F494196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1469 | 496 | 2938 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0008965|Ga0500568_0008965_3038_4093 |
| Length | 351 |
| Sequence | MAENPAKTDKRLGEDCMNIARSTTAQLTLSPCATRFRAPSHRTIHMSNLPANMDPRNSFQGLILTLQQFWAKQGCVILQPYDMQMGAGTFHTATTLRALGPKPWSAAYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPSPDNIQELYLQSLAEIGLDSKLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECKPVPGEITYGLERLAMYVQGVDNVYDLNFNGGANDKVTYGDVFLQNEQEFSKYNFEAADTEILFRHFADAEAECKSLLEKGQGADGKHTLAVPAYEQVIKASHNFNLLDARGVISVTERQSYILRIRELAKACGAAWLQTANGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 160 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 161 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 238 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 240 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 245 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 246 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 253 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 257 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 258 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 266 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 267 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 278 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 292 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 307 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 308 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 311 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 312 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 313 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 314 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 315 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 319 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 404 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 405 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 406 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 407 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 408 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 409 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 445 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 446 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 461 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 462 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 464 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 469 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 472 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 473 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 474 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 475 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 476 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 477 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 478 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 479 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 480 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 481 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 482 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 483 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 484 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 485 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 486 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 487 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 488 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 489 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 490 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 491 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 492 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 493 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 494 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 495 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 496 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0.07 |
| Isolates | 1.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.93 |
| Nodule | 0.34 |
| Rhizoplane | 7.35 |
| Rhizosphere | 86.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500568_0008965 | 3300053139 | Bacteria | 4782 |
| 2 | 2214856301 | 2209111006 | Bacteria | 8880 |
| 3 | ARSoilYngRDRAFT_c00230 | 3300000042 | Bacteria | 8969 |
| 4 | ARcpr5yngRDRAFT_c000213 | 3300000043 | Bacteria | 8928 |
| 5 | ARSoilOldRDRAFT_c000050 | 3300000044 | Bacteria | 25074 |
| 6 | ARCol0oldRDRAFT_c00024 | 3300000045 | Bacteria | 11391 |
| 7 | ARCol0yngRDRAFT_1000023 | 3300000652 | Bacteria | 28722 |
| 8 | JGI24032J14994_100494 | 3300001430 | Bacteria | 2061 |
| 9 | JGI24752J21851_1008885 | 3300001976 | Bacteria | 1311 |
| 10 | JGI24746J21847_1001781 | 3300001977 | Bacteria | 3447 |
| 11 | JGI24739J22299_10005003 | 3300001989 | Bacteria | 5045 |
| 12 | JGI24737J22298_10018568 | 3300001990 | Bacteria | 2231 |
| 13 | JGI24743J22301_10018721 | 3300001991 | Bacteria | 1311 |
| 14 | JGI24750J21931_1000102 | 3300002070 | Bacteria | 13191 |
| 15 | JGI24745J21846_1002496 | 3300002073 | Bacteria | 1886 |
| 16 | JGI24738J21930_10014758 | 3300002075 | Bacteria | 1672 |
| 17 | JGI24738J21930_10026883 | 3300002075 | Bacteria | 1180 |
| 18 | JGI24744J21845_10002596 | 3300002077 | Bacteria | 3689 |
| 19 | JGI24035J26624_1000171 | 3300002126 | Bacteria | 5997 |
| 20 | JGI24033J26618_1001421 | 3300002155 | Bacteria | 2379 |
| 21 | JGI24034J26672_10000829 | 3300002239 | Bacteria | 4013 |
| 22 | JGI24742J22300_10001490 | 3300002244 | Bacteria | 3700 |
| 23 | JGI24751J29686_10004114 | 3300002459 | Bacteria | 2949 |
| 24 | JGI25165J46597_1003936 | 3300003214 | Bacteria | 3416 |
| 25 | JGI25404J52841_10032794 | 3300003659 | Bacteria | 1107 |
| 26 | JGI25404J52841_10033486 | 3300003659 | Bacteria | 1095 |
| 27 | JGI25405J52794_10009927 | 3300003911 | Bacteria | 1805 |
| 28 | JGI25405J52794_10023998 | 3300003911 | Bacteria | 1243 |
| 29 | Ga0065716_1002253 | 3300005277 | Bacteria | 2032 |
| 30 | Ga0065712_10003536 | 3300005290 | Bacteria | 4967 |
| 31 | Ga0065712_10011678 | 3300005290 | Bacteria | 3964 |
| 32 | Ga0065715_10000519 | 3300005293 | Bacteria | 20489 |
| 33 | Ga0065715_10030487 | 3300005293 | Bacteria | 1530 |
| 34 | Ga0065707_10114906 | 3300005295 | Bacteria | 2283 |
| 35 | Ga0065707_10118473 | 3300005295 | Bacteria | 2184 |
| 36 | Ga0070658_10003120 | 3300005327 | Bacteria | 13675 |
| 37 | Ga0070658_10018141 | 3300005327 | Bacteria | 5631 |
| 38 | Ga0070658_10049121 | 3300005327 | Bacteria | 3417 |
| 39 | Ga0070658_10143391 | 3300005327 | Bacteria | 1996 |
| 40 | Ga0070676_10002693 | 3300005328 | Bacteria | 9148 |
| 41 | Ga0070676_10038921 | 3300005328 | Bacteria | 2748 |
| 42 | Ga0070683_100027405 | 3300005329 | Bacteria | 5139 |
| 43 | Ga0070683_100095077 | 3300005329 | Bacteria | 2801 |
| 44 | Ga0070690_100008145 | 3300005330 | Bacteria | 6024 |
| 45 | Ga0070690_100010289 | 3300005330 | Bacteria | 5440 |
| 46 | Ga0070690_100111148 | 3300005330 | Bacteria | 1829 |
| 47 | Ga0070670_100008745 | 3300005331 | Bacteria | 8647 |
| 48 | Ga0070670_100015441 | 3300005331 | Bacteria | 6559 |
| 49 | Ga0070670_100041797 | 3300005331 | Bacteria | 3939 |
| 50 | Ga0070670_100252667 | 3300005331 | Bacteria | 1536 |
| 51 | Ga0068869_100178072 | 3300005334 | Bacteria | 1665 |
| 52 | Ga0070666_10006379 | 3300005335 | Bacteria | 7253 |
| 53 | Ga0070680_100010045 | 3300005336 | Bacteria | 7291 |
| 54 | Ga0070680_100015880 | 3300005336 | Bacteria | 5912 |
| 55 | Ga0070680_100122270 | 3300005336 | Bacteria | 2173 |
| 56 | Ga0070680_100192767 | 3300005336 | Bacteria | 1717 |
| 57 | Ga0070680_100354517 | 3300005336 | Bacteria | 1248 |
| 58 | Ga0070682_100014492 | 3300005337 | Bacteria | 4558 |
| 59 | Ga0068868_100001527 | 3300005338 | Bacteria | 15860 |
| 60 | Ga0068868_100037531 | 3300005338 | Bacteria | 3756 |
| 61 | Ga0068868_100142147 | 3300005338 | Bacteria | 1971 |
| 62 | Ga0070660_100020338 | 3300005339 | Bacteria | 4877 |
| 63 | Ga0070660_100047479 | 3300005339 | Bacteria | 3295 |
| 64 | Ga0070689_100000929 | 3300005340 | Bacteria | 18210 |
| 65 | Ga0070689_100030326 | 3300005340 | Bacteria | 4104 |
| 66 | Ga0070689_100071052 | 3300005340 | Bacteria | 2719 |
| 67 | Ga0070689_100124661 | 3300005340 | Bacteria | 2060 |
| 68 | Ga0070689_100153421 | 3300005340 | Bacteria | 1859 |
| 69 | Ga0070661_100000546 | 3300005344 | Bacteria | 28860 |
| 70 | Ga0070661_100012813 | 3300005344 | Bacteria | 5872 |
| 71 | Ga0070661_100027189 | 3300005344 | Bacteria | 4118 |
| 72 | Ga0070661_100037834 | 3300005344 | Bacteria | 3511 |
| 73 | Ga0070661_100352735 | 3300005344 | Bacteria | 1155 |
| 74 | Ga0070692_10108828 | 3300005345 | Bacteria | 1530 |
| 75 | Ga0070668_100164363 | 3300005347 | Bacteria | 1803 |
| 76 | Ga0070669_100001139 | 3300005353 | Bacteria | 19432 |
| 77 | Ga0070669_100335732 | 3300005353 | Bacteria | 1224 |
| 78 | Ga0070675_100001097 | 3300005354 | Bacteria | 19503 |
| 79 | Ga0070675_100043846 | 3300005354 | Bacteria | 3658 |
| 80 | Ga0070675_100085984 | 3300005354 | Bacteria | 2628 |
| 81 | Ga0070675_100228391 | 3300005354 | Bacteria | 1623 |
| 82 | Ga0070671_100000920 | 3300005355 | Bacteria | 21484 |
| 83 | Ga0070671_100002424 | 3300005355 | Bacteria | 14415 |
| 84 | Ga0070671_100020437 | 3300005355 | Bacteria | 5400 |
| 85 | Ga0070671_100267474 | 3300005355 | Bacteria | 1453 |
| 86 | Ga0070674_100007918 | 3300005356 | Bacteria | 6290 |
| 87 | Ga0070674_100012885 | 3300005356 | Bacteria | 5149 |
| 88 | Ga0070674_100033223 | 3300005356 | Bacteria | 3432 |
| 89 | Ga0070674_100036548 | 3300005356 | Bacteria | 3298 |
| 90 | Ga0070674_100161277 | 3300005356 | Bacteria | 1701 |
| 91 | Ga0070673_100053154 | 3300005364 | Bacteria | 3180 |
| 92 | Ga0070673_100056730 | 3300005364 | Bacteria | 3091 |
| 93 | Ga0070688_100009707 | 3300005365 | Bacteria | 5280 |
| 94 | Ga0070688_100023449 | 3300005365 | Bacteria | 3630 |
| 95 | Ga0070688_100183792 | 3300005365 | Bacteria | 1452 |
| 96 | Ga0070659_100068142 | 3300005366 | Bacteria | 2822 |
| 97 | Ga0070667_100014147 | 3300005367 | Bacteria | 6591 |
| 98 | Ga0070667_100043899 | 3300005367 | Bacteria | 3752 |
| 99 | Ga0070667_100150291 | 3300005367 | Bacteria | 2045 |
| 100 | Ga0070667_100527733 | 3300005367 | Bacteria | 1084 |
| 101 | Ga0070703_10010709 | 3300005406 | Bacteria | 2586 |
| 102 | Ga0070709_10005298 | 3300005434 | Bacteria | 6981 |
| 103 | Ga0070709_10016155 | 3300005434 | Bacteria | 4256 |
| 104 | Ga0070709_10019105 | 3300005434 | Bacteria | 3955 |
| 105 | Ga0070714_100009488 | 3300005435 | Bacteria | 7654 |
| 106 | Ga0070714_100018806 | 3300005435 | Bacteria | 5619 |
| 107 | Ga0070713_100001192 | 3300005436 | Bacteria | 16609 |
| 108 | Ga0070713_100001912 | 3300005436 | Bacteria | 13425 |
| 109 | Ga0070713_100013592 | 3300005436 | Bacteria | 6018 |
| 110 | Ga0070713_100014731 | 3300005436 | Bacteria | 5816 |
| 111 | Ga0070713_100116421 | 3300005436 | Bacteria | 2337 |
| 112 | Ga0070710_10003780 | 3300005437 | Bacteria | 7163 |
| 113 | Ga0070710_10007121 | 3300005437 | Bacteria | 5403 |
| 114 | Ga0070701_10000614 | 3300005438 | Bacteria | 12496 |
| 115 | Ga0070711_100006635 | 3300005439 | Bacteria | 6994 |
| 116 | Ga0070711_100066810 | 3300005439 | Bacteria | 2520 |
| 117 | Ga0070711_100093281 | 3300005439 | Bacteria | 2174 |
| 118 | Ga0070711_100121822 | 3300005439 | Bacteria | 1930 |
| 119 | Ga0070711_100291014 | 3300005439 | Bacteria | 1295 |
| 120 | Ga0070705_100078926 | 3300005440 | Bacteria | 2015 |
| 121 | Ga0070700_100013350 | 3300005441 | Bacteria | 4613 |
| 122 | Ga0070708_100018331 | 3300005445 | Bacteria | 5858 |
| 123 | Ga0070708_100190592 | 3300005445 | Bacteria | 1917 |
| 124 | Ga0070663_100009155 | 3300005455 | Bacteria | 6123 |
| 125 | Ga0070663_100050659 | 3300005455 | Bacteria | 2954 |
| 126 | Ga0070663_100260111 | 3300005455 | Bacteria | 1376 |
| 127 | Ga0070678_100009503 | 3300005456 | Bacteria | 5897 |
| 128 | Ga0070678_100011270 | 3300005456 | Bacteria | 5507 |
| 129 | Ga0070678_100086519 | 3300005456 | Bacteria | 2391 |
| 130 | Ga0070678_100262471 | 3300005456 | Bacteria | 1453 |
| 131 | Ga0070678_100283006 | 3300005456 | Bacteria | 1403 |
| 132 | Ga0070678_100285394 | 3300005456 | Bacteria | 1397 |
| 133 | Ga0070662_100329707 | 3300005457 | Bacteria | 1247 |
| 134 | Ga0070681_10013628 | 3300005458 | Bacteria | 8089 |
| 135 | Ga0070681_10082846 | 3300005458 | Bacteria | 3162 |
| 136 | Ga0068867_100006480 | 3300005459 | Bacteria | 8270 |
| 137 | Ga0070685_10016680 | 3300005466 | Bacteria | 3917 |
| 138 | Ga0070699_100002610 | 3300005518 | Bacteria | 16096 |
| 139 | Ga0070699_100474031 | 3300005518 | Bacteria | 1136 |
| 140 | Ga0070679_100022119 | 3300005530 | Bacteria | 6212 |
| 141 | Ga0070679_100045910 | 3300005530 | Bacteria | 4353 |
| 142 | Ga0070679_100218267 | 3300005530 | Bacteria | 1869 |
| 143 | Ga0068853_100000786 | 3300005539 | Bacteria | 22065 |
| 144 | Ga0068853_100032323 | 3300005539 | Bacteria | 4433 |
| 145 | Ga0068853_100046165 | 3300005539 | Bacteria | 3735 |
| 146 | Ga0068853_100068652 | 3300005539 | Bacteria | 3082 |
| 147 | Ga0068853_100129162 | 3300005539 | Bacteria | 2260 |
| 148 | Ga0068853_100140635 | 3300005539 | Bacteria | 2167 |
| 149 | Ga0070672_100015601 | 3300005543 | Bacteria | 5416 |
| 150 | Ga0070672_100037857 | 3300005543 | Bacteria | 3682 |
| 151 | Ga0070672_100178712 | 3300005543 | Bacteria | 1768 |
| 152 | Ga0070686_100014810 | 3300005544 | Bacteria | 4500 |
| 153 | Ga0070686_100019639 | 3300005544 | Bacteria | 3985 |
| 154 | Ga0070695_100129803 | 3300005545 | Bacteria | 1736 |
| 155 | Ga0070696_100019911 | 3300005546 | Bacteria | 4548 |
| 156 | Ga0070696_100020889 | 3300005546 | Bacteria | 4437 |
| 157 | Ga0070696_100042043 | 3300005546 | Bacteria | 3160 |
| 158 | Ga0070696_100279296 | 3300005546 | Bacteria | 1273 |
| 159 | Ga0070693_100029206 | 3300005547 | Bacteria | 3006 |
| 160 | Ga0070693_100279927 | 3300005547 | Bacteria | 1117 |
| 161 | Ga0070665_100074891 | 3300005548 | Bacteria | 3391 |
| 162 | Ga0070665_100126519 | 3300005548 | Bacteria | 2558 |
| 163 | Ga0070665_100321175 | 3300005548 | Bacteria | 1552 |
| 164 | Ga0070665_100388832 | 3300005548 | Bacteria | 1402 |
| 165 | Ga0070704_100335385 | 3300005549 | Bacteria | 1271 |
| 166 | Ga0068855_100032737 | 3300005563 | Bacteria | 6207 |
| 167 | Ga0068855_100119486 | 3300005563 | Bacteria | 3018 |
| 168 | Ga0068855_100139702 | 3300005563 | Bacteria | 2762 |
| 169 | Ga0068855_100243393 | 3300005563 | Bacteria | 2009 |
| 170 | Ga0068855_100250120 | 3300005563 | Bacteria | 1977 |
| 171 | Ga0070664_100020682 | 3300005564 | Bacteria | 5421 |
| 172 | Ga0070664_100039417 | 3300005564 | Bacteria | 3981 |
| 173 | Ga0070664_100042434 | 3300005564 | Bacteria | 3839 |
| 174 | Ga0070664_100068565 | 3300005564 | Bacteria | 3033 |
| 175 | Ga0070664_100079796 | 3300005564 | Bacteria | 2818 |
| 176 | Ga0068857_100001682 | 3300005577 | Bacteria | 17775 |
| 177 | Ga0068857_100066995 | 3300005577 | Bacteria | 3195 |
| 178 | Ga0068857_100171590 | 3300005577 | Bacteria | 1972 |
| 179 | Ga0068857_100221910 | 3300005577 | Bacteria | 1727 |
| 180 | Ga0068854_100004886 | 3300005578 | Bacteria | 8457 |
| 181 | Ga0068854_100111424 | 3300005578 | Bacteria | 2065 |
| 182 | Ga0068856_100022885 | 3300005614 | Bacteria | 6078 |
| 183 | Ga0068856_100038302 | 3300005614 | Bacteria | 4706 |
| 184 | Ga0068856_100042346 | 3300005614 | Bacteria | 4479 |
| 185 | Ga0070702_100002124 | 3300005615 | Bacteria | 8416 |
| 186 | Ga0070702_100132240 | 3300005615 | Bacteria | 1577 |
| 187 | Ga0068852_100001494 | 3300005616 | Bacteria | 15815 |
| 188 | Ga0068852_100018615 | 3300005616 | Bacteria | 5473 |
| 189 | Ga0068852_100022494 | 3300005616 | Bacteria | 5056 |
| 190 | Ga0068852_100033474 | 3300005616 | Bacteria | 4267 |
| 191 | Ga0068852_100533209 | 3300005616 | Bacteria | 1172 |
| 192 | Ga0068859_100067323 | 3300005617 | Bacteria | 3616 |
| 193 | Ga0068859_100119191 | 3300005617 | Bacteria | 2705 |
| 194 | Ga0068864_100053650 | 3300005618 | Bacteria | 3478 |
| 195 | Ga0068864_100059795 | 3300005618 | Bacteria | 3298 |
| 196 | Ga0068864_100210171 | 3300005618 | Bacteria | 1791 |
| 197 | Ga0068866_10001816 | 3300005718 | Bacteria | 8977 |
| 198 | Ga0068851_10003692 | 3300005834 | Bacteria | 6838 |
| 199 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 200 | Ga0068863_100023028 | 3300005841 | Bacteria | 5953 |
| 201 | Ga0068858_100005723 | 3300005842 | Bacteria | 12147 |
| 202 | Ga0068858_100035999 | 3300005842 | Bacteria | 4589 |
| 203 | Ga0068858_100064209 | 3300005842 | Bacteria | 3397 |
| 204 | Ga0068858_100267294 | 3300005842 | Bacteria | 1627 |
| 205 | Ga0068860_100053522 | 3300005843 | Bacteria | 3838 |
| 206 | Ga0068860_100421191 | 3300005843 | Bacteria | 1324 |
| 207 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 208 | Ga0081455_10001230 | 3300005937 | Bacteria | 32010 |
| 209 | Ga0081455_10007188 | 3300005937 | Bacteria | 11768 |
| 210 | Ga0081455_10027801 | 3300005937 | Bacteria | 5179 |
| 211 | Ga0081455_10051088 | 3300005937 | Bacteria | 3549 |
| 212 | Ga0081455_10131883 | 3300005937 | Bacteria | 1953 |
| 213 | Ga0081538_10098084 | 3300005981 | Bacteria | 1487 |
| 214 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 215 | Ga0081540_1002046 | 3300005983 | Bacteria | 16820 |
| 216 | Ga0081540_1006542 | 3300005983 | Bacteria | 8464 |
| 217 | Ga0081540_1031653 | 3300005983 | Bacteria | 2903 |
| 218 | Ga0081540_1111228 | 3300005983 | Bacteria | 1157 |
| 219 | Ga0081539_10012578 | 3300005985 | Bacteria | 6500 |
| 220 | Ga0081539_10076467 | 3300005985 | Bacteria | 1774 |
| 221 | Ga0070717_10000991 | 3300006028 | Bacteria | 19033 |
| 222 | Ga0070717_10053421 | 3300006028 | Bacteria | 3330 |
| 223 | Ga0070717_10155550 | 3300006028 | Bacteria | 1980 |
| 224 | Ga0070717_10169757 | 3300006028 | Bacteria | 1897 |
| 225 | Ga0075365_10009038 | 3300006038 | Bacteria | 5699 |
| 226 | Ga0075365_10237306 | 3300006038 | Bacteria | 1280 |
| 227 | Ga0075368_10019081 | 3300006042 | Bacteria | 2586 |
