053158 Ga0500627_0001084 Ga0500627_0001084_6869_7330 151
922 3300053730 Ga0500645_081191 Ga0500645_081191_264_731 151
923 3300061719 Ga0466962_0011134 Ga0466962_0011134_2164_2625 151
924 iso_pu_bacteria 2919709256 2919711262 151
925 iso_pu_bacteria 3000865235 3000867371 151
926 3300002459 JGI24751J29686_10000166 JGI24751J29686_1000016614 152
927 3300005295 Ga0065707_10090212 Ga0065707_100902123 152
928 3300005331 Ga0070670_100000158 Ga0070670_10000015860 152
929 3300005335 Ga0070666_10231897 Ga0070666_102318972 152
930 3300005353 Ga0070669_100000031 Ga0070669_100000031136 152
931 3300005367 Ga0070667_100012635 Ga0070667_1000126354 152
932 3300005543 Ga0070672_100440561 Ga0070672_1004405612 152
933 3300005577 Ga0068857_100033095 Ga0068857_1000330953 152
934 3300005617 Ga0068859_100003342 Ga0068859_1000033422 152
935 3300005618 Ga0068864_100000123 Ga0068864_10000012360 152
936 3300005719 Ga0068861_100006738 Ga0068861_1000067383 152
937 3300005844 Ga0068862_100000043 Ga0068862_100000043152 152
938 3300006042 Ga0075368_10000388 Ga0075368_100003883 152
939 3300006048 Ga0075363_100333995 Ga0075363_1003339952 152
940 3300006178 Ga0075367_10040068 Ga0075367_100400684 152
941 3300006353 Ga0075370_10008159 Ga0075370_100081595 152
942 3300006358 Ga0068871_101062358 Ga0068871_1010623582 152
943 3300006931 Ga0097620_100003342 Ga0097620_1000033422 152
944 3300009177 Ga0105248_10002301 Ga0105248_1000230119 152
945 3300013297 Ga0157378_10018559 Ga0157378_100185593 152
946 3300014325 Ga0163163_10009391 Ga0163163_100093919 152
947 3300014326 Ga0157380_10000040 Ga0157380_1000004019 152
948 3300025914 Ga0207671_10008873 Ga0207671_100088733 152
949 3300025923 Ga0207681_10000014 Ga0207681_10000014341 152
950 3300025923 Ga0207681_10502319 Ga0207681_105023192 152
951 3300025925 Ga0207650_10000015 Ga0207650_10000015354 152
952 3300025940 Ga0207691_10381693 Ga0207691_103816932 152
953 3300025941 Ga0207711_10001332 Ga0207711_100013326 152
954 3300025986 Ga0207658_10000512 Ga0207658_1000051215 152
955 3300026088 Ga0207641_10054395 Ga0207641_100543952 152
956 3300026095 Ga0207676_10000021 Ga0207676_1000002148 152
957 3300026116 Ga0207674_10026530 Ga0207674_100265306 152
958 3300026118 Ga0207675_100014486 Ga0207675_1000144864 152
959 3300027866 Ga0209813_10000172 Ga0209813_1000017227 152
960 3300028380 Ga0268265_10000013 Ga0268265_1000001319 152
961 3300028381 Ga0268264_10903906 Ga0268264_109039061 152
962 3300031903 Ga0307407_10077532 Ga0307407_100775323 152
963 3300032002 Ga0307416_100004905 Ga0307416_10000490510 152
964 3300037853 Ga0436364_0098112 Ga0436364_0098112_133_603 152
965 3300046491 Ga0495584_0018184 Ga0495584_0018184_318_779 152
966 3300046519 Ga0495632_0000023 Ga0495632_0000023_24850_25311 152
967 3300046520 Ga0495637_0010624 Ga0495637_0010624_3843_4304 152
968 3300046522 Ga0495643_0000038 Ga0495643_0000038_25480_25941 152
969 3300046525 Ga0495663_0000019 Ga0495663_0000019_24850_25311 152
970 3300046558 Ga0495633_0000568 Ga0495633_0000568_31684_32145 152
971 3300046558 Ga0495633_0000772 Ga0495633_0000772_4992_5453 152
972 3300046616 Ga0495668_0022968 Ga0495668_0022968_2836_3300 152
973 3300046660 Ga0495625_0024634 Ga0495625_0024634_3574_4035 152
974 3300046692 Ga0495671_0000027 Ga0495671_0000027_210071_210532 152
975 3300047470 Ga0495681_0001314 Ga0495681_0001314_15476_15937 152
976 3300047472 Ga0495686_0005836 Ga0495686_0005836_3495_3977 152
977 3300048907 Ga0496104_0009597 Ga0496104_0009597_7244_7720 152
978 3300048921 Ga0496118_0037339 Ga0496118_0037339_3036_3509 152
979 3300048924 Ga0496121_0198435 Ga0496121_0198435_645_1118 152
980 3300048925 Ga0496122_0054104 Ga0496122_0054104_1512_1985 152
981 3300048925 Ga0496122_0457334 Ga0496122_0457334_27_497 152
982 3300048926 Ga0496123_0016203 Ga0496123_0016203_437_910 152
983 3300048926 Ga0496123_0126146 Ga0496123_0126146_44_514 152
984 3300048926 Ga0496123_0192535 Ga0496123_0192535_158_625 152
985 3300048927 Ga0496124_0006449 Ga0496124_0006449_192_662 152
986 3300048928 Ga0496125_0183332 Ga0496125_0183332_469_936 152
987 3300049459 Ga0495678_039007 Ga0495678_039007_268_732 152
988 3300049459 Ga0495678_063757 Ga0495678_063757_776_1240 152
989 3300050494 nmdc:mga06z11_2653_c1 nmdc:mga06z11_2653_c1_2342_2803 152
990 3300050495 nmdc:mga04h51_984_c1 nmdc:mga04h51_984_c1_3685_4146 152
991 3300053087 Ga0500643_000235 Ga0500643_000235_4170_4637 152
992 3300002067 JGI24735J21928_10003965 JGI24735J21928_100039653 153
993 3300002067 JGI24735J21928_10059162 JGI24735J21928_100591622 153
994 3300002067 JGI24735J21928_10180995 JGI24735J21928_101809952 153
995 3300002126 JGI24035J26624_1016265 JGI24035J26624_10162652 153
