F494178
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1467 | 544 | 2934 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_11118759|Ga0105243_111187592 |
| Length | 140 |
| Sequence | MAGSSTKAPKVKRMSTNPVQTVGTSGDKLKVTLAVCAAIAGVVAFYFLSDKPTPVRAAALVAGLILAIALAWTSMTGRDFINFSKEAVRETKKVVWPTRKEAMQITAIVFGFVLIMALFLFGTDKLLEFLLYDLILGWKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002865 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003288 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003291 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 52 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 55 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 104 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 197 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 198 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 199 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 200 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 201 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 223 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 226 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 227 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 228 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 229 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 230 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 231 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 232 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 233 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 234 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 235 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 236 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 237 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 238 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 385 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 408 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 409 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 410 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 411 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 412 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 413 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 414 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 415 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 416 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 417 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 418 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 419 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 422 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 428 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 430 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 432 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 434 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 435 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 436 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059606 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 473 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 474 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 484 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 487 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 488 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 489 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 490 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 491 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 492 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 493 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 494 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 495 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 496 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 497 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 498 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 499 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 500 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 501 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 502 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 503 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 504 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 505 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 506 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 507 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 508 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 509 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 510 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 511 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 512 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 513 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 514 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 515 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 516 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 517 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 518 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 519 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 520 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 521 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 522 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 523 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 524 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 525 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 526 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 527 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 528 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 529 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 530 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 531 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 532 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 533 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 534 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 535 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 536 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 537 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 538 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 539 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 540 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 541 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 542 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 543 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 544 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.73 |
| Metatranscriptomes | 17.72 |
| Isolates | 3.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.43 |
| Nodule | 0.34 |
| Rhizoplane | 4.16 |
| Rhizosphere | 82.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105243_11118759 | 3300009148 | Bacteria | 797 |
| 2 | JGI25155J39150_1001422 | 3300002704 | Bacteria | 1719 |
| 3 | JGI25162J39368_1003029 | 3300002737 | Bacteria | 5487 |
| 4 | JGI25162J39368_1013612 | 3300002737 | Bacteria | 893 |
| 5 | JGI25154J39366_1001113 | 3300002738 | Bacteria | 10452 |
| 6 | JGI25157J39369_1002793 | 3300002741 | Bacteria | 3986 |
| 7 | JGI25163J39215_1004486 | 3300002771 | Bacteria | 975 |
| 8 | Ga0006761J43178_107453 | 3300002865 | Bacteria | 787 |
| 9 | Ga0006763J43179_103551 | 3300002870 | Bacteria | 1885 |
| 10 | Ga0006762J43184_104088 | 3300002872 | Bacteria | 3536 |
| 11 | Ga0006765J45826_105488 | 3300003161 | Bacteria | 3656 |
| 12 | Ga0006765J45826_112366 | 3300003161 | Bacteria | 517 |
| 13 | Ga0006778J45830_1013353 | 3300003162 | Bacteria | 3860 |
| 14 | Ga0006778J45830_1040529 | 3300003162 | Bacteria | 1293 |
| 15 | Ga0006759J45824_1008312 | 3300003163 | Bacteria | 3423 |
| 16 | Ga0006759J45824_1017914 | 3300003163 | Bacteria | 783 |
| 17 | Ga0006759J45824_1050895 | 3300003163 | Bacteria | 532 |
| 18 | JGI25151J46595_10026667 | 3300003187 | Bacteria | 2327 |
| 19 | JGI25165J46597_1001017 | 3300003214 | Bacteria | 18492 |
| 20 | JGI25153J46596_10069502 | 3300003215 | Bacteria | 918 |
| 21 | Ga0007428J48920_101816 | 3300003288 | Bacteria | 1673 |
| 22 | Ga0007421J48921_108960 | 3300003291 | Bacteria | 985 |
| 23 | Ga0006758J48902_1003362 | 3300003300 | Bacteria | 5424 |
| 24 | Ga0006758J48902_1007376 | 3300003300 | Bacteria | 802 |
| 25 | Ga0006758J48902_1008629 | 3300003300 | Bacteria | 4431 |
| 26 | Ga0006758J48902_1013049 | 3300003300 | Bacteria | 550 |
| 27 | Ga0006770J48903_1029811 | 3300003305 | Bacteria | 1264 |
| 28 | Ga0006770J48903_1044284 | 3300003305 | Bacteria | 617 |
| 29 | Ga0006777J48905_1023760 | 3300003308 | Bacteria | 1382 |
| 30 | Ga0006777J48905_1039864 | 3300003308 | Bacteria | 1285 |
| 31 | rootH2_10111913 | 3300003320 | Bacteria | 1421 |
| 32 | JGI25160J50197_1016863 | 3300003354 | Bacteria | 2336 |
| 33 | Ga0007417J51691_1002081 | 3300003544 | Bacteria | 10064 |
| 34 | Ga0007417J51691_1010301 | 3300003544 | Bacteria | 12984 |
| 35 | Ga0007417J51691_1012480 | 3300003544 | Bacteria | 3735 |
| 36 | Ga0007417J51691_1047057 | 3300003544 | Bacteria | 1157 |
| 37 | Ga0007427J51700_104977 | 3300003559 | Bacteria | 3786 |
| 38 | Ga0006781J51513_1012464 | 3300003568 | Bacteria | 1740 |
| 39 | Ga0007410J51695_1007231 | 3300003574 | Bacteria | 17470 |
| 40 | Ga0007410J51695_1020989 | 3300003574 | Bacteria | 1047 |
| 41 | Ga0007409J51694_1001845 | 3300003575 | Bacteria | 1222 |
| 42 | Ga0007409J51694_1004205 | 3300003575 | Bacteria | 13192 |
| 43 | Ga0007409J51694_1052234 | 3300003575 | Bacteria | 546 |
| 44 | Ga0007416J51690_1008732 | 3300003577 | Bacteria | 13163 |
| 45 | Ga0007416J51690_1012477 | 3300003577 | Bacteria | 2533 |
| 46 | Ga0007416J51690_1013143 | 3300003577 | Bacteria | 3753 |
| 47 | Ga0007429J51699_1009554 | 3300003579 | Bacteria | 5322 |
| 48 | Ga0007429J51699_1048446 | 3300003579 | Bacteria | 4130 |
| 49 | Ga0007411J51799_105052 | 3300003611 | Bacteria | 7712 |
| 50 | Ga0007411J51799_105765 | 3300003611 | Bacteria | 1376 |
| 51 | Ga0007415J51800_105799 | 3300003613 | Bacteria | 1906 |
| 52 | Ga0007415J51800_107921 | 3300003613 | Bacteria | 564 |
| 53 | Ga0032354_1003507 | 3300003693 | Bacteria | 1535 |
| 54 | Ga0032354_1011615 | 3300003693 | Bacteria | 13713 |
| 55 | Ga0032354_1050188 | 3300003693 | Bacteria | 946 |
| 56 | Ga0032354_1055041 | 3300003693 | Bacteria | 1008 |
| 57 | Ga0006780_1004575 | 3300003735 | Bacteria | 5394 |
| 58 | Ga0006780_1014123 | 3300003735 | Bacteria | 1224 |
| 59 | Ga0055538_1000375 | 3300003751 | Bacteria | 18492 |
| 60 | Ga0055538_1002307 | 3300003751 | Bacteria | 2880 |
| 61 | Ga0055539_1000377 | 3300003752 | Bacteria | 18492 |
| 62 | Ga0055539_1002407 | 3300003752 | Bacteria | 2880 |
| 63 | Ga0055533_1000371 | 3300003756 | Bacteria | 18492 |
| 64 | Ga0055533_1003837 | 3300003756 | Bacteria | 2880 |
| 65 | Ga0055532_1000420 | 3300003758 | Bacteria | 20446 |
| 66 | Ga0055525_1000147 | 3300003759 | Bacteria | 96457 |
| 67 | Ga0055525_1000523 | 3300003759 | Bacteria | 18492 |
| 68 | Ga0055525_1001833 | 3300003759 | Bacteria | 2880 |
| 69 | Ga0055535_1005381 | 3300003761 | Bacteria | 2823 |
| 70 | Ga0055529_1000375 | 3300003763 | Bacteria | 48263 |
| 71 | Ga0055526_1021258 | 3300003771 | Bacteria | 2266 |
| 72 | Ga0055526_1021298 | 3300003771 | Bacteria | 2261 |
| 73 | Ga0055537_1007354 | 3300003773 | Bacteria | 2661 |
| 74 | Ga0055537_1012735 | 3300003773 | Bacteria | 1621 |
| 75 | Ga0055524_1035570 | 3300003775 | Bacteria | 1356 |
| 76 | Ga0055524_1039973 | 3300003775 | Bacteria | 1203 |
| 77 | Ga0055534_1006810 | 3300003784 | Bacteria | 2819 |
| 78 | Ga0055534_1023815 | 3300003784 | Bacteria | 998 |
| 79 | Ga0055528_1007975 | 3300003790 | Bacteria | 4609 |
| 80 | Ga0055528_1012187 | 3300003790 | Bacteria | 3355 |
| 81 | Ga0055530_10034470 | 3300003791 | Bacteria | 1293 |
| 82 | Ga0055540_1071237 | 3300003792 | Bacteria | 678 |
| 83 | Ga0055531_10055730 | 3300003794 | Bacteria | 1003 |
| 84 | Ga0055541_1000262 | 3300003841 | Bacteria | 18492 |
| 85 | Ga0055541_1003620 | 3300003841 | Bacteria | 2880 |
| 86 | Ga0055543_1028398 | 3300004625 | Bacteria | 985 |
| 87 | Ga0055543_1061760 | 3300004625 | Bacteria | 599 |
| 88 | Ga0058859_11830236 | 3300004798 | Bacteria | 602 |
| 89 | Ga0058863_10053884 | 3300004799 | Bacteria | 1211 |
| 90 | Ga0058861_10192042 | 3300004800 | Bacteria | 1266 |
| 91 | Ga0058860_12202994 | 3300004801 | Bacteria | 531 |
| 92 | Ga0058862_10285807 | 3300004803 | Bacteria | 831 |
| 93 | Ga0065165_1003318 | 3300005262 | Bacteria | 11513 |
| 94 | Ga0065165_1131124 | 3300005262 | Bacteria | 599 |
| 95 | Ga0065714_10039928 | 3300005288 | Bacteria | 728 |
| 96 | Ga0065714_10228053 | 3300005288 | Bacteria | 822 |
| 97 | Ga0065714_10510726 | 3300005288 | Bacteria | 518 |
| 98 | Ga0065704_10158451 | 3300005289 | Bacteria | 1373 |
| 99 | Ga0065715_10965565 | 3300005293 | Bacteria | 555 |
| 100 | Ga0070676_10119214 | 3300005328 | Bacteria | 1654 |
| 101 | Ga0070670_100067314 | 3300005331 | Bacteria | 3073 |
| 102 | Ga0070670_100670173 | 3300005331 | Bacteria | 931 |
| 103 | Ga0068869_100160311 | 3300005334 | Bacteria | 1751 |
| 104 | Ga0070680_100212917 | 3300005336 | Bacteria | 1630 |