| 228 | Ga0075368_10063290 | 3300006042 | Bacteria | 1484 |
| 229 | Ga0075364_10074352 | 3300006051 | Bacteria | 2240 |
| 230 | Ga0075364_10106253 | 3300006051 | Bacteria | 1870 |
| 231 | Ga0075432_10006659 | 3300006058 | Bacteria | 3933 |
| 232 | Ga0070715_10005136 | 3300006163 | Bacteria | 4347 |
| 233 | Ga0070715_10020287 | 3300006163 | Bacteria | 2562 |
| 234 | Ga0070716_100000495 | 3300006173 | Bacteria | 16409 |
| 235 | Ga0070716_100004877 | 3300006173 | Bacteria | 6452 |
| 236 | Ga0070716_100052184 | 3300006173 | Bacteria | 2328 |
| 237 | Ga0070712_100000682 | 3300006175 | Bacteria | 20073 |
| 238 | Ga0070712_100034088 | 3300006175 | Bacteria | 3449 |
| 239 | Ga0070712_100101640 | 3300006175 | Bacteria | 2127 |
| 240 | Ga0070712_100129037 | 3300006175 | Bacteria | 1914 |
| 241 | Ga0070712_100310268 | 3300006175 | Bacteria | 1280 |
| 242 | Ga0075362_10007737 | 3300006177 | Bacteria | 4083 |
| 243 | Ga0075362_10039940 | 3300006177 | Bacteria | 2065 |
| 244 | Ga0075367_10044448 | 3300006178 | Bacteria | 2604 |
| 245 | Ga0075367_10071846 | 3300006178 | Bacteria | 2082 |
| 246 | Ga0075367_10095744 | 3300006178 | Bacteria | 1810 |
| 247 | Ga0075367_10134718 | 3300006178 | Bacteria | 1528 |
| 248 | Ga0075369_10066182 | 3300006186 | Bacteria | 1585 |
| 249 | Ga0075369_10142485 | 3300006186 | Bacteria | 1093 |
| 250 | Ga0075427_10000261 | 3300006194 | Bacteria | 5674 |
| 251 | Ga0075366_10009412 | 3300006195 | Bacteria | 5454 |
| 252 | Ga0075366_10068503 | 3300006195 | Bacteria | 2111 |
| 253 | Ga0075366_10243758 | 3300006195 | Bacteria | 1096 |
| 254 | Ga0097621_100002133 | 3300006237 | Bacteria | 13532 |
| 255 | Ga0097621_100002924 | 3300006237 | Bacteria | 11739 |
| 256 | Ga0097621_100004972 | 3300006237 | Bacteria | 9322 |
| 257 | Ga0097621_100438609 | 3300006237 | Bacteria | 1175 |
| 258 | Ga0068871_100029472 | 3300006358 | Bacteria | 4311 |
| 259 | Ga0068871_100111485 | 3300006358 | Bacteria | 2301 |
| 260 | Ga0068871_100171829 | 3300006358 | Bacteria | 1858 |
| 261 | Ga0068871_100199193 | 3300006358 | Bacteria | 1728 |
| 262 | Ga0068871_100362264 | 3300006358 | Bacteria | 1284 |
| 263 | Ga0075428_100005056 | 3300006844 | Bacteria | 14667 |
| 264 | Ga0075428_100012795 | 3300006844 | Bacteria | 9332 |
| 265 | Ga0075428_100092115 | 3300006844 | Bacteria | 3305 |
| 266 | Ga0075428_100122717 | 3300006844 | Bacteria | 2828 |
| 267 | Ga0075428_100486506 | 3300006844 | Bacteria | 1321 |
| 268 | Ga0075430_100000471 | 3300006846 | Bacteria | 30118 |
| 269 | Ga0075430_100001054 | 3300006846 | Bacteria | 21797 |
| 270 | Ga0075430_100006528 | 3300006846 | Bacteria | 9837 |
| 271 | Ga0075430_100107369 | 3300006846 | Bacteria | 2329 |
| 272 | Ga0075430_100123886 | 3300006846 | Bacteria | 2155 |
| 273 | Ga0075431_100001076 | 3300006847 | Bacteria | 24422 |
| 274 | Ga0075431_100029109 | 3300006847 | Bacteria | 5682 |
| 275 | Ga0075433_10003469 | 3300006852 | Bacteria | 12175 |
| 276 | Ga0075433_10035548 | 3300006852 | Bacteria | 4285 |
| 277 | Ga0075434_100004788 | 3300006871 | Bacteria | 12258 |
| 278 | Ga0075434_100028770 | 3300006871 | Bacteria | 5464 |
| 279 | Ga0075429_100000098 | 3300006880 | Bacteria | 47888 |
| 280 | Ga0075429_100002876 | 3300006880 | Bacteria | 14584 |
| 281 | Ga0075429_100418449 | 3300006880 | Bacteria | 1174 |
| 282 | Ga0068865_100137035 | 3300006881 | Bacteria | 1841 |
| 283 | Ga0068865_100216946 | 3300006881 | Bacteria | 1494 |
| 284 | Ga0075436_100001537 | 3300006914 | Bacteria | 15770 |
| 285 | Ga0075436_100004300 | 3300006914 | Bacteria | 9779 |
| 286 | Ga0075436_100012725 | 3300006914 | Bacteria | 5767 |
| 287 | Ga0075436_100111230 | 3300006914 | Bacteria | 1912 |
| 288 | Ga0075436_100140402 | 3300006914 | Bacteria | 1698 |
| 289 | Ga0097620_100067323 | 3300006931 | Bacteria | 3616 |
| 290 | Ga0097620_100119190 | 3300006931 | Bacteria | 2705 |
| 291 | Ga0075435_100015360 | 3300007076 | Bacteria | 5754 |
| 292 | Ga0075435_100028360 | 3300007076 | Bacteria | 4390 |
| 293 | Ga0075435_100105810 | 3300007076 | Bacteria | 2335 |
| 294 | Ga0075435_100153717 | 3300007076 | Bacteria | 1936 |
| 295 | Ga0075435_100262760 | 3300007076 | Bacteria | 1471 |
| 296 | Ga0099794_10045374 | 3300007265 | Bacteria | 2103 |
| 297 | Ga0099794_10051076 | 3300007265 | Bacteria | 1990 |
| 298 | Ga0099795_10019933 | 3300007788 | Bacteria | 2177 |
| 299 | Ga0105244_10021434 | 3300009036 | Bacteria | 3574 |
| 300 | Ga0105250_10016023 | 3300009092 | Bacteria | 3059 |
| 301 | Ga0105240_10161446 | 3300009093 | Bacteria | 2661 |
| 302 | Ga0111539_10001453 | 3300009094 | Bacteria | 31639 |
| 303 | Ga0111539_10001671 | 3300009094 | Bacteria | 29561 |
| 304 | Ga0111539_10085719 | 3300009094 | Bacteria | 3702 |
| 305 | Ga0111539_10139855 | 3300009094 | Bacteria | 2835 |
| 306 | Ga0111539_10433277 | 3300009094 | Bacteria | 1531 |
| 307 | Ga0111539_10439114 | 3300009094 | Bacteria | 1520 |
| 308 | Ga0105245_10002939 | 3300009098 | Bacteria | 15302 |
| 309 | Ga0105245_10050596 | 3300009098 | Bacteria | 3724 |
| 310 | Ga0105245_10151049 | 3300009098 | Bacteria | 2196 |
| 311 | Ga0105247_10002735 | 3300009101 | Bacteria | 11818 |
| 312 | Ga0105247_10015124 | 3300009101 | Bacteria | 4628 |
| 313 | Ga0114129_10000025 | 3300009147 | Bacteria | 116480 |
| 314 | Ga0114129_10009089 | 3300009147 | Bacteria | 14161 |
| 315 | Ga0114129_10034003 | 3300009147 | Bacteria | 7201 |
| 316 | Ga0114129_10058625 | 3300009147 | Bacteria | 5385 |
| 317 | Ga0114129_10065000 | 3300009147 | Bacteria | 5092 |
| 318 | Ga0114129_10300516 | 3300009147 | Bacteria | 2139 |
| 319 | Ga0114129_10483114 | 3300009147 | Bacteria | 1620 |
| 320 | Ga0105243_10006997 | 3300009148 | Bacteria | 8685 |
| 321 | Ga0105243_10023377 | 3300009148 | Bacteria | 4707 |
| 322 | Ga0105243_10025996 | 3300009148 | Bacteria | 4479 |
| 323 | Ga0105243_10036757 | 3300009148 | Bacteria | 3803 |
| 324 | Ga0105243_10106943 | 3300009148 | Bacteria | 2333 |
| 325 | Ga0105241_10010830 | 3300009174 | Bacteria | 6690 |
| 326 | Ga0105241_10011769 | 3300009174 | Bacteria | 6424 |
| 327 | Ga0105241_10094395 | 3300009174 | Bacteria | 2366 |
| 328 | Ga0105241_10148224 | 3300009174 | Bacteria | 1917 |
| 329 | Ga0105242_10009891 | 3300009176 | Bacteria | 7305 |
| 330 | Ga0105248_10010592 | 3300009177 | Bacteria | 10164 |
| 331 | Ga0105248_10142885 | 3300009177 | Bacteria | 2700 |
| 332 | Ga0105248_10158679 | 3300009177 | Bacteria | 2552 |
| 333 | Ga0105237_10000124 | 3300009545 | Bacteria | 107409 |
| 334 | Ga0105237_10023115 | 3300009545 | Bacteria | 6374 |
| 335 | Ga0105237_10031006 | 3300009545 | Bacteria | 5423 |
| 336 | Ga0105237_10032818 | 3300009545 | Bacteria | 5256 |
| 337 | Ga0105237_10034886 | 3300009545 | Bacteria | 5091 |
| 338 | Ga0105237_10099182 | 3300009545 | Bacteria | 2905 |
| 339 | Ga0105238_10003564 | 3300009551 | Bacteria | 15520 |
| 340 | Ga0105238_10114242 | 3300009551 | Bacteria | 2679 |
| 341 | Ga0105238_10228461 | 3300009551 | Bacteria | 1838 |
| 342 | Ga0105249_10001468 | 3300009553 | Bacteria | 20685 |
| 343 | Ga0105249_10018341 | 3300009553 | Bacteria | 6223 |
| 344 | Ga0105239_10002088 | 3300010375 | Bacteria | 25903 |
| 345 | Ga0105239_10039305 | 3300010375 | Bacteria | 5184 |
| 346 | Ga0105239_10104991 | 3300010375 | Bacteria | 3128 |
| 347 | Ga0105239_10107620 | 3300010375 | Bacteria | 3089 |
| 348 | Ga0105246_10000255 | 3300011119 | Bacteria | 27531 |
| 349 | Ga0105246_10033874 | 3300011119 | Bacteria | 3398 |
| 350 | Ga0105246_10043455 | 3300011119 | Bacteria | 3049 |
| 351 | Ga0105246_10128195 | 3300011119 | Bacteria | 1891 |
| 352 | Ga0105246_10250868 | 3300011119 | Bacteria | 1404 |
| 353 | Ga0157341_1000443 | 3300012494 | Bacteria | 2081 |
| 354 | Ga0157373_10007992 | 3300013100 | Bacteria | 7866 |
| 355 | Ga0157371_10017533 | 3300013102 | Bacteria | 5318 |
| 356 | Ga0157371_10019520 | 3300013102 | Bacteria | 4996 |
| 357 | Ga0157370_10036061 | 3300013104 | Bacteria | 4802 |
| 358 | Ga0157369_10156646 | 3300013105 | Bacteria | 2406 |
| 359 | Ga0157374_10028071 | 3300013296 | Bacteria | 5083 |
| 360 | Ga0157374_10030321 | 3300013296 | Bacteria | 4909 |
| 361 | Ga0157374_10045769 | 3300013296 | Bacteria | 4050 |
| 362 | Ga0157374_10052278 | 3300013296 | Bacteria | 3804 |
| 363 | Ga0157374_10057990 | 3300013296 | Bacteria | 3618 |
| 364 | Ga0157374_10156149 | 3300013296 | Bacteria | 2220 |
| 365 | Ga0157374_10501030 | 3300013296 | Bacteria | 1219 |
| 366 | Ga0157378_10029344 | 3300013297 | Bacteria | 4855 |
| 367 | Ga0157378_10235070 | 3300013297 | Bacteria | 1748 |
| 368 | Ga0163162_10119616 | 3300013306 | Bacteria | 2737 |
| 369 | Ga0163162_10180233 | 3300013306 | Bacteria | 2239 |
| 370 | Ga0163162_10195685 | 3300013306 | Bacteria | 2150 |
| 371 | Ga0163162_10203337 | 3300013306 | Bacteria | 2110 |
| 372 | Ga0157372_10027692 | 3300013307 | Bacteria | 6176 |
| 373 | Ga0157372_10251592 | 3300013307 | Bacteria | 2051 |
| 374 | Ga0157375_10032495 | 3300013308 | Bacteria | 4950 |
| 375 | Ga0157375_10200519 | 3300013308 | Bacteria | 2151 |
| 376 | Ga0163163_10094482 | 3300014325 | Bacteria | 3008 |
| 377 | Ga0163163_10140965 | 3300014325 | Bacteria | 2453 |
| 378 | Ga0157380_10001687 | 3300014326 | Bacteria | 14585 |
| 379 | Ga0157377_10039707 | 3300014745 | Bacteria | 2605 |
| 380 | Ga0157379_10002095 | 3300014968 | Bacteria | 16559 |
| 381 | Ga0157379_10025569 | 3300014968 | Bacteria | 5246 |
| 382 | Ga0157379_10197978 | 3300014968 | Bacteria | 1816 |
| 383 | Ga0157376_10114731 | 3300014969 | Bacteria | 2377 |
| 384 | Ga0182006_1089802 | 3300015261 | Bacteria | 1107 |
| 385 | Ga0163161_10027479 | 3300017792 | Bacteria | 4037 |
| 386 | Ga0163161_10028989 | 3300017792 | Bacteria | 3933 |
| 387 | Ga0213876_10079991 | 3300021384 | Bacteria | 1727 |
| 388 | Ga0213875_10000012 | 3300021388 | Bacteria | 312017 |
| 389 | Ga0228598_1000722 | 3300024227 | Bacteria | 7060 |
| 390 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 391 | Ga0207427_102035 | 3300025231 | Bacteria | 6084 |
| 392 | Ga0209233_1000518 | 3300025261 | Bacteria | 22373 |
| 393 | Ga0209233_1004597 | 3300025261 | Bacteria | 4671 |
| 394 | Ga0207666_1001422 | 3300025271 | Bacteria | 2814 |
| 395 | Ga0207666_1003281 | 3300025271 | Bacteria | 1982 |
| 396 | Ga0207673_1000414 | 3300025290 | Bacteria | 4384 |
| 397 | Ga0207697_10003536 | 3300025315 | Bacteria | 7704 |
| 398 | Ga0207697_10010884 | 3300025315 | Bacteria | 3867 |
| 399 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 400 | Ga0207682_10001866 | 3300025893 | Bacteria | 9596 |
| 401 | Ga0207692_10000657 | 3300025898 | Bacteria | 12171 |
| 402 | Ga0207692_10001096 | 3300025898 | Bacteria | 9916 |
| 403 | Ga0207692_10001480 | 3300025898 | Bacteria | 8808 |
| 404 | Ga0207692_10070644 | 3300025898 | Bacteria | 1838 |
| 405 | Ga0207692_10111817 | 3300025898 | Bacteria | 1516 |
| 406 | Ga0207710_10004456 | 3300025900 | Bacteria | 6110 |
| 407 | Ga0207710_10023691 | 3300025900 | Bacteria | 2640 |
| 408 | Ga0207688_10000229 | 3300025901 | Bacteria | 25389 |
| 409 | Ga0207688_10001791 | 3300025901 | Bacteria | 11414 |
| 410 | Ga0207688_10128738 | 3300025901 | Bacteria | 1482 |
| 411 | Ga0207680_10039987 | 3300025903 | Bacteria | 2725 |
| 412 | Ga0207680_10089238 | 3300025903 | Bacteria | 1956 |
| 413 | Ga0207680_10166582 | 3300025903 | Bacteria | 1481 |
| 414 | Ga0207647_10002000 | 3300025904 | Bacteria | 15594 |
| 415 | Ga0207647_10018381 | 3300025904 | Bacteria | 4730 |
| 416 | Ga0207685_10060403 | 3300025905 | Bacteria | 1499 |
| 417 | Ga0207699_10003384 | 3300025906 | Bacteria | 7603 |
| 418 | Ga0207699_10042399 | 3300025906 | Bacteria | 2636 |
| 419 | Ga0207699_10052699 | 3300025906 | Bacteria | 2409 |
| 420 | Ga0207699_10122113 | 3300025906 | Bacteria | 1686 |
| 421 | Ga0207645_10000966 | 3300025907 | Bacteria | 23780 |
| 422 | Ga0207645_10030103 | 3300025907 | Bacteria | 3497 |
| 423 | Ga0207645_10048911 | 3300025907 | Bacteria | 2700 |
| 424 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 425 | Ga0207643_10000794 | 3300025908 | Bacteria | 19261 |
| 426 | Ga0207705_10030296 | 3300025909 | Bacteria | 3860 |
| 427 | Ga0207705_10048506 | 3300025909 | Bacteria | 3055 |
| 428 | Ga0207684_10237056 | 3300025910 | Bacteria | 1574 |
| 429 | Ga0207684_10351262 | 3300025910 | Bacteria | 1269 |
| 430 | Ga0207654_10013356 | 3300025911 | Bacteria | 4225 |
| 431 | Ga0207654_10030019 | 3300025911 | Bacteria | 2980 |
| 432 | Ga0207707_10006070 | 3300025912 | Bacteria | 10573 |
| 433 | Ga0207707_10008300 | 3300025912 | Bacteria | 9012 |
| 434 | Ga0207707_10139428 | 3300025912 | Bacteria | 2120 |
| 435 | Ga0207695_10077495 | 3300025913 | Bacteria | 3376 |
| 436 | Ga0207671_10000095 | 3300025914 | Bacteria | 137647 |
| 437 | Ga0207671_10089716 | 3300025914 | Bacteria | 2314 |
| 438 | Ga0207693_10000479 | 3300025915 | Bacteria | 36362 |
| 439 | Ga0207693_10003422 | 3300025915 | Bacteria | 13542 |
| 440 | Ga0207693_10013218 | 3300025915 | Bacteria | 6661 |
| 441 | Ga0207693_10013749 | 3300025915 | Bacteria | 6520 |
| 442 | Ga0207693_10015576 | 3300025915 | Bacteria | 6098 |
| 443 | Ga0207693_10045346 | 3300025915 | Bacteria | 3455 |
| 444 | Ga0207693_10149440 | 3300025915 | Bacteria | 1837 |
| 445 | Ga0207663_10001126 | 3300025916 | Bacteria | 12312 |
| 446 | Ga0207663_10002874 | 3300025916 | Bacteria | 8322 |
| 447 | Ga0207663_10021824 | 3300025916 | Bacteria | 3651 |
| 448 | Ga0207663_10026246 | 3300025916 | Bacteria | 3379 |
| 449 | Ga0207660_10004454 | 3300025917 | Bacteria | 9129 |
| 450 | Ga0207660_10133693 | 3300025917 | Bacteria | 1891 |
| 451 | Ga0207660_10158999 | 3300025917 | Bacteria | 1742 |
| 452 | Ga0207662_10000424 | 3300025918 | Bacteria | 18665 |
| 453 | Ga0207662_10015804 | 3300025918 | Bacteria | 4251 |
| 454 | Ga0207662_10018730 | 3300025918 | Bacteria | 3932 |
| 455 | Ga0207657_10028864 | 3300025919 | Bacteria | 5055 |
| 456 | Ga0207657_10032519 | 3300025919 | Bacteria | 4712 |
| 457 | Ga0207657_10037112 | 3300025919 | Bacteria | 4356 |
| 458 | Ga0207657_10067616 | 3300025919 | Bacteria | 3038 |
| 459 | Ga0207657_10123457 | 3300025919 | Bacteria | 2129 |
| 460 | Ga0207657_10430708 | 3300025919 | Bacteria | 1036 |
| 461 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 462 | Ga0207649_10000387 | 3300025920 | Bacteria | 32995 |
| 463 | Ga0207649_10026679 | 3300025920 | Bacteria | 3382 |
| 464 | Ga0207649_10054432 | 3300025920 | Bacteria | 2490 |
| 465 | Ga0207649_10305263 | 3300025920 | Bacteria | 1165 |
| 466 | Ga0207652_10000911 | 3300025921 | Bacteria | 27891 |
| 467 | Ga0207652_10033711 | 3300025921 | Bacteria | 4313 |
| 468 | Ga0207652_10083249 | 3300025921 | Bacteria | 2801 |
| 469 | Ga0207681_10007892 | 3300025923 | Bacteria | 6508 |
| 470 | Ga0207681_10051064 | 3300025923 | Bacteria | 2800 |
| 471 | Ga0207681_10308356 | 3300025923 | Bacteria | 1255 |
| 472 | Ga0207694_10034503 | 3300025924 | Bacteria | 3880 |
| 473 | Ga0207694_10135909 | 3300025924 | Bacteria | 1974 |
| 474 | Ga0207694_10289259 | 3300025924 | Bacteria | 1347 |
| 475 | Ga0207650_10080871 | 3300025925 | Bacteria | 2464 |
| 476 | Ga0207650_10215995 | 3300025925 | Bacteria | 1542 |
| 477 | Ga0207659_10001285 | 3300025926 | Bacteria | 15002 |
| 478 | Ga0207659_10086963 | 3300025926 | Bacteria | 2325 |
| 479 | Ga0207700_10000756 | 3300025928 | Bacteria | 18627 |
| 480 | Ga0207700_10047638 | 3300025928 | Bacteria | 3178 |
| 481 | Ga0207700_10161975 | 3300025928 | Bacteria | 1858 |
| 482 | Ga0207664_10018712 | 3300025929 | Bacteria | 5107 |
| 483 | Ga0207664_10024032 | 3300025929 | Bacteria | 4575 |
| 484 | Ga0207664_10041374 | 3300025929 | Bacteria | 3589 |
| 485 | Ga0207664_10157513 | 3300025929 | Bacteria | 1934 |
| 486 | Ga0207664_10266612 | 3300025929 | Bacteria | 1499 |
| 487 | Ga0207644_10004727 | 3300025931 | Bacteria | 8849 |
| 488 | Ga0207644_10010463 | 3300025931 | Bacteria | 6115 |
| 489 | Ga0207644_10017581 | 3300025931 | Bacteria | 4833 |
| 490 | Ga0207644_10219335 | 3300025931 | Bacteria | 1507 |
| 491 | Ga0207690_10001058 | 3300025932 | Bacteria | 17643 |
| 492 | Ga0207690_10209242 | 3300025932 | Bacteria | 1486 |
| 493 | Ga0207690_10368991 | 3300025932 | Bacteria | 1138 |
| 494 | Ga0207706_10016549 | 3300025933 | Bacteria | 6658 |
| 495 | Ga0207706_10019395 | 3300025933 | Bacteria | 6118 |
| 496 | Ga0207706_10149174 | 3300025933 | Bacteria | 2056 |
| 497 | Ga0207706_10160149 | 3300025933 | Bacteria | 1979 |
| 498 | Ga0207686_10005614 | 3300025934 | Bacteria | 6726 |
| 499 | Ga0207686_10083487 | 3300025934 | Bacteria | 2091 |
| 500 | Ga0207686_10200924 | 3300025934 | Bacteria | 1427 |
| 501 | Ga0207709_10009302 | 3300025935 | Bacteria | 5410 |
| 502 | Ga0207709_10046931 | 3300025935 | Bacteria | 2624 |
| 503 | Ga0207709_10085951 | 3300025935 | Bacteria | 2041 |
| 504 | Ga0207709_10238545 | 3300025935 | Bacteria | 1321 |
| 505 | Ga0207709_10249771 | 3300025935 | Bacteria | 1295 |
| 506 | Ga0207670_10000377 | 3300025936 | Bacteria | 25697 |
| 507 | Ga0207670_10152596 | 3300025936 | Bacteria | 1716 |
| 508 | Ga0207670_10286130 | 3300025936 | Bacteria | 1286 |
| 509 | Ga0207669_10014544 | 3300025937 | Bacteria | 3947 |
| 510 | Ga0207669_10019738 | 3300025937 | Bacteria | 3518 |
| 511 | Ga0207669_10023224 | 3300025937 | Bacteria | 3309 |
| 512 | Ga0207669_10038166 | 3300025937 | Bacteria | 2763 |
| 513 | Ga0207669_10204460 | 3300025937 | Bacteria | 1436 |
| 514 | Ga0207669_10243134 | 3300025937 | Bacteria | 1335 |
| 515 | Ga0207704_10034831 | 3300025938 | Bacteria | 2877 |
| 516 | Ga0207704_10216020 | 3300025938 | Bacteria | 1415 |
| 517 | Ga0207665_10000090 | 3300025939 | Bacteria | 58962 |
| 518 | Ga0207665_10008284 | 3300025939 | Bacteria | 6863 |
| 519 | Ga0207665_10035375 | 3300025939 | Bacteria | 3315 |
| 520 | Ga0207691_10019480 | 3300025940 | Bacteria | 6420 |
| 521 | Ga0207691_10065953 | 3300025940 | Bacteria | 3276 |
| 522 | Ga0207691_10159651 | 3300025940 | Bacteria | 1979 |
| 523 | Ga0207691_10276629 | 3300025940 | Bacteria | 1445 |
| 524 | Ga0207711_10006200 | 3300025941 | Bacteria | 10106 |
| 525 | Ga0207711_10036162 | 3300025941 | Bacteria | 4189 |
| 526 | Ga0207711_10055424 | 3300025941 | Bacteria | 3404 |