996 3300002459 JGI24751J29686_10108053 JGI24751J29686_101080531 153
997 3300002773 JGI25152J39213_1013596 JGI25152J39213_10135963 153
998 3300002774 JGI25150J39212_1000416 JGI25150J39212_100041614 153
999 3300003187 JGI25151J46595_10010394 JGI25151J46595_100103945 153
1000 3300003215 JGI25153J46596_10000153 JGI25153J46596_1000015328 153
1001 3300003773 Ga0055537_1012294 Ga0055537_10122942 153
1002 3300003781 Ga0055536_1058760 Ga0055536_10587601 153
1003 3300003791 Ga0055530_10046401 Ga0055530_100464012 153
1004 3300003792 Ga0055540_1003509 Ga0055540_10035094 153
1005 3300003792 Ga0055540_1005037 Ga0055540_10050374 153
1006 3300003911 JGI25405J52794_10066371 JGI25405J52794_100663711 153
1007 3300005289 Ga0065704_10164414 Ga0065704_101644142 153
1008 3300005289 Ga0065704_10447225 Ga0065704_104472252 153
1009 3300005293 Ga0065715_10016131 Ga0065715_100161312 153
1010 3300005293 Ga0065715_10252707 Ga0065715_102527072 153
1011 3300005295 Ga0065707_10091015 Ga0065707_100910154 153
1012 3300005327 Ga0070658_10842236 Ga0070658_108422361 153
1013 3300005327 Ga0070658_10897188 Ga0070658_108971882 153
1014 3300005328 Ga0070676_10056069 Ga0070676_100560693 153
1015 3300005331 Ga0070670_100004093 Ga0070670_1000040936 153
1016 3300005331 Ga0070670_100209327 Ga0070670_1002093271 153
1017 3300005333 Ga0070677_10013309 Ga0070677_100133092 153
1018 3300005333 Ga0070677_10148955 Ga0070677_101489552 153
1019 3300005336 Ga0070680_100000958 Ga0070680_10000095825 153
1020 3300005339 Ga0070660_100000385 Ga0070660_10000038523 153
1021 3300005339 Ga0070660_100236225 Ga0070660_1002362252 153
1022 3300005340 Ga0070689_101420092 Ga0070689_1014200922 153
1023 3300005344 Ga0070661_100000155 Ga0070661_10000015536 153
1024 3300005347 Ga0070668_100000649 Ga0070668_1000006497 153
1025 3300005347 Ga0070668_100150708 Ga0070668_1001507082 153
1026 3300005347 Ga0070668_100170329 Ga0070668_1001703294 153
1027 3300005347 Ga0070668_100364050 Ga0070668_1003640502 153
1028 3300005353 Ga0070669_100016538 Ga0070669_1000165382 153
1029 3300005353 Ga0070669_100805100 Ga0070669_1008051002 153
1030 3300005354 Ga0070675_100009019 Ga0070675_1000090198 153
1031 3300005354 Ga0070675_100086069 Ga0070675_1000860693 153
1032 3300005355 Ga0070671_100018037 Ga0070671_1000180372 153
1033 3300005355 Ga0070671_100359039 Ga0070671_1003590392 153
1034 3300005356 Ga0070674_100048184 Ga0070674_1000481843 153
1035 3300005364 Ga0070673_100164820 Ga0070673_1001648202 153
1036 3300005366 Ga0070659_100098528 Ga0070659_1000985283 153
1037 3300005367 Ga0070667_100000193 Ga0070667_10000019313 153
1038 3300005367 Ga0070667_100018227 Ga0070667_1000182272 153
1039 3300005456 Ga0070678_100540198 Ga0070678_1005401982 153
1040 3300005457 Ga0070662_100002559 Ga0070662_1000025597 153
1041 3300005457 Ga0070662_100155835 Ga0070662_1001558353 153
1042 3300005457 Ga0070662_100275603 Ga0070662_1002756032 153
1043 3300005457 Ga0070662_100949877 Ga0070662_1009498772 153
1044 3300005457 Ga0070662_101183953 Ga0070662_1011839532 153
1045 3300005458 Ga0070681_10030431 Ga0070681_100304314 153
1046 3300005530 Ga0070679_100000001 Ga0070679_100000001139 153
1047 3300005539 Ga0068853_100046035 Ga0068853_1000460355 153
1048 3300005539 Ga0068853_100471867 Ga0068853_1004718671 153
1049 3300005539 Ga0068853_100638609 Ga0068853_1006386092 153
1050 3300005543 Ga0070672_100000170 Ga0070672_10000017018 153
1051 3300005543 Ga0070672_101282502 Ga0070672_1012825021 153
1052 3300005544 Ga0070686_100590276 Ga0070686_1005902762 153
1053 3300005549 Ga0070704_100422165 Ga0070704_1004221652 153
1054 3300005563 Ga0068855_100001252 Ga0068855_10000125233 153
1055 3300005563 Ga0068855_100393047 Ga0068855_1003930472 153
1056 3300005577 Ga0068857_100207602 Ga0068857_1002076023 153
1057 3300005578 Ga0068854_100000027 Ga0068854_10000002797 153
1058 3300005578 Ga0068854_100117055 Ga0068854_1001170553 153
1059 3300005578 Ga0068854_101300220 Ga0068854_1013002202 153
1060 3300005616 Ga0068852_100000447 Ga0068852_10000044723 153
1061 3300005616 Ga0068852_100335200 Ga0068852_1003352002 153
1062 3300005616 Ga0068852_100689913 Ga0068852_1006899132 153
1063 3300005617 Ga0068859_101716222 Ga0068859_1017162222 153
1064 3300005618 Ga0068864_100141099 Ga0068864_1001410992 153
1065 3300005618 Ga0068864_100468323 Ga0068864_1004683232 153
1066 3300005719 Ga0068861_100747843 Ga0068861_1007478431 153
1067 3300005719 Ga0068861_101573598 Ga0068861_1015735982 153
1068 3300005834 Ga0068851_10040666 Ga0068851_100406665 153
1069 3300005840 Ga0068870_10122985 Ga0068870_101229852 153
1070 3300005841 Ga0068863_100001481 Ga0068863_10000148119 153