| 105 | Ga0070680_100331491 | 3300005336 | Bacteria | 1293 |
| 106 | Ga0070682_100049501 | 3300005337 | Bacteria | 2620 |
| 107 | Ga0070682_100139754 | 3300005337 | Bacteria | 1649 |
| 108 | Ga0070660_100054384 | 3300005339 | Bacteria | 3091 |
| 109 | Ga0070661_100103030 | 3300005344 | Bacteria | 2125 |
| 110 | Ga0070671_101904447 | 3300005355 | Bacteria | 529 |
| 111 | Ga0070659_100022490 | 3300005366 | Bacteria | 4814 |
| 112 | Ga0070663_100229308 | 3300005455 | Bacteria | 1462 |
| 113 | Ga0070662_100788233 | 3300005457 | Bacteria | 807 |
| 114 | Ga0070681_10693651 | 3300005458 | Bacteria | 934 |
| 115 | Ga0068867_100247809 | 3300005459 | Bacteria | 1447 |
| 116 | Ga0070684_100335993 | 3300005535 | Bacteria | 1388 |
| 117 | Ga0068853_100254548 | 3300005539 | Bacteria | 1612 |
| 118 | Ga0070672_100523242 | 3300005543 | Bacteria | 1028 |
| 119 | Ga0068855_100434090 | 3300005563 | Bacteria | 1435 |
| 120 | Ga0068855_100593288 | 3300005563 | Bacteria | 1195 |
| 121 | Ga0068855_101125821 | 3300005563 | Bacteria | 819 |
| 122 | Ga0070664_100139315 | 3300005564 | Bacteria | 2135 |
| 123 | Ga0070664_100796478 | 3300005564 | Bacteria | 883 |
| 124 | Ga0068857_100025716 | 3300005577 | Bacteria | 5183 |
| 125 | Ga0068854_100377989 | 3300005578 | Bacteria | 1166 |
| 126 | Ga0068854_100576719 | 3300005578 | Bacteria | 957 |
| 127 | Ga0068856_100085286 | 3300005614 | Bacteria | 3137 |
| 128 | Ga0068856_100087143 | 3300005614 | Bacteria | 3103 |
| 129 | Ga0068852_100062072 | 3300005616 | Bacteria | 3249 |
| 130 | Ga0068851_10071502 | 3300005834 | Bacteria | 1795 |
| 131 | Ga0068851_10112534 | 3300005834 | Bacteria | 1454 |
| 132 | Ga0068851_10405320 | 3300005834 | Bacteria | 803 |
| 133 | Ga0068862_101121132 | 3300005844 | Bacteria | 782 |
| 134 | Ga0075363_100016273 | 3300006048 | Bacteria | 3672 |
| 135 | Ga0075364_10849286 | 3300006051 | Bacteria | 622 |
| 136 | Ga0070712_100507328 | 3300006175 | Bacteria | 1012 |
| 137 | Ga0097621_100018618 | 3300006237 | Bacteria | 5310 |
| 138 | Ga0068871_100137146 | 3300006358 | Bacteria | 2078 |
| 139 | Ga0068865_100044877 | 3300006881 | Bacteria | 3027 |
| 140 | Ga0099823_1087981 | 3300006944 | Bacteria | 1097 |
| 141 | Ga0099794_10479873 | 3300007265 | Bacteria | 653 |
| 142 | Ga0105251_10078126 | 3300009011 | Bacteria | 1533 |
| 143 | Ga0105244_10015476 | 3300009036 | Bacteria | 4374 |
| 144 | Ga0105244_10019926 | 3300009036 | Bacteria | 3729 |
| 145 | Ga0105244_10039890 | 3300009036 | Bacteria | 2441 |
| 146 | Ga0105250_10141157 | 3300009092 | Bacteria | 999 |
| 147 | Ga0105250_10339321 | 3300009092 | Bacteria | 656 |
| 148 | Ga0105240_10021815 | 3300009093 | Bacteria | 8510 |
| 149 | Ga0105240_10209527 | 3300009093 | Bacteria | 2279 |
| 150 | Ga0105240_10307686 | 3300009093 | Bacteria | 1811 |
| 151 | Ga0105245_10043502 | 3300009098 | Bacteria | 4006 |
| 152 | Ga0105243_10016441 | 3300009148 | Bacteria | 5595 |
| 153 | Ga0105243_11533616 | 3300009148 | Bacteria | 691 |
| 154 | Ga0105243_13037755 | 3300009148 | Bacteria | 509 |
| 155 | Ga0105241_10173179 | 3300009174 | Bacteria | 1784 |
| 156 | Ga0105242_10156388 | 3300009176 | Bacteria | 1992 |
| 157 | Ga0105248_10786239 | 3300009177 | Bacteria | 1074 |
| 158 | Ga0105248_10951637 | 3300009177 | Bacteria | 970 |
| 159 | Ga0105237_10140721 | 3300009545 | Bacteria | 2407 |
| 160 | Ga0105237_10176405 | 3300009545 | Bacteria | 2137 |
| 161 | Ga0105238_10002020 | 3300009551 | Bacteria | 20484 |
| 162 | Ga0105238_10313151 | 3300009551 | Bacteria | 1555 |
| 163 | Ga0105238_10953002 | 3300009551 | Bacteria | 878 |
| 164 | Ga0105249_11042875 | 3300009553 | Bacteria | 887 |
| 165 | Ga0130086_1005042 | 3300009829 | Bacteria | 2342 |
| 166 | Ga0130086_1075241 | 3300009829 | Bacteria | 2349 |
| 167 | Ga0130086_1091490 | 3300009829 | Bacteria | 2006 |
| 168 | Ga0130085_1017480 | 3300009850 | Bacteria | 2342 |
| 169 | Ga0130085_1078041 | 3300009850 | Bacteria | 2349 |
| 170 | Ga0130085_1107450 | 3300009850 | Bacteria | 2006 |
| 171 | Ga0105239_10030541 | 3300010375 | Bacteria | 5924 |
| 172 | Ga0105239_10138610 | 3300010375 | Bacteria | 2710 |
| 173 | Ga0105239_10177507 | 3300010375 | Bacteria | 2382 |
| 174 | Ga0105239_11227710 | 3300010375 | Bacteria | 864 |
| 175 | Ga0105246_10340845 | 3300011119 | Bacteria | 1225 |
| 176 | Ga0105246_10866596 | 3300011119 | Bacteria | 807 |
| 177 | Ga0157325_1004116 | 3300012485 | Bacteria | 838 |
| 178 | Ga0157373_10261474 | 3300013100 | Bacteria | 1225 |
| 179 | Ga0157373_10718048 | 3300013100 | Bacteria | 733 |
| 180 | Ga0157371_10000710 | 3300013102 | Bacteria | 39002 |
| 181 | Ga0157370_10290342 | 3300013104 | Bacteria | 1510 |
| 182 | Ga0157370_10955217 | 3300013104 | Bacteria | 777 |
| 183 | Ga0157369_10404300 | 3300013105 | Bacteria | 1416 |
| 184 | Ga0157378_12462498 | 3300013297 | Bacteria | 572 |
| 185 | Ga0163162_10719007 | 3300013306 | Bacteria | 1119 |
| 186 | Ga0157372_11159304 | 3300013307 | Bacteria | 893 |
| 187 | Ga0157372_12979912 | 3300013307 | Bacteria | 541 |
| 188 | Ga0157375_11086602 | 3300013308 | Bacteria | 936 |
| 189 | Ga0182008_10004539 | 3300014497 | Bacteria | 8101 |
| 190 | Ga0182008_10005790 | 3300014497 | Bacteria | 6992 |
| 191 | Ga0182008_10171183 | 3300014497 | Bacteria | 1096 |
| 192 | Ga0182008_10393084 | 3300014497 | Bacteria | 743 |
| 193 | Ga0157377_10226863 | 3300014745 | Bacteria | 1199 |
| 194 | Ga0157376_10163721 | 3300014969 | Bacteria | 2019 |
| 195 | Ga0157376_11695674 | 3300014969 | Bacteria | 667 |
| 196 | Ga0182006_1000186 | 3300015261 | Bacteria | 64784 |
| 197 | Ga0182006_1010089 | 3300015261 | Bacteria | 4210 |
| 198 | Ga0182006_1013810 | 3300015261 | Bacteria | 3494 |
| 199 | Ga0182007_10000202 | 3300015262 | Bacteria | 40165 |
| 200 | Ga0182007_10018893 | 3300015262 | Bacteria | 2488 |
| 201 | Ga0182007_10031144 | 3300015262 | Bacteria | 1819 |
| 202 | Ga0182007_10032705 | 3300015262 | Bacteria | 1766 |
| 203 | Ga0182007_10232394 | 3300015262 | Bacteria | 655 |
| 204 | Ga0182005_1001571 | 3300015265 | Bacteria | 9020 |
| 205 | Ga0182005_1002884 | 3300015265 | Bacteria | 5976 |
| 206 | Ga0163161_10231881 | 3300017792 | Bacteria | 1433 |
| 207 | Ga0163161_10236417 | 3300017792 | Bacteria | 1419 |
| 208 | Ga0163161_10238636 | 3300017792 | Bacteria | 1413 |
| 209 | Ga0206355_1609219 | 3300020076 | Bacteria | 522 |
| 210 | Ga0206351_10512755 | 3300020077 | Bacteria | 1607 |
| 211 | Ga0206350_10480254 | 3300020080 | Bacteria | 1027 |
| 212 | Ga0206354_10352477 | 3300020081 | Bacteria | 1495 |
| 213 | Ga0213872_10052983 | 3300021361 | Bacteria | 1840 |
| 214 | Ga0213872_10067471 | 3300021361 | Bacteria | 1614 |
| 215 | Ga0209435_100186 | 3300025206 | Bacteria | 18475 |
| 216 | Ga0209435_100191 | 3300025206 | Bacteria | 17985 |
| 217 | Ga0209436_101414 | 3300025208 | Bacteria | 8429 |
| 218 | Ga0209436_101521 | 3300025208 | Bacteria | 7947 |
| 219 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 220 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 221 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 222 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 223 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 224 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 225 | Ga0209672_104073 | 3300025228 | Bacteria | 2815 |
| 226 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 227 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 228 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 229 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 230 | Ga0207427_100573 | 3300025231 | Bacteria | 18544 |
| 231 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 232 | Ga0209437_100639 | 3300025233 | Bacteria | 20468 |
| 233 | Ga0209437_118485 | 3300025233 | Bacteria | 893 |
| 234 | Ga0209437_119366 | 3300025233 | Bacteria | 856 |
| 235 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 236 | Ga0207425_1001042 | 3300025245 | Bacteria | 12856 |
| 237 | Ga0207425_1022002 | 3300025245 | Bacteria | 1347 |
| 238 | Ga0209646_1000246 | 3300025246 | Bacteria | 55219 |
| 239 | Ga0209646_1001041 | 3300025246 | Bacteria | 8366 |
| 240 | Ga0209026_1004204 | 3300025250 | Bacteria | 4388 |
| 241 | Ga0209026_1007856 | 3300025250 | Bacteria | 2318 |
| 242 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 243 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 244 | Ga0209677_111325 | 3300025253 | Bacteria | 1401 |
| 245 | Ga0209148_1000323 | 3300025254 | Bacteria | 66396 |
| 246 | Ga0209148_1011865 | 3300025254 | Bacteria | 1608 |
| 247 | Ga0209759_1015039 | 3300025256 | Bacteria | 2016 |
| 248 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 249 | Ga0209565_1006443 | 3300025263 | Bacteria | 3290 |
| 250 | Ga0209565_1010529 | 3300025263 | Bacteria | 2289 |
| 251 | Ga0209565_1026547 | 3300025263 | Bacteria | 1160 |
| 252 | Ga0209565_1048209 | 3300025263 | Bacteria | 772 |
| 253 | Ga0209565_1067964 | 3300025263 | Bacteria | 606 |
| 254 | Ga0209455_1000303 | 3300025272 | Bacteria | 50385 |
| 255 | Ga0209455_1005403 | 3300025272 | Bacteria | 3955 |
| 256 | Ga0209673_1003465 | 3300025273 | Bacteria | 9278 |
| 257 | Ga0209673_1004929 | 3300025273 | Bacteria | 6945 |
| 258 | Ga0209130_1002838 | 3300025284 | Bacteria | 8041 |
| 259 | Ga0209675_1002952 | 3300025291 | Bacteria | 8387 |
| 260 | Ga0209675_1009571 | 3300025291 | Bacteria | 3407 |
| 261 | Ga0209025_1001281 | 3300025294 | Bacteria | 34537 |
| 262 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 263 | Ga0209564_1000230 | 3300025295 | Bacteria | 123814 |
| 264 | Ga0209564_1013777 | 3300025295 | Bacteria | 3407 |
| 265 | Ga0209564_1019927 | 3300025295 | Bacteria | 2482 |
| 266 | Ga0209758_1011259 | 3300025297 | Bacteria | 5207 |
| 267 | Ga0209050_1000292 | 3300025298 | Bacteria | 106140 |
| 268 | Ga0209256_1004685 | 3300025299 | Bacteria | 8390 |
| 269 | Ga0209256_1012344 | 3300025299 | Bacteria | 3290 |
| 270 | Ga0207426_1002480 | 3300025302 | Bacteria | 11738 |
| 271 | Ga0209051_1055224 | 3300025303 | Bacteria | 1290 |
| 272 | Ga0209257_1000295 | 3300025304 | Bacteria | 109542 |
| 273 | Ga0207656_10251696 | 3300025321 | Bacteria | 866 |
| 274 | Ga0207656_10287302 | 3300025321 | Bacteria | 812 |
| 275 | Ga0207655_1003094 | 3300025728 | Bacteria | 12643 |
| 276 | Ga0207655_1027614 | 3300025728 | Bacteria | 2700 |
| 277 | Ga0207655_1142968 | 3300025728 | Bacteria | 766 |
| 278 | Ga0207713_1130135 | 3300025735 | Bacteria | 834 |
| 279 | Ga0207647_10261112 | 3300025904 | Bacteria | 992 |
| 280 | Ga0207645_10214311 | 3300025907 | Bacteria | 1269 |
| 281 | Ga0207705_11005312 | 3300025909 | Bacteria | 644 |
| 282 | Ga0207684_10913197 | 3300025910 | Bacteria | 738 |
| 283 | Ga0207654_10002179 | 3300025911 | Bacteria | 10027 |
| 284 | Ga0207707_10487097 | 3300025912 | Bacteria | 1053 |
| 285 | Ga0207695_10003953 | 3300025913 | Bacteria | 20492 |
| 286 | Ga0207695_10072393 | 3300025913 | Bacteria | 3517 |
| 287 | Ga0207695_10401694 | 3300025913 | Bacteria | 1255 |
| 288 | Ga0207695_10953808 | 3300025913 | Bacteria | 737 |
| 289 | Ga0207671_10139299 | 3300025914 | Bacteria | 1868 |
| 290 | Ga0207671_10178519 | 3300025914 | Bacteria | 1652 |
| 291 | Ga0207671_10579222 | 3300025914 | Bacteria | 895 |
| 292 | Ga0207693_10010110 | 3300025915 | Bacteria | 7664 |
| 293 | Ga0207657_10006550 | 3300025919 | Bacteria | 12056 |
| 294 | Ga0207649_10056050 | 3300025920 | Bacteria | 2459 |
| 295 | Ga0207649_10350719 | 3300025920 | Bacteria | 1092 |
| 296 | Ga0207694_10001435 | 3300025924 | Bacteria | 20449 |
| 297 | Ga0207694_10281831 | 3300025924 | Bacteria | 1365 |
| 298 | Ga0207694_10295775 | 3300025924 | Bacteria | 1332 |
| 299 | Ga0207650_10088896 | 3300025925 | Bacteria | 2357 |
| 300 | Ga0207659_11475330 | 3300025926 | Bacteria | 582 |
| 301 | Ga0207687_10591242 | 3300025927 | Bacteria | 935 |
| 302 | Ga0207690_11533167 | 3300025932 | Bacteria | 557 |
| 303 | Ga0207706_10313632 | 3300025933 | Bacteria | 1365 |
| 304 | Ga0207686_10112187 | 3300025934 | Bacteria | 1841 |
| 305 | Ga0207709_10055004 | 3300025935 | Bacteria | 2457 |
| 306 | Ga0207669_10511819 | 3300025937 | Bacteria | 962 |
| 307 | Ga0207704_10095815 | 3300025938 | Bacteria | 1963 |
| 308 | Ga0207691_10316183 | 3300025940 | Bacteria | 1339 |
| 309 | Ga0207711_10480757 | 3300025941 | Bacteria | 1157 |
| 310 | Ga0207711_10734557 | 3300025941 | Bacteria | 920 |
| 311 | Ga0207689_10123864 | 3300025942 | Bacteria | 2126 |
| 312 | Ga0207667_10023256 | 3300025949 | Bacteria | 6824 |
| 313 | Ga0207667_10042185 | 3300025949 | Bacteria | 4851 |
| 314 | Ga0207667_10143578 | 3300025949 | Bacteria | 2457 |
| 315 | Ga0207640_10169293 | 3300025981 | Bacteria | 1626 |
| 316 | Ga0207639_10312484 | 3300026041 | Bacteria | 1392 |
| 317 | Ga0207678_10543520 | 3300026067 | Bacteria | 1015 |
| 318 | Ga0207648_10531514 | 3300026089 | Bacteria | 1078 |
| 319 | Ga0207674_10021420 | 3300026116 | Bacteria | 6959 |
| 320 | Ga0207674_10637617 | 3300026116 | Bacteria | 1029 |
| 321 | Ga0207683_10480854 | 3300026121 | Bacteria | 1146 |
| 322 | Ga0207698_10012103 | 3300026142 | Bacteria | 5629 |
| 323 | Ga0209281_1008175 | 3300027111 | Bacteria | 2563 |
| 324 | Ga0268265_10147695 | 3300028380 | Bacteria | 1978 |
| 325 | Ga0316177_1138179 | 3300030731 | Bacteria | 1552 |