| 527 | Ga0207711_10068364 | 3300025941 | Bacteria | 3077 |
| 528 | Ga0207711_10078616 | 3300025941 | Bacteria | 2878 |
| 529 | Ga0207711_10176676 | 3300025941 | Bacteria | 1940 |
| 530 | Ga0207711_10258744 | 3300025941 | Bacteria | 1599 |
| 531 | Ga0207711_10289303 | 3300025941 | Bacteria | 1510 |
| 532 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 533 | Ga0207661_10064904 | 3300025944 | Bacteria | 2961 |
| 534 | Ga0207661_10350300 | 3300025944 | Bacteria | 1332 |
| 535 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 536 | Ga0207679_10107069 | 3300025945 | Bacteria | 2199 |
| 537 | Ga0207679_10110065 | 3300025945 | Bacteria | 2172 |
| 538 | Ga0207679_10194335 | 3300025945 | Bacteria | 1690 |
| 539 | Ga0207667_10050095 | 3300025949 | Bacteria | 4407 |
| 540 | Ga0207667_10142004 | 3300025949 | Bacteria | 2472 |
| 541 | Ga0207667_10379299 | 3300025949 | Bacteria | 1441 |
| 542 | Ga0207651_10000367 | 3300025960 | Bacteria | 19162 |
| 543 | Ga0207651_10037255 | 3300025960 | Bacteria | 3185 |
| 544 | Ga0207651_10063867 | 3300025960 | Bacteria | 2574 |
| 545 | Ga0207712_10001257 | 3300025961 | Bacteria | 17520 |
| 546 | Ga0207712_10220770 | 3300025961 | Bacteria | 1515 |
| 547 | Ga0207668_10001328 | 3300025972 | Bacteria | 14685 |
| 548 | Ga0207668_10259617 | 3300025972 | Bacteria | 1415 |
| 549 | Ga0207640_10006238 | 3300025981 | Bacteria | 6535 |
| 550 | Ga0207677_10083507 | 3300026023 | Bacteria | 2299 |
| 551 | Ga0207703_10004093 | 3300026035 | Bacteria | 12030 |
| 552 | Ga0207703_10141450 | 3300026035 | Bacteria | 2089 |
| 553 | Ga0207703_10414214 | 3300026035 | Bacteria | 1253 |
| 554 | Ga0207639_10002502 | 3300026041 | Bacteria | 12321 |
| 555 | Ga0207639_10037756 | 3300026041 | Bacteria | 3590 |
| 556 | Ga0207639_10062374 | 3300026041 | Bacteria | 2882 |
| 557 | Ga0207639_10137912 | 3300026041 | Bacteria | 2028 |
| 558 | Ga0207639_10177482 | 3300026041 | Bacteria | 1809 |
| 559 | Ga0207639_10205562 | 3300026041 | Bacteria | 1692 |
| 560 | Ga0207639_10352911 | 3300026041 | Bacteria | 1314 |
| 561 | Ga0207678_10007692 | 3300026067 | Bacteria | 9519 |
| 562 | Ga0207678_10036309 | 3300026067 | Bacteria | 4290 |
| 563 | Ga0207678_10077922 | 3300026067 | Bacteria | 2839 |
| 564 | Ga0207678_10188404 | 3300026067 | Bacteria | 1763 |
| 565 | Ga0207708_10003972 | 3300026075 | Bacteria | 10884 |
| 566 | Ga0207708_10064633 | 3300026075 | Bacteria | 2796 |
| 567 | Ga0207708_10114356 | 3300026075 | Bacteria | 2097 |
| 568 | Ga0207708_10199947 | 3300026075 | Bacteria | 1594 |
| 569 | Ga0207702_10002426 | 3300026078 | Bacteria | 17722 |
| 570 | Ga0207702_10124589 | 3300026078 | Bacteria | 2311 |
| 571 | Ga0207702_10168478 | 3300026078 | Bacteria | 2006 |
| 572 | Ga0207702_10242123 | 3300026078 | Bacteria | 1690 |
| 573 | Ga0207641_10002393 | 3300026088 | Bacteria | 17306 |
| 574 | Ga0207641_10065921 | 3300026088 | Bacteria | 3098 |
| 575 | Ga0207641_10107700 | 3300026088 | Bacteria | 2465 |
| 576 | Ga0207648_10026738 | 3300026089 | Bacteria | 5125 |
| 577 | Ga0207648_10063466 | 3300026089 | Bacteria | 3219 |
| 578 | Ga0207648_10077418 | 3300026089 | Bacteria | 2899 |
| 579 | Ga0207648_10131782 | 3300026089 | Bacteria | 2200 |
| 580 | Ga0207676_10061890 | 3300026095 | Bacteria | 2965 |
| 581 | Ga0207676_10121159 | 3300026095 | Bacteria | 2206 |
| 582 | Ga0207676_10291779 | 3300026095 | Bacteria | 1485 |
| 583 | Ga0207676_10587510 | 3300026095 | Bacteria | 1068 |
| 584 | Ga0207674_10000897 | 3300026116 | Bacteria | 38907 |
| 585 | Ga0207674_10022165 | 3300026116 | Bacteria | 6827 |
| 586 | Ga0207674_10033624 | 3300026116 | Bacteria | 5367 |
| 587 | Ga0207674_10349858 | 3300026116 | Bacteria | 1429 |
| 588 | Ga0207675_100021987 | 3300026118 | Bacteria | 5938 |
| 589 | Ga0207675_100024455 | 3300026118 | Bacteria | 5616 |
| 590 | Ga0207675_100187711 | 3300026118 | Bacteria | 1982 |
| 591 | Ga0207683_10021225 | 3300026121 | Bacteria | 5557 |
| 592 | Ga0207683_10023438 | 3300026121 | Bacteria | 5311 |
| 593 | Ga0207683_10331391 | 3300026121 | Bacteria | 1395 |
| 594 | Ga0207698_10013348 | 3300026142 | Bacteria | 5416 |
| 595 | Ga0207698_10046335 | 3300026142 | Bacteria | 3283 |
| 596 | Ga0207698_10136215 | 3300026142 | Bacteria | 2107 |
| 597 | Ga0207698_10165634 | 3300026142 | Bacteria | 1939 |
| 598 | Ga0207698_10246351 | 3300026142 | Bacteria | 1632 |
| 599 | Ga0207698_10315591 | 3300026142 | Bacteria | 1462 |
| 600 | Ga0209179_1005853 | 3300027512 | Bacteria | 1948 |
| 601 | Ga0209999_1015342 | 3300027543 | Bacteria | 1394 |
| 602 | Ga0210002_1002531 | 3300027617 | Bacteria | 2643 |
| 603 | Ga0209966_1001586 | 3300027695 | Bacteria | 3911 |
| 604 | Ga0209813_10008597 | 3300027866 | Bacteria | 2586 |
| 605 | Ga0209974_10009518 | 3300027876 | Bacteria | 3300 |
| 606 | Ga0209974_10015422 | 3300027876 | Bacteria | 2538 |
| 607 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 608 | Ga0207428_10000165 | 3300027907 | Bacteria | 91701 |
| 609 | Ga0207428_10000792 | 3300027907 | Bacteria | 35769 |
| 610 | Ga0207428_10001840 | 3300027907 | Bacteria | 21679 |
| 611 | Ga0268266_10000701 | 3300028379 | Bacteria | 45203 |
| 612 | Ga0268266_10018077 | 3300028379 | Bacteria | 6008 |
| 613 | Ga0268266_10074886 | 3300028379 | Bacteria | 2940 |
| 614 | Ga0268266_10111849 | 3300028379 | Bacteria | 2420 |
| 615 | Ga0268266_10404893 | 3300028379 | Bacteria | 1291 |
| 616 | Ga0268264_10001616 | 3300028381 | Bacteria | 20825 |
| 617 | Ga0268264_10333413 | 3300028381 | Bacteria | 1438 |
| 618 | Ga0268264_10391525 | 3300028381 | Bacteria | 1333 |
| 619 | Ga0268264_10432812 | 3300028381 | Bacteria | 1271 |
| 620 | Ga0265337_1001808 | 3300028556 | Bacteria | 10275 |
| 621 | Ga0265337_1015838 | 3300028556 | Bacteria | 2454 |
| 622 | Ga0265334_10001871 | 3300028573 | Bacteria | 9993 |
| 623 | Ga0265318_10030244 | 3300028577 | Bacteria | 2107 |
| 624 | Ga0265338_10048099 | 3300028800 | Bacteria | 3885 |
| 625 | Ga0265338_10050328 | 3300028800 | Bacteria | 3767 |
| 626 | Ga0265338_10258096 | 3300028800 | Bacteria | 1282 |
| 627 | Ga0265324_10052363 | 3300029957 | Bacteria | 1402 |
| 628 | Ga0265762_1016083 | 3300030760 | Bacteria | 1356 |
| 629 | Ga0265330_10080491 | 3300031235 | Bacteria | 1403 |
| 630 | Ga0265328_10000251 | 3300031239 | Bacteria | 24822 |
| 631 | Ga0265325_10000264 | 3300031241 | Bacteria | 37210 |
| 632 | Ga0265325_10002189 | 3300031241 | Bacteria | 13299 |
| 633 | Ga0265325_10003407 | 3300031241 | Bacteria | 10394 |
| 634 | Ga0265325_10013167 | 3300031241 | Bacteria | 4714 |
| 635 | Ga0265325_10031025 | 3300031241 | Bacteria | 2863 |
| 636 | Ga0265325_10099356 | 3300031241 | Bacteria | 1426 |
| 637 | Ga0265329_10071433 | 3300031242 | Bacteria | 1098 |
| 638 | Ga0265340_10001658 | 3300031247 | Bacteria | 12789 |
| 639 | Ga0265340_10013138 | 3300031247 | Bacteria | 4358 |
| 640 | Ga0265340_10024919 | 3300031247 | Bacteria | 3034 |
| 641 | Ga0265340_10046584 | 3300031247 | Bacteria | 2115 |
| 642 | Ga0265340_10062161 | 3300031247 | Bacteria | 1784 |
| 643 | Ga0265339_10000129 | 3300031249 | Bacteria | 62831 |
| 644 | Ga0265339_10000546 | 3300031249 | Bacteria | 29425 |
| 645 | Ga0265339_10003092 | 3300031249 | Bacteria | 11711 |
| 646 | Ga0265339_10009444 | 3300031249 | Bacteria | 6133 |
| 647 | Ga0265339_10024114 | 3300031249 | Bacteria | 3509 |
| 648 | Ga0265339_10033242 | 3300031249 | Bacteria | 2905 |
| 649 | Ga0265339_10062234 | 3300031249 | Bacteria | 2007 |
| 650 | Ga0265339_10069442 | 3300031249 | Bacteria | 1880 |
| 651 | Ga0265339_10119363 | 3300031249 | Bacteria | 1357 |
| 652 | Ga0265331_10000057 | 3300031250 | Bacteria | 175827 |
| 653 | Ga0265331_10012098 | 3300031250 | Bacteria | 4693 |
| 654 | Ga0265331_10022398 | 3300031250 | Bacteria | 3224 |
| 655 | Ga0265316_10001732 | 3300031344 | Bacteria | 23145 |
| 656 | Ga0265316_10067798 | 3300031344 | Bacteria | 2758 |
| 657 | Ga0265316_10099846 | 3300031344 | Bacteria | 2207 |
| 658 | Ga0265316_10115764 | 3300031344 | Bacteria | 2027 |
| 659 | Ga0265316_10154383 | 3300031344 | Bacteria | 1718 |
| 660 | Ga0265313_10000254 | 3300031595 | Bacteria | 58277 |
| 661 | Ga0265313_10000326 | 3300031595 | Bacteria | 51836 |
| 662 | Ga0265313_10000435 | 3300031595 | Bacteria | 44311 |
| 663 | Ga0265313_10001378 | 3300031595 | Bacteria | 22812 |
| 664 | Ga0265313_10005110 | 3300031595 | Bacteria | 9769 |
| 665 | Ga0265313_10011924 | 3300031595 | Bacteria | 5364 |
| 666 | Ga0265313_10023363 | 3300031595 | Bacteria | 3331 |
| 667 | Ga0265313_10025412 | 3300031595 | Bacteria | 3139 |
| 668 | Ga0265313_10029797 | 3300031595 | Bacteria | 2817 |
| 669 | Ga0316575_10012791 | 3300031665 | Bacteria | 3128 |
| 670 | Ga0316579_10136834 | 3300031691 | Bacteria | 1180 |
| 671 | Ga0265314_10001726 | 3300031711 | Bacteria | 23697 |
| 672 | Ga0265314_10009303 | 3300031711 | Bacteria | 8315 |
| 673 | Ga0265314_10029538 | 3300031711 | Bacteria | 4073 |
| 674 | Ga0265314_10112271 | 3300031711 | Bacteria | 1730 |
| 675 | Ga0265314_10170789 | 3300031711 | Bacteria | 1313 |
| 676 | Ga0265342_10000981 | 3300031712 | Bacteria | 28130 |
| 677 | Ga0265342_10002428 | 3300031712 | Bacteria | 16105 |
| 678 | Ga0265342_10019207 | 3300031712 | Bacteria | 4409 |
| 679 | Ga0265342_10074175 | 3300031712 | Bacteria | 1977 |
| 680 | Ga0265342_10175430 | 3300031712 | Bacteria | 1176 |
| 681 | Ga0316576_10035289 | 3300031727 | Bacteria | 3569 |
| 682 | Ga0316576_10060923 | 3300031727 | Bacteria | 2765 |
| 683 | Ga0316576_10147260 | 3300031727 | Bacteria | 1774 |
| 684 | Ga0316576_10191861 | 3300031727 | Bacteria | 1540 |
| 685 | Ga0316578_10095042 | 3300031728 | Bacteria | 1783 |
| 686 | Ga0316578_10110523 | 3300031728 | Bacteria | 1651 |
| 687 | Ga0316583_10032793 | 3300032133 | Bacteria | 1845 |
| 688 | Ga0373930_0000452 | 3300034816 | Bacteria | 5500 |
| 689 | Ga0373930_0002751 | 3300034816 | Bacteria | 2742 |
| 690 | Ga0373948_0006416 | 3300034817 | Bacteria | 1944 |
| 691 | Ga0373950_0009376 | 3300034818 | Bacteria | 1562 |
| 692 | Ga0373950_0009919 | 3300034818 | Bacteria | 1529 |
| 693 | Ga0373958_0000092 | 3300034819 | Bacteria | 9364 |
| 694 | Ga0373958_0004580 | 3300034819 | Bacteria | 2054 |
| 695 | Ga0373958_0006129 | 3300034819 | Bacteria | 1859 |
| 696 | Ga0373959_0001720 | 3300034820 | Bacteria | 3498 |
| 697 | Ga0373959_0040703 | 3300034820 | Bacteria | 974 |
| 698 | Ga0373938_0000636 | 3300034957 | Bacteria | 5647 |
| 699 | Ga0373938_0028309 | 3300034957 | Bacteria | 1184 |
| 700 | Ga0373926_0002855 | 3300035083 | Bacteria | 5532 |
| 701 | Ga0373928_0000449 | 3300035084 | Bacteria | 8127 |
| 702 | Ga0373928_0006492 | 3300035084 | Bacteria | 2248 |
| 703 | Ga0373929_0000206 | 3300035085 | Bacteria | 10608 |
| 704 | Ga0373929_0011326 | 3300035085 | Bacteria | 1680 |
| 705 | Ga0373934_0079393 | 3300035086 | Bacteria | 1318 |
| 706 | Ga0373940_0000275 | 3300035088 | Bacteria | 7415 |
| 707 | Ga0373944_0064575 | 3300035089 | Bacteria | 1181 |
| 708 | Ga0373944_0073042 | 3300035089 | Bacteria | 1121 |
| 709 | Ga0373949_0001134 | 3300035090 | Bacteria | 8033 |
| 710 | Ga0373949_0016538 | 3300035090 | Bacteria | 1654 |
| 711 | Ga0373951_0001767 | 3300035091 | Bacteria | 5622 |
| 712 | Ga0373951_0004572 | 3300035091 | Bacteria | 3276 |
| 713 | Ga0373952_0000038 | 3300035092 | Bacteria | 15588 |
| 714 | Ga0373952_0003171 | 3300035092 | Bacteria | 2961 |
| 715 | Ga0373923_0005915 | 3300035111 | Bacteria | 4184 |
| 716 | Ga0373923_0087237 | 3300035111 | Bacteria | 1361 |
| 717 | Ga0373923_0088670 | 3300035111 | Bacteria | 1350 |
| 718 | Ga0373923_0095440 | 3300035111 | Bacteria | 1306 |
| 719 | Ga0373923_0102375 | 3300035111 | Bacteria | 1264 |
| 720 | Ga0373932_0000572 | 3300035112 | Bacteria | 11295 |
| 721 | Ga0373932_0006403 | 3300035112 | Bacteria | 2783 |
| 722 | Ga0373932_0061926 | 3300035112 | Bacteria | 1139 |
| 723 | Ga0373936_0002351 | 3300035113 | Bacteria | 7077 |
| 724 | Ga0373936_0006584 | 3300035113 | Bacteria | 4375 |
| 725 | Ga0373936_0061540 | 3300035113 | Bacteria | 1533 |
| 726 | Ga0373939_0000257 | 3300035114 | Bacteria | 14265 |
| 727 | Ga0373939_0001338 | 3300035114 | Bacteria | 5981 |
| 728 | Ga0373941_0001019 | 3300035115 | Bacteria | 5815 |
| 729 | Ga0373945_0004740 | 3300035116 | Bacteria | 4330 |
| 730 | Ga0373953_0019090 | 3300035117 | Bacteria | 2546 |
| 731 | Ga0373953_0119171 | 3300035117 | Bacteria | 1120 |
| 732 | Ga0373954_0003212 | 3300035118 | Bacteria | 6911 |
| 733 | Ga0373954_0009592 | 3300035118 | Bacteria | 4260 |
| 734 | Ga0373954_0013665 | 3300035118 | Bacteria | 3617 |
| 735 | Ga0373954_0034538 | 3300035118 | Bacteria | 2343 |
| 736 | Ga0373956_0022878 | 3300035119 | Bacteria | 2678 |
| 737 | Ga0373957_0001356 | 3300035120 | Bacteria | 6580 |
| 738 | Ga0373957_0047898 | 3300035120 | Bacteria | 1627 |
| 739 | Ga0373960_0007980 | 3300035121 | Bacteria | 2523 |
| 740 | Ga0373943_0000022 | 3300035170 | Bacteria | 52033 |
| 741 | Ga0373943_0013955 | 3300035170 | Bacteria | 3633 |
| 742 | Ga0373943_0040109 | 3300035170 | Bacteria | 2259 |
| 743 | Ga0373943_0062294 | 3300035170 | Bacteria | 1867 |
| 744 | Ga0373946_0001714 | 3300035171 | Bacteria | 7645 |
| 745 | Ga0373946_0003547 | 3300035171 | Bacteria | 5538 |
| 746 | Ga0373946_0107071 | 3300035171 | Bacteria | 1261 |
| 747 | Ga0373946_0133443 | 3300035171 | Bacteria | 1144 |
| 748 | Ga0373955_0000952 | 3300035172 | Bacteria | 12352 |
| 749 | Ga0373955_0002078 | 3300035172 | Bacteria | 8632 |
| 750 | Ga0373955_0004881 | 3300035172 | Bacteria | 5982 |
| 751 | Ga0373955_0005612 | 3300035172 | Bacteria | 5644 |
| 752 | Ga0373955_0015292 | 3300035172 | Bacteria | 3753 |
| 753 | Ga0373955_0019882 | 3300035172 | Bacteria | 3366 |
| 754 | Ga0373942_0000089 | 3300035207 | Bacteria | 19884 |
| 755 | Ga0373942_0006193 | 3300035207 | Bacteria | 2762 |
| 756 | Ga0373961_0000846 | 3300035241 | Bacteria | 10336 |
| 757 | Ga0373961_0002484 | 3300035241 | Bacteria | 4767 |
| 758 | Ga0373961_0009318 | 3300035241 | Bacteria | 2401 |
| 759 | Ga0373962_0005746 | 3300035242 | Bacteria | 2995 |
| 760 | Ga0373962_0060160 | 3300035242 | Bacteria | 1114 |
| 761 | Ga0316574_0000238 | 3300035398 | Bacteria | 19958 |
| 762 | Ga0316574_0199113 | 3300035398 | Bacteria | 1287 |
| 763 | Ga0373924_0000337 | 3300035410 | Bacteria | 14377 |
| 764 | Ga0373924_0008273 | 3300035410 | Bacteria | 3775 |
| 765 | Ga0373924_0089905 | 3300035410 | Bacteria | 1313 |
| 766 | Ga0373924_0138931 | 3300035410 | Bacteria | 1059 |
| 767 | Ga0373931_0002088 | 3300035691 | Bacteria | 8796 |
| 768 | Ga0373931_0002736 | 3300035691 | Bacteria | 7840 |
| 769 | Ga0373931_0019758 | 3300035691 | Bacteria | 3365 |
| 770 | Ga0373935_0000151 | 3300035692 | Bacteria | 32024 |
| 771 | Ga0373935_0006737 | 3300035692 | Bacteria | 6862 |
| 772 | Ga0373935_0031968 | 3300035692 | Bacteria | 3269 |
| 773 | Ga0373935_0069147 | 3300035692 | Bacteria | 2273 |
| 774 | Ga0373927_0003569 | 3300035695 | Bacteria | 11108 |
| 775 | Ga0373927_0004805 | 3300035695 | Bacteria | 9395 |
| 776 | Ga0373927_0006375 | 3300035695 | Bacteria | 8037 |
| 777 | Ga0373927_0014549 | 3300035695 | Bacteria | 5206 |
| 778 | Ga0373927_0022521 | 3300035695 | Bacteria | 4127 |
| 779 | Ga0373927_0030912 | 3300035695 | Bacteria | 3493 |
| 780 | Ga0373927_0069345 | 3300035695 | Bacteria | 2282 |
| 781 | Ga0373927_0072818 | 3300035695 | Bacteria | 2224 |
| 782 | Ga0373927_0076206 | 3300035695 | Bacteria | 2172 |
| 783 | Ga0373927_0092860 | 3300035695 | Bacteria | 1960 |
| 784 | Ga0373927_0093600 | 3300035695 | Bacteria | 1952 |
| 785 | Ga0373927_0259062 | 3300035695 | Bacteria | 1144 |
| 786 | Ga0373933_0000038 | 3300035724 | Bacteria | 80976 |
| 787 | Ga0373933_0001536 | 3300035724 | Bacteria | 13495 |
| 788 | Ga0373933_0003575 | 3300035724 | Bacteria | 8633 |
| 789 | Ga0373933_0016229 | 3300035724 | Bacteria | 4161 |
| 790 | Ga0373933_0045925 | 3300035724 | Bacteria | 2591 |
| 791 | Ga0373933_0145035 | 3300035724 | Bacteria | 1501 |
| 792 | Ga0373947_0000424 | 3300035725 | Bacteria | 23999 |
| 793 | Ga0373947_0001986 | 3300035725 | Bacteria | 12521 |
| 794 | Ga0373947_0006522 | 3300035725 | Bacteria | 6768 |
| 795 | Ga0373947_0012693 | 3300035725 | Bacteria | 4830 |
| 796 | Ga0373947_0027002 | 3300035725 | Bacteria | 3359 |
| 797 | Ga0373947_0029621 | 3300035725 | Bacteria | 3212 |
| 798 | Ga0373947_0043248 | 3300035725 | Bacteria | 2690 |
| 799 | Ga0373947_0048098 | 3300035725 | Bacteria | 2558 |
| 800 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 801 | Ga0373937_0000564 | 3300036401 | Bacteria | 32873 |
| 802 | Ga0373937_0002216 | 3300036401 | Bacteria | 16239 |
| 803 | Ga0373937_0002513 | 3300036401 | Bacteria | 15234 |
| 804 | Ga0373937_0008198 | 3300036401 | Bacteria | 9075 |
| 805 | Ga0373937_0014261 | 3300036401 | Bacteria | 7013 |
| 806 | Ga0373937_0018346 | 3300036401 | Bacteria | 6248 |
| 807 | Ga0373937_0047021 | 3300036401 | Bacteria | 3947 |
| 808 | Ga0373937_0074468 | 3300036401 | Bacteria | 3133 |
| 809 | Ga0373937_0136754 | 3300036401 | Bacteria | 2291 |
| 810 | Ga0373937_0164152 | 3300036401 | Bacteria | 2083 |
| 811 | Ga0316584_0241922 | 3300036712 | Bacteria | 1320 |
| 812 | Ga0373925_0000095 | 3300037068 | Bacteria | 95071 |
| 813 | Ga0373925_0001200 | 3300037068 | Bacteria | 22817 |
| 814 | Ga0373925_0009185 | 3300037068 | Bacteria | 7199 |
| 815 | Ga0373925_0019344 | 3300037068 | Bacteria | 4953 |
| 816 | Ga0373925_0050867 | 3300037068 | Bacteria | 3091 |
| 817 | Ga0373925_0104482 | 3300037068 | Bacteria | 2181 |
| 818 | Ga0373925_0292319 | 3300037068 | Bacteria | 1314 |
| 819 | Ga0373925_0335729 | 3300037068 | Bacteria | 1225 |
| 820 | Ga0395899_0160346 | 3300037312 | Bacteria | 1589 |
| 821 | Ga0395900_0004874 | 3300037418 | Bacteria | 14131 |
| 822 | Ga0395900_0043925 | 3300037418 | Bacteria | 4606 |
| 823 | Ga0395898_0010366 | 3300037466 | Bacteria | 9746 |
| 824 | Ga0395898_0014711 | 3300037466 | Bacteria | 8033 |
| 825 | Ga0395898_0041967 | 3300037466 | Bacteria | 4516 |
| 826 | Ga0395898_0424123 | 3300037466 | Bacteria | 1267 |
| 827 | Ga0436364_0511355 | 3300037853 | Bacteria | 1088 |