1071 3300005843 Ga0068860_100112868 Ga0068860_1001128684 153
1072 3300005843 Ga0068860_100195788 Ga0068860_1001957882 153
1073 3300005844 Ga0068862_100009116 Ga0068862_1000091169 153
1074 3300005844 Ga0068862_100054975 Ga0068862_1000549753 153
1075 3300005844 Ga0068862_101398227 Ga0068862_1013982272 153
1076 3300005937 Ga0081455_10000392 Ga0081455_1000039233 153
1077 3300006051 Ga0075364_10026344 Ga0075364_100263443 153
1078 3300006237 Ga0097621_100058103 Ga0097621_1000581033 153
1079 3300006237 Ga0097621_100380793 Ga0097621_1003807932 153
1080 3300006353 Ga0075370_10003445 Ga0075370_100034453 153
1081 3300006358 Ga0068871_100008035 Ga0068871_1000080354 153
1082 3300006358 Ga0068871_100172341 Ga0068871_1001723412 153
1083 3300006881 Ga0068865_100538070 Ga0068865_1005380702 153
1084 3300006931 Ga0097620_101716081 Ga0097620_1017160812 153
1085 3300009094 Ga0111539_10305768 Ga0111539_103057683 153
1086 3300009176 Ga0105242_10115602 Ga0105242_101156024 153
1087 3300009177 Ga0105248_10486220 Ga0105248_104862203 153
1088 3300009553 Ga0105249_10123880 Ga0105249_101238801 153
1089 3300009553 Ga0105249_10137417 Ga0105249_101374172 153
1090 3300009553 Ga0105249_10344297 Ga0105249_103442972 153
1091 3300009553 Ga0105249_10568833 Ga0105249_105688331 153
1092 3300010375 Ga0105239_10103047 Ga0105239_101030476 153
1093 3300013100 Ga0157373_10011416 Ga0157373_100114166 153
1094 3300013100 Ga0157373_10151978 Ga0157373_101519783 153
1095 3300013100 Ga0157373_10322437 Ga0157373_103224372 153
1096 3300013102 Ga0157371_10136047 Ga0157371_101360472 153
1097 3300013104 Ga0157370_10304251 Ga0157370_103042512 153
1098 3300013104 Ga0157370_10435606 Ga0157370_104356062 153
1099 3300013105 Ga0157369_10125134 Ga0157369_101251342 153
1100 3300013105 Ga0157369_11201321 Ga0157369_112013212 153
1101 3300013306 Ga0163162_10104374 Ga0163162_101043742 153
1102 3300013306 Ga0163162_10161621 Ga0163162_101616213 153
1103 3300013306 Ga0163162_10402535 Ga0163162_104025351 153
1104 3300013307 Ga0157372_10825167 Ga0157372_108251672 153
1105 3300013308 Ga0157375_10251389 Ga0157375_102513892 153
1106 3300014325 Ga0163163_10682094 Ga0163163_106820942 153
1107 3300014326 Ga0157380_10009741 Ga0157380_100097412 153
1108 3300014326 Ga0157380_10130787 Ga0157380_101307873 153
1109 3300014745 Ga0157377_10130303 Ga0157377_101303033 153
1110 3300014969 Ga0157376_11474643 Ga0157376_114746432 153
1111 3300017792 Ga0163161_10026055 Ga0163161_100260555 153
1112 3300017792 Ga0163161_10028824 Ga0163161_100288242 153
1113 3300017792 Ga0163161_10032811 Ga0163161_100328115 153
1114 3300017792 Ga0163161_10233578 Ga0163161_102335782 153
1115 3300025245 Ga0207425_1000019 Ga0207425_1000019299 153
1116 3300025254 Ga0209148_1000061 Ga0209148_1000061155 153
1117 3300025258 Ga0209129_1006020 Ga0209129_10060204 153
1118 3300025263 Ga0209565_1000089 Ga0209565_100008935 153
1119 3300025263 Ga0209565_1014518 Ga0209565_10145183 153
1120 3300025271 Ga0207666_1028753 Ga0207666_10287532 153
1121 3300025273 Ga0209673_1017774 Ga0209673_10177742 153
1122 3300025292 Ga0209676_1003578 Ga0209676_100357810 153
1123 3300025294 Ga0209025_1000304 Ga0209025_100030418 153
1124 3300025295 Ga0209564_1035551 Ga0209564_10355512 153
1125 3300025297 Ga0209758_1000019 Ga0209758_1000019288 153
1126 3300025298 Ga0209050_1000001 Ga0209050_10000011353 153
1127 3300025303 Ga0209051_1000309 Ga0209051_100030964 153
1128 3300025304 Ga0209257_1003048 Ga0209257_10030488 153
1129 3300025304 Ga0209257_1003101 Ga0209257_10031018 153
1130 3300025315 Ga0207697_10012170 Ga0207697_100121702 153
1131 3300025315 Ga0207697_10062757 Ga0207697_100627572 153
1132 3300025321 Ga0207656_10031667 Ga0207656_100316674 153
1133 3300025893 Ga0207682_10001448 Ga0207682_100014482 153
1134 3300025901 Ga0207688_10105600 Ga0207688_101056003 153
1135 3300025903 Ga0207680_10005365 Ga0207680_100053655 153
1136 3300025904 Ga0207647_10009613 Ga0207647_100096134 153
1137 3300025904 Ga0207647_10013095 Ga0207647_100130953 153
1138 3300025904 Ga0207647_10165295 Ga0207647_101652952 153
1139 3300025907 Ga0207645_10061671 Ga0207645_100616713 153
1140 3300025907 Ga0207645_10306956 Ga0207645_103069561 153
1141 3300025909 Ga0207705_10000025 Ga0207705_1000002580 153
1142 3300025909 Ga0207705_10081335 Ga0207705_100813352 153
1143 3300025909 Ga0207705_11241794 Ga0207705_112417941 153
1144 3300025912 Ga0207707_10026465 Ga0207707_100264652 153
1145 3300025917 Ga0207660_10000972 Ga0207660_1000097218 153
1146 3300025919 Ga0207657_10008599 Ga0207657_100085999 153
1147 3300025919 Ga0207657_10097322 Ga0207657_100973223 153
1148 3300025919 Ga0207657_10126354 Ga0207657_101263542 153