| 326 | Ga0316176_1045076 | 3300030732 | Bacteria | 941 |
| 327 | Ga0316178_1018733 | 3300030735 | Bacteria | 1607 |
| 328 | Ga0316180_1160791 | 3300030736 | Bacteria | 1307 |
| 329 | Ga0316183_1020377 | 3300030742 | Bacteria | 1175 |
| 330 | Ga0316182_1052816 | 3300030745 | Bacteria | 807 |
| 331 | Ga0316182_1275498 | 3300030745 | Bacteria | 1503 |
| 332 | Ga0307408_100144522 | 3300031548 | Bacteria | 1870 |
| 333 | Ga0307408_102083828 | 3300031548 | Bacteria | 547 |
| 334 | Ga0307408_102093717 | 3300031548 | Bacteria | 545 |
| 335 | Ga0265314_10275927 | 3300031711 | Bacteria | 953 |
| 336 | Ga0307516_10309306 | 3300031730 | Bacteria | 1254 |
| 337 | Ga0307405_11287052 | 3300031731 | Bacteria | 636 |
| 338 | Ga0307406_10406741 | 3300031901 | Bacteria | 1080 |
| 339 | Ga0307407_11519995 | 3300031903 | Bacteria | 530 |
| 340 | Ga0307412_10649115 | 3300031911 | Bacteria | 900 |
| 341 | Ga0307416_100004760 | 3300032002 | Bacteria | 8239 |
| 342 | Ga0307414_10006142 | 3300032004 | Bacteria | 6673 |
| 343 | Ga0307411_10352971 | 3300032005 | Bacteria | 1200 |
| 344 | Ga0307411_10495387 | 3300032005 | Bacteria | 1032 |
| 345 | Ga0307411_10595392 | 3300032005 | Bacteria | 950 |
| 346 | Ga0307411_11417131 | 3300032005 | Bacteria | 636 |
| 347 | Ga0307510_10280273 | 3300033180 | Bacteria | 1138 |
| 348 | Ga0373949_0294284 | 3300035090 | Bacteria | 513 |
| 349 | Ga0373939_0053081 | 3300035114 | Bacteria | 1265 |
| 350 | Ga0373935_0201381 | 3300035692 | Bacteria | 1376 |
| 351 | Ga0395899_0000078 | 3300037312 | Bacteria | 174141 |
| 352 | Ga0395899_0005833 | 3300037312 | Bacteria | 9559 |
| 353 | Ga0395899_0668497 | 3300037312 | Bacteria | 654 |
| 354 | Ga0395899_0683208 | 3300037312 | Bacteria | 645 |
| 355 | Ga0395899_1008921 | 3300037312 | Bacteria | 501 |
| 356 | Ga0395900_0082284 | 3300037418 | Bacteria | 3307 |
| 357 | Ga0395900_0195712 | 3300037418 | Bacteria | 2048 |
| 358 | Ga0395900_0249092 | 3300037418 | Bacteria | 1778 |
| 359 | Ga0395900_0560241 | 3300037418 | Bacteria | 1086 |
| 360 | Ga0395900_1850502 | 3300037418 | Bacteria | 514 |
| 361 | Ga0395898_0695698 | 3300037466 | Bacteria | 958 |
| 362 | Ga0395898_1601238 | 3300037466 | Bacteria | 575 |
| 363 | Ga0395905_0000549 | 3300037471 | Bacteria | 51321 |
| 364 | Ga0395905_0007900 | 3300037471 | Bacteria | 10523 |
| 365 | Ga0395905_0011730 | 3300037471 | Bacteria | 8460 |
| 366 | Ga0395905_0092664 | 3300037471 | Bacteria | 2833 |
| 367 | Ga0395905_0150590 | 3300037471 | Bacteria | 2189 |
| 368 | Ga0395905_0537645 | 3300037471 | Bacteria | 1069 |
| 369 | Ga0395905_1906850 | 3300037471 | Bacteria | 500 |
| 370 | Ga0395901_0004460 | 3300038443 | Bacteria | 14123 |
| 371 | Ga0395901_0094399 | 3300038443 | Bacteria | 3133 |
| 372 | Ga0395901_0164294 | 3300038443 | Bacteria | 2331 |
| 373 | Ga0395901_0464144 | 3300038443 | Bacteria | 1293 |
| 374 | Ga0395901_0548664 | 3300038443 | Bacteria | 1171 |
| 375 | Ga0395901_1464874 | 3300038443 | Bacteria | 639 |
| 376 | Ga0436361_0004974 | 3300039447 | Bacteria | 978 |
| 377 | Ga0436361_0171206 | 3300039447 | Bacteria | 5353 |
| 378 | Ga0436361_0578689 | 3300039447 | Bacteria | 1890 |
| 379 | Ga0436361_0743577 | 3300039447 | Bacteria | 2264 |
| 380 | Ga0436361_0767937 | 3300039447 | Bacteria | 874 |
| 381 | Ga0436361_1038070 | 3300039447 | Bacteria | 9794 |
| 382 | Ga0439465_0049368 | 3300041413 | Bacteria | 1374 |
| 383 | Ga0451833_0022593 | 3300041491 | Bacteria | 603 |
| 384 | Ga0451853_2414847 | 3300041512 | Bacteria | 1555 |
| 385 | Ga0439442_092526 | 3300042002 | Bacteria | 651 |
| 386 | Ga0439448_0261686 | 3300042005 | Bacteria | 611 |
| 387 | Ga0439432_126317 | 3300042006 | Bacteria | 756 |
| 388 | Ga0439449_0244662 | 3300042007 | Bacteria | 674 |
| 389 | Ga0439450_013480 | 3300042008 | Bacteria | 1643 |
| 390 | Ga0439450_048323 | 3300042008 | Bacteria | 1004 |
| 391 | Ga0439455_0027559 | 3300042012 | Bacteria | 1393 |
| 392 | Ga0439455_0069102 | 3300042012 | Bacteria | 946 |
| 393 | Ga0439455_0166579 | 3300042012 | Bacteria | 631 |
| 394 | Ga0450921_020664 | 3300042123 | Bacteria | 624 |
| 395 | Ga0450890_033574 | 3300042127 | Bacteria | 738 |
| 396 | Ga0450895_019290 | 3300042132 | Bacteria | 626 |
| 397 | Ga0450898_013755 | 3300042134 | Bacteria | 1353 |
| 398 | Ga0450904_004772 | 3300042139 | Bacteria | 1396 |
| 399 | Ga0439446_0168394 | 3300042156 | Bacteria | 727 |
| 400 | Ga0439458_0076007 | 3300042157 | Bacteria | 852 |
| 401 | Ga0439434_0057775 | 3300042435 | Bacteria | 1210 |
| 402 | Ga0439464_0028984 | 3300042439 | Bacteria | 1545 |
| 403 | Ga0466972_0005095 | 3300044658 | Bacteria | 6583 |
| 404 | Ga0466972_0052412 | 3300044658 | Bacteria | 1966 |
| 405 | Ga0466965_0043592 | 3300044683 | Bacteria | 2215 |
| 406 | Ga0466965_0231235 | 3300044683 | Bacteria | 987 |
| 407 | Ga0466965_0247551 | 3300044683 | Bacteria | 955 |
| 408 | Ga0466965_0373023 | 3300044683 | Bacteria | 784 |
| 409 | Ga0466965_0595604 | 3300044683 | Bacteria | 628 |
| 410 | Ga0466966_0038419 | 3300044684 | Bacteria | 3085 |
| 411 | Ga0466966_0978184 | 3300044684 | Bacteria | 510 |
| 412 | Ga0466964_0024210 | 3300044706 | Bacteria | 2364 |
| 413 | Ga0466964_0087285 | 3300044706 | Bacteria | 1351 |
| 414 | Ga0466964_0152185 | 3300044706 | Bacteria | 1073 |
| 415 | Ga0466964_0242638 | 3300044706 | Bacteria | 884 |
| 416 | Ga0466971_0221878 | 3300044719 | Bacteria | 896 |
| 417 | Ga0466971_0240173 | 3300044719 | Bacteria | 861 |
| 418 | Ga0466968_0012025 | 3300044735 | Bacteria | 3381 |
| 419 | Ga0466968_0207495 | 3300044735 | Bacteria | 919 |
| 420 | Ga0466968_0284188 | 3300044735 | Bacteria | 792 |
| 421 | Ga0466968_0327837 | 3300044735 | Bacteria | 740 |
| 422 | Ga0466970_0057746 | 3300044765 | Bacteria | 2076 |
| 423 | Ga0466970_0232590 | 3300044765 | Bacteria | 1030 |
| 424 | Ga0466957_0167221 | 3300044842 | Bacteria | 1431 |
| 425 | Ga0466957_0233015 | 3300044842 | Bacteria | 1219 |
| 426 | Ga0466957_0286206 | 3300044842 | Bacteria | 1104 |
| 427 | Ga0466957_0983406 | 3300044842 | Bacteria | 605 |
| 428 | Ga0466960_0943304 | 3300044901 | Bacteria | 528 |
| 429 | Ga0466959_0204553 | 3300045049 | Bacteria | 1373 |
| 430 | Ga0451576_1776876 | 3300045051 | Bacteria | 638 |
| 431 | Ga0466958_0896361 | 3300045836 | Bacteria | 578 |
| 432 | Ga0466967_0948199 | 3300045976 | Bacteria | 856 |
| 433 | Ga0466967_1169271 | 3300045976 | Bacteria | 766 |
| 434 | Ga0466967_1605038 | 3300045976 | Bacteria | 648 |
| 435 | Ga0466967_1689390 | 3300045976 | Bacteria | 630 |
| 436 | Ga0495617_001026 | 3300046452 | Bacteria | 12853 |
| 437 | Ga0495617_004204 | 3300046452 | Bacteria | 5264 |
| 438 | Ga0495617_197794 | 3300046452 | Bacteria | 629 |
| 439 | Ga0495627_026656 | 3300046453 | Bacteria | 1861 |
| 440 | Ga0495627_045406 | 3300046453 | Bacteria | 1338 |
| 441 | Ga0495592_0139781 | 3300046454 | Bacteria | 1685 |
| 442 | Ga0495603_0007446 | 3300046455 | Bacteria | 6583 |
| 443 | Ga0495603_0066125 | 3300046455 | Bacteria | 2129 |
| 444 | Ga0495603_0164238 | 3300046455 | Bacteria | 1287 |
| 445 | Ga0495603_0533480 | 3300046455 | Bacteria | 672 |
| 446 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 447 | Ga0495590_0005309 | 3300046457 | Bacteria | 5113 |
| 448 | Ga0495590_0018848 | 3300046457 | Bacteria | 2465 |
| 449 | Ga0495590_0029266 | 3300046457 | Bacteria | 1931 |
| 450 | Ga0495590_0037945 | 3300046457 | Bacteria | 1679 |
| 451 | Ga0495590_0124562 | 3300046457 | Bacteria | 924 |
| 452 | Ga0495590_0233781 | 3300046457 | Bacteria | 681 |
| 453 | Ga0495590_0249208 | 3300046457 | Bacteria | 660 |
| 454 | Ga0495591_008200 | 3300046458 | Bacteria | 4305 |
| 455 | Ga0495591_061027 | 3300046458 | Bacteria | 1001 |
| 456 | Ga0495629_0415305 | 3300046459 | Bacteria | 913 |
| 457 | Ga0495638_0000408 | 3300046460 | Bacteria | 52490 |
| 458 | Ga0495638_0010010 | 3300046460 | Bacteria | 6610 |
| 459 | Ga0495638_0010721 | 3300046460 | Bacteria | 6343 |
| 460 | Ga0495638_0069655 | 3300046460 | Bacteria | 2155 |
| 461 | Ga0495638_0463668 | 3300046460 | Bacteria | 644 |
| 462 | Ga0495651_0061481 | 3300046462 | Bacteria | 2874 |
| 463 | Ga0495651_0108148 | 3300046462 | Bacteria | 2059 |
| 464 | Ga0495653_0003544 | 3300046463 | Bacteria | 12573 |
| 465 | Ga0495653_0025764 | 3300046463 | Bacteria | 4718 |
| 466 | Ga0495653_0042103 | 3300046463 | Bacteria | 3559 |
| 467 | Ga0495653_0504877 | 3300046463 | Bacteria | 753 |
| 468 | Ga0495650_0008022 | 3300046471 | Bacteria | 6240 |
| 469 | Ga0495650_0009500 | 3300046471 | Bacteria | 5522 |
| 470 | Ga0495650_0017326 | 3300046471 | Bacteria | 3614 |
| 471 | Ga0495650_0032252 | 3300046471 | Bacteria | 2345 |
| 472 | Ga0495650_0058728 | 3300046471 | Bacteria | 1551 |
| 473 | Ga0495580_0008648 | 3300046472 | Bacteria | 8072 |
| 474 | Ga0495580_0245555 | 3300046472 | Bacteria | 1226 |
| 475 | Ga0495580_0370728 | 3300046472 | Bacteria | 968 |
| 476 | Ga0495580_0743097 | 3300046472 | Bacteria | 639 |
| 477 | Ga0495582_0013331 | 3300046473 | Bacteria | 4524 |
| 478 | Ga0495582_0049936 | 3300046473 | Bacteria | 2304 |
| 479 | Ga0495582_0057380 | 3300046473 | Bacteria | 2146 |
| 480 | Ga0495605_0003232 | 3300046474 | Bacteria | 9782 |
| 481 | Ga0495605_0013410 | 3300046474 | Bacteria | 4516 |
| 482 | Ga0495605_0013696 | 3300046474 | Bacteria | 4456 |
| 483 | Ga0495605_0071613 | 3300046474 | Bacteria | 1636 |
| 484 | Ga0495605_0082794 | 3300046474 | Bacteria | 1498 |
| 485 | Ga0495605_0103420 | 3300046474 | Bacteria | 1306 |
| 486 | Ga0495605_0105953 | 3300046474 | Bacteria | 1287 |
| 487 | Ga0495605_0190560 | 3300046474 | Bacteria | 897 |
| 488 | Ga0495605_0195503 | 3300046474 | Bacteria | 883 |
| 489 | Ga0495605_0224230 | 3300046474 | Bacteria | 811 |
| 490 | Ga0495639_0181988 | 3300046475 | Bacteria | 1023 |
| 491 | Ga0495639_0570768 | 3300046475 | Bacteria | 580 |
| 492 | Ga0495584_0002812 | 3300046491 | Bacteria | 9712 |
| 493 | Ga0495584_0020283 | 3300046491 | Bacteria | 3378 |
| 494 | Ga0495584_0051866 | 3300046491 | Bacteria | 2064 |
| 495 | Ga0495584_0060945 | 3300046491 | Bacteria | 1896 |
| 496 | Ga0495584_0075775 | 3300046491 | Bacteria | 1691 |
| 497 | Ga0495584_0081139 | 3300046491 | Bacteria | 1632 |
| 498 | Ga0495584_0103631 | 3300046491 | Bacteria | 1438 |
| 499 | Ga0495584_0113268 | 3300046491 | Bacteria | 1372 |
| 500 | Ga0495584_0120831 | 3300046491 | Bacteria | 1326 |
| 501 | Ga0495584_0125919 | 3300046491 | Bacteria | 1298 |
| 502 | Ga0495584_0167318 | 3300046491 | Bacteria | 1117 |
| 503 | Ga0495584_0287350 | 3300046491 | Bacteria | 835 |
| 504 | Ga0495584_0355186 | 3300046491 | Bacteria | 744 |
| 505 | Ga0495584_0452034 | 3300046491 | Bacteria | 653 |
| 506 | Ga0495584_0502519 | 3300046491 | Bacteria | 617 |
| 507 | Ga0495585_0012012 | 3300046492 | Bacteria | 5110 |
| 508 | Ga0495585_0015837 | 3300046492 | Bacteria | 4377 |
| 509 | Ga0495585_0047201 | 3300046492 | Bacteria | 2399 |
| 510 | Ga0495585_0047852 | 3300046492 | Bacteria | 2379 |
| 511 | Ga0495585_0063130 | 3300046492 | Bacteria | 2033 |
| 512 | Ga0495585_0137156 | 3300046492 | Bacteria | 1283 |
| 513 | Ga0495585_0137334 | 3300046492 | Bacteria | 1282 |
| 514 | Ga0495585_0143002 | 3300046492 | Bacteria | 1251 |
| 515 | Ga0495585_0149517 | 3300046492 | Bacteria | 1218 |
| 516 | Ga0495585_0159448 | 3300046492 | Bacteria | 1171 |
| 517 | Ga0495585_0174673 | 3300046492 | Bacteria | 1107 |
| 518 | Ga0495585_0270942 | 3300046492 | Bacteria | 841 |
| 519 | Ga0495585_0290070 | 3300046492 | Bacteria | 806 |
| 520 | Ga0495585_0331337 | 3300046492 | Bacteria | 742 |
| 521 | Ga0495585_0357830 | 3300046492 | Bacteria | 708 |
| 522 | Ga0495585_0406997 | 3300046492 | Bacteria | 654 |
| 523 | Ga0495585_0436392 | 3300046492 | Bacteria | 627 |
| 524 | Ga0495585_0523948 | 3300046492 | Bacteria | 561 |
| 525 | Ga0495594_0020007 | 3300046499 | Bacteria | 3562 |
| 526 | Ga0495594_0186729 | 3300046499 | Bacteria | 1180 |
| 527 | Ga0495594_0302827 | 3300046499 | Bacteria | 910 |
| 528 | Ga0495594_0330178 | 3300046499 | Bacteria | 868 |
| 529 | Ga0495594_0338015 | 3300046499 | Bacteria | 857 |
| 530 | Ga0495594_0660763 | 3300046499 | Bacteria | 591 |
| 531 | Ga0495596_0005175 | 3300046500 | Bacteria | 6209 |
| 532 | Ga0495596_0021654 | 3300046500 | Bacteria | 2621 |
| 533 | Ga0495596_0040721 | 3300046500 | Bacteria | 1833 |
| 534 | Ga0495596_0044056 | 3300046500 | Bacteria | 1757 |
| 535 | Ga0495596_0059412 | 3300046500 | Bacteria | 1490 |
| 536 | Ga0495596_0277946 | 3300046500 | Bacteria | 650 |
| 537 | Ga0495596_0295666 | 3300046500 | Bacteria | 629 |
| 538 | Ga0495596_0296545 | 3300046500 | Bacteria | 628 |
| 539 | Ga0495607_0090940 | 3300046501 | Bacteria | 1653 |
| 540 | Ga0495607_0099837 | 3300046501 | Bacteria | 1556 |
| 541 | Ga0495607_0123713 | 3300046501 | Bacteria | 1354 |
| 542 | Ga0495607_0141517 | 3300046501 | Bacteria | 1240 |
| 543 | Ga0495607_0162714 | 3300046501 | Bacteria | 1132 |
| 544 | Ga0495607_0196673 | 3300046501 | Bacteria | 1000 |
| 545 | Ga0495607_0283948 | 3300046501 | Bacteria | 784 |
| 546 | Ga0495607_0379756 | 3300046501 | Bacteria | 646 |
| 547 | Ga0495583_0000310 | 3300046506 | Bacteria | 77200 |
| 548 | Ga0495583_0006309 | 3300046506 | Bacteria | 7786 |
| 549 | Ga0495583_0008959 | 3300046506 | Bacteria | 6037 |
| 550 | Ga0495583_0013755 | 3300046506 | Bacteria | 4495 |