| 828 | Ga0436364_0524693 | 3300037853 | Bacteria | 41977 |
| 829 | Ga0395901_0062428 | 3300038443 | Bacteria | 3877 |
| 830 | Ga0395901_0318225 | 3300038443 | Bacteria | 1610 |
| 831 | Ga0436365_0217688 | 3300039437 | Bacteria | 1994 |
| 832 | Ga0436365_0507358 | 3300039437 | Bacteria | 3847 |
| 833 | Ga0436365_0608033 | 3300039437 | Bacteria | 2424 |
| 834 | Ga0436365_0652419 | 3300039437 | Bacteria | 1161 |
| 835 | Ga0436365_1192445 | 3300039437 | Bacteria | 2541 |
| 836 | Ga0436365_1726749 | 3300039437 | Bacteria | 8029 |
| 837 | Ga0436365_1747000 | 3300039437 | Bacteria | 3070 |
| 838 | Ga0436360_1236069 | 3300039438 | Bacteria | 4818 |
| 839 | Ga0436361_0149914 | 3300039447 | Bacteria | 2479 |
| 840 | Ga0436361_1051179 | 3300039447 | Bacteria | 1986 |
| 841 | Ga0436363_0208725 | 3300039450 | Bacteria | 1410 |
| 842 | Ga0436363_0852738 | 3300039450 | Bacteria | 1702 |
| 843 | Ga0436363_1266619 | 3300039450 | Bacteria | 2470 |
| 844 | Ga0436362_0363294 | 3300039453 | Bacteria | 1947 |
| 845 | Ga0436362_0803318 | 3300039453 | Bacteria | 965 |
| 846 | Ga0439443_000552 | 3300042003 | Bacteria | 3423 |
| 847 | Ga0439459_0018369 | 3300042438 | Bacteria | 1314 |
| 848 | Ga0439460_0030397 | 3300042461 | Bacteria | 1535 |
| 849 | Ga0451577_0220582 | 3300042876 | Bacteria | 1714 |
| 850 | Ga0466969_0008527 | 3300044656 | Bacteria | 5440 |
| 851 | Ga0466966_0069919 | 3300044684 | Bacteria | 2201 |
| 852 | Ga0466966_0134077 | 3300044684 | Bacteria | 1515 |
| 853 | Ga0466961_0000090 | 3300044693 | Bacteria | 57757 |
| 854 | Ga0466961_0092027 | 3300044693 | Bacteria | 1915 |
| 855 | Ga0453684_0005340 | 3300044712 | Bacteria | 25596 |
| 856 | Ga0466971_0052858 | 3300044719 | Bacteria | 1830 |
| 857 | Ga0466959_0003543 | 3300045049 | Bacteria | 10258 |
| 858 | Ga0466959_0051536 | 3300045049 | Bacteria | 3018 |
| 859 | Ga0466959_0091516 | 3300045049 | Bacteria | 2184 |
| 860 | Ga0451576_0016545 | 3300045051 | Bacteria | 8134 |
| 861 | Ga0466958_0255103 | 3300045836 | Bacteria | 1122 |
| 862 | Ga0466967_0014846 | 3300045976 | Bacteria | 6086 |
| 863 | Ga0466967_0104527 | 3300045976 | Bacteria | 2593 |
| 864 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 865 | Ga0495592_0025647 | 3300046454 | Bacteria | 4473 |
| 866 | Ga0495592_0029044 | 3300046454 | Bacteria | 4186 |
| 867 | Ga0495592_0041594 | 3300046454 | Bacteria | 3444 |
| 868 | Ga0495592_0276136 | 3300046454 | Bacteria | 1101 |
| 869 | Ga0495603_0037515 | 3300046455 | Bacteria | 2908 |
| 870 | Ga0495629_0000447 | 3300046459 | Bacteria | 34326 |
| 871 | Ga0495629_0023396 | 3300046459 | Bacteria | 4402 |
| 872 | Ga0495629_0065540 | 3300046459 | Bacteria | 2535 |
| 873 | Ga0495638_0011418 | 3300046460 | Bacteria | 6121 |
| 874 | Ga0495641_0023515 | 3300046461 | Bacteria | 3058 |
| 875 | Ga0495641_0038974 | 3300046461 | Bacteria | 2218 |
| 876 | Ga0495651_0002508 | 3300046462 | Bacteria | 14206 |
| 877 | Ga0495651_0020710 | 3300046462 | Bacteria | 5106 |
| 878 | Ga0495651_0027167 | 3300046462 | Bacteria | 4458 |
| 879 | Ga0495651_0030858 | 3300046462 | Bacteria | 4179 |
| 880 | Ga0495653_0000045 | 3300046463 | Bacteria | 115410 |
| 881 | Ga0495653_0005387 | 3300046463 | Bacteria | 10409 |
| 882 | Ga0495653_0013922 | 3300046463 | Bacteria | 6558 |
| 883 | Ga0495653_0038393 | 3300046463 | Bacteria | 3759 |
| 884 | Ga0495653_0116030 | 3300046463 | Bacteria | 1915 |
| 885 | Ga0495580_0019007 | 3300046472 | Bacteria | 5109 |
| 886 | Ga0495582_0008399 | 3300046473 | Bacteria | 5696 |
| 887 | Ga0495582_0048745 | 3300046473 | Bacteria | 2333 |
| 888 | Ga0495582_0056310 | 3300046473 | Bacteria | 2166 |
| 889 | Ga0495582_0101943 | 3300046473 | Bacteria | 1607 |
| 890 | Ga0495582_0104592 | 3300046473 | Bacteria | 1587 |
| 891 | Ga0495639_0041184 | 3300046475 | Bacteria | 2080 |
| 892 | Ga0495662_0000956 | 3300046476 | Bacteria | 14150 |
| 893 | Ga0495662_0006352 | 3300046476 | Bacteria | 5907 |
| 894 | Ga0495662_0016654 | 3300046476 | Bacteria | 3561 |
| 895 | Ga0495662_0037874 | 3300046476 | Bacteria | 2330 |
| 896 | Ga0495662_0059478 | 3300046476 | Bacteria | 1845 |
| 897 | Ga0495662_0120508 | 3300046476 | Bacteria | 1288 |
| 898 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 899 | Ga0495664_0003742 | 3300046477 | Bacteria | 8297 |
| 900 | Ga0495664_0053735 | 3300046477 | Bacteria | 2395 |
| 901 | Ga0495664_0062489 | 3300046477 | Bacteria | 2218 |
| 902 | Ga0495664_0137514 | 3300046477 | Bacteria | 1480 |
| 903 | Ga0495584_0005410 | 3300046491 | Bacteria | 6764 |
| 904 | Ga0495594_0018229 | 3300046499 | Bacteria | 3716 |
| 905 | Ga0495594_0021714 | 3300046499 | Bacteria | 3428 |
| 906 | Ga0495594_0024640 | 3300046499 | Bacteria | 3234 |
| 907 | Ga0495607_0036689 | 3300046501 | Bacteria | 2951 |
| 908 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 909 | Ga0495608_0003528 | 3300046511 | Bacteria | 11206 |
| 910 | Ga0495608_0015432 | 3300046511 | Bacteria | 5297 |
| 911 | Ga0495608_0036638 | 3300046511 | Bacteria | 3302 |
| 912 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 913 | Ga0495618_0009367 | 3300046514 | Bacteria | 5912 |
| 914 | Ga0495618_0010524 | 3300046514 | Bacteria | 5596 |
| 915 | Ga0495618_0011587 | 3300046514 | Bacteria | 5349 |
| 916 | Ga0495618_0012818 | 3300046514 | Bacteria | 5095 |
| 917 | Ga0495618_0019212 | 3300046514 | Bacteria | 4202 |
| 918 | Ga0495618_0024630 | 3300046514 | Bacteria | 3728 |
| 919 | Ga0495618_0084130 | 3300046514 | Bacteria | 2033 |
| 920 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 921 | Ga0495628_0000319 | 3300046516 | Bacteria | 43414 |
| 922 | Ga0495628_0006361 | 3300046516 | Bacteria | 10324 |
| 923 | Ga0495628_0006602 | 3300046516 | Bacteria | 10126 |
| 924 | Ga0495630_0000947 | 3300046517 | Bacteria | 20279 |
| 925 | Ga0495630_0065869 | 3300046517 | Bacteria | 2722 |
| 926 | Ga0495630_0072015 | 3300046517 | Bacteria | 2602 |
| 927 | Ga0495637_0041673 | 3300046520 | Bacteria | 1968 |
| 928 | Ga0495644_0000748 | 3300046523 | Bacteria | 13392 |
| 929 | Ga0495666_0013922 | 3300046526 | Bacteria | 4011 |
| 930 | Ga0495666_0025854 | 3300046526 | Bacteria | 2897 |
| 931 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 932 | Ga0495652_0007288 | 3300046529 | Bacteria | 10204 |
| 933 | Ga0495652_0245602 | 3300046529 | Bacteria | 1329 |
| 934 | Ga0495665_0064664 | 3300046531 | Bacteria | 1930 |
| 935 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 936 | Ga0495640_0002125 | 3300046533 | Bacteria | 15820 |
| 937 | Ga0495640_0005236 | 3300046533 | Bacteria | 10313 |
| 938 | Ga0495640_0007483 | 3300046533 | Bacteria | 8580 |
| 939 | Ga0495640_0023689 | 3300046533 | Bacteria | 4467 |
| 940 | Ga0495640_0024699 | 3300046533 | Bacteria | 4368 |
| 941 | Ga0495640_0054557 | 3300046533 | Bacteria | 2737 |
| 942 | Ga0495640_0075722 | 3300046533 | Bacteria | 2247 |
| 943 | Ga0495640_0203380 | 3300046533 | Bacteria | 1254 |
| 944 | Ga0495586_0132817 | 3300046535 | Bacteria | 1394 |
| 945 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 946 | Ga0495587_0001323 | 3300046536 | Bacteria | 16465 |
| 947 | Ga0495587_0055786 | 3300046536 | Bacteria | 2326 |
| 948 | Ga0495598_0026269 | 3300046537 | Bacteria | 1595 |
| 949 | Ga0495621_0024040 | 3300046539 | Bacteria | 2031 |
| 950 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 951 | Ga0495645_0002662 | 3300046543 | Bacteria | 12135 |
| 952 | Ga0495645_0003160 | 3300046543 | Bacteria | 11163 |
| 953 | Ga0495645_0007704 | 3300046543 | Bacteria | 7491 |
| 954 | Ga0495645_0051861 | 3300046543 | Bacteria | 2985 |
| 955 | Ga0495645_0057125 | 3300046543 | Bacteria | 2833 |
| 956 | Ga0495622_0012435 | 3300046557 | Bacteria | 3940 |
| 957 | Ga0495633_0007380 | 3300046558 | Bacteria | 6332 |
| 958 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 959 | Ga0495667_0000679 | 3300046559 | Bacteria | 21812 |
| 960 | Ga0495667_0004191 | 3300046559 | Bacteria | 9712 |
| 961 | Ga0495667_0004817 | 3300046559 | Bacteria | 9124 |
| 962 | Ga0495667_0117471 | 3300046559 | Bacteria | 1718 |
| 963 | Ga0495656_0034485 | 3300046615 | Bacteria | 2073 |
| 964 | Ga0495634_0000082 | 3300046642 | Bacteria | 74301 |
| 965 | Ga0495634_0004557 | 3300046642 | Bacteria | 10828 |
| 966 | Ga0495634_0005436 | 3300046642 | Bacteria | 9808 |
| 967 | Ga0495634_0006661 | 3300046642 | Bacteria | 8760 |
| 968 | Ga0495634_0024131 | 3300046642 | Bacteria | 4270 |
| 969 | Ga0495634_0057804 | 3300046642 | Bacteria | 2587 |
| 970 | Ga0495611_0003367 | 3300046648 | Bacteria | 7056 |
| 971 | Ga0495625_0222550 | 3300046660 | Bacteria | 1236 |
| 972 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 973 | Ga0495635_0002274 | 3300046663 | Bacteria | 13065 |
| 974 | Ga0495635_0008183 | 3300046663 | Bacteria | 7302 |
| 975 | Ga0495635_0021903 | 3300046663 | Bacteria | 4454 |
| 976 | Ga0495635_0024554 | 3300046663 | Bacteria | 4200 |
| 977 | Ga0495588_0006148 | 3300046674 | Bacteria | 5392 |
| 978 | Ga0495588_0041797 | 3300046674 | Bacteria | 2342 |
| 979 | Ga0495657_0001356 | 3300046675 | Bacteria | 21268 |
| 980 | Ga0495657_0002915 | 3300046675 | Bacteria | 14186 |
| 981 | Ga0495657_0040604 | 3300046675 | Bacteria | 3190 |
| 982 | Ga0495657_0043599 | 3300046675 | Bacteria | 3058 |
| 983 | Ga0495657_0131890 | 3300046675 | Bacteria | 1564 |
| 984 | Ga0495657_0278516 | 3300046675 | Bacteria | 1001 |
| 985 | Ga0495599_0000104 | 3300046678 | Bacteria | 59442 |
| 986 | Ga0495599_0004501 | 3300046678 | Bacteria | 8260 |
| 987 | Ga0495599_0023990 | 3300046678 | Bacteria | 3814 |
| 988 | Ga0495599_0026313 | 3300046678 | Bacteria | 3645 |
| 989 | Ga0495599_0135219 | 3300046678 | Bacteria | 1530 |
| 990 | Ga0495623_0000108 | 3300046679 | Bacteria | 51088 |
| 991 | Ga0495623_0001764 | 3300046679 | Bacteria | 14512 |
| 992 | Ga0495623_0012776 | 3300046679 | Bacteria | 5436 |
| 993 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 994 | Ga0495646_0000684 | 3300046680 | Bacteria | 18642 |
| 995 | Ga0495646_0044732 | 3300046680 | Bacteria | 2706 |
| 996 | Ga0495647_0011289 | 3300046681 | Bacteria | 3059 |
| 997 | Ga0495647_0039378 | 3300046681 | Bacteria | 1792 |
| 998 | Ga0495647_0074153 | 3300046681 | Bacteria | 1368 |
| 999 | Ga0495658_0009740 | 3300046683 | Bacteria | 4792 |
| 1000 | Ga0495658_0033330 | 3300046683 | Bacteria | 2819 |
| 1001 | Ga0495658_0040037 | 3300046683 | Bacteria | 2604 |
| 1002 | Ga0495658_0058937 | 3300046683 | Bacteria | 2197 |
| 1003 | Ga0495658_0103417 | 3300046683 | Bacteria | 1703 |
| 1004 | Ga0495613_0022722 | 3300046689 | Bacteria | 4673 |
| 1005 | Ga0495613_0083586 | 3300046689 | Bacteria | 2318 |
| 1006 | Ga0495613_0135259 | 3300046689 | Bacteria | 1764 |
| 1007 | Ga0495613_0144500 | 3300046689 | Bacteria | 1698 |
| 1008 | Ga0495624_0011797 | 3300046690 | Bacteria | 5997 |
| 1009 | Ga0495624_0014518 | 3300046690 | Bacteria | 5344 |
| 1010 | Ga0495624_0021150 | 3300046690 | Bacteria | 4318 |
| 1011 | Ga0495624_0056771 | 3300046690 | Bacteria | 2463 |
| 1012 | Ga0495670_0001290 | 3300046691 | Bacteria | 12211 |
| 1013 | Ga0495649_0069504 | 3300046694 | Bacteria | 1889 |
| 1014 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 1015 | Ga0495600_0004224 | 3300046809 | Bacteria | 8577 |
| 1016 | Ga0495600_0004928 | 3300046809 | Bacteria | 8015 |
| 1017 | Ga0495600_0010276 | 3300046809 | Bacteria | 5804 |
| 1018 | Ga0495600_0020923 | 3300046809 | Bacteria | 4187 |
| 1019 | Ga0495600_0035198 | 3300046809 | Bacteria | 3251 |
| 1020 | Ga0495600_0141550 | 3300046809 | Bacteria | 1560 |
| 1021 | Ga0495581_0009308 | 3300047315 | Bacteria | 5684 |
| 1022 | Ga0495581_0016650 | 3300047315 | Bacteria | 4274 |
| 1023 | Ga0495581_0021358 | 3300047315 | Bacteria | 3754 |
| 1024 | Ga0495581_0028834 | 3300047315 | Bacteria | 3218 |
| 1025 | Ga0495581_0252274 | 3300047315 | Bacteria | 1032 |
| 1026 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 1027 | Ga0495604_0001938 | 3300047317 | Bacteria | 16749 |
| 1028 | Ga0495604_0013941 | 3300047317 | Bacteria | 6412 |
| 1029 | Ga0495636_0068340 | 3300047318 | Bacteria | 1513 |
| 1030 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 1031 | Ga0495674_0015017 | 3300047319 | Bacteria | 7248 |
| 1032 | Ga0495674_0036170 | 3300047319 | Bacteria | 4447 |
| 1033 | Ga0495674_0038342 | 3300047319 | Bacteria | 4301 |
| 1034 | Ga0495674_0069623 | 3300047319 | Bacteria | 3042 |
| 1035 | Ga0495674_0077360 | 3300047319 | Bacteria | 2861 |
| 1036 | Ga0495674_0189364 | 3300047319 | Bacteria | 1711 |
| 1037 | Ga0495676_0116065 | 3300047321 | Bacteria | 1956 |
| 1038 | Ga0495676_0123829 | 3300047321 | Bacteria | 1876 |
| 1039 | Ga0495680_0000268 | 3300047322 | Bacteria | 57815 |
| 1040 | Ga0495680_0002870 | 3300047322 | Bacteria | 17316 |
| 1041 | Ga0495680_0006079 | 3300047322 | Bacteria | 11275 |
| 1042 | Ga0495680_0012467 | 3300047322 | Bacteria | 7481 |
| 1043 | Ga0495680_0014725 | 3300047322 | Bacteria | 6761 |
| 1044 | Ga0495680_0048923 | 3300047322 | Bacteria | 3316 |
| 1045 | Ga0495683_0095531 | 3300047323 | Bacteria | 1435 |
| 1046 | Ga0495675_0000517 | 3300047444 | Bacteria | 25028 |
| 1047 | Ga0495675_0005619 | 3300047444 | Bacteria | 7656 |
| 1048 | Ga0495675_0044909 | 3300047444 | Bacteria | 2814 |
| 1049 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 1050 | Ga0495684_0005515 | 3300047471 | Bacteria | 9852 |
| 1051 | Ga0495684_0065720 | 3300047471 | Bacteria | 2757 |
| 1052 | Ga0495684_0074498 | 3300047471 | Bacteria | 2579 |
| 1053 | Ga0495684_0074555 | 3300047471 | Bacteria | 2578 |
| 1054 | Ga0495684_0128119 | 3300047471 | Bacteria | 1908 |
| 1055 | Ga0495684_0181039 | 3300047471 | Bacteria | 1562 |
| 1056 | Ga0495686_0183825 | 3300047472 | Bacteria | 1210 |
| 1057 | Ga0495593_0003103 | 3300047673 | Bacteria | 9998 |
| 1058 | Ga0495593_0007133 | 3300047673 | Bacteria | 6552 |
| 1059 | Ga0495593_0010906 | 3300047673 | Bacteria | 5237 |
| 1060 | Ga0495593_0021655 | 3300047673 | Bacteria | 3587 |
| 1061 | Ga0495593_0029987 | 3300047673 | Bacteria | 2979 |
| 1062 | Ga0495593_0107726 | 3300047673 | Bacteria | 1424 |
| 1063 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 1064 | Ga0495602_0000776 | 3300048088 | Bacteria | 30394 |
| 1065 | Ga0495602_0006877 | 3300048088 | Bacteria | 11953 |
| 1066 | Ga0495602_0017885 | 3300048088 | Bacteria | 7094 |
| 1067 | Ga0495602_0148118 | 3300048088 | Bacteria | 1849 |
| 1068 | Ga0495602_0347499 | 3300048088 | Bacteria | 1071 |
| 1069 | Ga0495614_0028122 | 3300048089 | Bacteria | 2423 |
| 1070 | Ga0495614_0064522 | 3300048089 | Bacteria | 1575 |
| 1071 | Ga0496100_0002767 | 3300048903 | Bacteria | 8965 |
| 1072 | Ga0496100_0034574 | 3300048903 | Bacteria | 3173 |
| 1073 | Ga0496100_0242383 | 3300048903 | Bacteria | 1331 |
| 1074 | Ga0496101_0002749 | 3300048904 | Bacteria | 10798 |
| 1075 | Ga0496101_0013492 | 3300048904 | Bacteria | 5475 |
| 1076 | Ga0496101_0021512 | 3300048904 | Bacteria | 4432 |
| 1077 | Ga0496101_0149227 | 3300048904 | Bacteria | 1787 |
| 1078 | Ga0496102_0002243 | 3300048905 | Bacteria | 16573 |
| 1079 | Ga0496102_0013701 | 3300048905 | Bacteria | 7029 |
| 1080 | Ga0496102_0015327 | 3300048905 | Bacteria | 6674 |
| 1081 | Ga0496102_0019523 | 3300048905 | Bacteria | 5970 |
| 1082 | Ga0496102_0035373 | 3300048905 | Bacteria | 4495 |
| 1083 | Ga0496102_0081945 | 3300048905 | Bacteria | 2975 |
| 1084 | Ga0496102_0161475 | 3300048905 | Bacteria | 2108 |
| 1085 | Ga0496103_0013454 | 3300048906 | Bacteria | 4853 |
| 1086 | Ga0496103_0040138 | 3300048906 | Bacteria | 2876 |
| 1087 | Ga0496103_0147693 | 3300048906 | Bacteria | 1505 |
| 1088 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 1089 | Ga0496104_0005552 | 3300048907 | Bacteria | 11047 |
| 1090 | Ga0496104_0027488 | 3300048907 | Bacteria | 5265 |
| 1091 | Ga0496104_0047588 | 3300048907 | Bacteria | 4042 |
| 1092 | Ga0496104_0064066 | 3300048907 | Bacteria | 3487 |
| 1093 | Ga0496104_0072480 | 3300048907 | Bacteria | 3275 |
| 1094 | Ga0496104_0107940 | 3300048907 | Bacteria | 2667 |
| 1095 | Ga0496104_0108902 | 3300048907 | Bacteria | 2655 |
| 1096 | Ga0496104_0144894 | 3300048907 | Bacteria | 2281 |
| 1097 | Ga0496105_0002503 | 3300048908 | Bacteria | 13320 |
| 1098 | Ga0496105_0003752 | 3300048908 | Bacteria | 11320 |
| 1099 | Ga0496105_0006025 | 3300048908 | Bacteria | 9268 |
| 1100 | Ga0496105_0063458 | 3300048908 | Bacteria | 3047 |
| 1101 | Ga0496105_0166837 | 3300048908 | Bacteria | 1806 |
| 1102 | Ga0496105_0287695 | 3300048908 | Bacteria | 1324 |
| 1103 | Ga0496106_0002308 | 3300048909 | Bacteria | 14232 |
| 1104 | Ga0496106_0005008 | 3300048909 | Bacteria | 9803 |
| 1105 | Ga0496106_0008873 | 3300048909 | Bacteria | 7432 |
| 1106 | Ga0496106_0016730 | 3300048909 | Bacteria | 5426 |
| 1107 | Ga0496106_0028383 | 3300048909 | Bacteria | 4168 |
| 1108 | Ga0496106_0035865 | 3300048909 | Bacteria | 3709 |
| 1109 | Ga0496106_0040080 | 3300048909 | Bacteria | 3507 |
| 1110 | Ga0496106_0053571 | 3300048909 | Bacteria | 3047 |
| 1111 | Ga0496106_0076993 | 3300048909 | Bacteria | 2557 |
| 1112 | Ga0496107_0000948 | 3300048910 | Bacteria | 17175 |
| 1113 | Ga0496107_0011336 | 3300048910 | Bacteria | 6204 |
| 1114 | Ga0496107_0024457 | 3300048910 | Bacteria | 4272 |
| 1115 | Ga0496107_0053474 | 3300048910 | Bacteria | 2913 |
| 1116 | Ga0496107_0283939 | 3300048910 | Bacteria | 1232 |
| 1117 | Ga0496108_0000386 | 3300048911 | Bacteria | 36634 |
| 1118 | Ga0496108_0008222 | 3300048911 | Bacteria | 8468 |
| 1119 | Ga0496108_0008465 | 3300048911 | Bacteria | 8345 |
| 1120 | Ga0496108_0015654 | 3300048911 | Bacteria | 6186 |
| 1121 | Ga0496108_0073741 | 3300048911 | Bacteria | 2881 |
| 1122 | Ga0496108_0116847 | 3300048911 | Bacteria | 2285 |
| 1123 | Ga0496108_0208857 | 3300048911 | Bacteria | 1695 |
| 1124 | Ga0496109_0001313 | 3300048912 | Bacteria | 20515 |
| 1125 | Ga0496109_0002084 | 3300048912 | Bacteria | 16616 |
| 1126 | Ga0496109_0005082 | 3300048912 | Bacteria | 10991 |
| 1127 | Ga0496109_0013436 | 3300048912 | Bacteria | 7102 |
| 1128 | Ga0496109_0025848 | 3300048912 | Bacteria | 5233 |
| 1129 | Ga0496109_0037307 | 3300048912 | Bacteria | 4391 |