1149 3300025919 Ga0207657_10577195 Ga0207657_105771952 153
1150 3300025920 Ga0207649_10000016 Ga0207649_10000016250 153
1151 3300025920 Ga0207649_10713604 Ga0207649_107136042 153
1152 3300025921 Ga0207652_10000002 Ga0207652_10000002700 153
1153 3300025923 Ga0207681_10061301 Ga0207681_100613013 153
1154 3300025923 Ga0207681_10282739 Ga0207681_102827392 153
1155 3300025923 Ga0207681_10349944 Ga0207681_103499442 153
1156 3300025924 Ga0207694_10016029 Ga0207694_100160294 153
1157 3300025924 Ga0207694_10212076 Ga0207694_102120762 153
1158 3300025925 Ga0207650_10001533 Ga0207650_100015339 153
1159 3300025925 Ga0207650_10105761 Ga0207650_101057613 153
1160 3300025925 Ga0207650_10316048 Ga0207650_103160482 153
1161 3300025925 Ga0207650_10554679 Ga0207650_105546791 153
1162 3300025925 Ga0207650_10603530 Ga0207650_106035302 153
1163 3300025926 Ga0207659_10110673 Ga0207659_101106732 153
1164 3300025931 Ga0207644_10057346 Ga0207644_100573462 153
1165 3300025931 Ga0207644_10533404 Ga0207644_105334042 153
1166 3300025932 Ga0207690_10068260 Ga0207690_100682603 153
1167 3300025933 Ga0207706_10009297 Ga0207706_100092975 153
1168 3300025933 Ga0207706_10017508 Ga0207706_100175085 153
1169 3300025933 Ga0207706_10084827 Ga0207706_100848272 153
1170 3300025933 Ga0207706_10115718 Ga0207706_101157184 153
1171 3300025933 Ga0207706_10228795 Ga0207706_102287952 153
1172 3300025934 Ga0207686_10522826 Ga0207686_105228262 153
1173 3300025938 Ga0207704_10425500 Ga0207704_104255002 153
1174 3300025940 Ga0207691_10000765 Ga0207691_1000076523 153
1175 3300025940 Ga0207691_10125936 Ga0207691_101259363 153
1176 3300025941 Ga0207711_11248071 Ga0207711_112480712 153
1177 3300025949 Ga0207667_10000035 Ga0207667_1000003553 153
1178 3300025949 Ga0207667_10369894 Ga0207667_103698942 153
1179 3300025960 Ga0207651_10039183 Ga0207651_100391834 153
1180 3300025961 Ga0207712_10074531 Ga0207712_100745311 153
1181 3300025961 Ga0207712_10224948 Ga0207712_102249482 153
1182 3300025961 Ga0207712_10978701 Ga0207712_109787012 153
1183 3300025972 Ga0207668_10000161 Ga0207668_1000016128 153
1184 3300025972 Ga0207668_10002721 Ga0207668_100027216 153
1185 3300025972 Ga0207668_10028897 Ga0207668_100288972 153
1186 3300025972 Ga0207668_10034340 Ga0207668_100343402 153
1187 3300025972 Ga0207668_10311923 Ga0207668_103119232 153
1188 3300025972 Ga0207668_10734230 Ga0207668_107342302 153
1189 3300025981 Ga0207640_10000085 Ga0207640_1000008589 153
1190 3300025981 Ga0207640_10060676 Ga0207640_100606763 153
1191 3300025981 Ga0207640_10109389 Ga0207640_101093892 153
1192 3300025981 Ga0207640_11004801 Ga0207640_110048012 153
1193 3300025986 Ga0207658_10000042 Ga0207658_1000004270 153
1194 3300025986 Ga0207658_10191313 Ga0207658_101913133 153
1195 3300025986 Ga0207658_11065924 Ga0207658_110659241 153
1196 3300026041 Ga0207639_10015067 Ga0207639_100150674 153
1197 3300026041 Ga0207639_10192741 Ga0207639_101927412 153
1198 3300026041 Ga0207639_10348550 Ga0207639_103485502 153
1199 3300026041 Ga0207639_10441627 Ga0207639_104416272 153
1200 3300026041 Ga0207639_10837237 Ga0207639_108372372 153
1201 3300026067 Ga0207678_10001182 Ga0207678_1000118224 153
1202 3300026067 Ga0207678_10461979 Ga0207678_104619792 153
1203 3300026075 Ga0207708_10791015 Ga0207708_107910152 153
1204 3300026078 Ga0207702_10203201 Ga0207702_102032012 153
1205 3300026088 Ga0207641_10000046 Ga0207641_10000046113 153
1206 3300026089 Ga0207648_10008755 Ga0207648_100087554 153
1207 3300026095 Ga0207676_10152251 Ga0207676_101522512 153
1208 3300026095 Ga0207676_11024649 Ga0207676_110246492 153
1209 3300026116 Ga0207674_10140417 Ga0207674_101404172 153
1210 3300026116 Ga0207674_10254932 Ga0207674_102549323 153
1211 3300026118 Ga0207675_100039788 Ga0207675_1000397885 153
1212 3300026118 Ga0207675_101490432 Ga0207675_1014904322 153
1213 3300026121 Ga0207683_10188073 Ga0207683_101880733 153
1214 3300026142 Ga0207698_10000746 Ga0207698_1000074616 153
1215 3300026142 Ga0207698_10280443 Ga0207698_102804433 153
1216 3300026142 Ga0207698_10358738 Ga0207698_103587382 153
1217 3300026142 Ga0207698_10479909 Ga0207698_104799092 153
1218 3300027665 Ga0209983_1005081 Ga0209983_10050813 153
1219 3300027876 Ga0209974_10010160 Ga0209974_100101603 153
1220 3300027907 Ga0207428_10176052 Ga0207428_101760523 153
1221 3300028379 Ga0268266_10657572 Ga0268266_106575722 153
1222 3300028380 Ga0268265_10011100 Ga0268265_100111006 153
1223 3300028380 Ga0268265_10057429 Ga0268265_100574293 153
1224 3300028380 Ga0268265_10277997 Ga0268265_102779973 153
1225 3300028380 Ga0268265_11811369 Ga0268265_118113691 153
1226 3300028381 Ga0268264_10438302 Ga0268264_104383023 153