| 551 | Ga0495583_0039755 | 3300046506 | Bacteria | 2213 |
| 552 | Ga0495583_0041060 | 3300046506 | Bacteria | 2169 |
| 553 | Ga0495583_0047710 | 3300046506 | Bacteria | 1968 |
| 554 | Ga0495583_0094961 | 3300046506 | Bacteria | 1279 |
| 555 | Ga0495583_0096954 | 3300046506 | Bacteria | 1262 |
| 556 | Ga0495583_0122294 | 3300046506 | Bacteria | 1094 |
| 557 | Ga0495583_0131777 | 3300046506 | Bacteria | 1045 |
| 558 | Ga0495583_0197012 | 3300046506 | Bacteria | 819 |
| 559 | Ga0495583_0251356 | 3300046506 | Bacteria | 709 |
| 560 | Ga0495606_0007181 | 3300046507 | Bacteria | 10052 |
| 561 | Ga0495606_0013036 | 3300046507 | Bacteria | 6605 |
| 562 | Ga0495606_0019502 | 3300046507 | Bacteria | 5042 |
| 563 | Ga0495606_0039988 | 3300046507 | Bacteria | 3154 |
| 564 | Ga0495606_0108118 | 3300046507 | Bacteria | 1681 |
| 565 | Ga0495606_0109444 | 3300046507 | Bacteria | 1668 |
| 566 | Ga0495606_0148706 | 3300046507 | Bacteria | 1376 |
| 567 | Ga0495606_0149612 | 3300046507 | Bacteria | 1371 |
| 568 | Ga0495606_0193919 | 3300046507 | Bacteria | 1162 |
| 569 | Ga0495606_0217296 | 3300046507 | Bacteria | 1079 |
| 570 | Ga0495606_0284940 | 3300046507 | Bacteria | 901 |
| 571 | Ga0495606_0293819 | 3300046507 | Bacteria | 883 |
| 572 | Ga0495606_0313019 | 3300046507 | Bacteria | 846 |
| 573 | Ga0495606_0325847 | 3300046507 | Bacteria | 823 |
| 574 | Ga0495606_0379068 | 3300046507 | Bacteria | 742 |
| 575 | Ga0495606_0435842 | 3300046507 | Bacteria | 674 |
| 576 | Ga0495606_0526404 | 3300046507 | Bacteria | 592 |
| 577 | Ga0495608_0027939 | 3300046511 | Bacteria | 3835 |
| 578 | Ga0495608_0087527 | 3300046511 | Bacteria | 2017 |
| 579 | Ga0495610_0003877 | 3300046512 | Bacteria | 11361 |
| 580 | Ga0495610_0018155 | 3300046512 | Bacteria | 3981 |
| 581 | Ga0495610_0023962 | 3300046512 | Bacteria | 3303 |
| 582 | Ga0495610_0027750 | 3300046512 | Bacteria | 3003 |
| 583 | Ga0495610_0198124 | 3300046512 | Bacteria | 824 |
| 584 | Ga0495610_0203181 | 3300046512 | Bacteria | 810 |
| 585 | Ga0495616_0002539 | 3300046513 | Bacteria | 12051 |
| 586 | Ga0495616_0020539 | 3300046513 | Bacteria | 3590 |
| 587 | Ga0495616_0022828 | 3300046513 | Bacteria | 3374 |
| 588 | Ga0495616_0103362 | 3300046513 | Bacteria | 1333 |
| 589 | Ga0495616_0160497 | 3300046513 | Bacteria | 1011 |
| 590 | Ga0495616_0188240 | 3300046513 | Bacteria | 913 |
| 591 | Ga0495616_0209358 | 3300046513 | Bacteria | 853 |
| 592 | Ga0495616_0322294 | 3300046513 | Bacteria | 648 |
| 593 | Ga0495618_0079070 | 3300046514 | Bacteria | 2097 |
| 594 | Ga0495618_0606092 | 3300046514 | Bacteria | 651 |
| 595 | Ga0495620_0011229 | 3300046515 | Bacteria | 4681 |
| 596 | Ga0495628_0051980 | 3300046516 | Bacteria | 3237 |
| 597 | Ga0495628_0153435 | 3300046516 | Bacteria | 1753 |
| 598 | Ga0495630_0473133 | 3300046517 | Bacteria | 960 |
| 599 | Ga0495630_0528698 | 3300046517 | Bacteria | 904 |
| 600 | Ga0495631_0026738 | 3300046518 | Bacteria | 2645 |
| 601 | Ga0495631_0037499 | 3300046518 | Bacteria | 2159 |
| 602 | Ga0495631_0037577 | 3300046518 | Bacteria | 2156 |
| 603 | Ga0495631_0073566 | 3300046518 | Bacteria | 1475 |
| 604 | Ga0495631_0091500 | 3300046518 | Bacteria | 1309 |
| 605 | Ga0495631_0093621 | 3300046518 | Bacteria | 1293 |
| 606 | Ga0495631_0103090 | 3300046518 | Bacteria | 1227 |
| 607 | Ga0495631_0106058 | 3300046518 | Bacteria | 1208 |
| 608 | Ga0495631_0174114 | 3300046518 | Bacteria | 922 |
| 609 | Ga0495631_0182275 | 3300046518 | Bacteria | 899 |
| 610 | Ga0495631_0211047 | 3300046518 | Bacteria | 829 |
| 611 | Ga0495631_0269289 | 3300046518 | Bacteria | 725 |
| 612 | Ga0495632_0041954 | 3300046519 | Bacteria | 2295 |
| 613 | Ga0495632_0052841 | 3300046519 | Bacteria | 1996 |
| 614 | Ga0495632_0112463 | 3300046519 | Bacteria | 1277 |
| 615 | Ga0495632_0154007 | 3300046519 | Bacteria | 1061 |
| 616 | Ga0495632_0166880 | 3300046519 | Bacteria | 1012 |
| 617 | Ga0495632_0195587 | 3300046519 | Bacteria | 922 |
| 618 | Ga0495637_0001714 | 3300046520 | Bacteria | 12614 |
| 619 | Ga0495637_0013614 | 3300046520 | Bacteria | 3857 |
| 620 | Ga0495637_0027010 | 3300046520 | Bacteria | 2571 |
| 621 | Ga0495637_0044618 | 3300046520 | Bacteria | 1886 |
| 622 | Ga0495637_0074308 | 3300046520 | Bacteria | 1365 |
| 623 | Ga0495637_0107325 | 3300046520 | Bacteria | 1085 |
| 624 | Ga0495637_0294839 | 3300046520 | Bacteria | 576 |
| 625 | Ga0495643_0010644 | 3300046522 | Bacteria | 5651 |
| 626 | Ga0495643_0032093 | 3300046522 | Bacteria | 2917 |
| 627 | Ga0495643_0065304 | 3300046522 | Bacteria | 1921 |
| 628 | Ga0495643_0066699 | 3300046522 | Bacteria | 1897 |
| 629 | Ga0495643_0078750 | 3300046522 | Bacteria | 1719 |
| 630 | Ga0495643_0081093 | 3300046522 | Bacteria | 1687 |
| 631 | Ga0495643_0085218 | 3300046522 | Bacteria | 1638 |
| 632 | Ga0495643_0091504 | 3300046522 | Bacteria | 1568 |
| 633 | Ga0495643_0118867 | 3300046522 | Bacteria | 1337 |
| 634 | Ga0495643_0139286 | 3300046522 | Bacteria | 1211 |
| 635 | Ga0495643_0192027 | 3300046522 | Bacteria | 985 |
| 636 | Ga0495643_0221022 | 3300046522 | Bacteria | 898 |
| 637 | Ga0495643_0226757 | 3300046522 | Bacteria | 883 |
| 638 | Ga0495644_0027051 | 3300046523 | Bacteria | 2174 |
| 639 | Ga0495644_0035051 | 3300046523 | Bacteria | 1894 |
| 640 | Ga0495644_0083860 | 3300046523 | Bacteria | 1201 |
| 641 | Ga0495644_0084397 | 3300046523 | Bacteria | 1197 |
| 642 | Ga0495644_0088545 | 3300046523 | Bacteria | 1167 |
| 643 | Ga0495644_0098570 | 3300046523 | Bacteria | 1105 |
| 644 | Ga0495644_0112630 | 3300046523 | Bacteria | 1032 |
| 645 | Ga0495644_0113788 | 3300046523 | Bacteria | 1027 |
| 646 | Ga0495644_0120039 | 3300046523 | Bacteria | 999 |
| 647 | Ga0495648_0013276 | 3300046524 | Bacteria | 6100 |
| 648 | Ga0495648_0034037 | 3300046524 | Bacteria | 3321 |
| 649 | Ga0495648_0042742 | 3300046524 | Bacteria | 2848 |
| 650 | Ga0495648_0069259 | 3300046524 | Bacteria | 2054 |
| 651 | Ga0495648_0107232 | 3300046524 | Bacteria | 1527 |
| 652 | Ga0495648_0167280 | 3300046524 | Bacteria | 1130 |
| 653 | Ga0495648_0175469 | 3300046524 | Bacteria | 1094 |
| 654 | Ga0495648_0179256 | 3300046524 | Bacteria | 1078 |
| 655 | Ga0495663_0010607 | 3300046525 | Bacteria | 2563 |
| 656 | Ga0495663_0031792 | 3300046525 | Bacteria | 1569 |
| 657 | Ga0495663_0093960 | 3300046525 | Bacteria | 980 |
| 658 | Ga0495663_0123673 | 3300046525 | Bacteria | 868 |
| 659 | Ga0495663_0150239 | 3300046525 | Bacteria | 794 |
| 660 | Ga0495663_0181453 | 3300046525 | Bacteria | 729 |
| 661 | Ga0495666_0087815 | 3300046526 | Bacteria | 1468 |
| 662 | Ga0495666_0178036 | 3300046526 | Bacteria | 982 |
| 663 | Ga0495666_0244369 | 3300046526 | Bacteria | 818 |
| 664 | Ga0495666_0268240 | 3300046526 | Bacteria | 775 |
| 665 | Ga0495666_0293812 | 3300046526 | Bacteria | 735 |
| 666 | Ga0495642_0004349 | 3300046528 | Bacteria | 5500 |
| 667 | Ga0495642_0021122 | 3300046528 | Bacteria | 2559 |
| 668 | Ga0495642_0027378 | 3300046528 | Bacteria | 2268 |
| 669 | Ga0495642_0048979 | 3300046528 | Bacteria | 1734 |
| 670 | Ga0495642_0052249 | 3300046528 | Bacteria | 1682 |
| 671 | Ga0495642_0061666 | 3300046528 | Bacteria | 1556 |
| 672 | Ga0495642_0066277 | 3300046528 | Bacteria | 1504 |
| 673 | Ga0495642_0067965 | 3300046528 | Bacteria | 1486 |
| 674 | Ga0495642_0096136 | 3300046528 | Bacteria | 1257 |
| 675 | Ga0495642_0115352 | 3300046528 | Bacteria | 1150 |
| 676 | Ga0495642_0124442 | 3300046528 | Bacteria | 1107 |
| 677 | Ga0495642_0127967 | 3300046528 | Bacteria | 1092 |
| 678 | Ga0495642_0178962 | 3300046528 | Bacteria | 922 |
| 679 | Ga0495642_0182863 | 3300046528 | Bacteria | 912 |
| 680 | Ga0495642_0213288 | 3300046528 | Bacteria | 842 |
| 681 | Ga0495642_0324610 | 3300046528 | Bacteria | 675 |
| 682 | Ga0495652_0027829 | 3300046529 | Bacteria | 4980 |
| 683 | Ga0495652_0035148 | 3300046529 | Bacteria | 4362 |
| 684 | Ga0495652_0271463 | 3300046529 | Bacteria | 1246 |
| 685 | Ga0495652_0314968 | 3300046529 | Bacteria | 1132 |
| 686 | Ga0495652_0503440 | 3300046529 | Bacteria | 839 |
| 687 | Ga0495654_0000115 | 3300046530 | Bacteria | 91440 |
| 688 | Ga0495654_0065073 | 3300046530 | Bacteria | 1741 |
| 689 | Ga0495654_0077712 | 3300046530 | Bacteria | 1561 |
| 690 | Ga0495654_0082162 | 3300046530 | Bacteria | 1508 |
| 691 | Ga0495654_0091742 | 3300046530 | Bacteria | 1408 |
| 692 | Ga0495654_0115950 | 3300046530 | Bacteria | 1217 |
| 693 | Ga0495654_0160159 | 3300046530 | Bacteria | 988 |
| 694 | Ga0495654_0168280 | 3300046530 | Bacteria | 957 |
| 695 | Ga0495665_0046360 | 3300046531 | Bacteria | 2307 |
| 696 | Ga0495665_0055908 | 3300046531 | Bacteria | 2083 |
| 697 | Ga0495665_0081402 | 3300046531 | Bacteria | 1702 |
| 698 | Ga0495665_0192065 | 3300046531 | Bacteria | 1059 |
| 699 | Ga0495665_0482052 | 3300046531 | Bacteria | 625 |
| 700 | Ga0495640_0305576 | 3300046533 | Bacteria | 987 |
| 701 | Ga0495640_0307279 | 3300046533 | Bacteria | 984 |
| 702 | Ga0495586_0034290 | 3300046535 | Bacteria | 2725 |
| 703 | Ga0495586_0052978 | 3300046535 | Bacteria | 2197 |
| 704 | Ga0495586_0121477 | 3300046535 | Bacteria | 1459 |
| 705 | Ga0495587_0015602 | 3300046536 | Bacteria | 4739 |
| 706 | Ga0495587_0118398 | 3300046536 | Bacteria | 1517 |
| 707 | Ga0495587_0246276 | 3300046536 | Bacteria | 1005 |
| 708 | Ga0495587_0334153 | 3300046536 | Bacteria | 845 |
| 709 | Ga0495598_0217997 | 3300046537 | Bacteria | 695 |
| 710 | Ga0495598_0264374 | 3300046537 | Bacteria | 641 |
| 711 | Ga0495609_0002112 | 3300046538 | Bacteria | 12496 |
| 712 | Ga0495609_0003741 | 3300046538 | Bacteria | 8588 |
| 713 | Ga0495609_0005231 | 3300046538 | Bacteria | 6903 |
| 714 | Ga0495609_0010718 | 3300046538 | Bacteria | 4385 |
| 715 | Ga0495609_0073530 | 3300046538 | Bacteria | 1499 |
| 716 | Ga0495609_0088916 | 3300046538 | Bacteria | 1344 |
| 717 | Ga0495609_0098226 | 3300046538 | Bacteria | 1269 |
| 718 | Ga0495609_0135374 | 3300046538 | Bacteria | 1053 |
| 719 | Ga0495609_0138755 | 3300046538 | Bacteria | 1038 |
| 720 | Ga0495609_0324097 | 3300046538 | Bacteria | 624 |
| 721 | Ga0495621_0124882 | 3300046539 | Bacteria | 997 |
| 722 | Ga0495621_0129299 | 3300046539 | Bacteria | 981 |
| 723 | Ga0495621_0239139 | 3300046539 | Bacteria | 739 |
| 724 | Ga0495597_0008648 | 3300046542 | Bacteria | 5090 |
| 725 | Ga0495597_0039483 | 3300046542 | Bacteria | 2113 |
| 726 | Ga0495597_0051584 | 3300046542 | Bacteria | 1813 |
| 727 | Ga0495597_0071899 | 3300046542 | Bacteria | 1488 |
| 728 | Ga0495597_0090026 | 3300046542 | Bacteria | 1303 |
| 729 | Ga0495597_0098005 | 3300046542 | Bacteria | 1238 |
| 730 | Ga0495597_0112166 | 3300046542 | Bacteria | 1142 |
| 731 | Ga0495597_0123957 | 3300046542 | Bacteria | 1075 |
| 732 | Ga0495597_0137308 | 3300046542 | Bacteria | 1010 |
| 733 | Ga0495597_0173986 | 3300046542 | Bacteria | 872 |
| 734 | Ga0495597_0184857 | 3300046542 | Bacteria | 840 |
| 735 | Ga0495597_0196766 | 3300046542 | Bacteria | 808 |
| 736 | Ga0495645_0099543 | 3300046543 | Bacteria | 2068 |
| 737 | Ga0495645_0158047 | 3300046543 | Bacteria | 1569 |
| 738 | Ga0495645_0380992 | 3300046543 | Bacteria | 902 |
| 739 | Ga0495622_0010681 | 3300046557 | Bacteria | 4235 |
| 740 | Ga0495622_0075497 | 3300046557 | Bacteria | 1553 |
| 741 | Ga0495622_0087025 | 3300046557 | Bacteria | 1436 |
| 742 | Ga0495622_0142933 | 3300046557 | Bacteria | 1086 |
| 743 | Ga0495622_0143997 | 3300046557 | Bacteria | 1081 |
| 744 | Ga0495622_0197854 | 3300046557 | Bacteria | 896 |
| 745 | Ga0495622_0202751 | 3300046557 | Bacteria | 883 |
| 746 | Ga0495622_0209861 | 3300046557 | Bacteria | 865 |
| 747 | Ga0495622_0213533 | 3300046557 | Bacteria | 856 |
| 748 | Ga0495633_0016754 | 3300046558 | Bacteria | 3768 |
| 749 | Ga0495633_0040031 | 3300046558 | Bacteria | 2234 |
| 750 | Ga0495633_0046083 | 3300046558 | Bacteria | 2063 |
| 751 | Ga0495633_0047892 | 3300046558 | Bacteria | 2020 |
| 752 | Ga0495633_0069829 | 3300046558 | Bacteria | 1639 |
| 753 | Ga0495633_0113004 | 3300046558 | Bacteria | 1259 |
| 754 | Ga0495633_0131615 | 3300046558 | Bacteria | 1157 |
| 755 | Ga0495633_0171891 | 3300046558 | Bacteria | 998 |
| 756 | Ga0495633_0254752 | 3300046558 | Bacteria | 800 |
| 757 | Ga0495633_0276289 | 3300046558 | Bacteria | 764 |
| 758 | Ga0495633_0282116 | 3300046558 | Bacteria | 755 |
| 759 | Ga0495633_0300229 | 3300046558 | Bacteria | 729 |
| 760 | Ga0495633_0345992 | 3300046558 | Bacteria | 674 |
| 761 | Ga0495633_0359431 | 3300046558 | Bacteria | 659 |
| 762 | Ga0495667_0076074 | 3300046559 | Bacteria | 2184 |
| 763 | Ga0495656_0006272 | 3300046615 | Bacteria | 4164 |
| 764 | Ga0495656_0070784 | 3300046615 | Bacteria | 1548 |
| 765 | Ga0495656_0101671 | 3300046615 | Bacteria | 1330 |
| 766 | Ga0495656_0150503 | 3300046615 | Bacteria | 1123 |
| 767 | Ga0495656_0288364 | 3300046615 | Bacteria | 838 |
| 768 | Ga0495656_0302232 | 3300046615 | Bacteria | 820 |
| 769 | Ga0495656_0310447 | 3300046615 | Bacteria | 810 |
| 770 | Ga0495668_0007707 | 3300046616 | Bacteria | 6842 |
| 771 | Ga0495668_0020876 | 3300046616 | Bacteria | 3761 |
| 772 | Ga0495668_0025580 | 3300046616 | Bacteria | 3353 |
| 773 | Ga0495668_0054798 | 3300046616 | Bacteria | 2202 |
| 774 | Ga0495668_0057793 | 3300046616 | Bacteria | 2140 |