| 1130 | Ga0496109_0089599 | 3300048912 | Bacteria | 2844 |
| 1131 | Ga0496109_0108049 | 3300048912 | Bacteria | 2585 |
| 1132 | Ga0496109_0183313 | 3300048912 | Bacteria | 1967 |
| 1133 | Ga0496109_0554419 | 3300048912 | Bacteria | 1084 |
| 1134 | Ga0496110_0002099 | 3300048913 | Bacteria | 14861 |
| 1135 | Ga0496110_0007609 | 3300048913 | Bacteria | 8660 |
| 1136 | Ga0496110_0021235 | 3300048913 | Bacteria | 5493 |
| 1137 | Ga0496110_0027444 | 3300048913 | Bacteria | 4881 |
| 1138 | Ga0496110_0031648 | 3300048913 | Bacteria | 4565 |
| 1139 | Ga0496110_0051043 | 3300048913 | Bacteria | 3634 |
| 1140 | Ga0496110_0108219 | 3300048913 | Bacteria | 2496 |
| 1141 | Ga0496110_0125266 | 3300048913 | Bacteria | 2318 |
| 1142 | Ga0496111_0003477 | 3300048914 | Bacteria | 9748 |
| 1143 | Ga0496111_0011952 | 3300048914 | Bacteria | 5867 |
| 1144 | Ga0496111_0024335 | 3300048914 | Bacteria | 4262 |
| 1145 | Ga0496111_0042385 | 3300048914 | Bacteria | 3268 |
| 1146 | Ga0496111_0055370 | 3300048914 | Bacteria | 2868 |
| 1147 | Ga0496111_0058738 | 3300048914 | Bacteria | 2785 |
| 1148 | Ga0496111_0094130 | 3300048914 | Bacteria | 2197 |
| 1149 | Ga0496111_0134909 | 3300048914 | Bacteria | 1828 |
| 1150 | Ga0496112_0000426 | 3300048915 | Bacteria | 27828 |
| 1151 | Ga0496112_0002276 | 3300048915 | Bacteria | 15347 |
| 1152 | Ga0496112_0002729 | 3300048915 | Bacteria | 14297 |
| 1153 | Ga0496112_0017139 | 3300048915 | Bacteria | 6803 |
| 1154 | Ga0496112_0073881 | 3300048915 | Bacteria | 3370 |
| 1155 | Ga0496112_0079495 | 3300048915 | Bacteria | 3243 |
| 1156 | Ga0496112_0112869 | 3300048915 | Bacteria | 2688 |
| 1157 | Ga0496112_0159970 | 3300048915 | Bacteria | 2218 |
| 1158 | Ga0496112_0213665 | 3300048915 | Bacteria | 1886 |
| 1159 | Ga0496112_0408096 | 3300048915 | Bacteria | 1298 |
| 1160 | Ga0496112_0439604 | 3300048915 | Bacteria | 1242 |
| 1161 | Ga0496113_0000395 | 3300048916 | Bacteria | 21041 |
| 1162 | Ga0496113_0005585 | 3300048916 | Bacteria | 7861 |
| 1163 | Ga0496113_0006364 | 3300048916 | Bacteria | 7473 |
| 1164 | Ga0496113_0192335 | 3300048916 | Bacteria | 1620 |
| 1165 | Ga0496113_0275053 | 3300048916 | Bacteria | 1346 |
| 1166 | Ga0496114_0039960 | 3300048917 | Bacteria | 3882 |
| 1167 | Ga0496114_0050201 | 3300048917 | Bacteria | 3472 |
| 1168 | Ga0496114_0065094 | 3300048917 | Bacteria | 3053 |
| 1169 | Ga0496114_0138104 | 3300048917 | Bacteria | 2108 |
| 1170 | Ga0496114_0285405 | 3300048917 | Bacteria | 1456 |
| 1171 | Ga0496114_0299688 | 3300048917 | Bacteria | 1419 |
| 1172 | Ga0496115_0005407 | 3300048918 | Bacteria | 9286 |
| 1173 | Ga0496115_0015763 | 3300048918 | Bacteria | 5740 |
| 1174 | Ga0496115_0032770 | 3300048918 | Bacteria | 4100 |
| 1175 | Ga0496115_0058117 | 3300048918 | Bacteria | 3111 |
| 1176 | Ga0496115_0069401 | 3300048918 | Bacteria | 2854 |
| 1177 | Ga0496115_0081086 | 3300048918 | Bacteria | 2642 |
| 1178 | Ga0496115_0453306 | 3300048918 | Bacteria | 1036 |
| 1179 | Ga0496119_0001157 | 3300048922 | Bacteria | 33058 |
| 1180 | Ga0496121_0087070 | 3300048924 | Bacteria | 2453 |
| 1181 | Ga0496122_0004668 | 3300048925 | Bacteria | 16823 |
| 1182 | Ga0496123_0016898 | 3300048926 | Bacteria | 5897 |
| 1183 | Ga0496124_0118723 | 3300048927 | Bacteria | 2117 |
| 1184 | Ga0496125_0001734 | 3300048928 | Bacteria | 30312 |
| 1185 | Ga0496125_0008258 | 3300048928 | Bacteria | 10932 |
| 1186 | Ga0496125_0008325 | 3300048928 | Bacteria | 10883 |
| 1187 | Ga0496125_0276292 | 3300048928 | Bacteria | 1043 |
| 1188 | Ga0501031_0015877 | 3300049568 | Bacteria | 4889 |
| 1189 | Ga0501031_0036686 | 3300049568 | Bacteria | 3198 |
| 1190 | Ga0501031_0152461 | 3300049568 | Bacteria | 1510 |
| 1191 | Ga0501032_0011857 | 3300049569 | Bacteria | 6244 |
| 1192 | Ga0501032_0056036 | 3300049569 | Bacteria | 2650 |
| 1193 | Ga0501032_0067199 | 3300049569 | Bacteria | 2395 |
| 1194 | Ga0501032_0083622 | 3300049569 | Bacteria | 2122 |
| 1195 | Ga0501032_0119882 | 3300049569 | Bacteria | 1739 |
| 1196 | Ga0501033_0014850 | 3300049570 | Bacteria | 5912 |
| 1197 | Ga0501033_0047585 | 3300049570 | Bacteria | 3188 |
| 1198 | Ga0501033_0048467 | 3300049570 | Bacteria | 3155 |
| 1199 | Ga0501033_0051645 | 3300049570 | Bacteria | 3047 |
| 1200 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 1201 | Ga0501034_0000229 | 3300049571 | Bacteria | 105030 |
| 1202 | Ga0501034_0001110 | 3300049571 | Bacteria | 37765 |
| 1203 | Ga0501034_0008683 | 3300049571 | Bacteria | 10704 |
| 1204 | Ga0501034_0017595 | 3300049571 | Bacteria | 7328 |
| 1205 | Ga0501034_0026137 | 3300049571 | Bacteria | 5945 |
| 1206 | Ga0501034_0069983 | 3300049571 | Bacteria | 3520 |
| 1207 | Ga0501034_0088085 | 3300049571 | Bacteria | 3103 |
| 1208 | Ga0501034_0089500 | 3300049571 | Bacteria | 3076 |
| 1209 | Ga0501034_0118129 | 3300049571 | Bacteria | 2639 |
| 1210 | Ga0501034_0144962 | 3300049571 | Bacteria | 2352 |
| 1211 | Ga0501034_0178248 | 3300049571 | Bacteria | 2090 |
| 1212 | Ga0501034_0239028 | 3300049571 | Bacteria | 1763 |
| 1213 | Ga0501034_0269085 | 3300049571 | Bacteria | 1645 |
| 1214 | Ga0501034_0307234 | 3300049571 | Bacteria | 1521 |
| 1215 | Ga0501036_0000783 | 3300049572 | Bacteria | 23531 |
| 1216 | Ga0501036_0007660 | 3300049572 | Bacteria | 8815 |
| 1217 | Ga0501036_0022257 | 3300049572 | Bacteria | 5331 |
| 1218 | Ga0501036_0050874 | 3300049572 | Bacteria | 3508 |
| 1219 | Ga0501036_0061182 | 3300049572 | Bacteria | 3189 |
| 1220 | Ga0501036_0102160 | 3300049572 | Bacteria | 2425 |
| 1221 | Ga0501037_0001572 | 3300049573 | Bacteria | 16634 |
| 1222 | Ga0501037_0008091 | 3300049573 | Bacteria | 7705 |
| 1223 | Ga0501037_0022876 | 3300049573 | Bacteria | 4622 |
| 1224 | Ga0501037_0031393 | 3300049573 | Bacteria | 3922 |
| 1225 | Ga0501037_0059581 | 3300049573 | Bacteria | 2784 |
| 1226 | Ga0501037_0078288 | 3300049573 | Bacteria | 2399 |
| 1227 | Ga0501037_0123315 | 3300049573 | Bacteria | 1861 |
| 1228 | Ga0501038_0006136 | 3300049574 | Bacteria | 11124 |
| 1229 | Ga0501038_0014576 | 3300049574 | Bacteria | 7164 |
| 1230 | Ga0501038_0037381 | 3300049574 | Bacteria | 4256 |
| 1231 | Ga0501038_0068808 | 3300049574 | Bacteria | 3009 |
| 1232 | Ga0501038_0152189 | 3300049574 | Bacteria | 1885 |
| 1233 | Ga0501038_0191440 | 3300049574 | Bacteria | 1646 |
| 1234 | Ga0501038_0335269 | 3300049574 | Bacteria | 1180 |
| 1235 | Ga0501039_0000946 | 3300049575 | Bacteria | 21119 |
| 1236 | Ga0501039_0028565 | 3300049575 | Bacteria | 4293 |
| 1237 | Ga0501039_0032425 | 3300049575 | Bacteria | 4028 |
| 1238 | Ga0501039_0040211 | 3300049575 | Bacteria | 3611 |
| 1239 | Ga0501039_0065951 | 3300049575 | Bacteria | 2809 |
| 1240 | Ga0501039_0366616 | 3300049575 | Bacteria | 1131 |
| 1241 | Ga0501041_0133149 | 3300049577 | Bacteria | 1549 |
| 1242 | Ga0501041_0233661 | 3300049577 | Bacteria | 1155 |
| 1243 | Ga0501042_0214089 | 3300049578 | Bacteria | 1390 |
| 1244 | Ga0501043_0022518 | 3300049579 | Bacteria | 4940 |
| 1245 | Ga0501043_0049038 | 3300049579 | Bacteria | 3319 |
| 1246 | Ga0501043_0082459 | 3300049579 | Bacteria | 2528 |
| 1247 | Ga0501043_0086312 | 3300049579 | Bacteria | 2466 |
| 1248 | Ga0501043_0254958 | 3300049579 | Bacteria | 1350 |
| 1249 | Ga0501046_0000010 | 3300049580 | Bacteria | 331082 |
| 1250 | Ga0501046_0010235 | 3300049580 | Bacteria | 8070 |
| 1251 | Ga0501046_0039838 | 3300049580 | Bacteria | 3758 |
| 1252 | Ga0501046_0212966 | 3300049580 | Bacteria | 1433 |
| 1253 | Ga0501047_0000164 | 3300049581 | Bacteria | 81200 |
| 1254 | Ga0501047_0000291 | 3300049581 | Bacteria | 57615 |
| 1255 | Ga0501047_0015143 | 3300049581 | Bacteria | 7342 |
| 1256 | Ga0501047_0050411 | 3300049581 | Bacteria | 4020 |
| 1257 | Ga0501047_0052031 | 3300049581 | Bacteria | 3958 |
| 1258 | Ga0501047_0066787 | 3300049581 | Bacteria | 3467 |
| 1259 | Ga0501047_0083239 | 3300049581 | Bacteria | 3075 |
| 1260 | Ga0501047_0089676 | 3300049581 | Bacteria | 2952 |
| 1261 | Ga0501047_0169799 | 3300049581 | Bacteria | 2050 |
| 1262 | Ga0501047_0432273 | 3300049581 | Bacteria | 1147 |
| 1263 | Ga0501048_0006531 | 3300049582 | Bacteria | 8865 |
| 1264 | Ga0501048_0055770 | 3300049582 | Bacteria | 2804 |
| 1265 | Ga0501048_0070696 | 3300049582 | Bacteria | 2465 |
| 1266 | Ga0501067_0000487 | 3300049583 | Bacteria | 21691 |
| 1267 | Ga0501067_0063613 | 3300049583 | Bacteria | 2043 |
| 1268 | Ga0501068_0002927 | 3300049584 | Bacteria | 9093 |
| 1269 | Ga0501068_0089214 | 3300049584 | Bacteria | 1900 |
| 1270 | Ga0501068_0147955 | 3300049584 | Bacteria | 1475 |
| 1271 | Ga0501069_0093948 | 3300049585 | Bacteria | 1697 |
| 1272 | Ga0501069_0182377 | 3300049585 | Bacteria | 1214 |
| 1273 | Ga0501070_0013638 | 3300049586 | Bacteria | 6848 |
| 1274 | Ga0501070_0023580 | 3300049586 | Bacteria | 5155 |
| 1275 | Ga0501070_0040808 | 3300049586 | Bacteria | 3869 |
| 1276 | Ga0501070_0089636 | 3300049586 | Bacteria | 2545 |
| 1277 | Ga0501070_0158537 | 3300049586 | Bacteria | 1866 |
| 1278 | Ga0501071_0012458 | 3300049587 | Bacteria | 5768 |
| 1279 | Ga0501071_0315243 | 3300049587 | Bacteria | 1187 |
| 1280 | Ga0501072_0002738 | 3300049588 | Bacteria | 13230 |
| 1281 | Ga0501072_0003379 | 3300049588 | Bacteria | 12001 |
| 1282 | Ga0501073_0002202 | 3300049589 | Bacteria | 14581 |
| 1283 | Ga0501073_0009007 | 3300049589 | Bacteria | 7370 |
| 1284 | Ga0501073_0024957 | 3300049589 | Bacteria | 4289 |
| 1285 | Ga0501073_0040426 | 3300049589 | Bacteria | 3300 |
| 1286 | Ga0501073_0113772 | 3300049589 | Bacteria | 1876 |
| 1287 | Ga0501073_0126501 | 3300049589 | Bacteria | 1771 |
| 1288 | Ga0501073_0201519 | 3300049589 | Bacteria | 1376 |
| 1289 | Ga0501073_0208558 | 3300049589 | Bacteria | 1350 |
| 1290 | Ga0501073_0213170 | 3300049589 | Bacteria | 1334 |
| 1291 | Ga0501074_0009952 | 3300049590 | Bacteria | 6910 |
| 1292 | Ga0501074_0062173 | 3300049590 | Bacteria | 2689 |
| 1293 | Ga0501074_0075397 | 3300049590 | Bacteria | 2421 |
| 1294 | Ga0501074_0100137 | 3300049590 | Bacteria | 2074 |
| 1295 | Ga0501076_0139656 | 3300049592 | Bacteria | 1968 |
| 1296 | Ga0501076_0164058 | 3300049592 | Bacteria | 1811 |
| 1297 | Ga0501077_0055553 | 3300049593 | Bacteria | 2514 |
| 1298 | Ga0501077_0061029 | 3300049593 | Bacteria | 2392 |
| 1299 | Ga0501079_0036076 | 3300049741 | Bacteria | 3808 |
| 1300 | Ga0501080_0000235 | 3300049742 | Bacteria | 41534 |
| 1301 | Ga0501080_0000258 | 3300049742 | Bacteria | 40073 |
| 1302 | Ga0501080_0039927 | 3300049742 | Bacteria | 4379 |
| 1303 | Ga0501080_0058855 | 3300049742 | Bacteria | 3576 |
| 1304 | Ga0501080_0070213 | 3300049742 | Bacteria | 3257 |
| 1305 | Ga0501080_0102107 | 3300049742 | Bacteria | 2660 |
| 1306 | Ga0501080_0154097 | 3300049742 | Bacteria | 2123 |
| 1307 | Ga0501080_0188731 | 3300049742 | Bacteria | 1894 |
| 1308 | Ga0501080_0206916 | 3300049742 | Bacteria | 1799 |
| 1309 | Ga0501081_0199108 | 3300049743 | Bacteria | 1452 |
| 1310 | Ga0501081_0355102 | 3300049743 | Bacteria | 1081 |
| 1311 | Ga0501081_0366669 | 3300049743 | Bacteria | 1063 |
| 1312 | Ga0501083_0000506 | 3300049744 | Bacteria | 24815 |
| 1313 | Ga0501083_0031711 | 3300049744 | Bacteria | 3627 |
| 1314 | Ga0501083_0122636 | 3300049744 | Bacteria | 1704 |
| 1315 | Ga0501083_0123038 | 3300049744 | Bacteria | 1701 |
| 1316 | Ga0501083_0140484 | 3300049744 | Bacteria | 1581 |
| 1317 | Ga0501035_0000034 | 3300049822 | Bacteria | 174589 |
| 1318 | Ga0501035_0061564 | 3300049822 | Bacteria | 3340 |
| 1319 | Ga0501035_0096557 | 3300049822 | Bacteria | 2596 |
| 1320 | Ga0501035_0309002 | 3300049822 | Bacteria | 1330 |
| 1321 | Ga0501044_0000039 | 3300049823 | Bacteria | 158218 |
| 1322 | Ga0501044_0000707 | 3300049823 | Bacteria | 40284 |
| 1323 | Ga0501044_0004032 | 3300049823 | Bacteria | 16468 |
| 1324 | Ga0501044_0011537 | 3300049823 | Bacteria | 9574 |
| 1325 | Ga0501044_0017386 | 3300049823 | Bacteria | 7714 |
| 1326 | Ga0501044_0037357 | 3300049823 | Bacteria | 5076 |
| 1327 | Ga0501044_0046521 | 3300049823 | Bacteria | 4491 |
| 1328 | Ga0501044_0080101 | 3300049823 | Bacteria | 3308 |
| 1329 | Ga0501044_0098295 | 3300049823 | Bacteria | 2947 |
| 1330 | Ga0501044_0138359 | 3300049823 | Bacteria | 2424 |
| 1331 | Ga0501044_0165260 | 3300049823 | Bacteria | 2187 |
| 1332 | Ga0501044_0197562 | 3300049823 | Bacteria | 1970 |
| 1333 | Ga0501044_0377465 | 3300049823 | Bacteria | 1333 |
| 1334 | Ga0501045_0012382 | 3300049824 | Bacteria | 6009 |
| 1335 | Ga0501045_0040900 | 3300049824 | Bacteria | 3372 |
| 1336 | nmdc:mga03683_10353_c1 | 3300050489 | Bacteria | 3343 |
| 1337 | nmdc:mga0yw44_11239_c1 | 3300050492 | Bacteria | 4611 |
| 1338 | nmdc:mga0yw44_59058_c1 | 3300050492 | Bacteria | 2345 |
| 1339 | nmdc:mga0k408_111811_c1 | 3300050493 | Bacteria | 1615 |
| 1340 | nmdc:mga06z11_19545_c1 | 3300050494 | Bacteria | 3117 |
| 1341 | nmdc:mga04h51_33510_c1 | 3300050495 | Bacteria | 1636 |
| 1342 | nmdc:mga07m45_130342_c1 | 3300050496 | Bacteria | 1455 |
| 1343 | nmdc:mga05p37_10364_c1 | 3300050507 | Bacteria | 11064 |
| 1344 | nmdc:mga05p37_153287_c1 | 3300050507 | Bacteria | 2817 |
| 1345 | nmdc:mga05p37_165020_c1 | 3300050507 | Bacteria | 2703 |
| 1346 | nmdc:mga05p37_174250_c1 | 3300050507 | Bacteria | 2622 |
| 1347 | nmdc:mga05p37_201_c1 | 3300050507 | Bacteria | 59705 |
| 1348 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 1349 | nmdc:mga09592_1702_c1 | 3300050508 | Bacteria | 17731 |
| 1350 | nmdc:mga09592_18352_c1 | 3300050508 | Bacteria | 5737 |
| 1351 | nmdc:mga09592_295465_c1 | 3300050508 | Bacteria | 1404 |
| 1352 | nmdc:mga0qj67_100307_c1 | 3300050509 | Bacteria | 2334 |
| 1353 | nmdc:mga0qj67_16874_c1 | 3300050509 | Bacteria | 5546 |
| 1354 | nmdc:mga0qj67_7_c1 | 3300050509 | Bacteria | 146944 |
| 1355 | nmdc:mga06r32_100609_c1 | 3300050510 | Bacteria | 2836 |
| 1356 | nmdc:mga06r32_109586_c1 | 3300050510 | Bacteria | 2715 |
| 1357 | nmdc:mga06r32_176145_c1 | 3300050510 | Bacteria | 2123 |
| 1358 | nmdc:mga06r32_2037_c1 | 3300050510 | Bacteria | 18072 |
| 1359 | nmdc:mga06r32_9994_c1 | 3300050510 | Bacteria | 8562 |
| 1360 | nmdc:mga08y16_12219_c1 | 3300050511 | Bacteria | 9024 |
| 1361 | nmdc:mga08y16_126312_c1 | 3300050511 | Bacteria | 2660 |
| 1362 | nmdc:mga08y16_1809_c1 | 3300050511 | Bacteria | 21689 |
| 1363 | nmdc:mga08y16_36558_c1 | 3300050511 | Bacteria | 5158 |
| 1364 | nmdc:mga08y16_48_c1 | 3300050511 | Bacteria | 111306 |
| 1365 | nmdc:mga08y16_52087_c1 | 3300050511 | Bacteria | 4283 |
| 1366 | nmdc:mga0n895_112554_c1 | 3300050512 | Bacteria | 2739 |
| 1367 | nmdc:mga0n895_20739_c1 | 3300050512 | Bacteria | 6135 |
| 1368 | nmdc:mga0n895_222430_c1 | 3300050512 | Bacteria | 1916 |
| 1369 | nmdc:mga0n895_244249_c1 | 3300050512 | Bacteria | 1822 |
| 1370 | nmdc:mga0n895_29594_c1 | 3300050512 | Bacteria | 5226 |
| 1371 | nmdc:mga0n895_37587_c1 | 3300050512 | Bacteria | 4685 |
| 1372 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 1373 | nmdc:mga0n895_512304_c1 | 3300050512 | Bacteria | 1208 |
| 1374 | nmdc:mga0n895_9627_c1 | 3300050512 | Bacteria | 8466 |
| 1375 | nmdc:mga0rr50_10053_c1 | 3300050513 | Bacteria | 5987 |
| 1376 | nmdc:mga0rr50_113682_c1 | 3300050513 | Bacteria | 2145 |
| 1377 | nmdc:mga0rr50_1204_c1 | 3300050513 | Bacteria | 14048 |
| 1378 | nmdc:mga0rr50_40525_c1 | 3300050513 | Bacteria | 3387 |
| 1379 | nmdc:mga08x19_113498_c1 | 3300050514 | Bacteria | 1809 |
| 1380 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 1381 | nmdc:mga08x19_311750_c1 | 3300050514 | Bacteria | 1094 |
| 1382 | nmdc:mga0a205_2982_c1 | 3300050515 | Bacteria | 15012 |
| 1383 | nmdc:mga0a205_31139_c1 | 3300050515 | Bacteria | 5109 |
| 1384 | nmdc:mga0a205_945_c1 | 3300050515 | Bacteria | 23974 |
| 1385 | nmdc:mga0sz30_57812_c1 | 3300050516 | Bacteria | 1653 |
| 1386 | nmdc:mga0sz30_65082_c1 | 3300050516 | Bacteria | 1563 |
| 1387 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 1388 | Ga0495601_0000107 | 3300053077 | Bacteria | 45730 |
| 1389 | Ga0495601_0001733 | 3300053077 | Bacteria | 12062 |
| 1390 | Ga0495601_0002632 | 3300053077 | Bacteria | 10188 |
| 1391 | Ga0495601_0007967 | 3300053077 | Bacteria | 6237 |
| 1392 | Ga0495601_0014835 | 3300053077 | Bacteria | 4702 |
| 1393 | Ga0495601_0015899 | 3300053077 | Bacteria | 4553 |
| 1394 | Ga0495601_0023623 | 3300053077 | Bacteria | 3778 |
| 1395 | Ga0495601_0053932 | 3300053077 | Bacteria | 2542 |
| 1396 | Ga0495601_0098367 | 3300053077 | Bacteria | 1888 |
| 1397 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 1398 | Ga0495612_0000162 | 3300053078 | Bacteria | 27772 |
| 1399 | Ga0495612_0000390 | 3300053078 | Bacteria | 17581 |
| 1400 | Ga0495612_0005556 | 3300053078 | Bacteria | 5214 |
| 1401 | Ga0495612_0007461 | 3300053078 | Bacteria | 4468 |
| 1402 | Ga0495612_0021992 | 3300053078 | Bacteria | 2557 |
| 1403 | Ga0495612_0044037 | 3300053078 | Bacteria | 1825 |
| 1404 | Ga0495612_0086041 | 3300053078 | Bacteria | 1325 |
| 1405 | Ga0495595_0000020 | 3300053084 | Bacteria | 115983 |
| 1406 | Ga0495595_0001476 | 3300053084 | Bacteria | 9177 |
| 1407 | Ga0495595_0001769 | 3300053084 | Bacteria | 8433 |
| 1408 | Ga0495595_0001841 | 3300053084 | Bacteria | 8239 |
| 1409 | Ga0495595_0009256 | 3300053084 | Bacteria | 4069 |
| 1410 | Ga0495595_0013739 | 3300053084 | Bacteria | 3424 |
| 1411 | Ga0495595_0022243 | 3300053084 | Bacteria | 2781 |
| 1412 | Ga0495595_0026401 | 3300053084 | Bacteria | 2580 |
| 1413 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 1414 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 1415 | Ga0495619_0000337 | 3300053085 | Bacteria | 32903 |
| 1416 | Ga0495619_0001011 | 3300053085 | Bacteria | 18406 |
| 1417 | Ga0495619_0002709 | 3300053085 | Bacteria | 11585 |
| 1418 | Ga0495619_0007573 | 3300053085 | Bacteria | 6874 |
| 1419 | Ga0495619_0016006 | 3300053085 | Bacteria | 4746 |
| 1420 | Ga0495619_0020702 | 3300053085 | Bacteria | 4193 |
| 1421 | Ga0495619_0037365 | 3300053085 | Bacteria | 3163 |
| 1422 | Ga0495619_0046616 | 3300053085 | Bacteria | 2850 |
| 1423 | Ga0495619_0056153 | 3300053085 | Bacteria | 2609 |
| 1424 | Ga0495619_0092469 | 3300053085 | Bacteria | 2049 |