1227 3300028381 Ga0268264_10610096 Ga0268264_106100962 153
1228 3300031548 Ga0307408_100089857 Ga0307408_1000898574 153
1229 3300031548 Ga0307408_100565976 Ga0307408_1005659761 153
1230 3300031731 Ga0307405_10288256 Ga0307405_102882562 153
1231 3300031824 Ga0307413_10023856 Ga0307413_100238562 153
1232 3300031852 Ga0307410_10045082 Ga0307410_100450821 153
1233 3300031901 Ga0307406_10041271 Ga0307406_100412712 153
1234 3300031901 Ga0307406_10225324 Ga0307406_102253243 153
1235 3300031903 Ga0307407_10003078 Ga0307407_100030782 153
1236 3300031903 Ga0307407_10705575 Ga0307407_107055751 153
1237 3300031903 Ga0307407_10843606 Ga0307407_108436062 153
1238 3300031911 Ga0307412_10672295 Ga0307412_106722952 153
1239 3300031995 Ga0307409_100138111 Ga0307409_1001381112 153
1240 3300032002 Ga0307416_100043277 Ga0307416_1000432772 153
1241 3300032002 Ga0307416_101094416 Ga0307416_1010944162 153
1242 3300032002 Ga0307416_102318339 Ga0307416_1023183392 153
1243 3300032004 Ga0307414_10133299 Ga0307414_101332992 153
1244 3300032004 Ga0307414_10255259 Ga0307414_102552593 153
1245 3300032005 Ga0307411_10023982 Ga0307411_100239822 153
1246 3300032005 Ga0307411_10241255 Ga0307411_102412553 153
1247 3300032005 Ga0307411_10519597 Ga0307411_105195972 153
1248 3300032126 Ga0307415_100666522 Ga0307415_1006665221 153
1249 3300037418 Ga0395900_0290108 Ga0395900_0290108_200_679 153
1250 3300039437 Ga0436365_0072488 Ga0436365_0072488_34_501 153
1251 3300039450 Ga0436363_0564025 Ga0436363_0564025_77_544 153
1252 3300041405 Ga0439438_110082 Ga0439438_110082_179_652 153
1253 3300041413 Ga0439465_0256057 Ga0439465_0256057_144_617 153
1254 3300042005 Ga0439448_0012175 Ga0439448_0012175_829_1293 153
1255 3300042005 Ga0439448_0018040 Ga0439448_0018040_1319_1783 153
1256 3300042012 Ga0439455_0001228 Ga0439455_0001228_1107_1571 153
1257 3300042012 Ga0439455_0001341 Ga0439455_0001341_89_553 153
1258 3300042122 Ga0450920_037897 Ga0450920_037897_425_898 153
1259 3300042157 Ga0439458_0001461 Ga0439458_0001461_2869_3333 153
1260 3300042157 Ga0439458_0002748 Ga0439458_0002748_1805_2269 153
1261 3300044658 Ga0466972_0000848 Ga0466972_0000848_13523_14002 153
1262 3300044683 Ga0466965_0178091 Ga0466965_0178091_531_1001 153
1263 3300044693 Ga0466961_0179466 Ga0466961_0179466_123_596 153
1264 3300044735 Ga0466968_0125705 Ga0466968_0125705_267_746 153
1265 3300044765 Ga0466970_0197118 Ga0466970_0197118_150_629 153
1266 3300044842 Ga0466957_0506691 Ga0466957_0506691_180_659 153
1267 3300044901 Ga0466960_0002697 Ga0466960_0002697_1966_2445 153
1268 3300045049 Ga0466959_0244498 Ga0466959_0244498_725_1204 153
1269 3300045976 Ga0466967_0671267 Ga0466967_0671267_88_567 153
1270 3300046452 Ga0495617_010266 Ga0495617_010266_1269_1742 153
1271 3300046452 Ga0495617_010616 Ga0495617_010616_2120_2614 153
1272 3300046453 Ga0495627_025157 Ga0495627_025157_1098_1571 153
1273 3300046460 Ga0495638_0000068 Ga0495638_0000068_4244_4738 153
1274 3300046471 Ga0495650_0000915 Ga0495650_0000915_17954_18427 153
1275 3300046491 Ga0495584_0388565 Ga0495584_0388565_74_547 153
1276 3300046506 Ga0495583_0000279 Ga0495583_0000279_4058_4525 153
1277 3300046506 Ga0495583_0001108 Ga0495583_0001108_3801_4295 153
1278 3300046512 Ga0495610_0000083 Ga0495610_0000083_62713_63186 153
1279 3300046519 Ga0495632_0000730 Ga0495632_0000730_3875_4369 153
1280 3300046519 Ga0495632_0115259 Ga0495632_0115259_775_1248 153
1281 3300046520 Ga0495637_0000836 Ga0495637_0000836_16599_17072 153
1282 3300046524 Ga0495648_0000046 Ga0495648_0000046_4207_4701 153
1283 3300046525 Ga0495663_0036906 Ga0495663_0036906_360_836 153
1284 3300046525 Ga0495663_0261645 Ga0495663_0261645_108_584 153
1285 3300046537 Ga0495598_0028173 Ga0495598_0028173_842_1318 153
1286 3300046539 Ga0495621_0063300 Ga0495621_0063300_638_1114 153
1287 3300046539 Ga0495621_0071079 Ga0495621_0071079_184_660 153
1288 3300046539 Ga0495621_0095353 Ga0495621_0095353_562_1038 153
1289 3300046558 Ga0495633_0054335 Ga0495633_0054335_1308_1802 153
1290 3300046558 Ga0495633_0071686 Ga0495633_0071686_475_951 153
1291 3300046558 Ga0495633_0130320 Ga0495633_0130320_640_1116 153
1292 3300046616 Ga0495668_0008602 Ga0495668_0008602_3817_4296 153
1293 3300046648 Ga0495611_0051546 Ga0495611_0051546_835_1302 153
1294 3300046660 Ga0495625_0127438 Ga0495625_0127438_1224_1703 153
1295 3300046664 Ga0495659_0003471 Ga0495659_0003471_2067_2543 153
1296 3300046665 Ga0495661_0114128 Ga0495661_0114128_610_1077 153
1297 3300046691 Ga0495670_0015072 Ga0495670_0015072_229_696 153
1298 3300046691 Ga0495670_0145092 Ga0495670_0145092_366_842 153
1299 3300046691 Ga0495670_0184790 Ga0495670_0184790_502_978 153