| 775 | Ga0495668_0067174 | 3300046616 | Bacteria | 1972 |
| 776 | Ga0495668_0102990 | 3300046616 | Bacteria | 1561 |
| 777 | Ga0495668_0157367 | 3300046616 | Bacteria | 1244 |
| 778 | Ga0495668_0216198 | 3300046616 | Bacteria | 1049 |
| 779 | Ga0495668_0216973 | 3300046616 | Bacteria | 1047 |
| 780 | Ga0495668_0244514 | 3300046616 | Bacteria | 982 |
| 781 | Ga0495668_0283014 | 3300046616 | Bacteria | 908 |
| 782 | Ga0495668_0316831 | 3300046616 | Bacteria | 855 |
| 783 | Ga0495668_0438164 | 3300046616 | Bacteria | 719 |
| 784 | Ga0495668_0572655 | 3300046616 | Bacteria | 623 |
| 785 | Ga0495668_0810551 | 3300046616 | Bacteria | 518 |
| 786 | Ga0495634_0019079 | 3300046642 | Bacteria | 4874 |
| 787 | Ga0495634_0192943 | 3300046642 | Bacteria | 1269 |
| 788 | Ga0495611_0013452 | 3300046648 | Bacteria | 3484 |
| 789 | Ga0495611_0051565 | 3300046648 | Bacteria | 1854 |
| 790 | Ga0495611_0066175 | 3300046648 | Bacteria | 1647 |
| 791 | Ga0495611_0077598 | 3300046648 | Bacteria | 1523 |
| 792 | Ga0495611_0099340 | 3300046648 | Bacteria | 1350 |
| 793 | Ga0495611_0167304 | 3300046648 | Bacteria | 1027 |
| 794 | Ga0495611_0191501 | 3300046648 | Bacteria | 954 |
| 795 | Ga0495611_0309654 | 3300046648 | Bacteria | 727 |
| 796 | Ga0495625_0020104 | 3300046660 | Bacteria | 5160 |
| 797 | Ga0495625_0021030 | 3300046660 | Bacteria | 5029 |
| 798 | Ga0495625_0022675 | 3300046660 | Bacteria | 4809 |
| 799 | Ga0495625_0053638 | 3300046660 | Bacteria | 2882 |
| 800 | Ga0495625_0078068 | 3300046660 | Bacteria | 2311 |
| 801 | Ga0495625_0134180 | 3300046660 | Bacteria | 1675 |
| 802 | Ga0495625_0263877 | 3300046660 | Bacteria | 1114 |
| 803 | Ga0495625_0322930 | 3300046660 | Bacteria | 982 |
| 804 | Ga0495625_0347986 | 3300046660 | Bacteria | 937 |
| 805 | Ga0495635_0014432 | 3300046663 | Bacteria | 5526 |
| 806 | Ga0495635_0068579 | 3300046663 | Bacteria | 2432 |
| 807 | Ga0495659_0012672 | 3300046664 | Bacteria | 2735 |
| 808 | Ga0495659_0020773 | 3300046664 | Bacteria | 2208 |
| 809 | Ga0495659_0047516 | 3300046664 | Bacteria | 1552 |
| 810 | Ga0495659_0121116 | 3300046664 | Bacteria | 1030 |
| 811 | Ga0495659_0309852 | 3300046664 | Bacteria | 668 |
| 812 | Ga0495659_0447522 | 3300046664 | Bacteria | 562 |
| 813 | Ga0495659_0470245 | 3300046664 | Bacteria | 549 |
| 814 | Ga0495661_0010669 | 3300046665 | Bacteria | 6258 |
| 815 | Ga0495661_0018478 | 3300046665 | Bacteria | 4584 |
| 816 | Ga0495661_0058552 | 3300046665 | Bacteria | 2296 |
| 817 | Ga0495661_0058855 | 3300046665 | Bacteria | 2288 |
| 818 | Ga0495661_0077557 | 3300046665 | Bacteria | 1924 |
| 819 | Ga0495661_0088865 | 3300046665 | Bacteria | 1762 |
| 820 | Ga0495661_0115856 | 3300046665 | Bacteria | 1487 |
| 821 | Ga0495661_0124105 | 3300046665 | Bacteria | 1422 |
| 822 | Ga0495661_0149912 | 3300046665 | Bacteria | 1260 |
| 823 | Ga0495661_0153590 | 3300046665 | Bacteria | 1241 |
| 824 | Ga0495661_0156350 | 3300046665 | Bacteria | 1227 |
| 825 | Ga0495661_0167032 | 3300046665 | Bacteria | 1176 |
| 826 | Ga0495661_0199840 | 3300046665 | Bacteria | 1047 |
| 827 | Ga0495661_0223551 | 3300046665 | Bacteria | 974 |
| 828 | Ga0495661_0228249 | 3300046665 | Bacteria | 961 |
| 829 | Ga0495661_0241389 | 3300046665 | Bacteria | 926 |
| 830 | Ga0495661_0258570 | 3300046665 | Bacteria | 885 |
| 831 | Ga0495661_0397778 | 3300046665 | Bacteria | 670 |
| 832 | Ga0495661_0465733 | 3300046665 | Bacteria | 606 |
| 833 | Ga0495661_0478009 | 3300046665 | Bacteria | 596 |
| 834 | Ga0495661_0510115 | 3300046665 | Bacteria | 572 |
| 835 | Ga0495588_0010876 | 3300046674 | Bacteria | 4252 |
| 836 | Ga0495588_0014904 | 3300046674 | Bacteria | 3730 |
| 837 | Ga0495588_0040459 | 3300046674 | Bacteria | 2377 |
| 838 | Ga0495588_0062419 | 3300046674 | Bacteria | 1931 |
| 839 | Ga0495588_0114119 | 3300046674 | Bacteria | 1423 |
| 840 | Ga0495588_0120582 | 3300046674 | Bacteria | 1382 |
| 841 | Ga0495588_0126731 | 3300046674 | Bacteria | 1346 |
| 842 | Ga0495588_0169163 | 3300046674 | Bacteria | 1155 |
| 843 | Ga0495588_0269792 | 3300046674 | Bacteria | 896 |
| 844 | Ga0495588_0284320 | 3300046674 | Bacteria | 871 |
| 845 | Ga0495588_0383066 | 3300046674 | Bacteria | 738 |
| 846 | Ga0495588_0459929 | 3300046674 | Bacteria | 667 |
| 847 | Ga0495657_0029648 | 3300046675 | Bacteria | 3836 |
| 848 | Ga0495657_0353281 | 3300046675 | Bacteria | 870 |
| 849 | Ga0495599_0007721 | 3300046678 | Bacteria | 6532 |
| 850 | Ga0495599_0184025 | 3300046678 | Bacteria | 1287 |
| 851 | Ga0495599_0416237 | 3300046678 | Bacteria | 799 |
| 852 | Ga0495623_0068842 | 3300046679 | Bacteria | 2206 |
| 853 | Ga0495623_0076509 | 3300046679 | Bacteria | 2076 |
| 854 | Ga0495623_0205957 | 3300046679 | Bacteria | 1128 |
| 855 | Ga0495623_0218757 | 3300046679 | Bacteria | 1086 |
| 856 | Ga0495623_0283811 | 3300046679 | Bacteria | 920 |
| 857 | Ga0495623_0312291 | 3300046679 | Bacteria | 865 |
| 858 | Ga0495623_0380325 | 3300046679 | Bacteria | 763 |
| 859 | Ga0495646_0112772 | 3300046680 | Bacteria | 1546 |
| 860 | Ga0495646_0181463 | 3300046680 | Bacteria | 1155 |
| 861 | Ga0495646_0253356 | 3300046680 | Bacteria | 942 |
| 862 | Ga0495646_0333161 | 3300046680 | Bacteria | 797 |
| 863 | Ga0495646_0637124 | 3300046680 | Bacteria | 539 |
| 864 | Ga0495658_0224387 | 3300046683 | Bacteria | 1177 |
| 865 | Ga0495669_0021103 | 3300046684 | Bacteria | 2824 |
| 866 | Ga0495669_0056751 | 3300046684 | Bacteria | 1765 |
| 867 | Ga0495669_0065000 | 3300046684 | Bacteria | 1655 |
| 868 | Ga0495669_0067620 | 3300046684 | Bacteria | 1624 |
| 869 | Ga0495669_0086910 | 3300046684 | Bacteria | 1440 |
| 870 | Ga0495669_0112795 | 3300046684 | Bacteria | 1270 |
| 871 | Ga0495669_0215544 | 3300046684 | Bacteria | 919 |
| 872 | Ga0495669_0221649 | 3300046684 | Bacteria | 906 |
| 873 | Ga0495613_0065356 | 3300046689 | Bacteria | 2658 |
| 874 | Ga0495613_0253770 | 3300046689 | Bacteria | 1227 |
| 875 | Ga0495613_0394069 | 3300046689 | Bacteria | 945 |
| 876 | Ga0495624_0078632 | 3300046690 | Bacteria | 2045 |
| 877 | Ga0495624_0121558 | 3300046690 | Bacteria | 1603 |
| 878 | Ga0495624_0123298 | 3300046690 | Bacteria | 1591 |
| 879 | Ga0495624_0777347 | 3300046690 | Bacteria | 566 |
| 880 | Ga0495670_0042081 | 3300046691 | Bacteria | 2279 |
| 881 | Ga0495670_0044966 | 3300046691 | Bacteria | 2204 |
| 882 | Ga0495670_0046118 | 3300046691 | Bacteria | 2176 |
| 883 | Ga0495670_0082751 | 3300046691 | Bacteria | 1636 |
| 884 | Ga0495670_0152880 | 3300046691 | Bacteria | 1210 |
| 885 | Ga0495670_0165436 | 3300046691 | Bacteria | 1163 |
| 886 | Ga0495670_0172779 | 3300046691 | Bacteria | 1138 |
| 887 | Ga0495670_0200169 | 3300046691 | Bacteria | 1057 |
| 888 | Ga0495670_0298224 | 3300046691 | Bacteria | 863 |
| 889 | Ga0495670_0329266 | 3300046691 | Bacteria | 820 |
| 890 | Ga0495670_0337191 | 3300046691 | Bacteria | 810 |
| 891 | Ga0495670_0638070 | 3300046691 | Bacteria | 580 |
| 892 | Ga0495671_0016693 | 3300046692 | Bacteria | 3916 |
| 893 | Ga0495671_0029072 | 3300046692 | Bacteria | 2841 |
| 894 | Ga0495671_0049468 | 3300046692 | Bacteria | 2095 |
| 895 | Ga0495671_0078583 | 3300046692 | Bacteria | 1617 |
| 896 | Ga0495671_0116767 | 3300046692 | Bacteria | 1302 |
| 897 | Ga0495671_0145008 | 3300046692 | Bacteria | 1156 |
| 898 | Ga0495671_0182117 | 3300046692 | Bacteria | 1020 |
| 899 | Ga0495671_0210520 | 3300046692 | Bacteria | 942 |
| 900 | Ga0495671_0398155 | 3300046692 | Bacteria | 659 |
| 901 | Ga0495649_0014801 | 3300046694 | Bacteria | 4457 |
| 902 | Ga0495649_0024341 | 3300046694 | Bacteria | 3376 |
| 903 | Ga0495649_0053355 | 3300046694 | Bacteria | 2188 |
| 904 | Ga0495649_0060727 | 3300046694 | Bacteria | 2033 |
| 905 | Ga0495649_0120385 | 3300046694 | Bacteria | 1388 |
| 906 | Ga0495649_0184805 | 3300046694 | Bacteria | 1086 |
| 907 | Ga0495649_0198523 | 3300046694 | Bacteria | 1042 |
| 908 | Ga0495649_0482298 | 3300046694 | Bacteria | 617 |
| 909 | Ga0495649_0588584 | 3300046694 | Bacteria | 549 |
| 910 | Ga0495589_0014565 | 3300046794 | Bacteria | 4046 |
| 911 | Ga0495589_0022141 | 3300046794 | Bacteria | 3245 |
| 912 | Ga0495589_0043731 | 3300046794 | Bacteria | 2228 |
| 913 | Ga0495589_0085487 | 3300046794 | Bacteria | 1532 |
| 914 | Ga0495589_0085914 | 3300046794 | Bacteria | 1528 |
| 915 | Ga0495589_0088958 | 3300046794 | Bacteria | 1499 |
| 916 | Ga0495589_0106067 | 3300046794 | Bacteria | 1357 |
| 917 | Ga0495589_0120451 | 3300046794 | Bacteria | 1263 |
| 918 | Ga0495589_0137014 | 3300046794 | Bacteria | 1173 |
| 919 | Ga0495589_0177569 | 3300046794 | Bacteria | 1011 |
| 920 | Ga0495589_0228246 | 3300046794 | Bacteria | 873 |
| 921 | Ga0495589_0306391 | 3300046794 | Bacteria | 735 |
| 922 | Ga0495589_0328935 | 3300046794 | Bacteria | 705 |
| 923 | Ga0495589_0411505 | 3300046794 | Bacteria | 620 |
| 924 | Ga0495600_0011381 | 3300046809 | Bacteria | 5543 |
| 925 | Ga0495600_0075615 | 3300046809 | Bacteria | 2199 |
| 926 | Ga0495600_0169292 | 3300046809 | Bacteria | 1410 |
| 927 | Ga0495600_0300712 | 3300046809 | Bacteria | 1012 |
| 928 | Ga0495660_0003674 | 3300046810 | Bacteria | 9441 |
| 929 | Ga0495660_0007171 | 3300046810 | Bacteria | 6566 |
| 930 | Ga0495660_0030863 | 3300046810 | Bacteria | 3017 |
| 931 | Ga0495660_0054740 | 3300046810 | Bacteria | 2161 |
| 932 | Ga0495660_0091402 | 3300046810 | Bacteria | 1581 |
| 933 | Ga0495660_0147915 | 3300046810 | Bacteria | 1162 |
| 934 | Ga0495660_0154468 | 3300046810 | Bacteria | 1130 |
| 935 | Ga0495660_0168230 | 3300046810 | Bacteria | 1069 |
| 936 | Ga0495660_0219733 | 3300046810 | Bacteria | 896 |
| 937 | Ga0495660_0232924 | 3300046810 | Bacteria | 862 |
| 938 | Ga0495660_0308179 | 3300046810 | Bacteria | 715 |
| 939 | Ga0495581_0011795 | 3300047315 | Bacteria | 5059 |
| 940 | Ga0495581_0084029 | 3300047315 | Bacteria | 1844 |
| 941 | Ga0495581_0360631 | 3300047315 | Bacteria | 848 |
| 942 | Ga0495581_0381506 | 3300047315 | Bacteria | 822 |
| 943 | Ga0495581_0723677 | 3300047315 | Bacteria | 573 |
| 944 | Ga0495604_0098589 | 3300047317 | Bacteria | 2152 |
| 945 | Ga0495604_0113202 | 3300047317 | Bacteria | 1975 |
| 946 | Ga0495604_0145750 | 3300047317 | Bacteria | 1687 |
| 947 | Ga0495604_0351376 | 3300047317 | Bacteria | 979 |
| 948 | Ga0495604_0521019 | 3300047317 | Bacteria | 769 |
| 949 | Ga0495636_0006088 | 3300047318 | Bacteria | 4736 |
| 950 | Ga0495636_0006698 | 3300047318 | Bacteria | 4530 |
| 951 | Ga0495636_0007040 | 3300047318 | Bacteria | 4424 |
| 952 | Ga0495636_0022781 | 3300047318 | Bacteria | 2534 |
| 953 | Ga0495636_0162291 | 3300047318 | Bacteria | 1007 |
| 954 | Ga0495636_0287990 | 3300047318 | Bacteria | 766 |
| 955 | Ga0495636_0535779 | 3300047318 | Bacteria | 568 |
| 956 | Ga0495674_0035014 | 3300047319 | Bacteria | 4533 |
| 957 | Ga0495672_0019097 | 3300047320 | Bacteria | 4531 |
| 958 | Ga0495672_0020418 | 3300047320 | Bacteria | 4343 |
| 959 | Ga0495672_0026706 | 3300047320 | Bacteria | 3679 |
| 960 | Ga0495672_0059705 | 3300047320 | Bacteria | 2205 |
| 961 | Ga0495672_0078821 | 3300047320 | Bacteria | 1841 |
| 962 | Ga0495672_0083387 | 3300047320 | Bacteria | 1775 |
| 963 | Ga0495672_0144473 | 3300047320 | Bacteria | 1239 |
| 964 | Ga0495672_0205361 | 3300047320 | Bacteria | 982 |
| 965 | Ga0495672_0350773 | 3300047320 | Bacteria | 685 |
| 966 | Ga0495676_0059819 | 3300047321 | Bacteria | 2989 |
| 967 | Ga0495676_0093491 | 3300047321 | Bacteria | 2242 |
| 968 | Ga0495676_0173448 | 3300047321 | Bacteria | 1516 |
| 969 | Ga0495676_0257446 | 3300047321 | Bacteria | 1188 |
| 970 | Ga0495676_0304389 | 3300047321 | Bacteria | 1074 |
| 971 | Ga0495676_0495608 | 3300047321 | Bacteria | 802 |
| 972 | Ga0495680_0081403 | 3300047322 | Bacteria | 2444 |
| 973 | Ga0495680_0082868 | 3300047322 | Bacteria | 2419 |
| 974 | Ga0495680_0344851 | 3300047322 | Bacteria | 1038 |
| 975 | Ga0495680_0537176 | 3300047322 | Bacteria | 789 |
| 976 | Ga0495683_0025191 | 3300047323 | Bacteria | 3050 |
| 977 | Ga0495683_0037514 | 3300047323 | Bacteria | 2456 |
| 978 | Ga0495683_0070704 | 3300047323 | Bacteria | 1713 |
| 979 | Ga0495683_0140598 | 3300047323 | Bacteria | 1131 |
| 980 | Ga0495683_0142576 | 3300047323 | Bacteria | 1121 |
| 981 | Ga0495683_0151837 | 3300047323 | Bacteria | 1077 |
| 982 | Ga0495683_0186374 | 3300047323 | Bacteria | 944 |
| 983 | Ga0495683_0233898 | 3300047323 | Bacteria | 813 |
| 984 | Ga0495683_0234859 | 3300047323 | Bacteria | 811 |
| 985 | Ga0495683_0322969 | 3300047323 | Bacteria | 657 |
| 986 | Ga0495683_0326250 | 3300047323 | Bacteria | 653 |
| 987 | Ga0495687_000370 | 3300047443 | Bacteria | 56035 |
| 988 | Ga0495687_007822 | 3300047443 | Bacteria | 6222 |
| 989 | Ga0495687_014326 | 3300047443 | Bacteria | 4086 |
| 990 | Ga0495687_024856 | 3300047443 | Bacteria | 2840 |
| 991 | Ga0495687_029913 | 3300047443 | Bacteria | 2513 |
| 992 | Ga0495687_036882 | 3300047443 | Bacteria | 2182 |
| 993 | Ga0495687_088588 | 3300047443 | Bacteria | 1191 |
| 994 | Ga0495687_090810 | 3300047443 | Bacteria | 1169 |
| 995 | Ga0495687_097393 | 3300047443 | Bacteria | 1111 |
| 996 | Ga0495675_0151163 | 3300047444 | Bacteria | 1434 |
| 997 | Ga0495675_0229325 | 3300047444 | Bacteria | 1121 |
| 998 | Ga0495675_0243254 | 3300047444 | Bacteria | 1082 |