| 1425 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 1426 | Ga0500651_0007654 | 3300053093 | Bacteria | 6317 |
| 1427 | Ga0500556_0000363 | 3300053104 | Bacteria | 33629 |
| 1428 | Ga0500593_001999 | 3300053117 | Bacteria | 7391 |
| 1429 | Ga0500594_0029603 | 3300053118 | Bacteria | 1433 |
| 1430 | Ga0500568_0034718 | 3300053139 | Bacteria | 2062 |
| 1431 | Ga0500577_0106100 | 3300053142 | Bacteria | 1154 |
| 1432 | Ga0500616_0123736 | 3300053153 | Bacteria | 1231 |
| 1433 | Ga0500636_0001441 | 3300053177 | Bacteria | 12935 |
| 1434 | Ga0500587_010152 | 3300053739 | Bacteria | 1196 |
| 1435 | Ga0501084_0163108 | 3300054114 | Bacteria | 1880 |
| 1436 | Ga0501084_0178584 | 3300054114 | Bacteria | 1792 |
| 1437 | Ga0501084_0299765 | 3300054114 | Bacteria | 1357 |
| 1438 | Ga0501082_0004474 | 3300060353 | Bacteria | 12206 |
| 1439 | Ga0501082_0041247 | 3300060353 | Bacteria | 3980 |
| 1440 | Ga0501082_0070038 | 3300060353 | Bacteria | 3020 |
| 1441 | Ga0501082_0152643 | 3300060353 | Bacteria | 2007 |
| 1442 | Ga0501082_0239067 | 3300060353 | Bacteria | 1580 |
| 1443 | Ga0501082_0364743 | 3300060353 | Bacteria | 1260 |
| 1444 | Ga0466962_0132564 | 3300061719 | Bacteria | 1205 |
| 1445 | Ga0530510_0024251 | 3300061734 | Bacteria | 4327 |
| 1446 | 2509080163 | 2508501114 | Bacteria | 7082538 |
| 1447 | 2513591539 | 2513237087 | Bacteria | 5817514 |
| 1448 | 2643964412 | 2643221591 | Bacteria | 4397626 |
| 1449 | 2644168953 | 2643221629 | Bacteria | 5850260 |
| 1450 | 2644347505 | 2643221662 | Bacteria | 5851492 |
| 1451 | 2738743493 | 2738541281 | Bacteria | 5112672 |
| 1452 | 2739352400 | 2738543032 | Bacteria | 5115625 |
| 1453 | 2828308251 | 2828305725 | Bacteria | 4916900 |
| 1454 | 2829747323 | 2829745981 | Bacteria | 5406054 |
| 1455 | 2835316750 | 2835312727 | Bacteria | 7413381 |
| 1456 | 2842696329 | 2842694124 | Bacteria | 4063419 |
| 1457 | 2844320412 | 2844315083 | Bacteria | 8138177 |
| 1458 | 2847937949 | 2847930680 | Bacteria | 9342022 |
| 1459 | 2874632901 | 2874628541 | Bacteria | 8630250 |
| 1460 | 2882456911 | 2882456835 | Bacteria | 6863978 |
| 1461 | 2885430278 | 2885429604 | Bacteria | 3642894 |
| 1462 | 2894236201 | 2894232714 | Bacteria | 8834183 |
| 1463 | 2895886248 | 2895880812 | Bacteria | 11255272 |
| 1464 | 2903732927 | 2903727486 | Bacteria | 8281579 |
| 1465 | 2906607259 | 2906602504 | Bacteria | 8295279 |
| 1466 | 2917555763 | 2917554339 | Bacteria | 4987857 |
| 1467 | 2946789504 | 2946787523 | Bacteria | 4366789 |
| 1468 | 643602018 | 643348564 | Bacteria | 8839022 |
| 1469 | 8001847501 | 8001845381 | Bacteria | 5804942 |
| 1470 | Ga0500568_0008965 | |||
| 1471 | 2214856301 | |||
| 1472 | ARSoilYngRDRAFT_c00230 | |||
| 1473 | ARcpr5yngRDRAFT_c000213 | |||
| 1474 | ARSoilOldRDRAFT_c000050 | |||
| 1475 | ARCol0oldRDRAFT_c00024 | |||
| 1476 | ARCol0yngRDRAFT_1000023 | |||
| 1477 | JGI24032J14994_100494 | |||
| 1478 | JGI24752J21851_1008885 | |||
| 1479 | JGI24746J21847_1001781 | |||
| 1480 | JGI24739J22299_10005003 | |||
| 1481 | JGI24737J22298_10018568 | |||
| 1482 | JGI24743J22301_10018721 | |||
| 1483 | JGI24750J21931_1000102 | |||
| 1484 | JGI24745J21846_1002496 | |||
| 1485 | JGI24738J21930_10014758 | |||
| 1486 | JGI24738J21930_10026883 | |||
| 1487 | JGI24744J21845_10002596 | |||
| 1488 | JGI24035J26624_1000171 | |||
| 1489 | JGI24033J26618_1001421 | |||
| 1490 | JGI24034J26672_10000829 | |||
| 1491 | JGI24742J22300_10001490 | |||
| 1492 | JGI24751J29686_10004114 | |||
| 1493 | JGI25165J46597_1003936 | |||
| 1494 | JGI25404J52841_10032794 | |||
| 1495 | JGI25404J52841_10033486 | |||
| 1496 | JGI25405J52794_10009927 | |||
| 1497 | JGI25405J52794_10023998 | |||
| 1498 | Ga0065716_1002253 | |||
| 1499 | Ga0065712_10003536 | |||
| 1500 | Ga0065712_10011678 | |||
| 1501 | Ga0065715_10000519 | |||
| 1502 | Ga0065715_10030487 | |||
| 1503 | Ga0065707_10114906 | |||
| 1504 | Ga0065707_10118473 | |||
| 1505 | Ga0070658_10003120 | |||
| 1506 | Ga0070658_10018141 | |||
| 1507 | Ga0070658_10049121 | |||
| 1508 | Ga0070658_10143391 | |||
| 1509 | Ga0070676_10002693 | |||
| 1510 | Ga0070676_10038921 | |||
| 1511 | Ga0070683_100027405 | |||
| 1512 | Ga0070683_100095077 | |||
| 1513 | Ga0070690_100008145 | |||
| 1514 | Ga0070690_100010289 | |||
| 1515 | Ga0070690_100111148 | |||
| 1516 | Ga0070670_100008745 | |||
| 1517 | Ga0070670_100015441 | |||
| 1518 | Ga0070670_100041797 | |||
| 1519 | Ga0070670_100252667 | |||
| 1520 | Ga0068869_100178072 | |||
| 1521 | Ga0070666_10006379 | |||
| 1522 | Ga0070680_100010045 | |||
| 1523 | Ga0070680_100015880 | |||
| 1524 | Ga0070680_100122270 | |||
| 1525 | Ga0070680_100192767 | |||
| 1526 | Ga0070680_100354517 | |||
| 1527 | Ga0070682_100014492 | |||
| 1528 | Ga0068868_100001527 | |||
| 1529 | Ga0068868_100037531 | |||
| 1530 | Ga0068868_100142147 | |||
| 1531 | Ga0070660_100020338 | |||
| 1532 | Ga0070660_100047479 | |||
| 1533 | Ga0070689_100000929 | |||
| 1534 | Ga0070689_100030326 | |||
| 1535 | Ga0070689_100071052 | |||
| 1536 | Ga0070689_100124661 | |||
| 1537 | Ga0070689_100153421 | |||
| 1538 | Ga0070661_100000546 | |||
| 1539 | Ga0070661_100012813 | |||
| 1540 | Ga0070661_100027189 | |||
| 1541 | Ga0070661_100037834 | |||
| 1542 | Ga0070661_100352735 | |||
| 1543 | Ga0070692_10108828 | |||
| 1544 | Ga0070668_100164363 | |||
| 1545 | Ga0070669_100001139 | |||
| 1546 | Ga0070669_100335732 | |||
| 1547 | Ga0070675_100001097 | |||
| 1548 | Ga0070675_100043846 | |||
| 1549 | Ga0070675_100085984 | |||
| 1550 | Ga0070675_100228391 | |||
| 1551 | Ga0070671_100000920 | |||
| 1552 | Ga0070671_100002424 | |||
| 1553 | Ga0070671_100020437 | |||
| 1554 | Ga0070671_100267474 | |||
| 1555 | Ga0070674_100007918 | |||
| 1556 | Ga0070674_100012885 | |||
| 1557 | Ga0070674_100033223 | |||
| 1558 | Ga0070674_100036548 | |||
| 1559 | Ga0070674_100161277 | |||
| 1560 | Ga0070673_100053154 | |||
| 1561 | Ga0070673_100056730 | |||
| 1562 | Ga0070688_100009707 | |||
| 1563 | Ga0070688_100023449 | |||
| 1564 | Ga0070688_100183792 | |||
| 1565 | Ga0070659_100068142 | |||
| 1566 | Ga0070667_100014147 | |||
| 1567 | Ga0070667_100043899 | |||
| 1568 | Ga0070667_100150291 | |||
| 1569 | Ga0070667_100527733 | |||
| 1570 | Ga0070703_10010709 | |||
| 1571 | Ga0070709_10005298 | |||
| 1572 | Ga0070709_10016155 | |||
| 1573 | Ga0070709_10019105 | |||
| 1574 | Ga0070714_100009488 | |||
| 1575 | Ga0070714_100018806 | |||
| 1576 | Ga0070713_100001192 | |||
| 1577 | Ga0070713_100001912 | |||
| 1578 | Ga0070713_100013592 | |||
| 1579 | Ga0070713_100014731 | |||
| 1580 | Ga0070713_100116421 | |||
| 1581 | Ga0070710_10003780 | |||
| 1582 | Ga0070710_10007121 | |||
| 1583 | Ga0070701_10000614 | |||
| 1584 | Ga0070711_100006635 | |||
| 1585 | Ga0070711_100066810 | |||
| 1586 | Ga0070711_100093281 | |||
| 1587 | Ga0070711_100121822 | |||
| 1588 | Ga0070711_100291014 | |||
| 1589 | Ga0070705_100078926 | |||
| 1590 | Ga0070700_100013350 | |||
| 1591 | Ga0070708_100018331 | |||
| 1592 | Ga0070708_100190592 | |||
| 1593 | Ga0070663_100009155 | |||
| 1594 | Ga0070663_100050659 | |||
| 1595 | Ga0070663_100260111 | |||
| 1596 | Ga0070678_100009503 | |||
| 1597 | Ga0070678_100011270 | |||
| 1598 | Ga0070678_100086519 | |||
| 1599 | Ga0070678_100262471 | |||
| 1600 | Ga0070678_100283006 | |||
| 1601 | Ga0070678_100285394 | |||
| 1602 | Ga0070662_100329707 | |||
| 1603 | Ga0070681_10013628 | |||
| 1604 | Ga0070681_10082846 | |||
| 1605 | Ga0068867_100006480 | |||
| 1606 | Ga0070685_10016680 | |||
| 1607 | Ga0070699_100002610 | |||
| 1608 | Ga0070699_100474031 | |||
| 1609 | Ga0070679_100022119 | |||
| 1610 | Ga0070679_100045910 | |||
| 1611 | Ga0070679_100218267 | |||
| 1612 | Ga0068853_100000786 | |||
| 1613 | Ga0068853_100032323 | |||
| 1614 | Ga0068853_100046165 | |||
| 1615 | Ga0068853_100068652 | |||
| 1616 | Ga0068853_100129162 | |||
| 1617 | Ga0068853_100140635 | |||
| 1618 | Ga0070672_100015601 | |||
| 1619 | Ga0070672_100037857 | |||
| 1620 | Ga0070672_100178712 | |||
| 1621 | Ga0070686_100014810 | |||
| 1622 | Ga0070686_100019639 | |||
| 1623 | Ga0070695_100129803 | |||
| 1624 | Ga0070696_100019911 | |||
| 1625 | Ga0070696_100020889 | |||
| 1626 | Ga0070696_100042043 | |||
| 1627 | Ga0070696_100279296 | |||
| 1628 | Ga0070693_100029206 | |||
| 1629 | Ga0070693_100279927 | |||
| 1630 | Ga0070665_100074891 | |||
| 1631 | Ga0070665_100126519 | |||
| 1632 | Ga0070665_100321175 | |||
| 1633 | Ga0070665_100388832 | |||
| 1634 | Ga0070704_100335385 | |||
| 1635 | Ga0068855_100032737 | |||
| 1636 | Ga0068855_100119486 | |||
| 1637 | Ga0068855_100139702 | |||
| 1638 | Ga0068855_100243393 | |||
| 1639 | Ga0068855_100250120 | |||
| 1640 | Ga0070664_100020682 | |||
| 1641 | Ga0070664_100039417 | |||
| 1642 | Ga0070664_100042434 | |||
| 1643 | Ga0070664_100068565 | |||
| 1644 | Ga0070664_100079796 | |||
| 1645 | Ga0068857_100001682 | |||
| 1646 | Ga0068857_100066995 | |||
| 1647 | Ga0068857_100171590 | |||
| 1648 | Ga0068857_100221910 | |||
| 1649 | Ga0068854_100004886 | |||
| 1650 | Ga0068854_100111424 | |||
| 1651 | Ga0068856_100022885 | |||
| 1652 | Ga0068856_100038302 | |||
| 1653 | Ga0068856_100042346 | |||
| 1654 | Ga0070702_100002124 | |||
| 1655 | Ga0070702_100132240 | |||
| 1656 | Ga0068852_100001494 | |||
| 1657 | Ga0068852_100018615 | |||
| 1658 | Ga0068852_100022494 | |||
| 1659 | Ga0068852_100033474 | |||
| 1660 | Ga0068852_100533209 | |||
| 1661 | Ga0068859_100067323 | |||
| 1662 | Ga0068859_100119191 | |||
| 1663 | Ga0068864_100053650 | |||
| 1664 | Ga0068864_100059795 | |||
| 1665 | Ga0068864_100210171 | |||
| 1666 | Ga0068866_10001816 | |||
| 1667 | Ga0068851_10003692 | |||
| 1668 | Ga0068870_10000051 | |||
| 1669 | Ga0068863_100023028 | |||
| 1670 | Ga0068858_100005723 | |||
| 1671 | Ga0068858_100035999 | |||
| 1672 | Ga0068858_100064209 | |||
| 1673 | Ga0068858_100267294 | |||
| 1674 | Ga0068860_100053522 | |||
| 1675 | Ga0068860_100421191 | |||
| 1676 | Ga0081455_10000081 | |||
| 1677 | Ga0081455_10001230 | |||
| 1678 | Ga0081455_10007188 | |||
| 1679 | Ga0081455_10027801 | |||
| 1680 | Ga0081455_10051088 | |||
| 1681 | Ga0081455_10131883 | |||
| 1682 | Ga0081538_10098084 | |||
| 1683 | Ga0081540_1000007 | |||
| 1684 | Ga0081540_1002046 | |||
| 1685 | Ga0081540_1006542 | |||
| 1686 | Ga0081540_1031653 | |||
| 1687 | Ga0081540_1111228 | |||
| 1688 | Ga0081539_10012578 | |||
| 1689 | Ga0081539_10076467 | |||
| 1690 | Ga0070717_10000991 | |||
| 1691 | Ga0070717_10053421 | |||
| 1692 | Ga0070717_10155550 | |||
| 1693 | Ga0070717_10169757 | |||
| 1694 | Ga0075365_10009038 | |||
| 1695 | Ga0075365_10237306 | |||
| 1696 | Ga0075368_10019081 | |||
| 1697 | Ga0075368_10063290 | |||
| 1698 | Ga0075364_10074352 | |||
| 1699 | Ga0075364_10106253 | |||
| 1700 | Ga0075432_10006659 | |||
| 1701 | Ga0070715_10005136 | |||
| 1702 | Ga0070715_10020287 | |||
| 1703 | Ga0070716_100000495 | |||
| 1704 | Ga0070716_100004877 | |||
| 1705 | Ga0070716_100052184 | |||
| 1706 | Ga0070712_100000682 | |||
| 1707 | Ga0070712_100034088 | |||
| 1708 | Ga0070712_100101640 | |||
| 1709 | Ga0070712_100129037 | |||
| 1710 | Ga0070712_100310268 | |||
| 1711 | Ga0075362_10007737 | |||
| 1712 | Ga0075362_10039940 | |||
| 1713 | Ga0075367_10044448 | |||
| 1714 | Ga0075367_10071846 | |||
| 1715 | Ga0075367_10095744 | |||
| 1716 | Ga0075367_10134718 | |||
| 1717 | Ga0075369_10066182 | |||
| 1718 | Ga0075369_10142485 | |||
| 1719 | Ga0075427_10000261 | |||
| 1720 | Ga0075366_10009412 | |||
| 1721 | Ga0075366_10068503 | |||
| 1722 | Ga0075366_10243758 | |||
| 1723 | Ga0097621_100002133 | |||
| 1724 | Ga0097621_100002924 | |||
| 1725 | Ga0097621_100004972 | |||
| 1726 | Ga0097621_100438609 | |||
| 1727 | Ga0068871_100029472 | |||
| 1728 | Ga0068871_100111485 | |||
| 1729 | Ga0068871_100171829 | |||
| 1730 | Ga0068871_100199193 | |||
| 1731 | Ga0068871_100362264 | |||
| 1732 | Ga0075428_100005056 | |||
| 1733 | Ga0075428_100012795 | |||
| 1734 | Ga0075428_100092115 | |||
| 1735 | Ga0075428_100122717 | |||
| 1736 | Ga0075428_100486506 | |||
| 1737 | Ga0075430_100000471 | |||
| 1738 | Ga0075430_100001054 | |||
| 1739 | Ga0075430_100006528 | |||
| 1740 | Ga0075430_100107369 | |||
| 1741 | Ga0075430_100123886 | |||
| 1742 | Ga0075431_100001076 | |||
| 1743 | Ga0075431_100029109 | |||
| 1744 | Ga0075433_10003469 | |||
| 1745 | Ga0075433_10035548 | |||
| 1746 | Ga0075434_100004788 | |||
| 1747 | Ga0075434_100028770 | |||
| 1748 | Ga0075429_100000098 | |||
| 1749 | Ga0075429_100002876 | |||
| 1750 | Ga0075429_100418449 | |||
| 1751 | Ga0068865_100137035 | |||
| 1752 | Ga0068865_100216946 | |||
| 1753 | Ga0075436_100001537 | |||
| 1754 | Ga0075436_100004300 | |||
| 1755 | Ga0075436_100012725 | |||
| 1756 | Ga0075436_100111230 | |||
| 1757 | Ga0075436_100140402 | |||
| 1758 | Ga0097620_100067323 | |||
| 1759 | Ga0097620_100119190 | |||
| 1760 | Ga0075435_100015360 | |||
| 1761 | Ga0075435_100028360 | |||
| 1762 | Ga0075435_100105810 | |||
| 1763 | Ga0075435_100153717 | |||
| 1764 | Ga0075435_100262760 | |||
| 1765 | Ga0099794_10045374 | |||
| 1766 | Ga0099794_10051076 | |||
| 1767 | Ga0099795_10019933 | |||
| 1768 | Ga0105244_10021434 | |||
| 1769 | Ga0105250_10016023 | |||
| 1770 | Ga0105240_10161446 | |||
| 1771 | Ga0111539_10001453 | |||
| 1772 | Ga0111539_10001671 | |||
| 1773 | Ga0111539_10085719 | |||
| 1774 | Ga0111539_10139855 | |||
| 1775 | Ga0111539_10433277 | |||
| 1776 | Ga0111539_10439114 | |||
| 1777 | Ga0105245_10002939 | |||
| 1778 | Ga0105245_10050596 | |||
| 1779 | Ga0105245_10151049 | |||
| 1780 | Ga0105247_10002735 | |||
| 1781 | Ga0105247_10015124 | |||
| 1782 | Ga0114129_10000025 | |||
| 1783 | Ga0114129_10009089 | |||
| 1784 | Ga0114129_10034003 | |||
| 1785 | Ga0114129_10058625 | |||
| 1786 | Ga0114129_10065000 | |||
| 1787 | Ga0114129_10300516 | |||
| 1788 | Ga0114129_10483114 | |||
| 1789 | Ga0105243_10006997 | |||
| 1790 | Ga0105243_10023377 | |||
| 1791 | Ga0105243_10025996 | |||
| 1792 | Ga0105243_10036757 | |||
| 1793 | Ga0105243_10106943 | |||
| 1794 | Ga0105241_10010830 | |||
| 1795 | Ga0105241_10011769 | |||
| 1796 | Ga0105241_10094395 | |||
| 1797 | Ga0105241_10148224 | |||
| 1798 | Ga0105242_10009891 | |||
| 1799 | Ga0105248_10010592 | |||
| 1800 | Ga0105248_10142885 | |||
| 1801 | Ga0105248_10158679 | |||
| 1802 | Ga0105237_10000124 | |||
| 1803 | Ga0105237_10023115 | |||
| 1804 | Ga0105237_10031006 | |||
| 1805 | Ga0105237_10032818 | |||
| 1806 | Ga0105237_10034886 | |||
| 1807 | Ga0105237_10099182 | |||
| 1808 | Ga0105238_10003564 | |||
| 1809 | Ga0105238_10114242 | |||
| 1810 | Ga0105238_10228461 | |||
| 1811 | Ga0105249_10001468 | |||
| 1812 | Ga0105249_10018341 | |||
| 1813 | Ga0105239_10002088 | |||
| 1814 | Ga0105239_10039305 | |||
| 1815 | Ga0105239_10104991 | |||
| 1816 | Ga0105239_10107620 | |||
| 1817 | Ga0105246_10000255 | |||
| 1818 | Ga0105246_10033874 | |||
| 1819 | Ga0105246_10043455 | |||
| 1820 | Ga0105246_10128195 | |||
| 1821 | Ga0105246_10250868 | |||
| 1822 | Ga0157341_1000443 | |||
| 1823 | Ga0157373_10007992 | |||
| 1824 | Ga0157371_10017533 | |||
| 1825 | Ga0157371_10019520 | |||
| 1826 | Ga0157370_10036061 | |||
| 1827 | Ga0157369_10156646 | |||
| 1828 | Ga0157374_10028071 | |||
| 1829 | Ga0157374_10030321 | |||
| 1830 | Ga0157374_10045769 | |||
| 1831 | Ga0157374_10052278 | |||
| 1832 | Ga0157374_10057990 | |||
| 1833 | Ga0157374_10156149 | |||
| 1834 | Ga0157374_10501030 | |||
| 1835 | Ga0157378_10029344 | |||
| 1836 | Ga0157378_10235070 | |||
| 1837 | Ga0163162_10119616 | |||
| 1838 | Ga0163162_10180233 | |||
| 1839 | Ga0163162_10195685 | |||
| 1840 | Ga0163162_10203337 | |||
| 1841 | Ga0157372_10027692 | |||
| 1842 | Ga0157372_10251592 | |||
| 1843 | Ga0157375_10032495 | |||
| 1844 | Ga0157375_10200519 | |||
| 1845 | Ga0163163_10094482 | |||
| 1846 | Ga0163163_10140965 | |||
| 1847 | Ga0157380_10001687 | |||
| 1848 | Ga0157377_10039707 | |||
| 1849 | Ga0157379_10002095 | |||
| 1850 | Ga0157379_10025569 | |||
| 1851 | Ga0157379_10197978 | |||
| 1852 | Ga0157376_10114731 | |||
| 1853 | Ga0182006_1089802 | |||
| 1854 | Ga0163161_10027479 | |||
| 1855 | Ga0163161_10028989 | |||
| 1856 | Ga0213876_10079991 | |||
| 1857 | Ga0213875_10000012 | |||
| 1858 | Ga0228598_1000722 | |||
| 1859 | Ga0209563_100053 | |||
| 1860 | Ga0207427_102035 | |||
| 1861 | Ga0209233_1000518 | |||
| 1862 | Ga0209233_1004597 | |||
| 1863 | Ga0207666_1001422 | |||
| 1864 | Ga0207666_1003281 | |||
| 1865 | Ga0207673_1000414 | |||
| 1866 | Ga0207697_10003536 | |||
| 1867 | Ga0207697_10010884 | |||
| 1868 | Ga0207682_10000072 | |||
| 1869 | Ga0207682_10001866 | |||
| 1870 | Ga0207692_10000657 | |||
| 1871 | Ga0207692_10001096 | |||
| 1872 | Ga0207692_10001480 | |||
| 1873 | Ga0207692_10070644 | |||
| 1874 | Ga0207692_10111817 | |||
| 1875 | Ga0207710_10004456 | |||
| 1876 | Ga0207710_10023691 | |||
| 1877 | Ga0207688_10000229 | |||
| 1878 | Ga0207688_10001791 | |||
| 1879 | Ga0207688_10128738 | |||
| 1880 | Ga0207680_10039987 | |||
| 1881 | Ga0207680_10089238 | |||
| 1882 | Ga0207680_10166582 | |||
| 1883 | Ga0207647_10002000 | |||
| 1884 | Ga0207647_10018381 | |||
| 1885 | Ga0207685_10060403 | |||
| 1886 | Ga0207699_10003384 | |||
| 1887 | Ga0207699_10042399 | |||
| 1888 | Ga0207699_10052699 | |||
| 1889 | Ga0207699_10122113 | |||
| 1890 | Ga0207645_10000966 | |||
| 1891 | Ga0207645_10030103 | |||
| 1892 | Ga0207645_10048911 | |||
| 1893 | Ga0207643_10000004 | |||
| 1894 | Ga0207643_10000794 | |||
| 1895 | Ga0207705_10030296 | |||
| 1896 | Ga0207705_10048506 | |||
| 1897 | Ga0207684_10237056 | |||
| 1898 | Ga0207684_10351262 | |||
| 1899 | Ga0207654_10013356 | |||
| 1900 | Ga0207654_10030019 | |||
| 1901 | Ga0207707_10006070 | |||
| 1902 | Ga0207707_10008300 | |||
| 1903 | Ga0207707_10139428 | |||
| 1904 | Ga0207695_10077495 | |||
| 1905 | Ga0207671_10000095 | |||
| 1906 | Ga0207671_10089716 | |||
| 1907 | Ga0207693_10000479 | |||
| 1908 | Ga0207693_10003422 | |||
| 1909 | Ga0207693_10013218 | |||
| 1910 | Ga0207693_10013749 | |||
| 1911 | Ga0207693_10015576 | |||
| 1912 | Ga0207693_10045346 | |||
| 1913 | Ga0207693_10149440 | |||
| 1914 | Ga0207663_10001126 | |||