1300 3300046692 Ga0495671_0000204 Ga0495671_0000204_47413_47907 153
1301 3300047318 Ga0495636_0254770 Ga0495636_0254770_317_793 153
1302 3300047445 Ga0495677_0027213 Ga0495677_0027213_301_777 153
1303 3300047445 Ga0495677_0042749 Ga0495677_0042749_829_1305 153
1304 3300047445 Ga0495677_0288156 Ga0495677_0288156_137_613 153
1305 3300047469 Ga0495673_0000110 Ga0495673_0000110_3995_4489 153
1306 3300047469 Ga0495673_0008745 Ga0495673_0008745_3082_3561 153
1307 3300047470 Ga0495681_0000279 Ga0495681_0000279_33206_33679 153
1308 3300047472 Ga0495686_0033894 Ga0495686_0033894_2007_2480 153
1309 3300048905 Ga0496102_0253452 Ga0496102_0253452_891_1364 153
1310 3300048906 Ga0496103_0019468 Ga0496103_0019468_883_1356 153
1311 3300048906 Ga0496103_0646563 Ga0496103_0646563_119_598 153
1312 3300048907 Ga0496104_0440934 Ga0496104_0440934_736_1200 153
1313 3300048912 Ga0496109_0051517 Ga0496109_0051517_2979_3455 153
1314 3300048912 Ga0496109_0151485 Ga0496109_0151485_668_1132 153
1315 3300048913 Ga0496110_0015811 Ga0496110_0015811_3476_3940 153
1316 3300048913 Ga0496110_0035091 Ga0496110_0035091_2328_2792 153
1317 3300048913 Ga0496110_0536987 Ga0496110_0536987_288_761 153
1318 3300048914 Ga0496111_0026586 Ga0496111_0026586_1093_1563 153
1319 3300048914 Ga0496111_0080284 Ga0496111_0080284_770_1234 153
1320 3300048916 Ga0496113_0060335 Ga0496113_0060335_917_1381 153
1321 3300048917 Ga0496114_0680074 Ga0496114_0680074_176_649 153
1322 3300048924 Ga0496121_0168726 Ga0496121_0168726_813_1277 153
1323 3300048925 Ga0496122_0014017 Ga0496122_0014017_1098_1562 153
1324 3300048925 Ga0496122_0115718 Ga0496122_0115718_611_1087 153
1325 3300048926 Ga0496123_0090115 Ga0496123_0090115_1162_1626 153
1326 3300048926 Ga0496123_0098348 Ga0496123_0098348_183_647 153
1327 3300048926 Ga0496123_0309935 Ga0496123_0309935_204_680 153
1328 3300048927 Ga0496124_0176056 Ga0496124_0176056_519_983 153
1329 3300048927 Ga0496124_0257291 Ga0496124_0257291_258_722 153
1330 3300048928 Ga0496125_0038468 Ga0496125_0038468_2078_2542 153
1331 3300048928 Ga0496125_0044314 Ga0496125_0044314_1280_1744 153
1332 3300048928 Ga0496125_0069512 Ga0496125_0069512_951_1415 153
1333 3300048929 Ga0496126_0223604 Ga0496126_0223604_483_947 153
1334 3300048929 Ga0496126_0862034 Ga0496126_0862034_38_502 153
1335 3300049459 Ga0495678_049583 Ga0495678_049583_717_1190 153
1336 3300049569 Ga0501032_0154725 Ga0501032_0154725_822_1307 153
1337 3300049571 Ga0501034_0434750 Ga0501034_0434750_449_934 153
1338 3300049571 Ga0501034_0796263 Ga0501034_0796263_29_517 153
1339 3300049574 Ga0501038_0272248 Ga0501038_0272248_300_785 153
1340 3300049579 Ga0501043_0549691 Ga0501043_0549691_42_530 153
1341 3300049663 Ga0501223_000086 Ga0501223_000086_3690_4154 153
1342 3300049669 Ga0501235_031439 Ga0501235_031439_395_859 153
1343 3300049705 Ga0501225_0000034 Ga0501225_0000034_4002_4466 153
1344 3300050491 nmdc:mga00v17_51035_c1 nmdc:mga00v17_51035_c1_1386_1931 153
1345 3300050496 nmdc:mga07m45_27501_c1 nmdc:mga07m45_27501_c1_926_1390 153
1346 3300050511 nmdc:mga08y16_231553_c1 nmdc:mga08y16_231553_c1_956_1432 153
1347 3300050511 nmdc:mga08y16_440190_c1 nmdc:mga08y16_440190_c1_536_1012 153
1348 3300050512 nmdc:mga0n895_1182676_c1 nmdc:mga0n895_1182676_c1_239_715 153
1349 3300053116 Ga0500592_000506 Ga0500592_000506_3279_3749 153
1350 3300053151 Ga0500604_0121521 Ga0500604_0121521_353_832 153
1351 3300053153 Ga0500616_0204319 Ga0500616_0204319_259_723 153
1352 3300053156 Ga0500622_0130928 Ga0500622_0130928_669_1142 153
1353 3300053158 Ga0500627_0000898 Ga0500627_0000898_3352_3831 153
1354 3300053177 Ga0500636_0000447 Ga0500636_0000447_9315_9821 153
1355 3300061719 Ga0466962_0091485 Ga0466962_0091485_628_1101 153
1356 3300061719 Ga0466962_0155786 Ga0466962_0155786_148_627 153
1357 3300001915 JGI24741J21665_1000079 JGI24741J21665_10000796 154
1358 3300001989 JGI24739J22299_10000379 JGI24739J22299_100003795 154
1359 3300001990 JGI24737J22298_10002301 JGI24737J22298_100023018 154
1360 3300002067 JGI24735J21928_10000880 JGI24735J21928_1000088012 154
1361 3300003771 Ga0055526_1004471 Ga0055526_10044716 154
1362 3300005327 Ga0070658_10115663 Ga0070658_101156632 154
1363 3300005327 Ga0070658_10360151 Ga0070658_103601512 154
1364 3300005329 Ga0070683_100805470 Ga0070683_1008054702 154
1365 3300005333 Ga0070677_10000501 Ga0070677_100005012 154
1366 3300005335 Ga0070666_10292548 Ga0070666_102925482 154
1367 3300005339 Ga0070660_100091425 Ga0070660_1000914253 154
1368 3300005356 Ga0070674_100582590 Ga0070674_1005825901 154
1369 3300005457 Ga0070662_101160063 Ga0070662_1011600631 154
1370 3300005535 Ga0070684_100259463 Ga0070684_1002594633 154