| 999 | Ga0495675_0361090 | 3300047444 | Bacteria | 852 |
| 1000 | Ga0495675_0526632 | 3300047444 | Bacteria | 676 |
| 1001 | Ga0495677_0006314 | 3300047445 | Bacteria | 4477 |
| 1002 | Ga0495677_0006510 | 3300047445 | Bacteria | 4412 |
| 1003 | Ga0495677_0026532 | 3300047445 | Bacteria | 2101 |
| 1004 | Ga0495677_0032012 | 3300047445 | Bacteria | 1914 |
| 1005 | Ga0495677_0043835 | 3300047445 | Bacteria | 1640 |
| 1006 | Ga0495677_0070385 | 3300047445 | Bacteria | 1303 |
| 1007 | Ga0495677_0085894 | 3300047445 | Bacteria | 1182 |
| 1008 | Ga0495677_0087226 | 3300047445 | Bacteria | 1173 |
| 1009 | Ga0495677_0089584 | 3300047445 | Bacteria | 1158 |
| 1010 | Ga0495677_0093603 | 3300047445 | Bacteria | 1133 |
| 1011 | Ga0495677_0097213 | 3300047445 | Bacteria | 1112 |
| 1012 | Ga0495677_0181154 | 3300047445 | Bacteria | 816 |
| 1013 | Ga0495677_0215504 | 3300047445 | Bacteria | 747 |
| 1014 | Ga0495677_0278112 | 3300047445 | Bacteria | 656 |
| 1015 | Ga0495677_0280702 | 3300047445 | Bacteria | 653 |
| 1016 | Ga0495679_008823 | 3300047446 | Bacteria | 4069 |
| 1017 | Ga0495679_051789 | 3300047446 | Bacteria | 1229 |
| 1018 | Ga0495679_052553 | 3300047446 | Bacteria | 1218 |
| 1019 | Ga0495679_061198 | 3300047446 | Bacteria | 1103 |
| 1020 | Ga0495679_065665 | 3300047446 | Bacteria | 1055 |
| 1021 | Ga0495679_084892 | 3300047446 | Bacteria | 894 |
| 1022 | Ga0495679_104770 | 3300047446 | Bacteria | 783 |
| 1023 | Ga0495685_001797 | 3300047447 | Bacteria | 6613 |
| 1024 | Ga0495685_049119 | 3300047447 | Bacteria | 1433 |
| 1025 | Ga0495685_051223 | 3300047447 | Bacteria | 1400 |
| 1026 | Ga0495685_059807 | 3300047447 | Bacteria | 1285 |
| 1027 | Ga0495685_096110 | 3300047447 | Bacteria | 979 |
| 1028 | Ga0495685_231982 | 3300047447 | Bacteria | 587 |
| 1029 | Ga0495685_241979 | 3300047447 | Bacteria | 573 |
| 1030 | Ga0495673_0000185 | 3300047469 | Bacteria | 100703 |
| 1031 | Ga0495673_0000338 | 3300047469 | Bacteria | 59988 |
| 1032 | Ga0495673_0002607 | 3300047469 | Bacteria | 12542 |
| 1033 | Ga0495673_0100936 | 3300047469 | Bacteria | 1166 |
| 1034 | Ga0495681_0018699 | 3300047470 | Bacteria | 3808 |
| 1035 | Ga0495681_0030651 | 3300047470 | Bacteria | 2735 |
| 1036 | Ga0495681_0061145 | 3300047470 | Bacteria | 1735 |
| 1037 | Ga0495681_0078367 | 3300047470 | Bacteria | 1480 |
| 1038 | Ga0495681_0106719 | 3300047470 | Bacteria | 1217 |
| 1039 | Ga0495681_0139883 | 3300047470 | Bacteria | 1023 |
| 1040 | Ga0495681_0152247 | 3300047470 | Bacteria | 969 |
| 1041 | Ga0495681_0232725 | 3300047470 | Bacteria | 734 |
| 1042 | Ga0495681_0271659 | 3300047470 | Bacteria | 663 |
| 1043 | Ga0495686_0005000 | 3300047472 | Bacteria | 10648 |
| 1044 | Ga0495686_0041880 | 3300047472 | Bacteria | 2914 |
| 1045 | Ga0495686_0116547 | 3300047472 | Bacteria | 1596 |
| 1046 | Ga0495686_0121709 | 3300047472 | Bacteria | 1554 |
| 1047 | Ga0495686_0203037 | 3300047472 | Bacteria | 1136 |
| 1048 | Ga0495686_0452869 | 3300047472 | Bacteria | 681 |
| 1049 | Ga0495686_0727384 | 3300047472 | Bacteria | 504 |
| 1050 | Ga0495593_0012462 | 3300047673 | Bacteria | 4859 |
| 1051 | Ga0495593_0195327 | 3300047673 | Bacteria | 1017 |
| 1052 | Ga0495593_0374729 | 3300047673 | Bacteria | 711 |
| 1053 | Ga0495593_0682892 | 3300047673 | Bacteria | 515 |
| 1054 | Ga0495602_0058801 | 3300048088 | Bacteria | 3362 |
| 1055 | Ga0495602_0277034 | 3300048088 | Bacteria | 1237 |
| 1056 | Ga0495602_0734444 | 3300048088 | Bacteria | 667 |
| 1057 | Ga0495614_0029810 | 3300048089 | Bacteria | 2347 |
| 1058 | Ga0495614_0060035 | 3300048089 | Bacteria | 1634 |
| 1059 | Ga0495614_0107230 | 3300048089 | Bacteria | 1224 |
| 1060 | Ga0495615_0020588 | 3300048090 | Bacteria | 1480 |
| 1061 | Ga0495615_0042504 | 3300048090 | Bacteria | 1140 |
| 1062 | Ga0495615_0078113 | 3300048090 | Bacteria | 903 |
| 1063 | Ga0495626_0003909 | 3300048091 | Bacteria | 9334 |
| 1064 | Ga0495626_0010744 | 3300048091 | Bacteria | 4868 |
| 1065 | Ga0495626_0012906 | 3300048091 | Bacteria | 4359 |
| 1066 | Ga0495626_0016437 | 3300048091 | Bacteria | 3756 |
| 1067 | Ga0495626_0027831 | 3300048091 | Bacteria | 2745 |
| 1068 | Ga0495626_0032859 | 3300048091 | Bacteria | 2489 |
| 1069 | Ga0495626_0077411 | 3300048091 | Bacteria | 1482 |
| 1070 | Ga0495626_0080378 | 3300048091 | Bacteria | 1449 |
| 1071 | Ga0495626_0081637 | 3300048091 | Bacteria | 1435 |
| 1072 | Ga0495626_0125936 | 3300048091 | Bacteria | 1097 |
| 1073 | Ga0495626_0133404 | 3300048091 | Bacteria | 1058 |
| 1074 | Ga0495626_0345249 | 3300048091 | Bacteria | 581 |
| 1075 | Ga0496100_0018888 | 3300048903 | Bacteria | 4101 |
| 1076 | Ga0496100_0632587 | 3300048903 | Bacteria | 832 |
| 1077 | Ga0496100_0647665 | 3300048903 | Bacteria | 822 |
| 1078 | Ga0496100_0972939 | 3300048903 | Bacteria | 667 |
| 1079 | Ga0496101_0319243 | 3300048904 | Bacteria | 1218 |
| 1080 | Ga0496102_0068828 | 3300048905 | Bacteria | 3248 |
| 1081 | Ga0496102_0088863 | 3300048905 | Bacteria | 2857 |
| 1082 | Ga0496102_0137406 | 3300048905 | Bacteria | 2290 |
| 1083 | Ga0496102_0803991 | 3300048905 | Bacteria | 862 |
| 1084 | Ga0496102_1070135 | 3300048905 | Bacteria | 726 |
| 1085 | Ga0496102_1077448 | 3300048905 | Bacteria | 723 |
| 1086 | Ga0496102_1348585 | 3300048905 | Bacteria | 632 |
| 1087 | Ga0496103_0058673 | 3300048906 | Bacteria | 2391 |
| 1088 | Ga0496103_0070829 | 3300048906 | Bacteria | 2181 |
| 1089 | Ga0496103_0090188 | 3300048906 | Bacteria | 1934 |
| 1090 | Ga0496103_0091802 | 3300048906 | Bacteria | 1916 |
| 1091 | Ga0496103_0180310 | 3300048906 | Bacteria | 1357 |
| 1092 | Ga0496103_0419965 | 3300048906 | Bacteria | 858 |
| 1093 | Ga0496103_0612122 | 3300048906 | Bacteria | 693 |
| 1094 | Ga0496104_0178000 | 3300048907 | Bacteria | 2037 |
| 1095 | Ga0496104_0570097 | 3300048907 | Bacteria | 1042 |
| 1096 | Ga0496104_1134155 | 3300048907 | Bacteria | 685 |
| 1097 | Ga0496105_0442086 | 3300048908 | Bacteria | 1027 |
| 1098 | Ga0496105_0534987 | 3300048908 | Bacteria | 916 |
| 1099 | Ga0496105_0547476 | 3300048908 | Bacteria | 903 |
| 1100 | Ga0496105_0952840 | 3300048908 | Bacteria | 644 |
| 1101 | Ga0496106_0253104 | 3300048909 | Bacteria | 1408 |
| 1102 | Ga0496106_0535103 | 3300048909 | Bacteria | 940 |
| 1103 | Ga0496107_0248001 | 3300048910 | Bacteria | 1325 |
| 1104 | Ga0496107_0398111 | 3300048910 | Bacteria | 1024 |
| 1105 | Ga0496107_0479689 | 3300048910 | Bacteria | 923 |
| 1106 | Ga0496107_0860266 | 3300048910 | Bacteria | 662 |
| 1107 | Ga0496108_0191326 | 3300048911 | Bacteria | 1773 |
| 1108 | Ga0496108_0599219 | 3300048911 | Bacteria | 960 |
| 1109 | Ga0496108_0849703 | 3300048911 | Bacteria | 785 |
| 1110 | Ga0496109_0072916 | 3300048912 | Bacteria | 3155 |
| 1111 | Ga0496109_0186739 | 3300048912 | Bacteria | 1947 |
| 1112 | Ga0496109_0783590 | 3300048912 | Bacteria | 891 |
| 1113 | Ga0496109_1056140 | 3300048912 | Bacteria | 749 |
| 1114 | Ga0496110_0080386 | 3300048913 | Bacteria | 2904 |
| 1115 | Ga0496110_0491583 | 3300048913 | Bacteria | 1117 |
| 1116 | Ga0496110_0690196 | 3300048913 | Bacteria | 922 |
| 1117 | Ga0496110_0861253 | 3300048913 | Bacteria | 811 |
| 1118 | Ga0496110_0936409 | 3300048913 | Bacteria | 773 |
| 1119 | Ga0496110_1164934 | 3300048913 | Bacteria | 679 |
| 1120 | Ga0496111_0091872 | 3300048914 | Bacteria | 2224 |
| 1121 | Ga0496111_0146589 | 3300048914 | Bacteria | 1750 |
| 1122 | Ga0496111_0521994 | 3300048914 | Bacteria | 873 |
| 1123 | Ga0496112_0306153 | 3300048915 | Bacteria | 1534 |
| 1124 | Ga0496113_0099847 | 3300048916 | Bacteria | 2248 |
| 1125 | Ga0496113_0385700 | 3300048916 | Bacteria | 1124 |
| 1126 | Ga0496114_0022403 | 3300048917 | Bacteria | 5149 |
| 1127 | Ga0496114_0289742 | 3300048917 | Bacteria | 1444 |
| 1128 | Ga0496114_0438915 | 3300048917 | Bacteria | 1156 |
| 1129 | Ga0496114_0637577 | 3300048917 | Bacteria | 938 |
| 1130 | Ga0496114_0641742 | 3300048917 | Bacteria | 934 |
| 1131 | Ga0496115_0050867 | 3300048918 | Bacteria | 3321 |
| 1132 | Ga0496115_0221193 | 3300048918 | Bacteria | 1562 |
| 1133 | Ga0496115_0321110 | 3300048918 | Bacteria | 1266 |
| 1134 | Ga0496115_0801713 | 3300048918 | Bacteria | 733 |
| 1135 | Ga0496116_0091755 | 3300048919 | Bacteria | 1845 |
| 1136 | Ga0496116_0253322 | 3300048919 | Bacteria | 874 |
| 1137 | Ga0496118_0183090 | 3300048921 | Bacteria | 1263 |
| 1138 | Ga0496120_0124356 | 3300048923 | Bacteria | 1329 |
| 1139 | Ga0496121_0243249 | 3300048924 | Bacteria | 1252 |
| 1140 | Ga0496121_0329613 | 3300048924 | Bacteria | 1024 |
| 1141 | Ga0496121_0537195 | 3300048924 | Bacteria | 734 |
| 1142 | Ga0496121_0676800 | 3300048924 | Bacteria | 624 |
| 1143 | Ga0496122_0077023 | 3300048925 | Bacteria | 2344 |
| 1144 | Ga0496122_0109128 | 3300048925 | Bacteria | 1822 |
| 1145 | Ga0496122_0194708 | 3300048925 | Bacteria | 1192 |
| 1146 | Ga0496122_0426972 | 3300048925 | Bacteria | 664 |
| 1147 | Ga0496123_0013659 | 3300048926 | Bacteria | 6791 |
| 1148 | Ga0496123_0031651 | 3300048926 | Bacteria | 3845 |
| 1149 | Ga0496123_0069843 | 3300048926 | Bacteria | 2202 |
| 1150 | Ga0496124_0106187 | 3300048927 | Bacteria | 2267 |
| 1151 | Ga0496124_0129517 | 3300048927 | Bacteria | 2006 |
| 1152 | Ga0496124_0132720 | 3300048927 | Bacteria | 1976 |
| 1153 | Ga0496124_0150483 | 3300048927 | Bacteria | 1826 |
| 1154 | Ga0496124_0323784 | 3300048927 | Bacteria | 1102 |
| 1155 | Ga0496124_0348155 | 3300048927 | Bacteria | 1049 |
| 1156 | Ga0496124_0355597 | 3300048927 | Bacteria | 1034 |
| 1157 | Ga0496124_0745176 | 3300048927 | Bacteria | 614 |
| 1158 | Ga0496124_0787945 | 3300048927 | Bacteria | 590 |
| 1159 | Ga0496124_0801049 | 3300048927 | Bacteria | 583 |
| 1160 | Ga0496125_0021606 | 3300048928 | Bacteria | 5998 |
| 1161 | Ga0496125_0060592 | 3300048928 | Bacteria | 3040 |
| 1162 | Ga0496125_0063503 | 3300048928 | Bacteria | 2944 |
| 1163 | Ga0496125_0427486 | 3300048928 | Bacteria | 765 |
| 1164 | Ga0496126_0031527 | 3300048929 | Bacteria | 5006 |
| 1165 | Ga0496126_0345681 | 3300048929 | Bacteria | 1218 |
| 1166 | Ga0496126_0708504 | 3300048929 | Bacteria | 781 |
| 1167 | Ga0501306_000150 | 3300049127 | Bacteria | 4359 |
| 1168 | Ga0501306_003340 | 3300049127 | Bacteria | 1723 |
| 1169 | Ga0501306_009215 | 3300049127 | Bacteria | 1221 |
| 1170 | Ga0501306_058971 | 3300049127 | Bacteria | 629 |
| 1171 | Ga0501306_077581 | 3300049127 | Bacteria | 569 |
| 1172 | Ga0501306_079075 | 3300049127 | Bacteria | 565 |
| 1173 | Ga0501308_000398 | 3300049128 | Bacteria | 2773 |
| 1174 | Ga0501308_002408 | 3300049128 | Bacteria | 1638 |
| 1175 | Ga0501308_018121 | 3300049128 | Bacteria | 859 |
| 1176 | Ga0501309_004241 | 3300049129 | Bacteria | 1663 |
| 1177 | Ga0501309_011386 | 3300049129 | Bacteria | 1159 |
| 1178 | Ga0501310_001072 | 3300049130 | Bacteria | 2465 |
| 1179 | Ga0501310_006078 | 3300049130 | Bacteria | 1258 |
| 1180 | Ga0501310_016049 | 3300049130 | Bacteria | 894 |
| 1181 | Ga0501343_000533 | 3300049132 | Bacteria | 2250 |
| 1182 | Ga0501343_007025 | 3300049132 | Bacteria | 885 |
| 1183 | Ga0501343_010267 | 3300049132 | Bacteria | 763 |
| 1184 | Ga0501304_001138 | 3300049160 | Bacteria | 1639 |
| 1185 | Ga0501304_002860 | 3300049160 | Bacteria | 1229 |
| 1186 | Ga0501304_005072 | 3300049160 | Bacteria | 1021 |
| 1187 | Ga0501304_008888 | 3300049160 | Bacteria | 853 |
| 1188 | Ga0501305_005503 | 3300049161 | Bacteria | 1538 |
| 1189 | Ga0501305_006325 | 3300049161 | Bacteria | 1467 |
| 1190 | Ga0501305_028998 | 3300049161 | Bacteria | 854 |
| 1191 | Ga0501305_047139 | 3300049161 | Bacteria | 715 |
| 1192 | Ga0501305_075734 | 3300049161 | Bacteria | 598 |
| 1193 | Ga0501305_081335 | 3300049161 | Bacteria | 583 |
| 1194 | Ga0501305_082426 | 3300049161 | Bacteria | 580 |
| 1195 | Ga0501307_002498 | 3300049162 | Bacteria | 1720 |
| 1196 | Ga0501307_002525 | 3300049162 | Bacteria | 1715 |
| 1197 | Ga0501307_004154 | 3300049162 | Bacteria | 1463 |
| 1198 | Ga0501307_004969 | 3300049162 | Bacteria | 1383 |
| 1199 | Ga0501307_024948 | 3300049162 | Bacteria | 800 |
| 1200 | Ga0501307_067261 | 3300049162 | Bacteria | 566 |
| 1201 | Ga0495678_006998 | 3300049459 | Bacteria | 5916 |
| 1202 | Ga0495678_025193 | 3300049459 | Bacteria | 2558 |
| 1203 | Ga0495678_027928 | 3300049459 | Bacteria | 2387 |
| 1204 | Ga0495678_059401 | 3300049459 | Bacteria | 1441 |
| 1205 | Ga0495678_066094 | 3300049459 | Bacteria | 1340 |
| 1206 | Ga0495678_069294 | 3300049459 | Bacteria | 1297 |
| 1207 | Ga0495678_091123 | 3300049459 | Bacteria | 1073 |
| 1208 | Ga0495678_092832 | 3300049459 | Bacteria | 1059 |
| 1209 | Ga0495682_0063615 | 3300049460 | Bacteria | 1330 |
| 1210 | Ga0495682_0080123 | 3300049460 | Bacteria | 1174 |
| 1211 | Ga0495682_0124886 | 3300049460 | Bacteria | 921 |
| 1212 | Ga0501297_011034 | 3300049520 | Bacteria | 1031 |
| 1213 | Ga0501311_000165 | 3300049527 | Bacteria | 3696 |
| 1214 | Ga0501311_020593 | 3300049527 | Bacteria | 893 |
| 1215 | Ga0501311_023545 | 3300049527 | Bacteria | 853 |
| 1216 | Ga0501311_089829 | 3300049527 | Bacteria | 532 |
| 1217 | Ga0501312_004623 | 3300049528 | Bacteria | 1633 |
| 1218 | Ga0501312_012905 | 3300049528 | Bacteria | 1155 |
| 1219 | Ga0501312_025618 | 3300049528 | Bacteria | 900 |
| 1220 | Ga0501312_032245 | 3300049528 | Bacteria | 826 |