| 1915 | Ga0207663_10002874 | |||
| 1916 | Ga0207663_10021824 | |||
| 1917 | Ga0207663_10026246 | |||
| 1918 | Ga0207660_10004454 | |||
| 1919 | Ga0207660_10133693 | |||
| 1920 | Ga0207660_10158999 | |||
| 1921 | Ga0207662_10000424 | |||
| 1922 | Ga0207662_10015804 | |||
| 1923 | Ga0207662_10018730 | |||
| 1924 | Ga0207657_10028864 | |||
| 1925 | Ga0207657_10032519 | |||
| 1926 | Ga0207657_10037112 | |||
| 1927 | Ga0207657_10067616 | |||
| 1928 | Ga0207657_10123457 | |||
| 1929 | Ga0207657_10430708 | |||
| 1930 | Ga0207649_10000262 | |||
| 1931 | Ga0207649_10000387 | |||
| 1932 | Ga0207649_10026679 | |||
| 1933 | Ga0207649_10054432 | |||
| 1934 | Ga0207649_10305263 | |||
| 1935 | Ga0207652_10000911 | |||
| 1936 | Ga0207652_10033711 | |||
| 1937 | Ga0207652_10083249 | |||
| 1938 | Ga0207681_10007892 | |||
| 1939 | Ga0207681_10051064 | |||
| 1940 | Ga0207681_10308356 | |||
| 1941 | Ga0207694_10034503 | |||
| 1942 | Ga0207694_10135909 | |||
| 1943 | Ga0207694_10289259 | |||
| 1944 | Ga0207650_10080871 | |||
| 1945 | Ga0207650_10215995 | |||
| 1946 | Ga0207659_10001285 | |||
| 1947 | Ga0207659_10086963 | |||
| 1948 | Ga0207700_10000756 | |||
| 1949 | Ga0207700_10047638 | |||
| 1950 | Ga0207700_10161975 | |||
| 1951 | Ga0207664_10018712 | |||
| 1952 | Ga0207664_10024032 | |||
| 1953 | Ga0207664_10041374 | |||
| 1954 | Ga0207664_10157513 | |||
| 1955 | Ga0207664_10266612 | |||
| 1956 | Ga0207644_10004727 | |||
| 1957 | Ga0207644_10010463 | |||
| 1958 | Ga0207644_10017581 | |||
| 1959 | Ga0207644_10219335 | |||
| 1960 | Ga0207690_10001058 | |||
| 1961 | Ga0207690_10209242 | |||
| 1962 | Ga0207690_10368991 | |||
| 1963 | Ga0207706_10016549 | |||
| 1964 | Ga0207706_10019395 | |||
| 1965 | Ga0207706_10149174 | |||
| 1966 | Ga0207706_10160149 | |||
| 1967 | Ga0207686_10005614 | |||
| 1968 | Ga0207686_10083487 | |||
| 1969 | Ga0207686_10200924 | |||
| 1970 | Ga0207709_10009302 | |||
| 1971 | Ga0207709_10046931 | |||
| 1972 | Ga0207709_10085951 | |||
| 1973 | Ga0207709_10238545 | |||
| 1974 | Ga0207709_10249771 | |||
| 1975 | Ga0207670_10000377 | |||
| 1976 | Ga0207670_10152596 | |||
| 1977 | Ga0207670_10286130 | |||
| 1978 | Ga0207669_10014544 | |||
| 1979 | Ga0207669_10019738 | |||
| 1980 | Ga0207669_10023224 | |||
| 1981 | Ga0207669_10038166 | |||
| 1982 | Ga0207669_10204460 | |||
| 1983 | Ga0207669_10243134 | |||
| 1984 | Ga0207704_10034831 | |||
| 1985 | Ga0207704_10216020 | |||
| 1986 | Ga0207665_10000090 | |||
| 1987 | Ga0207665_10008284 | |||
| 1988 | Ga0207665_10035375 | |||
| 1989 | Ga0207691_10019480 | |||
| 1990 | Ga0207691_10065953 | |||
| 1991 | Ga0207691_10159651 | |||
| 1992 | Ga0207691_10276629 | |||
| 1993 | Ga0207711_10006200 | |||
| 1994 | Ga0207711_10036162 | |||
| 1995 | Ga0207711_10055424 | |||
| 1996 | Ga0207711_10068364 | |||
| 1997 | Ga0207711_10078616 | |||
| 1998 | Ga0207711_10176676 | |||
| 1999 | Ga0207711_10258744 | |||
| 2000 | Ga0207711_10289303 | |||
| 2001 | Ga0207689_10000203 | |||
| 2002 | Ga0207661_10064904 | |||
| 2003 | Ga0207661_10350300 | |||
| 2004 | Ga0207679_10000157 | |||
| 2005 | Ga0207679_10107069 | |||
| 2006 | Ga0207679_10110065 | |||
| 2007 | Ga0207679_10194335 | |||
| 2008 | Ga0207667_10050095 | |||
| 2009 | Ga0207667_10142004 | |||
| 2010 | Ga0207667_10379299 | |||
| 2011 | Ga0207651_10000367 | |||
| 2012 | Ga0207651_10037255 | |||
| 2013 | Ga0207651_10063867 | |||
| 2014 | Ga0207712_10001257 | |||
| 2015 | Ga0207712_10220770 | |||
| 2016 | Ga0207668_10001328 | |||
| 2017 | Ga0207668_10259617 | |||
| 2018 | Ga0207640_10006238 | |||
| 2019 | Ga0207677_10083507 | |||
| 2020 | Ga0207703_10004093 | |||
| 2021 | Ga0207703_10141450 | |||
| 2022 | Ga0207703_10414214 | |||
| 2023 | Ga0207639_10002502 | |||
| 2024 | Ga0207639_10037756 | |||
| 2025 | Ga0207639_10062374 | |||
| 2026 | Ga0207639_10137912 | |||
| 2027 | Ga0207639_10177482 | |||
| 2028 | Ga0207639_10205562 | |||
| 2029 | Ga0207639_10352911 | |||
| 2030 | Ga0207678_10007692 | |||
| 2031 | Ga0207678_10036309 | |||
| 2032 | Ga0207678_10077922 | |||
| 2033 | Ga0207678_10188404 | |||
| 2034 | Ga0207708_10003972 | |||
| 2035 | Ga0207708_10064633 | |||
| 2036 | Ga0207708_10114356 | |||
| 2037 | Ga0207708_10199947 | |||
| 2038 | Ga0207702_10002426 | |||
| 2039 | Ga0207702_10124589 | |||
| 2040 | Ga0207702_10168478 | |||
| 2041 | Ga0207702_10242123 | |||
| 2042 | Ga0207641_10002393 | |||
| 2043 | Ga0207641_10065921 | |||
| 2044 | Ga0207641_10107700 | |||
| 2045 | Ga0207648_10026738 | |||
| 2046 | Ga0207648_10063466 | |||
| 2047 | Ga0207648_10077418 | |||
| 2048 | Ga0207648_10131782 | |||
| 2049 | Ga0207676_10061890 | |||
| 2050 | Ga0207676_10121159 | |||
| 2051 | Ga0207676_10291779 | |||
| 2052 | Ga0207676_10587510 | |||
| 2053 | Ga0207674_10000897 | |||
| 2054 | Ga0207674_10022165 | |||
| 2055 | Ga0207674_10033624 | |||
| 2056 | Ga0207674_10349858 | |||
| 2057 | Ga0207675_100021987 | |||
| 2058 | Ga0207675_100024455 | |||
| 2059 | Ga0207675_100187711 | |||
| 2060 | Ga0207683_10021225 | |||
| 2061 | Ga0207683_10023438 | |||
| 2062 | Ga0207683_10331391 | |||
| 2063 | Ga0207698_10013348 | |||
| 2064 | Ga0207698_10046335 | |||
| 2065 | Ga0207698_10136215 | |||
| 2066 | Ga0207698_10165634 | |||
| 2067 | Ga0207698_10246351 | |||
| 2068 | Ga0207698_10315591 | |||
| 2069 | Ga0209179_1005853 | |||
| 2070 | Ga0209999_1015342 | |||
| 2071 | Ga0210002_1002531 | |||
| 2072 | Ga0209966_1001586 | |||
| 2073 | Ga0209813_10008597 | |||
| 2074 | Ga0209974_10009518 | |||
| 2075 | Ga0209974_10015422 | |||
| 2076 | Ga0207428_10000137 | |||
| 2077 | Ga0207428_10000165 | |||
| 2078 | Ga0207428_10000792 | |||
| 2079 | Ga0207428_10001840 | |||
| 2080 | Ga0268266_10000701 | |||
| 2081 | Ga0268266_10018077 | |||
| 2082 | Ga0268266_10074886 | |||
| 2083 | Ga0268266_10111849 | |||
| 2084 | Ga0268266_10404893 | |||
| 2085 | Ga0268264_10001616 | |||
| 2086 | Ga0268264_10333413 | |||
| 2087 | Ga0268264_10391525 | |||
| 2088 | Ga0268264_10432812 | |||
| 2089 | Ga0265337_1001808 | |||
| 2090 | Ga0265337_1015838 | |||
| 2091 | Ga0265334_10001871 | |||
| 2092 | Ga0265318_10030244 | |||
| 2093 | Ga0265338_10048099 | |||
| 2094 | Ga0265338_10050328 | |||
| 2095 | Ga0265338_10258096 | |||
| 2096 | Ga0265324_10052363 | |||
| 2097 | Ga0265762_1016083 | |||
| 2098 | Ga0265330_10080491 | |||
| 2099 | Ga0265328_10000251 | |||
| 2100 | Ga0265325_10000264 | |||
| 2101 | Ga0265325_10002189 | |||
| 2102 | Ga0265325_10003407 | |||
| 2103 | Ga0265325_10013167 | |||
| 2104 | Ga0265325_10031025 | |||
| 2105 | Ga0265325_10099356 | |||
| 2106 | Ga0265329_10071433 | |||
| 2107 | Ga0265340_10001658 | |||
| 2108 | Ga0265340_10013138 | |||
| 2109 | Ga0265340_10024919 | |||
| 2110 | Ga0265340_10046584 | |||
| 2111 | Ga0265340_10062161 | |||
| 2112 | Ga0265339_10000129 | |||
| 2113 | Ga0265339_10000546 | |||
| 2114 | Ga0265339_10003092 | |||
| 2115 | Ga0265339_10009444 | |||
| 2116 | Ga0265339_10024114 | |||
| 2117 | Ga0265339_10033242 | |||
| 2118 | Ga0265339_10062234 | |||
| 2119 | Ga0265339_10069442 | |||
| 2120 | Ga0265339_10119363 | |||
| 2121 | Ga0265331_10000057 | |||
| 2122 | Ga0265331_10012098 | |||
| 2123 | Ga0265331_10022398 | |||
| 2124 | Ga0265316_10001732 | |||
| 2125 | Ga0265316_10067798 | |||
| 2126 | Ga0265316_10099846 | |||
| 2127 | Ga0265316_10115764 | |||
| 2128 | Ga0265316_10154383 | |||
| 2129 | Ga0265313_10000254 | |||
| 2130 | Ga0265313_10000326 | |||
| 2131 | Ga0265313_10000435 | |||
| 2132 | Ga0265313_10001378 | |||
| 2133 | Ga0265313_10005110 | |||
| 2134 | Ga0265313_10011924 | |||
| 2135 | Ga0265313_10023363 | |||
| 2136 | Ga0265313_10025412 | |||
| 2137 | Ga0265313_10029797 | |||
| 2138 | Ga0316575_10012791 | |||
| 2139 | Ga0316579_10136834 | |||
| 2140 | Ga0265314_10001726 | |||
| 2141 | Ga0265314_10009303 | |||
| 2142 | Ga0265314_10029538 | |||
| 2143 | Ga0265314_10112271 | |||
| 2144 | Ga0265314_10170789 | |||
| 2145 | Ga0265342_10000981 | |||
| 2146 | Ga0265342_10002428 | |||
| 2147 | Ga0265342_10019207 | |||
| 2148 | Ga0265342_10074175 | |||
| 2149 | Ga0265342_10175430 | |||
| 2150 | Ga0316576_10035289 | |||
| 2151 | Ga0316576_10060923 | |||
| 2152 | Ga0316576_10147260 | |||
| 2153 | Ga0316576_10191861 | |||
| 2154 | Ga0316578_10095042 | |||
| 2155 | Ga0316578_10110523 | |||
| 2156 | Ga0316583_10032793 | |||
| 2157 | Ga0373930_0000452 | |||
| 2158 | Ga0373930_0002751 | |||
| 2159 | Ga0373948_0006416 | |||
| 2160 | Ga0373950_0009376 | |||
| 2161 | Ga0373950_0009919 | |||
| 2162 | Ga0373958_0000092 | |||
| 2163 | Ga0373958_0004580 | |||
| 2164 | Ga0373958_0006129 | |||
| 2165 | Ga0373959_0001720 | |||
| 2166 | Ga0373959_0040703 | |||
| 2167 | Ga0373938_0000636 | |||
| 2168 | Ga0373938_0028309 | |||
| 2169 | Ga0373926_0002855 | |||
| 2170 | Ga0373928_0000449 | |||
| 2171 | Ga0373928_0006492 | |||
| 2172 | Ga0373929_0000206 | |||
| 2173 | Ga0373929_0011326 | |||
| 2174 | Ga0373934_0079393 | |||
| 2175 | Ga0373940_0000275 | |||
| 2176 | Ga0373944_0064575 | |||
| 2177 | Ga0373944_0073042 | |||
| 2178 | Ga0373949_0001134 | |||
| 2179 | Ga0373949_0016538 | |||
| 2180 | Ga0373951_0001767 | |||
| 2181 | Ga0373951_0004572 | |||
| 2182 | Ga0373952_0000038 | |||
| 2183 | Ga0373952_0003171 | |||
| 2184 | Ga0373923_0005915 | |||
| 2185 | Ga0373923_0087237 | |||
| 2186 | Ga0373923_0088670 | |||
| 2187 | Ga0373923_0095440 | |||
| 2188 | Ga0373923_0102375 | |||
| 2189 | Ga0373932_0000572 | |||
| 2190 | Ga0373932_0006403 | |||
| 2191 | Ga0373932_0061926 | |||
| 2192 | Ga0373936_0002351 | |||
| 2193 | Ga0373936_0006584 | |||
| 2194 | Ga0373936_0061540 | |||
| 2195 | Ga0373939_0000257 | |||
| 2196 | Ga0373939_0001338 | |||
| 2197 | Ga0373941_0001019 | |||
| 2198 | Ga0373945_0004740 | |||
| 2199 | Ga0373953_0019090 | |||
| 2200 | Ga0373953_0119171 | |||
| 2201 | Ga0373954_0003212 | |||
| 2202 | Ga0373954_0009592 | |||
| 2203 | Ga0373954_0013665 | |||
| 2204 | Ga0373954_0034538 | |||
| 2205 | Ga0373956_0022878 | |||
| 2206 | Ga0373957_0001356 | |||
| 2207 | Ga0373957_0047898 | |||
| 2208 | Ga0373960_0007980 | |||
| 2209 | Ga0373943_0000022 | |||
| 2210 | Ga0373943_0013955 | |||
| 2211 | Ga0373943_0040109 | |||
| 2212 | Ga0373943_0062294 | |||
| 2213 | Ga0373946_0001714 | |||
| 2214 | Ga0373946_0003547 | |||
| 2215 | Ga0373946_0107071 | |||
| 2216 | Ga0373946_0133443 | |||
| 2217 | Ga0373955_0000952 | |||
| 2218 | Ga0373955_0002078 | |||
| 2219 | Ga0373955_0004881 | |||
| 2220 | Ga0373955_0005612 | |||
| 2221 | Ga0373955_0015292 | |||
| 2222 | Ga0373955_0019882 | |||
| 2223 | Ga0373942_0000089 | |||
| 2224 | Ga0373942_0006193 | |||
| 2225 | Ga0373961_0000846 | |||
| 2226 | Ga0373961_0002484 | |||
| 2227 | Ga0373961_0009318 | |||
| 2228 | Ga0373962_0005746 | |||
| 2229 | Ga0373962_0060160 | |||
| 2230 | Ga0316574_0000238 | |||
| 2231 | Ga0316574_0199113 | |||
| 2232 | Ga0373924_0000337 | |||
| 2233 | Ga0373924_0008273 | |||
| 2234 | Ga0373924_0089905 | |||
| 2235 | Ga0373924_0138931 | |||
| 2236 | Ga0373931_0002088 | |||
| 2237 | Ga0373931_0002736 | |||
| 2238 | Ga0373931_0019758 | |||
| 2239 | Ga0373935_0000151 | |||
| 2240 | Ga0373935_0006737 | |||
| 2241 | Ga0373935_0031968 | |||
| 2242 | Ga0373935_0069147 | |||
| 2243 | Ga0373927_0003569 | |||
| 2244 | Ga0373927_0004805 | |||
| 2245 | Ga0373927_0006375 | |||
| 2246 | Ga0373927_0014549 | |||
| 2247 | Ga0373927_0022521 | |||
| 2248 | Ga0373927_0030912 | |||
| 2249 | Ga0373927_0069345 | |||
| 2250 | Ga0373927_0072818 | |||
| 2251 | Ga0373927_0076206 | |||
| 2252 | Ga0373927_0092860 | |||
| 2253 | Ga0373927_0093600 | |||
| 2254 | Ga0373927_0259062 | |||
| 2255 | Ga0373933_0000038 | |||
| 2256 | Ga0373933_0001536 | |||
| 2257 | Ga0373933_0003575 | |||
| 2258 | Ga0373933_0016229 | |||
| 2259 | Ga0373933_0045925 | |||
| 2260 | Ga0373933_0145035 | |||
| 2261 | Ga0373947_0000424 | |||
| 2262 | Ga0373947_0001986 | |||
| 2263 | Ga0373947_0006522 | |||
| 2264 | Ga0373947_0012693 | |||
| 2265 | Ga0373947_0027002 | |||
| 2266 | Ga0373947_0029621 | |||
| 2267 | Ga0373947_0043248 | |||
| 2268 | Ga0373947_0048098 | |||
| 2269 | Ga0373937_0000004 | |||
| 2270 | Ga0373937_0000564 | |||
| 2271 | Ga0373937_0002216 | |||
| 2272 | Ga0373937_0002513 | |||
| 2273 | Ga0373937_0008198 | |||
| 2274 | Ga0373937_0014261 | |||
| 2275 | Ga0373937_0018346 | |||
| 2276 | Ga0373937_0047021 | |||
| 2277 | Ga0373937_0074468 | |||
| 2278 | Ga0373937_0136754 | |||
| 2279 | Ga0373937_0164152 | |||
| 2280 | Ga0316584_0241922 | |||
| 2281 | Ga0373925_0000095 | |||
| 2282 | Ga0373925_0001200 | |||
| 2283 | Ga0373925_0009185 | |||
| 2284 | Ga0373925_0019344 | |||
| 2285 | Ga0373925_0050867 | |||
| 2286 | Ga0373925_0104482 | |||
| 2287 | Ga0373925_0292319 | |||
| 2288 | Ga0373925_0335729 | |||
| 2289 | Ga0395899_0160346 | |||
| 2290 | Ga0395900_0004874 | |||
| 2291 | Ga0395900_0043925 | |||
| 2292 | Ga0395898_0010366 | |||
| 2293 | Ga0395898_0014711 | |||
| 2294 | Ga0395898_0041967 | |||
| 2295 | Ga0395898_0424123 | |||
| 2296 | Ga0436364_0511355 | |||
| 2297 | Ga0436364_0524693 | |||
| 2298 | Ga0395901_0062428 | |||
| 2299 | Ga0395901_0318225 | |||
| 2300 | Ga0436365_0217688 | |||
| 2301 | Ga0436365_0507358 | |||
| 2302 | Ga0436365_0608033 | |||
| 2303 | Ga0436365_0652419 | |||
| 2304 | Ga0436365_1192445 | |||
| 2305 | Ga0436365_1726749 | |||
| 2306 | Ga0436365_1747000 | |||
| 2307 | Ga0436360_1236069 | |||
| 2308 | Ga0436361_0149914 | |||
| 2309 | Ga0436361_1051179 | |||
| 2310 | Ga0436363_0208725 | |||
| 2311 | Ga0436363_0852738 | |||
| 2312 | Ga0436363_1266619 | |||
| 2313 | Ga0436362_0363294 | |||
| 2314 | Ga0436362_0803318 | |||
| 2315 | Ga0439443_000552 | |||
| 2316 | Ga0439459_0018369 | |||
| 2317 | Ga0439460_0030397 | |||
| 2318 | Ga0451577_0220582 | |||
| 2319 | Ga0466969_0008527 | |||
| 2320 | Ga0466966_0069919 | |||
| 2321 | Ga0466966_0134077 | |||
| 2322 | Ga0466961_0000090 | |||
| 2323 | Ga0466961_0092027 | |||
| 2324 | Ga0453684_0005340 | |||
| 2325 | Ga0466971_0052858 | |||
| 2326 | Ga0466959_0003543 | |||
| 2327 | Ga0466959_0051536 | |||
| 2328 | Ga0466959_0091516 | |||
| 2329 | Ga0451576_0016545 | |||
| 2330 | Ga0466958_0255103 | |||
| 2331 | Ga0466967_0014846 | |||
| 2332 | Ga0466967_0104527 | |||
| 2333 | Ga0495592_0000029 | |||
| 2334 | Ga0495592_0025647 | |||
| 2335 | Ga0495592_0029044 | |||
| 2336 | Ga0495592_0041594 | |||
| 2337 | Ga0495592_0276136 | |||
| 2338 | Ga0495603_0037515 | |||
| 2339 | Ga0495629_0000447 | |||
| 2340 | Ga0495629_0023396 | |||
| 2341 | Ga0495629_0065540 | |||
| 2342 | Ga0495638_0011418 | |||
| 2343 | Ga0495641_0023515 | |||
| 2344 | Ga0495641_0038974 | |||
| 2345 | Ga0495651_0002508 | |||
| 2346 | Ga0495651_0020710 | |||
| 2347 | Ga0495651_0027167 | |||
| 2348 | Ga0495651_0030858 | |||
| 2349 | Ga0495653_0000045 | |||
| 2350 | Ga0495653_0005387 | |||
| 2351 | Ga0495653_0013922 | |||
| 2352 | Ga0495653_0038393 | |||
| 2353 | Ga0495653_0116030 | |||
| 2354 | Ga0495580_0019007 | |||
| 2355 | Ga0495582_0008399 | |||
| 2356 | Ga0495582_0048745 | |||
| 2357 | Ga0495582_0056310 | |||
| 2358 | Ga0495582_0101943 | |||
| 2359 | Ga0495582_0104592 | |||
| 2360 | Ga0495639_0041184 | |||
| 2361 | Ga0495662_0000956 | |||
| 2362 | Ga0495662_0006352 | |||
| 2363 | Ga0495662_0016654 | |||
| 2364 | Ga0495662_0037874 | |||
| 2365 | Ga0495662_0059478 | |||
| 2366 | Ga0495662_0120508 | |||
| 2367 | Ga0495664_0000004 | |||
| 2368 | Ga0495664_0003742 | |||
| 2369 | Ga0495664_0053735 | |||
| 2370 | Ga0495664_0062489 | |||
| 2371 | Ga0495664_0137514 | |||
| 2372 | Ga0495584_0005410 | |||
| 2373 | Ga0495594_0018229 | |||
| 2374 | Ga0495594_0021714 | |||
| 2375 | Ga0495594_0024640 | |||
| 2376 | Ga0495607_0036689 | |||
| 2377 | Ga0495608_0000017 | |||
| 2378 | Ga0495608_0003528 | |||
| 2379 | Ga0495608_0015432 | |||
| 2380 | Ga0495608_0036638 | |||
| 2381 | Ga0495618_0000006 | |||
| 2382 | Ga0495618_0009367 | |||
| 2383 | Ga0495618_0010524 | |||
| 2384 | Ga0495618_0011587 | |||
| 2385 | Ga0495618_0012818 | |||
| 2386 | Ga0495618_0019212 | |||
| 2387 | Ga0495618_0024630 | |||
| 2388 | Ga0495618_0084130 | |||
| 2389 | Ga0495628_0000001 | |||
| 2390 | Ga0495628_0000319 | |||
| 2391 | Ga0495628_0006361 | |||
| 2392 | Ga0495628_0006602 | |||
| 2393 | Ga0495630_0000947 | |||
| 2394 | Ga0495630_0065869 | |||
| 2395 | Ga0495630_0072015 | |||
| 2396 | Ga0495637_0041673 | |||
| 2397 | Ga0495644_0000748 | |||
| 2398 | Ga0495666_0013922 | |||
| 2399 | Ga0495666_0025854 | |||
| 2400 | Ga0495652_0000002 | |||
| 2401 | Ga0495652_0007288 | |||
| 2402 | Ga0495652_0245602 | |||
| 2403 | Ga0495665_0064664 | |||
| 2404 | Ga0495640_0000001 | |||
| 2405 | Ga0495640_0002125 | |||
| 2406 | Ga0495640_0005236 | |||
| 2407 | Ga0495640_0007483 | |||
| 2408 | Ga0495640_0023689 | |||
| 2409 | Ga0495640_0024699 | |||
| 2410 | Ga0495640_0054557 | |||
| 2411 | Ga0495640_0075722 | |||
| 2412 | Ga0495640_0203380 | |||
| 2413 | Ga0495586_0132817 | |||
| 2414 | Ga0495587_0000008 | |||
| 2415 | Ga0495587_0001323 | |||
| 2416 | Ga0495587_0055786 | |||
| 2417 | Ga0495598_0026269 | |||
| 2418 | Ga0495621_0024040 | |||
| 2419 | Ga0495645_0000002 | |||
| 2420 | Ga0495645_0002662 | |||
| 2421 | Ga0495645_0003160 | |||
| 2422 | Ga0495645_0007704 | |||
| 2423 | Ga0495645_0051861 | |||
| 2424 | Ga0495645_0057125 | |||
| 2425 | Ga0495622_0012435 | |||
| 2426 | Ga0495633_0007380 | |||
| 2427 | Ga0495667_0000029 | |||
| 2428 | Ga0495667_0000679 | |||
| 2429 | Ga0495667_0004191 | |||
| 2430 | Ga0495667_0004817 | |||
| 2431 | Ga0495667_0117471 | |||
| 2432 | Ga0495656_0034485 | |||
| 2433 | Ga0495634_0000082 | |||
| 2434 | Ga0495634_0004557 | |||
| 2435 | Ga0495634_0005436 | |||
| 2436 | Ga0495634_0006661 | |||
| 2437 | Ga0495634_0024131 | |||
| 2438 | Ga0495634_0057804 | |||
| 2439 | Ga0495611_0003367 | |||
| 2440 | Ga0495625_0222550 | |||
| 2441 | Ga0495635_0000002 | |||
| 2442 | Ga0495635_0002274 | |||
| 2443 | Ga0495635_0008183 | |||
| 2444 | Ga0495635_0021903 | |||
| 2445 | Ga0495635_0024554 | |||
| 2446 | Ga0495588_0006148 | |||
| 2447 | Ga0495588_0041797 | |||
| 2448 | Ga0495657_0001356 | |||
| 2449 | Ga0495657_0002915 | |||
| 2450 | Ga0495657_0040604 | |||
| 2451 | Ga0495657_0043599 | |||
| 2452 | Ga0495657_0131890 | |||