1371 3300005539 Ga0068853_100058280 Ga0068853_1000582803 154
1372 3300005539 Ga0068853_100192312 Ga0068853_1001923123 154
1373 3300005539 Ga0068853_100511297 Ga0068853_1005112972 154
1374 3300005539 Ga0068853_100520501 Ga0068853_1005205013 154
1375 3300005544 Ga0070686_100727717 Ga0070686_1007277172 154
1376 3300005548 Ga0070665_100000168 Ga0070665_10000016827 154
1377 3300005548 Ga0070665_100000567 Ga0070665_10000056747 154
1378 3300005548 Ga0070665_100496891 Ga0070665_1004968912 154
1379 3300005563 Ga0068855_100187900 Ga0068855_1001879003 154
1380 3300005577 Ga0068857_100437437 Ga0068857_1004374372 154
1381 3300005577 Ga0068857_101260773 Ga0068857_1012607732 154
1382 3300005614 Ga0068856_100336928 Ga0068856_1003369282 154
1383 3300005616 Ga0068852_100683669 Ga0068852_1006836692 154
1384 3300005616 Ga0068852_101478864 Ga0068852_1014788642 154
1385 3300005618 Ga0068864_100000480 Ga0068864_1000004806 154
1386 3300005834 Ga0068851_10047555 Ga0068851_100475553 154
1387 3300005842 Ga0068858_100000137 Ga0068858_10000013740 154
1388 3300005843 Ga0068860_100086393 Ga0068860_1000863934 154
1389 3300009093 Ga0105240_10569649 Ga0105240_105696492 154
1390 3300009098 Ga0105245_10089647 Ga0105245_100896474 154
1391 3300009174 Ga0105241_10002058 Ga0105241_1000205810 154
1392 3300009174 Ga0105241_10937703 Ga0105241_109377032 154
1393 3300009545 Ga0105237_10077306 Ga0105237_100773064 154
1394 3300009551 Ga0105238_10483622 Ga0105238_104836222 154
1395 3300009551 Ga0105238_10902790 Ga0105238_109027902 154
1396 3300013104 Ga0157370_10120289 Ga0157370_101202891 154
1397 3300013105 Ga0157369_10508432 Ga0157369_105084323 154
1398 3300013307 Ga0157372_10806964 Ga0157372_108069642 154
1399 3300013307 Ga0157372_10962040 Ga0157372_109620402 154
1400 3300013307 Ga0157372_11223144 Ga0157372_112231442 154
1401 3300014745 Ga0157377_10519416 Ga0157377_105194162 154
1402 3300017792 Ga0163161_10256005 Ga0163161_102560052 154
1403 3300020070 Ga0206356_10395973 Ga0206356_103959734 154
1404 3300020070 Ga0206356_11873308 Ga0206356_118733081 154
1405 3300025295 Ga0209564_1000686 Ga0209564_100068625 154
1406 3300025298 Ga0209050_1053928 Ga0209050_10539281 154
1407 3300025321 Ga0207656_10052406 Ga0207656_100524063 154
1408 3300025903 Ga0207680_10526975 Ga0207680_105269752 154
1409 3300025909 Ga0207705_10099905 Ga0207705_100999052 154
1410 3300025911 Ga0207654_10185478 Ga0207654_101854782 154
1411 3300025913 Ga0207695_10390953 Ga0207695_103909532 154
1412 3300025914 Ga0207671_10027697 Ga0207671_100276974 154
1413 3300025919 Ga0207657_10015232 Ga0207657_100152329 154
1414 3300025920 Ga0207649_11221239 Ga0207649_112212391 154
1415 3300025924 Ga0207694_10254974 Ga0207694_102549742 154
1416 3300025924 Ga0207694_10328973 Ga0207694_103289732 154
1417 3300025924 Ga0207694_11640831 Ga0207694_116408311 154
1418 3300025927 Ga0207687_10282961 Ga0207687_102829612 154
1419 3300025932 Ga0207690_11357505 Ga0207690_113575052 154
1420 3300025933 Ga0207706_10047011 Ga0207706_100470114 154
1421 3300025937 Ga0207669_10409654 Ga0207669_104096542 154
1422 3300025945 Ga0207679_10155817 Ga0207679_101558172 154
1423 3300025949 Ga0207667_10032281 Ga0207667_100322818 154
1424 3300026035 Ga0207703_10000330 Ga0207703_1000033040 154
1425 3300026041 Ga0207639_10000323 Ga0207639_1000032329 154
1426 3300026041 Ga0207639_10131154 Ga0207639_101311543 154
1427 3300026041 Ga0207639_10330174 Ga0207639_103301742 154
1428 3300026067 Ga0207678_10000068 Ga0207678_1000006837 154
1429 3300026078 Ga0207702_10001343 Ga0207702_1000134313 154
1430 3300026095 Ga0207676_10016538 Ga0207676_100165385 154
1431 3300026118 Ga0207675_100135661 Ga0207675_1001356612 154
1432 3300026142 Ga0207698_10197045 Ga0207698_101970452 154
1433 3300028379 Ga0268266_10000130 Ga0268266_1000013096 154
1434 3300028379 Ga0268266_10000486 Ga0268266_1000048637 154
1435 3300028381 Ga0268264_10005789 Ga0268264_100057896 154
1436 3300031456 Ga0307513_10310592 Ga0307513_103105922 154
1437 3300031548 Ga0307408_100041334 Ga0307408_1000413342 154
1438 3300031548 Ga0307408_100381625 Ga0307408_1003816252 154
1439 3300031731 Ga0307405_10016052 Ga0307405_100160525 154
1440 3300031731 Ga0307405_10256154 Ga0307405_102561543 154
1441 3300031824 Ga0307413_10096898 Ga0307413_100968985 154
1442 3300031852 Ga0307410_10161675 Ga0307410_101616752 154
1443 3300031852 Ga0307410_10525665 Ga0307410_105256653 154
1444 3300031901 Ga0307406_10454337 Ga0307406_104543372 154
1445 3300031901 Ga0307406_11174102 Ga0307406_111741021 154
1446 3300031911 Ga0307412_10389842 Ga0307412_103898422 154
1447 3300031911 Ga0307412_10651185 Ga0307412_106511852 154