| 1221 | Ga0501312_053251 | 3300049528 | Bacteria | 687 |
| 1222 | Ga0501312_090417 | 3300049528 | Bacteria | 564 |
| 1223 | Ga0501313_000756 | 3300049529 | Bacteria | 2434 |
| 1224 | Ga0501313_001122 | 3300049529 | Bacteria | 2196 |
| 1225 | Ga0501314_005033 | 3300049530 | Bacteria | 1115 |
| 1226 | Ga0501314_008905 | 3300049530 | Bacteria | 914 |
| 1227 | Ga0501314_021302 | 3300049530 | Bacteria | 676 |
| 1228 | Ga0501315_000556 | 3300049531 | Bacteria | 2665 |
| 1229 | Ga0501315_002286 | 3300049531 | Bacteria | 1779 |
| 1230 | Ga0501315_003217 | 3300049531 | Bacteria | 1616 |
| 1231 | Ga0501315_003289 | 3300049531 | Bacteria | 1603 |
| 1232 | Ga0501315_012963 | 3300049531 | Bacteria | 1038 |
| 1233 | Ga0501315_013154 | 3300049531 | Bacteria | 1033 |
| 1234 | Ga0501315_082020 | 3300049531 | Bacteria | 549 |
| 1235 | Ga0501316_000848 | 3300049532 | Bacteria | 2366 |
| 1236 | Ga0501316_006293 | 3300049532 | Bacteria | 1260 |
| 1237 | Ga0501316_007300 | 3300049532 | Bacteria | 1197 |
| 1238 | Ga0501316_043078 | 3300049532 | Bacteria | 634 |
| 1239 | Ga0501317_016468 | 3300049533 | Bacteria | 959 |
| 1240 | Ga0501317_016650 | 3300049533 | Bacteria | 956 |
| 1241 | Ga0501317_022573 | 3300049533 | Bacteria | 863 |
| 1242 | Ga0501319_026436 | 3300049535 | Bacteria | 543 |
| 1243 | Ga0501320_003037 | 3300049536 | Bacteria | 1393 |
| 1244 | Ga0501320_003150 | 3300049536 | Bacteria | 1378 |
| 1245 | Ga0501320_003152 | 3300049536 | Bacteria | 1378 |
| 1246 | Ga0501320_009090 | 3300049536 | Bacteria | 990 |
| 1247 | Ga0501320_009230 | 3300049536 | Bacteria | 984 |
| 1248 | Ga0501321_003885 | 3300049537 | Bacteria | 1399 |
| 1249 | Ga0501321_021050 | 3300049537 | Bacteria | 811 |
| 1250 | Ga0501321_025452 | 3300049537 | Bacteria | 763 |
| 1251 | Ga0501321_026065 | 3300049537 | Bacteria | 757 |
| 1252 | Ga0501321_039662 | 3300049537 | Bacteria | 658 |
| 1253 | Ga0501322_003710 | 3300049538 | Bacteria | 1000 |
| 1254 | Ga0501323_017947 | 3300049539 | Bacteria | 912 |
| 1255 | Ga0501323_038409 | 3300049539 | Bacteria | 695 |
| 1256 | Ga0501323_055330 | 3300049539 | Bacteria | 610 |
| 1257 | Ga0501323_086114 | 3300049539 | Bacteria | 519 |
| 1258 | Ga0501324_000146 | 3300049540 | Bacteria | 3029 |
| 1259 | Ga0501324_032909 | 3300049540 | Bacteria | 572 |
| 1260 | Ga0501324_039127 | 3300049540 | Bacteria | 538 |
| 1261 | Ga0501325_002483 | 3300049541 | Bacteria | 1266 |
| 1262 | Ga0501326_03837 | 3300049542 | Bacteria | 783 |
| 1263 | Ga0501327_07824 | 3300049543 | Bacteria | 671 |
| 1264 | Ga0501330_015869 | 3300049546 | Bacteria | 575 |
| 1265 | Ga0501334_02030 | 3300049550 | Bacteria | 1172 |
| 1266 | Ga0501334_11604 | 3300049550 | Bacteria | 647 |
| 1267 | Ga0501335_016552 | 3300049551 | Bacteria | 760 |
| 1268 | Ga0501335_030466 | 3300049551 | Bacteria | 608 |
| 1269 | Ga0501336_001604 | 3300049552 | Bacteria | 1373 |
| 1270 | Ga0501336_021445 | 3300049552 | Bacteria | 590 |
| 1271 | Ga0501337_003695 | 3300049553 | Bacteria | 979 |
| 1272 | Ga0501036_0168725 | 3300049572 | Bacteria | 1844 |
| 1273 | Ga0501211_003467 | 3300049658 | Bacteria | 1625 |
| 1274 | Ga0501222_052889 | 3300049662 | Bacteria | 599 |
| 1275 | Ga0501227_001669 | 3300049665 | Bacteria | 4945 |
| 1276 | Ga0501233_046721 | 3300049668 | Bacteria | 1036 |
| 1277 | Ga0501238_028740 | 3300049671 | Bacteria | 800 |
| 1278 | Ga0501249_011012 | 3300049679 | Bacteria | 1895 |
| 1279 | Ga0501257_178657 | 3300049686 | Bacteria | 600 |
| 1280 | Ga0501234_014155 | 3300049707 | Bacteria | 1252 |
| 1281 | Ga0501232_048342 | 3300049757 | Bacteria | 648 |
| 1282 | Ga0501263_009328 | 3300049760 | Bacteria | 1186 |
| 1283 | Ga0501268_014162 | 3300049765 | Bacteria | 1297 |
| 1284 | Ga0501268_048277 | 3300049765 | Bacteria | 818 |
| 1285 | Ga0501279_003775 | 3300049775 | Bacteria | 1982 |
| 1286 | Ga0501279_014665 | 3300049775 | Bacteria | 1080 |
| 1287 | Ga0501035_0035964 | 3300049822 | Bacteria | 4492 |
| 1288 | Ga0501044_1175829 | 3300049823 | Bacteria | 635 |
| 1289 | nmdc:mga03683_124751_c1 | 3300050489 | Bacteria | 1148 |
| 1290 | nmdc:mga03n38_79853_c1 | 3300050490 | Bacteria | 1535 |
| 1291 | nmdc:mga0k408_362329_c1 | 3300050493 | Bacteria | 864 |
| 1292 | nmdc:mga07m45_367000_c1 | 3300050496 | Bacteria | 836 |
| 1293 | nmdc:mga07m45_95626_c1 | 3300050496 | Bacteria | 1704 |
| 1294 | Ga0495601_0011363 | 3300053077 | Bacteria | 5322 |
| 1295 | Ga0495655_0195039 | 3300053083 | Bacteria | 659 |
| 1296 | Ga0500646_0325529 | 3300053090 | Bacteria | 556 |
| 1297 | Ga0500594_0105109 | 3300053118 | Bacteria | 873 |
| 1298 | Ga0500595_081341 | 3300053119 | Bacteria | 947 |
| 1299 | Ga0500618_004294 | 3300053125 | Bacteria | 4610 |
| 1300 | Ga0500621_188196 | 3300053126 | Bacteria | 742 |
| 1301 | Ga0500559_0112531 | 3300053136 | Bacteria | 1262 |
| 1302 | Ga0500573_0380923 | 3300053140 | Bacteria | 674 |
| 1303 | Ga0500574_000852 | 3300053141 | Bacteria | 4160 |
| 1304 | Ga0500586_092624 | 3300053145 | Bacteria | 1061 |
| 1305 | Ga0500586_130803 | 3300053145 | Bacteria | 868 |
| 1306 | Ga0500619_083039 | 3300053154 | Bacteria | 1077 |
| 1307 | Ga0500624_071695 | 3300053157 | Bacteria | 678 |
| 1308 | Ga0500636_0475721 | 3300053177 | Bacteria | 558 |
| 1309 | Ga0587084_006452 | 3300059477 | Bacteria | 1425 |
| 1310 | Ga0587084_017124 | 3300059477 | Bacteria | 1043 |
| 1311 | Ga0587084_027909 | 3300059477 | Bacteria | 890 |
| 1312 | Ga0587093_001802 | 3300059478 | Bacteria | 1885 |
| 1313 | Ga0587093_003356 | 3300059478 | Bacteria | 1567 |
| 1314 | Ga0587066_002048 | 3300059490 | Bacteria | 2157 |
| 1315 | Ga0587066_025732 | 3300059490 | Bacteria | 1011 |
| 1316 | Ga0587070_011858 | 3300059491 | Bacteria | 1313 |
| 1317 | Ga0587070_012033 | 3300059491 | Bacteria | 1307 |
| 1318 | Ga0587070_037857 | 3300059491 | Bacteria | 909 |
| 1319 | Ga0587073_0000405 | 3300059492 | Bacteria | 3811 |
| 1320 | Ga0587073_0152513 | 3300059492 | Bacteria | 655 |
| 1321 | Ga0587077_008903 | 3300059493 | Bacteria | 1508 |
| 1322 | Ga0587077_009273 | 3300059493 | Bacteria | 1489 |
| 1323 | Ga0587080_003728 | 3300059503 | Bacteria | 1923 |
| 1324 | Ga0587080_019330 | 3300059503 | Bacteria | 1103 |
| 1325 | Ga0587080_053033 | 3300059503 | Bacteria | 771 |
| 1326 | Ga0587082_000814 | 3300059504 | Bacteria | 2909 |
| 1327 | Ga0587082_062171 | 3300059504 | Bacteria | 739 |
| 1328 | Ga0587083_0032996 | 3300059505 | Bacteria | 1042 |
| 1329 | Ga0587083_0039846 | 3300059505 | Bacteria | 978 |
| 1330 | Ga0587085_006188 | 3300059506 | Bacteria | 1445 |
| 1331 | Ga0587085_013499 | 3300059506 | Bacteria | 1138 |
| 1332 | Ga0587086_000667 | 3300059507 | Bacteria | 2638 |
| 1333 | Ga0587086_003732 | 3300059507 | Bacteria | 1551 |
| 1334 | Ga0587086_012653 | 3300059507 | Bacteria | 1052 |
| 1335 | Ga0587088_000683 | 3300059508 | Bacteria | 3024 |
| 1336 | Ga0587088_006876 | 3300059508 | Bacteria | 1552 |
| 1337 | Ga0587088_039639 | 3300059508 | Bacteria | 882 |
| 1338 | Ga0587089_009849 | 3300059509 | Bacteria | 1181 |
| 1339 | Ga0587089_018181 | 3300059509 | Bacteria | 951 |
| 1340 | Ga0587089_031477 | 3300059509 | Bacteria | 784 |
| 1341 | Ga0587090_003488 | 3300059510 | Bacteria | 1832 |
| 1342 | Ga0587090_007045 | 3300059510 | Bacteria | 1464 |
| 1343 | Ga0587091_002980 | 3300059511 | Bacteria | 2079 |
| 1344 | Ga0587091_021583 | 3300059511 | Bacteria | 1129 |
| 1345 | Ga0587092_005373 | 3300059512 | Bacteria | 1577 |
| 1346 | Ga0587092_008921 | 3300059512 | Bacteria | 1336 |
| 1347 | Ga0587094_002657 | 3300059513 | Bacteria | 1867 |
| 1348 | Ga0587094_003403 | 3300059513 | Bacteria | 1731 |
| 1349 | Ga0587094_003513 | 3300059513 | Bacteria | 1716 |
| 1350 | Ga0587095_000862 | 3300059514 | Bacteria | 1720 |
| 1351 | Ga0587095_001423 | 3300059514 | Bacteria | 1470 |
| 1352 | Ga0587097_00287 | 3300059603 | Bacteria | 1337 |
| 1353 | Ga0587097_01444 | 3300059603 | Bacteria | 857 |
| 1354 | Ga0587098_001919 | 3300059604 | Bacteria | 1686 |
| 1355 | Ga0587098_028142 | 3300059604 | Bacteria | 758 |
| 1356 | Ga0587121_01643 | 3300059606 | Bacteria | 1126 |
| 1357 | Ga0587125_000574 | 3300059607 | Bacteria | 2242 |
| 1358 | Ga0587129_003518 | 3300059608 | Bacteria | 988 |
| 1359 | Ga0587099_005269 | 3300059622 | Bacteria | 1156 |
| 1360 | Ga0587101_000524 | 3300059623 | Bacteria | 2775 |
| 1361 | Ga0587101_002989 | 3300059623 | Bacteria | 1678 |
| 1362 | Ga0587101_008422 | 3300059623 | Bacteria | 1245 |
| 1363 | Ga0587101_033901 | 3300059623 | Bacteria | 811 |
| 1364 | Ga0587109_014290 | 3300059624 | Bacteria | 1330 |
| 1365 | Ga0587109_031962 | 3300059624 | Bacteria | 1004 |
| 1366 | Ga0587115_006225 | 3300059626 | Bacteria | 1369 |
| 1367 | Ga0587117_015916 | 3300059627 | Bacteria | 994 |
| 1368 | Ga0587128_005351 | 3300059630 | Bacteria | 1529 |
| 1369 | Ga0587128_036484 | 3300059630 | Bacteria | 841 |
| 1370 | Ga0587062_015555 | 3300059639 | Bacteria | 1018 |
| 1371 | Ga0587062_016957 | 3300059639 | Bacteria | 991 |
| 1372 | Ga0587062_064065 | 3300059639 | Bacteria | 651 |
| 1373 | Ga0587068_006343 | 3300059641 | Bacteria | 1653 |
| 1374 | Ga0587068_025778 | 3300059641 | Bacteria | 991 |
| 1375 | Ga0587069_000151 | 3300059642 | Bacteria | 4141 |
| 1376 | Ga0587069_008398 | 3300059642 | Bacteria | 1305 |
| 1377 | Ga0587072_019128 | 3300059643 | Bacteria | 1196 |
| 1378 | Ga0587072_039981 | 3300059643 | Bacteria | 908 |
| 1379 | Ga0587075_002302 | 3300059644 | Bacteria | 2003 |
| 1380 | Ga0587075_008575 | 3300059644 | Bacteria | 1312 |
| 1381 | Ga0587076_000769 | 3300059645 | Bacteria | 2890 |
| 1382 | Ga0587076_008880 | 3300059645 | Bacteria | 1415 |
| 1383 | Ga0587078_021377 | 3300059646 | Bacteria | 820 |
| 1384 | Ga0587079_000436 | 3300059647 | Bacteria | 3627 |
| 1385 | Ga0587079_022980 | 3300059647 | Bacteria | 1137 |
| 1386 | Ga0587079_034095 | 3300059647 | Bacteria | 994 |
| 1387 | Ga0587079_037059 | 3300059647 | Bacteria | 967 |
| 1388 | Ga0587079_048272 | 3300059647 | Bacteria | 885 |
| 1389 | Ga0587100_005333 | 3300059648 | Bacteria | 954 |
| 1390 | Ga0587102_000673 | 3300059649 | Bacteria | 2076 |
| 1391 | Ga0587102_001335 | 3300059649 | Bacteria | 1704 |
| 1392 | Ga0587102_011088 | 3300059649 | Bacteria | 901 |
| 1393 | Ga0587104_000706 | 3300059650 | Bacteria | 1539 |
| 1394 | Ga0587105_002305 | 3300059651 | Bacteria | 1080 |
| 1395 | Ga0587107_008387 | 3300059652 | Bacteria | 1192 |
| 1396 | Ga0587108_000215 | 3300059653 | Bacteria | 2673 |
| 1397 | Ga0587110_001895 | 3300059654 | Bacteria | 1590 |
| 1398 | Ga0587116_04152 | 3300059656 | Bacteria | 835 |
| 1399 | Ga0587118_02411 | 3300059657 | Bacteria | 1210 |
| 1400 | Ga0587119_001725 | 3300059658 | Bacteria | 1859 |
| 1401 | Ga0587119_015430 | 3300059658 | Bacteria | 925 |
| 1402 | Ga0587120_000930 | 3300059659 | Bacteria | 1689 |
| 1403 | Ga0587065_06038 | 3300060245 | Bacteria | 714 |
| 1404 | Ga0587081_13236 | 3300060246 | Bacteria | 610 |
| 1405 | Ga0587096_00225 | 3300060247 | Bacteria | 1357 |
| 1406 | Ga0587071_000779 | 3300060344 | Bacteria | 3530 |
| 1407 | Ga0587071_015766 | 3300060344 | Bacteria | 1329 |
| 1408 | Ga0587071_025527 | 3300060344 | Bacteria | 1109 |
| 1409 | Ga0587071_048707 | 3300060344 | Bacteria | 870 |
| 1410 | Ga0587111_0002093 | 3300060346 | Bacteria | 2589 |
| 1411 | Ga0587111_0005555 | 3300060346 | Bacteria | 1953 |
| 1412 | Ga0587111_0006057 | 3300060346 | Bacteria | 1899 |
| 1413 | Ga0587111_0026675 | 3300060346 | Bacteria | 1153 |
| 1414 | Ga0587111_0080351 | 3300060346 | Bacteria | 778 |
| 1415 | Ga0466962_0268453 | 3300061719 | Bacteria | 840 |
| 1416 | 2511247426 | 2511231003 | Bacteria | 5606035 |
| 1417 | 2511384278 | 2511231026 | Bacteria | 5225445 |
| 1418 | 2521560845 | 2521172590 | Bacteria | 5047645 |
| 1419 | 2550696713 | 2548876994 | Bacteria | 4904866 |
| 1420 | 2553008127 | 2551306416 | Bacteria | 6152985 |
| 1421 | 2601667097 | 2600255292 | Bacteria | 6300551 |
| 1422 | 2643789313 | 2643221554 | Bacteria | 6603920 |
| 1423 | 2643799317 | 2643221556 | Bacteria | 7251154 |
| 1424 | 2644030560 | 2643221603 | Bacteria | 6147767 |
| 1425 | 2644251646 | 2643221645 | Bacteria | 7207331 |
| 1426 | 2644356009 | 2643221664 | Bacteria | 7272945 |
| 1427 | 2644472513 | 2643221684 | Bacteria | 7145183 |
| 1428 | 2738738195 | 2738541280 | Bacteria | 6630198 |
| 1429 | 2738826685 | 2738541297 | Bacteria | 6549566 |
| 1430 | 2738842999 | 2738541300 | Bacteria | 6675882 |
| 1431 | 2739150482 | 2738541357 | Bacteria | 6549408 |
| 1432 | 2739192401 | 2738543003 | Bacteria | 6549560 |
| 1433 | 2739273747 | 2738543018 | Bacteria | 6718814 |
| 1434 | 2739318878 | 2738543026 | Bacteria | 6549408 |
| 1435 | 2739337119 | 2738543029 | Bacteria | 6549249 |
| 1436 | 2739342791 | 2738543030 | Bacteria | 6719714 |
| 1437 | 2765567279 | 2765235838 | Bacteria | 5445269 |
| 1438 | 2808984192 | 2808606386 | Bacteria | 4471946 |
| 1439 | 2809131996 | 2808606415 | Bacteria | 4576710 |
| 1440 | 2809145972 | 2808606418 | Bacteria | 6724496 |
| 1441 | 2809151619 | 2808606419 | Bacteria | 4576925 |
| 1442 | 2819594380 | 2818991445 | Bacteria | 4955017 |
| 1443 | 2819618852 | 2818991449 | Bacteria | 5518009 |
| 1444 | 2821136285 | 2821131069 | Bacteria | 6108407 |
| 1445 | 2839095493 | 2839094727 | Bacteria | 5534556 |