| 2453 | Ga0495657_0278516 | |||
| 2454 | Ga0495599_0000104 | |||
| 2455 | Ga0495599_0004501 | |||
| 2456 | Ga0495599_0023990 | |||
| 2457 | Ga0495599_0026313 | |||
| 2458 | Ga0495599_0135219 | |||
| 2459 | Ga0495623_0000108 | |||
| 2460 | Ga0495623_0001764 | |||
| 2461 | Ga0495623_0012776 | |||
| 2462 | Ga0495646_0000064 | |||
| 2463 | Ga0495646_0000684 | |||
| 2464 | Ga0495646_0044732 | |||
| 2465 | Ga0495647_0011289 | |||
| 2466 | Ga0495647_0039378 | |||
| 2467 | Ga0495647_0074153 | |||
| 2468 | Ga0495658_0009740 | |||
| 2469 | Ga0495658_0033330 | |||
| 2470 | Ga0495658_0040037 | |||
| 2471 | Ga0495658_0058937 | |||
| 2472 | Ga0495658_0103417 | |||
| 2473 | Ga0495613_0022722 | |||
| 2474 | Ga0495613_0083586 | |||
| 2475 | Ga0495613_0135259 | |||
| 2476 | Ga0495613_0144500 | |||
| 2477 | Ga0495624_0011797 | |||
| 2478 | Ga0495624_0014518 | |||
| 2479 | Ga0495624_0021150 | |||
| 2480 | Ga0495624_0056771 | |||
| 2481 | Ga0495670_0001290 | |||
| 2482 | Ga0495649_0069504 | |||
| 2483 | Ga0495600_0000010 | |||
| 2484 | Ga0495600_0004224 | |||
| 2485 | Ga0495600_0004928 | |||
| 2486 | Ga0495600_0010276 | |||
| 2487 | Ga0495600_0020923 | |||
| 2488 | Ga0495600_0035198 | |||
| 2489 | Ga0495600_0141550 | |||
| 2490 | Ga0495581_0009308 | |||
| 2491 | Ga0495581_0016650 | |||
| 2492 | Ga0495581_0021358 | |||
| 2493 | Ga0495581_0028834 | |||
| 2494 | Ga0495581_0252274 | |||
| 2495 | Ga0495604_0000009 | |||
| 2496 | Ga0495604_0001938 | |||
| 2497 | Ga0495604_0013941 | |||
| 2498 | Ga0495636_0068340 | |||
| 2499 | Ga0495674_0000002 | |||
| 2500 | Ga0495674_0015017 | |||
| 2501 | Ga0495674_0036170 | |||
| 2502 | Ga0495674_0038342 | |||
| 2503 | Ga0495674_0069623 | |||
| 2504 | Ga0495674_0077360 | |||
| 2505 | Ga0495674_0189364 | |||
| 2506 | Ga0495676_0116065 | |||
| 2507 | Ga0495676_0123829 | |||
| 2508 | Ga0495680_0000268 | |||
| 2509 | Ga0495680_0002870 | |||
| 2510 | Ga0495680_0006079 | |||
| 2511 | Ga0495680_0012467 | |||
| 2512 | Ga0495680_0014725 | |||
| 2513 | Ga0495680_0048923 | |||
| 2514 | Ga0495683_0095531 | |||
| 2515 | Ga0495675_0000517 | |||
| 2516 | Ga0495675_0005619 | |||
| 2517 | Ga0495675_0044909 | |||
| 2518 | Ga0495684_0000006 | |||
| 2519 | Ga0495684_0005515 | |||
| 2520 | Ga0495684_0065720 | |||
| 2521 | Ga0495684_0074498 | |||
| 2522 | Ga0495684_0074555 | |||
| 2523 | Ga0495684_0128119 | |||
| 2524 | Ga0495684_0181039 | |||
| 2525 | Ga0495686_0183825 | |||
| 2526 | Ga0495593_0003103 | |||
| 2527 | Ga0495593_0007133 | |||
| 2528 | Ga0495593_0010906 | |||
| 2529 | Ga0495593_0021655 | |||
| 2530 | Ga0495593_0029987 | |||
| 2531 | Ga0495593_0107726 | |||
| 2532 | Ga0495602_0000005 | |||
| 2533 | Ga0495602_0000776 | |||
| 2534 | Ga0495602_0006877 | |||
| 2535 | Ga0495602_0017885 | |||
| 2536 | Ga0495602_0148118 | |||
| 2537 | Ga0495602_0347499 | |||
| 2538 | Ga0495614_0028122 | |||
| 2539 | Ga0495614_0064522 | |||
| 2540 | Ga0496100_0002767 | |||
| 2541 | Ga0496100_0034574 | |||
| 2542 | Ga0496100_0242383 | |||
| 2543 | Ga0496101_0002749 | |||
| 2544 | Ga0496101_0013492 | |||
| 2545 | Ga0496101_0021512 | |||
| 2546 | Ga0496101_0149227 | |||
| 2547 | Ga0496102_0002243 | |||
| 2548 | Ga0496102_0013701 | |||
| 2549 | Ga0496102_0015327 | |||
| 2550 | Ga0496102_0019523 | |||
| 2551 | Ga0496102_0035373 | |||
| 2552 | Ga0496102_0081945 | |||
| 2553 | Ga0496102_0161475 | |||
| 2554 | Ga0496103_0013454 | |||
| 2555 | Ga0496103_0040138 | |||
| 2556 | Ga0496103_0147693 | |||
| 2557 | Ga0496104_0000092 | |||
| 2558 | Ga0496104_0005552 | |||
| 2559 | Ga0496104_0027488 | |||
| 2560 | Ga0496104_0047588 | |||
| 2561 | Ga0496104_0064066 | |||
| 2562 | Ga0496104_0072480 | |||
| 2563 | Ga0496104_0107940 | |||
| 2564 | Ga0496104_0108902 | |||
| 2565 | Ga0496104_0144894 | |||
| 2566 | Ga0496105_0002503 | |||
| 2567 | Ga0496105_0003752 | |||
| 2568 | Ga0496105_0006025 | |||
| 2569 | Ga0496105_0063458 | |||
| 2570 | Ga0496105_0166837 | |||
| 2571 | Ga0496105_0287695 | |||
| 2572 | Ga0496106_0002308 | |||
| 2573 | Ga0496106_0005008 | |||
| 2574 | Ga0496106_0008873 | |||
| 2575 | Ga0496106_0016730 | |||
| 2576 | Ga0496106_0028383 | |||
| 2577 | Ga0496106_0035865 | |||
| 2578 | Ga0496106_0040080 | |||
| 2579 | Ga0496106_0053571 | |||
| 2580 | Ga0496106_0076993 | |||
| 2581 | Ga0496107_0000948 | |||
| 2582 | Ga0496107_0011336 | |||
| 2583 | Ga0496107_0024457 | |||
| 2584 | Ga0496107_0053474 | |||
| 2585 | Ga0496107_0283939 | |||
| 2586 | Ga0496108_0000386 | |||
| 2587 | Ga0496108_0008222 | |||
| 2588 | Ga0496108_0008465 | |||
| 2589 | Ga0496108_0015654 | |||
| 2590 | Ga0496108_0073741 | |||
| 2591 | Ga0496108_0116847 | |||
| 2592 | Ga0496108_0208857 | |||
| 2593 | Ga0496109_0001313 | |||
| 2594 | Ga0496109_0002084 | |||
| 2595 | Ga0496109_0005082 | |||
| 2596 | Ga0496109_0013436 | |||
| 2597 | Ga0496109_0025848 | |||
| 2598 | Ga0496109_0037307 | |||
| 2599 | Ga0496109_0089599 | |||
| 2600 | Ga0496109_0108049 | |||
| 2601 | Ga0496109_0183313 | |||
| 2602 | Ga0496109_0554419 | |||
| 2603 | Ga0496110_0002099 | |||
| 2604 | Ga0496110_0007609 | |||
| 2605 | Ga0496110_0021235 | |||
| 2606 | Ga0496110_0027444 | |||
| 2607 | Ga0496110_0031648 | |||
| 2608 | Ga0496110_0051043 | |||
| 2609 | Ga0496110_0108219 | |||
| 2610 | Ga0496110_0125266 | |||
| 2611 | Ga0496111_0003477 | |||
| 2612 | Ga0496111_0011952 | |||
| 2613 | Ga0496111_0024335 | |||
| 2614 | Ga0496111_0042385 | |||
| 2615 | Ga0496111_0055370 | |||
| 2616 | Ga0496111_0058738 | |||
| 2617 | Ga0496111_0094130 | |||
| 2618 | Ga0496111_0134909 | |||
| 2619 | Ga0496112_0000426 | |||
| 2620 | Ga0496112_0002276 | |||
| 2621 | Ga0496112_0002729 | |||
| 2622 | Ga0496112_0017139 | |||
| 2623 | Ga0496112_0073881 | |||
| 2624 | Ga0496112_0079495 | |||
| 2625 | Ga0496112_0112869 | |||
| 2626 | Ga0496112_0159970 | |||
| 2627 | Ga0496112_0213665 | |||
| 2628 | Ga0496112_0408096 | |||
| 2629 | Ga0496112_0439604 | |||
| 2630 | Ga0496113_0000395 | |||
| 2631 | Ga0496113_0005585 | |||
| 2632 | Ga0496113_0006364 | |||
| 2633 | Ga0496113_0192335 | |||
| 2634 | Ga0496113_0275053 | |||
| 2635 | Ga0496114_0039960 | |||
| 2636 | Ga0496114_0050201 | |||
| 2637 | Ga0496114_0065094 | |||
| 2638 | Ga0496114_0138104 | |||
| 2639 | Ga0496114_0285405 | |||
| 2640 | Ga0496114_0299688 | |||
| 2641 | Ga0496115_0005407 | |||
| 2642 | Ga0496115_0015763 | |||
| 2643 | Ga0496115_0032770 | |||
| 2644 | Ga0496115_0058117 | |||
| 2645 | Ga0496115_0069401 | |||
| 2646 | Ga0496115_0081086 | |||
| 2647 | Ga0496115_0453306 | |||
| 2648 | Ga0496119_0001157 | |||
| 2649 | Ga0496121_0087070 | |||
| 2650 | Ga0496122_0004668 | |||
| 2651 | Ga0496123_0016898 | |||
| 2652 | Ga0496124_0118723 | |||
| 2653 | Ga0496125_0001734 | |||
| 2654 | Ga0496125_0008258 | |||
| 2655 | Ga0496125_0008325 | |||
| 2656 | Ga0496125_0276292 | |||
| 2657 | Ga0501031_0015877 | |||
| 2658 | Ga0501031_0036686 | |||
| 2659 | Ga0501031_0152461 | |||
| 2660 | Ga0501032_0011857 | |||
| 2661 | Ga0501032_0056036 | |||
| 2662 | Ga0501032_0067199 | |||
| 2663 | Ga0501032_0083622 | |||
| 2664 | Ga0501032_0119882 | |||
| 2665 | Ga0501033_0014850 | |||
| 2666 | Ga0501033_0047585 | |||
| 2667 | Ga0501033_0048467 | |||
| 2668 | Ga0501033_0051645 | |||
| 2669 | Ga0501034_0000014 | |||
| 2670 | Ga0501034_0000229 | |||
| 2671 | Ga0501034_0001110 | |||
| 2672 | Ga0501034_0008683 | |||
| 2673 | Ga0501034_0017595 | |||
| 2674 | Ga0501034_0026137 | |||
| 2675 | Ga0501034_0069983 | |||
| 2676 | Ga0501034_0088085 | |||
| 2677 | Ga0501034_0089500 | |||
| 2678 | Ga0501034_0118129 | |||
| 2679 | Ga0501034_0144962 | |||
| 2680 | Ga0501034_0178248 | |||
| 2681 | Ga0501034_0239028 | |||
| 2682 | Ga0501034_0269085 | |||
| 2683 | Ga0501034_0307234 | |||
| 2684 | Ga0501036_0000783 | |||
| 2685 | Ga0501036_0007660 | |||
| 2686 | Ga0501036_0022257 | |||
| 2687 | Ga0501036_0050874 | |||
| 2688 | Ga0501036_0061182 | |||
| 2689 | Ga0501036_0102160 | |||
| 2690 | Ga0501037_0001572 | |||
| 2691 | Ga0501037_0008091 | |||
| 2692 | Ga0501037_0022876 | |||
| 2693 | Ga0501037_0031393 | |||
| 2694 | Ga0501037_0059581 | |||
| 2695 | Ga0501037_0078288 | |||
| 2696 | Ga0501037_0123315 | |||
| 2697 | Ga0501038_0006136 | |||
| 2698 | Ga0501038_0014576 | |||
| 2699 | Ga0501038_0037381 | |||
| 2700 | Ga0501038_0068808 | |||
| 2701 | Ga0501038_0152189 | |||
| 2702 | Ga0501038_0191440 | |||
| 2703 | Ga0501038_0335269 | |||
| 2704 | Ga0501039_0000946 | |||
| 2705 | Ga0501039_0028565 | |||
| 2706 | Ga0501039_0032425 | |||
| 2707 | Ga0501039_0040211 | |||
| 2708 | Ga0501039_0065951 | |||
| 2709 | Ga0501039_0366616 | |||
| 2710 | Ga0501041_0133149 | |||
| 2711 | Ga0501041_0233661 | |||
| 2712 | Ga0501042_0214089 | |||
| 2713 | Ga0501043_0022518 | |||
| 2714 | Ga0501043_0049038 | |||
| 2715 | Ga0501043_0082459 | |||
| 2716 | Ga0501043_0086312 | |||
| 2717 | Ga0501043_0254958 | |||
| 2718 | Ga0501046_0000010 | |||
| 2719 | Ga0501046_0010235 | |||
| 2720 | Ga0501046_0039838 | |||
| 2721 | Ga0501046_0212966 | |||
| 2722 | Ga0501047_0000164 | |||
| 2723 | Ga0501047_0000291 | |||
| 2724 | Ga0501047_0015143 | |||
| 2725 | Ga0501047_0050411 | |||
| 2726 | Ga0501047_0052031 | |||
| 2727 | Ga0501047_0066787 | |||
| 2728 | Ga0501047_0083239 | |||
| 2729 | Ga0501047_0089676 | |||
| 2730 | Ga0501047_0169799 | |||
| 2731 | Ga0501047_0432273 | |||
| 2732 | Ga0501048_0006531 | |||
| 2733 | Ga0501048_0055770 | |||
| 2734 | Ga0501048_0070696 | |||
| 2735 | Ga0501067_0000487 | |||
| 2736 | Ga0501067_0063613 | |||
| 2737 | Ga0501068_0002927 | |||
| 2738 | Ga0501068_0089214 | |||
| 2739 | Ga0501068_0147955 | |||
| 2740 | Ga0501069_0093948 | |||
| 2741 | Ga0501069_0182377 | |||
| 2742 | Ga0501070_0013638 | |||
| 2743 | Ga0501070_0023580 | |||
| 2744 | Ga0501070_0040808 | |||
| 2745 | Ga0501070_0089636 | |||
| 2746 | Ga0501070_0158537 | |||
| 2747 | Ga0501071_0012458 | |||
| 2748 | Ga0501071_0315243 | |||
| 2749 | Ga0501072_0002738 | |||
| 2750 | Ga0501072_0003379 | |||
| 2751 | Ga0501073_0002202 | |||
| 2752 | Ga0501073_0009007 | |||
| 2753 | Ga0501073_0024957 | |||
| 2754 | Ga0501073_0040426 | |||
| 2755 | Ga0501073_0113772 | |||
| 2756 | Ga0501073_0126501 | |||
| 2757 | Ga0501073_0201519 | |||
| 2758 | Ga0501073_0208558 | |||
| 2759 | Ga0501073_0213170 | |||
| 2760 | Ga0501074_0009952 | |||
| 2761 | Ga0501074_0062173 | |||
| 2762 | Ga0501074_0075397 | |||
| 2763 | Ga0501074_0100137 | |||
| 2764 | Ga0501076_0139656 | |||
| 2765 | Ga0501076_0164058 | |||
| 2766 | Ga0501077_0055553 | |||
| 2767 | Ga0501077_0061029 | |||
| 2768 | Ga0501079_0036076 | |||
| 2769 | Ga0501080_0000235 | |||
| 2770 | Ga0501080_0000258 | |||
| 2771 | Ga0501080_0039927 | |||
| 2772 | Ga0501080_0058855 | |||
| 2773 | Ga0501080_0070213 | |||
| 2774 | Ga0501080_0102107 | |||
| 2775 | Ga0501080_0154097 | |||
| 2776 | Ga0501080_0188731 | |||
| 2777 | Ga0501080_0206916 | |||
| 2778 | Ga0501081_0199108 | |||
| 2779 | Ga0501081_0355102 | |||
| 2780 | Ga0501081_0366669 | |||
| 2781 | Ga0501083_0000506 | |||
| 2782 | Ga0501083_0031711 | |||
| 2783 | Ga0501083_0122636 | |||
| 2784 | Ga0501083_0123038 | |||
| 2785 | Ga0501083_0140484 | |||
| 2786 | Ga0501035_0000034 | |||
| 2787 | Ga0501035_0061564 | |||
| 2788 | Ga0501035_0096557 | |||
| 2789 | Ga0501035_0309002 | |||
| 2790 | Ga0501044_0000039 | |||
| 2791 | Ga0501044_0000707 | |||
| 2792 | Ga0501044_0004032 | |||
| 2793 | Ga0501044_0011537 | |||
| 2794 | Ga0501044_0017386 | |||
| 2795 | Ga0501044_0037357 | |||
| 2796 | Ga0501044_0046521 | |||
| 2797 | Ga0501044_0080101 | |||
| 2798 | Ga0501044_0098295 | |||
| 2799 | Ga0501044_0138359 | |||
| 2800 | Ga0501044_0165260 | |||
| 2801 | Ga0501044_0197562 | |||
| 2802 | Ga0501044_0377465 | |||
| 2803 | Ga0501045_0012382 | |||
| 2804 | Ga0501045_0040900 | |||
| 2805 | nmdc:mga03683_10353_c1 | |||
| 2806 | nmdc:mga0yw44_11239_c1 | |||
| 2807 | nmdc:mga0yw44_59058_c1 | |||
| 2808 | nmdc:mga0k408_111811_c1 | |||
| 2809 | nmdc:mga06z11_19545_c1 | |||
| 2810 | nmdc:mga04h51_33510_c1 | |||
| 2811 | nmdc:mga07m45_130342_c1 | |||
| 2812 | nmdc:mga05p37_10364_c1 | |||
| 2813 | nmdc:mga05p37_153287_c1 | |||
| 2814 | nmdc:mga05p37_165020_c1 | |||
| 2815 | nmdc:mga05p37_174250_c1 | |||
| 2816 | nmdc:mga05p37_201_c1 | |||
| 2817 | nmdc:mga05p37_66_c1 | |||
| 2818 | nmdc:mga09592_1702_c1 | |||
| 2819 | nmdc:mga09592_18352_c1 | |||
| 2820 | nmdc:mga09592_295465_c1 | |||
| 2821 | nmdc:mga0qj67_100307_c1 | |||
| 2822 | nmdc:mga0qj67_16874_c1 | |||
| 2823 | nmdc:mga0qj67_7_c1 | |||
| 2824 | nmdc:mga06r32_100609_c1 | |||
| 2825 | nmdc:mga06r32_109586_c1 | |||
| 2826 | nmdc:mga06r32_176145_c1 | |||
| 2827 | nmdc:mga06r32_2037_c1 | |||
| 2828 | nmdc:mga06r32_9994_c1 | |||
| 2829 | nmdc:mga08y16_12219_c1 | |||
| 2830 | nmdc:mga08y16_126312_c1 | |||
| 2831 | nmdc:mga08y16_1809_c1 | |||
| 2832 | nmdc:mga08y16_36558_c1 | |||
| 2833 | nmdc:mga08y16_48_c1 | |||
| 2834 | nmdc:mga08y16_52087_c1 | |||
| 2835 | nmdc:mga0n895_112554_c1 | |||
| 2836 | nmdc:mga0n895_20739_c1 | |||
| 2837 | nmdc:mga0n895_222430_c1 | |||
| 2838 | nmdc:mga0n895_244249_c1 | |||
| 2839 | nmdc:mga0n895_29594_c1 | |||
| 2840 | nmdc:mga0n895_37587_c1 | |||
| 2841 | nmdc:mga0n895_43_c1 | |||
| 2842 | nmdc:mga0n895_512304_c1 | |||
| 2843 | nmdc:mga0n895_9627_c1 | |||
| 2844 | nmdc:mga0rr50_10053_c1 | |||
| 2845 | nmdc:mga0rr50_113682_c1 | |||
| 2846 | nmdc:mga0rr50_1204_c1 | |||
| 2847 | nmdc:mga0rr50_40525_c1 | |||
| 2848 | nmdc:mga08x19_113498_c1 | |||
| 2849 | nmdc:mga08x19_22_c1 | |||
| 2850 | nmdc:mga08x19_311750_c1 | |||
| 2851 | nmdc:mga0a205_2982_c1 | |||
| 2852 | nmdc:mga0a205_31139_c1 | |||
| 2853 | nmdc:mga0a205_945_c1 | |||
| 2854 | nmdc:mga0sz30_57812_c1 | |||
| 2855 | nmdc:mga0sz30_65082_c1 | |||
| 2856 | Ga0495601_0000002 | |||
| 2857 | Ga0495601_0000107 | |||
| 2858 | Ga0495601_0001733 | |||
| 2859 | Ga0495601_0002632 | |||
| 2860 | Ga0495601_0007967 | |||
| 2861 | Ga0495601_0014835 | |||
| 2862 | Ga0495601_0015899 | |||
| 2863 | Ga0495601_0023623 | |||
| 2864 | Ga0495601_0053932 | |||
| 2865 | Ga0495601_0098367 | |||
| 2866 | Ga0495612_0000010 | |||
| 2867 | Ga0495612_0000162 | |||
| 2868 | Ga0495612_0000390 | |||
| 2869 | Ga0495612_0005556 | |||
| 2870 | Ga0495612_0007461 | |||
| 2871 | Ga0495612_0021992 | |||
| 2872 | Ga0495612_0044037 | |||
| 2873 | Ga0495612_0086041 | |||
| 2874 | Ga0495595_0000020 | |||
| 2875 | Ga0495595_0001476 | |||
| 2876 | Ga0495595_0001769 | |||
| 2877 | Ga0495595_0001841 | |||
| 2878 | Ga0495595_0009256 | |||
| 2879 | Ga0495595_0013739 | |||
| 2880 | Ga0495595_0022243 | |||
| 2881 | Ga0495595_0026401 | |||
| 2882 | Ga0495619_0000019 | |||
| 2883 | Ga0495619_0000045 | |||
| 2884 | Ga0495619_0000337 | |||
| 2885 | Ga0495619_0001011 | |||
| 2886 | Ga0495619_0002709 | |||
| 2887 | Ga0495619_0007573 | |||
| 2888 | Ga0495619_0016006 | |||
| 2889 | Ga0495619_0020702 | |||
| 2890 | Ga0495619_0037365 | |||
| 2891 | Ga0495619_0046616 | |||
| 2892 | Ga0495619_0056153 | |||
| 2893 | Ga0495619_0092469 | |||
| 2894 | Ga0500643_000001 | |||
| 2895 | Ga0500651_0007654 | |||
| 2896 | Ga0500556_0000363 | |||
| 2897 | Ga0500593_001999 | |||
| 2898 | Ga0500594_0029603 | |||
| 2899 | Ga0500568_0034718 | |||
| 2900 | Ga0500577_0106100 | |||
| 2901 | Ga0500616_0123736 | |||
| 2902 | Ga0500636_0001441 | |||
| 2903 | Ga0500587_010152 | |||
| 2904 | Ga0501084_0163108 | |||
| 2905 | Ga0501084_0178584 | |||
| 2906 | Ga0501084_0299765 | |||
| 2907 | Ga0501082_0004474 | |||
| 2908 | Ga0501082_0041247 | |||
| 2909 | Ga0501082_0070038 | |||
| 2910 | Ga0501082_0152643 | |||
| 2911 | Ga0501082_0239067 | |||
| 2912 | Ga0501082_0364743 | |||
| 2913 | Ga0466962_0132564 | |||
| 2914 | Ga0530510_0024251 | |||
| 2915 | 2509080163 | |||
| 2916 | 2513591539 | |||
| 2917 | 2643964412 | |||
| 2918 | 2644168953 | |||
| 2919 | 2644347505 | |||
| 2920 | 2738743493 | |||
| 2921 | 2739352400 | |||
| 2922 | 2828308251 | |||
| 2923 | 2829747323 | |||
| 2924 | 2835316750 | |||
| 2925 | 2842696329 | |||
| 2926 | 2844320412 | |||
| 2927 | 2847937949 | |||
| 2928 | 2874632901 | |||
| 2929 | 2882456911 | |||
| 2930 | 2885430278 | |||
| 2931 | 2894236201 | |||
| 2932 | 2895886248 | |||
| 2933 | 2903732927 | |||
| 2934 | 2906607259 | |||
| 2935 | 2917555763 | |||
| 2936 | 2946789504 | |||
| 2937 | 643602018 | |||
| 2938 | 8001847501 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rf1-assembly1.cif.gz_B | the crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9761 | 22 | 310 |
| 5f5w-assembly1.cif.gz_A | crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa) | 0.9711 | 22 | 311 |
| 1j5w-assembly1.cif.gz_B | crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution | 0.969 | 22 | 311 |
| 1j5w-assembly1.cif.gz_A | crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution | 0.9681 | 22 | 311 |
| 7xof-assembly1.cif.gz_B | crystal structure of oryza sativa plastid glycyl-trna synthetase | 0.9663 | 22 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00960_215_296_1.20.58.180 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 | 0.9667 | 230 | 312 | 1.20.58.180 |
| af_P00960_1_214_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.961 | 20 | 229 | 3.30.930.10 |
| af_A0A1D6NXM7_66_257_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9411 | 44 | 215 | 3.30.930.10 |
| af_P00960_1_214_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9346 | 20 | 229 | 3.30.930.10 |
| af_P00960_215_296_1.20.58.180 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 | 0.875 | 230 | 312 | 1.20.58.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528TEF1-F1-model_v4 | Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) | 0.9983 | 123 | 192 |
GO:0004820
GO:0005524 GO:0005829 GO:0006426 |
| AF-A0A531JF41-F1-model_v4 | Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) | 0.9939 | 94 | 195 |
GO:0004820
GO:0005524 GO:0005829 GO:0006426 |
| AF-A0A6I3UA74-F1-model_v4 | glycine--tRNA ligase (EC 6.1.1.14) | 0.9933 | 123 | 198 |
GO:0004820
GO:0005524 GO:0005829 GO:0006426 GO:0016740 |
| AF-B0L8W9-F1-model_v4 | glycine--tRNA ligase (EC 6.1.1.14) | 0.9931 | 92 | 197 |
GO:0004820
GO:0005524 GO:0005829 GO:0006426 |
| AF-A0A3D3SK23-F1-model_v4 | deleted | 0.9916 | 127 | 319 |
|