1448 3300031911 Ga0307412_10828845 Ga0307412_108288452 154
1449 3300031995 Ga0307409_100263778 Ga0307409_1002637782 154
1450 3300031995 Ga0307409_101204246 Ga0307409_1012042461 154
1451 3300032002 Ga0307416_100272205 Ga0307416_1002722052 154
1452 3300032004 Ga0307414_10042447 Ga0307414_100424473 154
1453 3300032004 Ga0307414_10626984 Ga0307414_106269842 154
1454 3300032004 Ga0307414_10895371 Ga0307414_108953712 154
1455 3300032126 Ga0307415_100383910 Ga0307415_1003839101 154
1456 3300037853 Ga0436364_1172012 Ga0436364_1172012_494_958 154
1457 3300038705 Ga0237819_00528 Ga0237819_00528_11371_11844 154
1458 3300039145 Ga0237816_00113 Ga0237816_00113_5020_5493 154
1459 3300039437 Ga0436365_0049535 Ga0436365_0049535_3493_3969 154
1460 3300039450 Ga0436363_0030425 Ga0436363_0030425_317_781 154
1461 3300039450 Ga0436363_0908780 Ga0436363_0908780_600_1064 154
1462 3300041496 Ga0451839_0351685 Ga0451839_0351685_148_612 154
1463 3300042125 Ga0450923_009175 Ga0450923_009175_887_1411 154
1464 3300046513 Ga0495616_0197352 Ga0495616_0197352_14_499 154
1465 3300046528 Ga0495642_0012730 Ga0495642_0012730_1627_2091 154
1466 3300046660 Ga0495625_0044441 Ga0495625_0044441_2321_2785 154
1467 3300048918 Ga0496115_0007525 Ga0496115_0007525_3024_3500 154
1468 3300048919 Ga0496116_0023996 Ga0496116_0023996_1885_2361 154
1469 3300048927 Ga0496124_0089483 Ga0496124_0089483_346_822 154
1470 3300048929 Ga0496126_0135286 Ga0496126_0135286_169_645 154
1471 3300049575 Ga0501039_0352777 Ga0501039_0352777_144_644 154
1472 3300049585 Ga0501069_0008325 Ga0501069_0008325_1877_2341 154
1473 3300049586 Ga0501070_0053026 Ga0501070_0053026_2871_3335 154
1474 3300049590 Ga0501074_0547961 Ga0501074_0547961_173_637 154
1475 3300053087 Ga0500643_022236 Ga0500643_022236_1092_1568 154
1476 3300053139 Ga0500568_0008217 Ga0500568_0008217_4502_4984 154
1477 3300053151 Ga0500604_0000095 Ga0500604_0000095_23551_24015 154
1478 3300053153 Ga0500616_0000267 Ga0500616_0000267_23368_23850 154
1479 3300053157 Ga0500624_000101 Ga0500624_000101_1454_1933 154
1480 3300053739 Ga0500587_000737 Ga0500587_000737_2914_3378 154
1481 3300060353 Ga0501082_0159656 Ga0501082_0159656_824_1288 154
1482 3300000549 LJQas_1003333 LJQas_10033331 155
1483 3300005295 Ga0065707_10348275 Ga0065707_103482752 155
1484 3300005617 Ga0068859_100037439 Ga0068859_1000374393 155
1485 3300005841 Ga0068863_100081416 Ga0068863_1000814164 155
1486 3300005843 Ga0068860_100008662 Ga0068860_1000086628 155
1487 3300005844 Ga0068862_100003380 Ga0068862_1000033806 155
1488 3300006931 Ga0097620_100037439 Ga0097620_1000374393 155
1489 3300009101 Ga0105247_10041803 Ga0105247_100418033 155
1490 3300009553 Ga0105249_10000002 Ga0105249_1000000265 155
1491 3300014326 Ga0157380_10335812 Ga0157380_103358122 155
1492 3300025900 Ga0207710_10023671 Ga0207710_100236713 155
1493 3300025961 Ga0207712_10000002 Ga0207712_10000002436 155
1494 3300026088 Ga0207641_10000648 Ga0207641_1000064823 155
1495 3300028380 Ga0268265_10000231 Ga0268265_1000023149 155
1496 3300028381 Ga0268264_10000539 Ga0268264_1000053949 155
1497 3300031456 Ga0307513_10185192 Ga0307513_101851922 155
1498 3300042003 Ga0439443_001194 Ga0439443_001194_849_1466 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

91

165

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7707 58 148
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.7553 58 148
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.7527 57 155
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.7485 60 153
4qq0-assembly1.cif.gz_A cdsd - the structural protein of the type iii secretion system of chlamydia trachomatis: c-terminal domain 0.7395 57 137
ID Description Score Start End Superfamily
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8384 57 144 3.30.300.130
af_P9WJN7_3_100_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8232 54 154 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7975 57 146 3.30.300.130
af_Q58529_1_94_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7933 60 155 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7886 57 144 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A1G0VN27-F1-model_v4 FeS assembly SUF system protein 0.9697 56 137
AF-A0A7C5CKV7-F1-model_v4 Metal-sulfur cluster assembly factor 0.9513 57 135
AF-A0A7X6XER4-F1-model_v4 DUF59 domain-containing protein 0.9297 57 140
AF-A0A3M2CT19-F1-model_v4 Iron-sulfur cluster carrier protein ApbC 0.9213 60 136 GO:0005524
GO:0016226
GO:0046872
GO:0051539
GO:0140663
AF-A0A435U9M6-F1-model_v4 deleted 0.9187 49 134

Feature Viewer

pLDDT pTM Quality
75.68 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map