| 1446 | 2842717719 | 2842711865 | Bacteria | 7155354 |
| 1447 | 2852622921 | 2852618963 | Bacteria | 4577824 |
| 1448 | 2857563377 | 2857558681 | Bacteria | 6617694 |
| 1449 | 2857567908 | 2857564685 | Bacteria | 6290584 |
| 1450 | 2884814298 | 2884811622 | Bacteria | 5552861 |
| 1451 | 2884840777 | 2884836552 | Bacteria | 5219991 |
| 1452 | 2884857627 | 2884852848 | Bacteria | 5221161 |
| 1453 | 2885080589 | 2885080285 | Bacteria | 6355622 |
| 1454 | 2896158567 | 2896154374 | Bacteria | 5221518 |
| 1455 | 2904427831 | 2904424332 | Bacteria | 7633521 |
| 1456 | 2904445257 | 2904439833 | Bacteria | 5931679 |
| 1457 | 2904533798 | 2904530477 | Bacteria | 5876334 |
| 1458 | 2904589365 | 2904584206 | Bacteria | 6028872 |
| 1459 | 2904595068 | 2904589729 | Bacteria | 6113573 |
| 1460 | 2904606734 | 2904601388 | Bacteria | 5884906 |
| 1461 | 2919050778 | 2919046199 | Bacteria | 5567169 |
| 1462 | 2919084998 | 2919079590 | Bacteria | 5946433 |
| 1463 | 2919476868 | 2919476304 | Bacteria | 5888696 |
| 1464 | 2923514686 | 2923510766 | Bacteria | 5926163 |
| 1465 | 2928135734 | 2928130867 | Bacteria | 5467269 |
| 1466 | 2932422363 | 2932416698 | Bacteria | 6315112 |
| 1467 | 8047676180 | 8047673197 | Bacteria | 7395230 |
| 1468 | Ga0105243_11118759 | |||
| 1469 | JGI25155J39150_1001422 | |||
| 1470 | JGI25162J39368_1003029 | |||
| 1471 | JGI25162J39368_1013612 | |||
| 1472 | JGI25154J39366_1001113 | |||
| 1473 | JGI25157J39369_1002793 | |||
| 1474 | JGI25163J39215_1004486 | |||
| 1475 | Ga0006761J43178_107453 | |||
| 1476 | Ga0006763J43179_103551 | |||
| 1477 | Ga0006762J43184_104088 | |||
| 1478 | Ga0006765J45826_105488 | |||
| 1479 | Ga0006765J45826_112366 | |||
| 1480 | Ga0006778J45830_1013353 | |||
| 1481 | Ga0006778J45830_1040529 | |||
| 1482 | Ga0006759J45824_1008312 | |||
| 1483 | Ga0006759J45824_1017914 | |||
| 1484 | Ga0006759J45824_1050895 | |||
| 1485 | JGI25151J46595_10026667 | |||
| 1486 | JGI25165J46597_1001017 | |||
| 1487 | JGI25153J46596_10069502 | |||
| 1488 | Ga0007428J48920_101816 | |||
| 1489 | Ga0007421J48921_108960 | |||
| 1490 | Ga0006758J48902_1003362 | |||
| 1491 | Ga0006758J48902_1007376 | |||
| 1492 | Ga0006758J48902_1008629 | |||
| 1493 | Ga0006758J48902_1013049 | |||
| 1494 | Ga0006770J48903_1029811 | |||
| 1495 | Ga0006770J48903_1044284 | |||
| 1496 | Ga0006777J48905_1023760 | |||
| 1497 | Ga0006777J48905_1039864 | |||
| 1498 | rootH2_10111913 | |||
| 1499 | JGI25160J50197_1016863 | |||
| 1500 | Ga0007417J51691_1002081 | |||
| 1501 | Ga0007417J51691_1010301 | |||
| 1502 | Ga0007417J51691_1012480 | |||
| 1503 | Ga0007417J51691_1047057 | |||
| 1504 | Ga0007427J51700_104977 | |||
| 1505 | Ga0006781J51513_1012464 | |||
| 1506 | Ga0007410J51695_1007231 | |||
| 1507 | Ga0007410J51695_1020989 | |||
| 1508 | Ga0007409J51694_1001845 | |||
| 1509 | Ga0007409J51694_1004205 | |||
| 1510 | Ga0007409J51694_1052234 | |||
| 1511 | Ga0007416J51690_1008732 | |||
| 1512 | Ga0007416J51690_1012477 | |||
| 1513 | Ga0007416J51690_1013143 | |||
| 1514 | Ga0007429J51699_1009554 | |||
| 1515 | Ga0007429J51699_1048446 | |||
| 1516 | Ga0007411J51799_105052 | |||
| 1517 | Ga0007411J51799_105765 | |||
| 1518 | Ga0007415J51800_105799 | |||
| 1519 | Ga0007415J51800_107921 | |||
| 1520 | Ga0032354_1003507 | |||
| 1521 | Ga0032354_1011615 | |||
| 1522 | Ga0032354_1050188 | |||
| 1523 | Ga0032354_1055041 | |||
| 1524 | Ga0006780_1004575 | |||
| 1525 | Ga0006780_1014123 | |||
| 1526 | Ga0055538_1000375 | |||
| 1527 | Ga0055538_1002307 | |||
| 1528 | Ga0055539_1000377 | |||
| 1529 | Ga0055539_1002407 | |||
| 1530 | Ga0055533_1000371 | |||
| 1531 | Ga0055533_1003837 | |||
| 1532 | Ga0055532_1000420 | |||
| 1533 | Ga0055525_1000147 | |||
| 1534 | Ga0055525_1000523 | |||
| 1535 | Ga0055525_1001833 | |||
| 1536 | Ga0055535_1005381 | |||
| 1537 | Ga0055529_1000375 | |||
| 1538 | Ga0055526_1021258 | |||
| 1539 | Ga0055526_1021298 | |||
| 1540 | Ga0055537_1007354 | |||
| 1541 | Ga0055537_1012735 | |||
| 1542 | Ga0055524_1035570 | |||
| 1543 | Ga0055524_1039973 | |||
| 1544 | Ga0055534_1006810 | |||
| 1545 | Ga0055534_1023815 | |||
| 1546 | Ga0055528_1007975 | |||
| 1547 | Ga0055528_1012187 | |||
| 1548 | Ga0055530_10034470 | |||
| 1549 | Ga0055540_1071237 | |||
| 1550 | Ga0055531_10055730 | |||
| 1551 | Ga0055541_1000262 | |||
| 1552 | Ga0055541_1003620 | |||
| 1553 | Ga0055543_1028398 | |||
| 1554 | Ga0055543_1061760 | |||
| 1555 | Ga0058859_11830236 | |||
| 1556 | Ga0058863_10053884 | |||
| 1557 | Ga0058861_10192042 | |||
| 1558 | Ga0058860_12202994 | |||
| 1559 | Ga0058862_10285807 | |||
| 1560 | Ga0065165_1003318 | |||
| 1561 | Ga0065165_1131124 | |||
| 1562 | Ga0065714_10039928 | |||
| 1563 | Ga0065714_10228053 | |||
| 1564 | Ga0065714_10510726 | |||
| 1565 | Ga0065704_10158451 | |||
| 1566 | Ga0065715_10965565 | |||
| 1567 | Ga0070676_10119214 | |||
| 1568 | Ga0070670_100067314 | |||
| 1569 | Ga0070670_100670173 | |||
| 1570 | Ga0068869_100160311 | |||
| 1571 | Ga0070680_100212917 | |||
| 1572 | Ga0070680_100331491 | |||
| 1573 | Ga0070682_100049501 | |||
| 1574 | Ga0070682_100139754 | |||
| 1575 | Ga0070660_100054384 | |||
| 1576 | Ga0070661_100103030 | |||
| 1577 | Ga0070671_101904447 | |||
| 1578 | Ga0070659_100022490 | |||
| 1579 | Ga0070663_100229308 | |||
| 1580 | Ga0070662_100788233 | |||
| 1581 | Ga0070681_10693651 | |||
| 1582 | Ga0068867_100247809 | |||
| 1583 | Ga0070684_100335993 | |||
| 1584 | Ga0068853_100254548 | |||
| 1585 | Ga0070672_100523242 | |||
| 1586 | Ga0068855_100434090 | |||
| 1587 | Ga0068855_100593288 | |||
| 1588 | Ga0068855_101125821 | |||
| 1589 | Ga0070664_100139315 | |||
| 1590 | Ga0070664_100796478 | |||
| 1591 | Ga0068857_100025716 | |||
| 1592 | Ga0068854_100377989 | |||
| 1593 | Ga0068854_100576719 | |||
| 1594 | Ga0068856_100085286 | |||
| 1595 | Ga0068856_100087143 | |||
| 1596 | Ga0068852_100062072 | |||
| 1597 | Ga0068851_10071502 | |||
| 1598 | Ga0068851_10112534 | |||
| 1599 | Ga0068851_10405320 | |||
| 1600 | Ga0068862_101121132 | |||
| 1601 | Ga0075363_100016273 | |||
| 1602 | Ga0075364_10849286 | |||
| 1603 | Ga0070712_100507328 | |||
| 1604 | Ga0097621_100018618 | |||
| 1605 | Ga0068871_100137146 | |||
| 1606 | Ga0068865_100044877 | |||
| 1607 | Ga0099823_1087981 | |||
| 1608 | Ga0099794_10479873 | |||
| 1609 | Ga0105251_10078126 | |||
| 1610 | Ga0105244_10015476 | |||
| 1611 | Ga0105244_10019926 | |||
| 1612 | Ga0105244_10039890 | |||
| 1613 | Ga0105250_10141157 | |||
| 1614 | Ga0105250_10339321 | |||
| 1615 | Ga0105240_10021815 | |||
| 1616 | Ga0105240_10209527 | |||
| 1617 | Ga0105240_10307686 | |||
| 1618 | Ga0105245_10043502 | |||
| 1619 | Ga0105243_10016441 | |||
| 1620 | Ga0105243_11533616 | |||
| 1621 | Ga0105243_13037755 | |||
| 1622 | Ga0105241_10173179 | |||
| 1623 | Ga0105242_10156388 | |||
| 1624 | Ga0105248_10786239 | |||
| 1625 | Ga0105248_10951637 | |||
| 1626 | Ga0105237_10140721 | |||
| 1627 | Ga0105237_10176405 | |||
| 1628 | Ga0105238_10002020 | |||
| 1629 | Ga0105238_10313151 | |||
| 1630 | Ga0105238_10953002 | |||
| 1631 | Ga0105249_11042875 | |||
| 1632 | Ga0130086_1005042 | |||
| 1633 | Ga0130086_1075241 | |||
| 1634 | Ga0130086_1091490 | |||
| 1635 | Ga0130085_1017480 | |||
| 1636 | Ga0130085_1078041 | |||
| 1637 | Ga0130085_1107450 | |||
| 1638 | Ga0105239_10030541 | |||
| 1639 | Ga0105239_10138610 | |||
| 1640 | Ga0105239_10177507 | |||
| 1641 | Ga0105239_11227710 | |||
| 1642 | Ga0105246_10340845 | |||
| 1643 | Ga0105246_10866596 | |||
| 1644 | Ga0157325_1004116 | |||
| 1645 | Ga0157373_10261474 | |||
| 1646 | Ga0157373_10718048 | |||
| 1647 | Ga0157371_10000710 | |||
| 1648 | Ga0157370_10290342 | |||
| 1649 | Ga0157370_10955217 | |||
| 1650 | Ga0157369_10404300 | |||
| 1651 | Ga0157378_12462498 | |||
| 1652 | Ga0163162_10719007 | |||
| 1653 | Ga0157372_11159304 | |||
| 1654 | Ga0157372_12979912 | |||
| 1655 | Ga0157375_11086602 | |||
| 1656 | Ga0182008_10004539 | |||
| 1657 | Ga0182008_10005790 | |||
| 1658 | Ga0182008_10171183 | |||
| 1659 | Ga0182008_10393084 | |||
| 1660 | Ga0157377_10226863 | |||
| 1661 | Ga0157376_10163721 | |||
| 1662 | Ga0157376_11695674 | |||
| 1663 | Ga0182006_1000186 | |||
| 1664 | Ga0182006_1010089 | |||
| 1665 | Ga0182006_1013810 | |||
| 1666 | Ga0182007_10000202 | |||
| 1667 | Ga0182007_10018893 | |||
| 1668 | Ga0182007_10031144 | |||
| 1669 | Ga0182007_10032705 | |||
| 1670 | Ga0182007_10232394 | |||
| 1671 | Ga0182005_1001571 | |||
| 1672 | Ga0182005_1002884 | |||
| 1673 | Ga0163161_10231881 | |||
| 1674 | Ga0163161_10236417 | |||
| 1675 | Ga0163161_10238636 | |||
| 1676 | Ga0206355_1609219 | |||
| 1677 | Ga0206351_10512755 | |||
| 1678 | Ga0206350_10480254 | |||
| 1679 | Ga0206354_10352477 | |||
| 1680 | Ga0213872_10052983 | |||
| 1681 | Ga0213872_10067471 | |||
| 1682 | Ga0209435_100186 | |||
| 1683 | Ga0209435_100191 | |||
| 1684 | Ga0209436_101414 | |||
| 1685 | Ga0209436_101521 | |||
| 1686 | Ga0209784_100010 | |||
| 1687 | Ga0209784_100035 | |||
| 1688 | Ga0209566_100008 | |||
| 1689 | Ga0209566_100040 | |||
| 1690 | Ga0209674_100019 | |||
| 1691 | Ga0209674_100057 | |||
| 1692 | Ga0209672_104073 | |||
| 1693 | Ga0209147_100060 | |||
| 1694 | Ga0209563_100011 | |||
| 1695 | Ga0209563_100021 | |||
| 1696 | Ga0209563_100059 | |||
| 1697 | Ga0207427_100573 | |||
| 1698 | Ga0209437_100019 | |||
| 1699 | Ga0209437_100639 | |||
| 1700 | Ga0209437_118485 | |||
| 1701 | Ga0209437_119366 | |||
| 1702 | Ga0209258_100141 | |||
| 1703 | Ga0207425_1001042 | |||
| 1704 | Ga0207425_1022002 | |||
| 1705 | Ga0209646_1000246 | |||
| 1706 | Ga0209646_1001041 | |||
| 1707 | Ga0209026_1004204 | |||
| 1708 | Ga0209026_1007856 | |||
| 1709 | Ga0209677_100011 | |||
| 1710 | Ga0209677_100036 | |||
| 1711 | Ga0209677_111325 | |||
| 1712 | Ga0209148_1000323 | |||
| 1713 | Ga0209148_1011865 | |||
| 1714 | Ga0209759_1015039 | |||
| 1715 | Ga0209233_1000025 | |||
| 1716 | Ga0209565_1006443 | |||
| 1717 | Ga0209565_1010529 | |||
| 1718 | Ga0209565_1026547 | |||
| 1719 | Ga0209565_1048209 | |||
| 1720 | Ga0209565_1067964 | |||
| 1721 | Ga0209455_1000303 | |||
| 1722 | Ga0209455_1005403 | |||
| 1723 | Ga0209673_1003465 | |||
| 1724 | Ga0209673_1004929 | |||
| 1725 | Ga0209130_1002838 | |||
| 1726 | Ga0209675_1002952 | |||
| 1727 | Ga0209675_1009571 | |||
| 1728 | Ga0209025_1001281 | |||
| 1729 | Ga0209564_1000027 | |||
| 1730 | Ga0209564_1000230 | |||
| 1731 | Ga0209564_1013777 | |||
| 1732 | Ga0209564_1019927 | |||
| 1733 | Ga0209758_1011259 | |||
| 1734 | Ga0209050_1000292 | |||
| 1735 | Ga0209256_1004685 | |||
| 1736 | Ga0209256_1012344 | |||
| 1737 | Ga0207426_1002480 | |||
| 1738 | Ga0209051_1055224 | |||
| 1739 | Ga0209257_1000295 | |||
| 1740 | Ga0207656_10251696 | |||
| 1741 | Ga0207656_10287302 | |||
| 1742 | Ga0207655_1003094 | |||
| 1743 | Ga0207655_1027614 | |||
| 1744 | Ga0207655_1142968 | |||
| 1745 | Ga0207713_1130135 | |||
| 1746 | Ga0207647_10261112 | |||
| 1747 | Ga0207645_10214311 | |||
| 1748 | Ga0207705_11005312 | |||
| 1749 | Ga0207684_10913197 | |||
| 1750 | Ga0207654_10002179 | |||
| 1751 | Ga0207707_10487097 | |||
| 1752 | Ga0207695_10003953 | |||
| 1753 | Ga0207695_10072393 | |||
| 1754 | Ga0207695_10401694 | |||
| 1755 | Ga0207695_10953808 | |||
| 1756 | Ga0207671_10139299 | |||
| 1757 | Ga0207671_10178519 | |||
| 1758 | Ga0207671_10579222 | |||
| 1759 | Ga0207693_10010110 | |||
| 1760 | Ga0207657_10006550 | |||
| 1761 | Ga0207649_10056050 | |||
| 1762 | Ga0207649_10350719 | |||
| 1763 | Ga0207694_10001435 | |||
| 1764 | Ga0207694_10281831 | |||
| 1765 | Ga0207694_10295775 | |||
| 1766 | Ga0207650_10088896 | |||
| 1767 | Ga0207659_11475330 | |||
| 1768 | Ga0207687_10591242 | |||
| 1769 | Ga0207690_11533167 | |||
| 1770 | Ga0207706_10313632 | |||
| 1771 | Ga0207686_10112187 | |||
| 1772 | Ga0207709_10055004 | |||
| 1773 | Ga0207669_10511819 | |||
| 1774 | Ga0207704_10095815 | |||
| 1775 | Ga0207691_10316183 | |||
| 1776 | Ga0207711_10480757 | |||
| 1777 | Ga0207711_10734557 | |||
| 1778 | Ga0207689_10123864 | |||
| 1779 | Ga0207667_10023256 | |||
| 1780 | Ga0207667_10042185 | |||
| 1781 | Ga0207667_10143578 | |||
| 1782 | Ga0207640_10169293 | |||
| 1783 | Ga0207639_10312484 | |||
| 1784 | Ga0207678_10543520 | |||
| 1785 | Ga0207648_10531514 | |||
| 1786 | Ga0207674_10021420 | |||
| 1787 | Ga0207674_10637617 | |||
| 1788 | Ga0207683_10480854 | |||
| 1789 | Ga0207698_10012103 | |||
| 1790 | Ga0209281_1008175 | |||
| 1791 | Ga0268265_10147695 | |||
| 1792 | Ga0316177_1138179 | |||
| 1793 | Ga0316176_1045076 | |||
| 1794 | Ga0316178_1018733 | |||
| 1795 | Ga0316180_1160791 | |||
| 1796 | Ga0316183_1020377 | |||
| 1797 | Ga0316182_1052816 | |||
| 1798 | Ga0316182_1275498 | |||
| 1799 | Ga0307408_100144522 | |||
| 1800 | Ga0307408_102083828 | |||
| 1801 | Ga0307408_102093717 | |||
| 1802 | Ga0265314_10275927 | |||
| 1803 | Ga0307516_10309306 | |||
| 1804 | Ga0307405_11287052 | |||
| 1805 | Ga0307406_10406741 | |||
| 1806 | Ga0307407_11519995 | |||
| 1807 | Ga0307412_10649115 | |||
| 1808 | Ga0307416_100004760 | |||
| 1809 | Ga0307414_10006142 | |||
| 1810 | Ga0307411_10352971 | |||
| 1811 | Ga0307411_10495387 | |||
| 1812 | Ga0307411_10595392 | |||
| 1813 | Ga0307411_11417131 | |||
| 1814 | Ga0307510_10280273 | |||
| 1815 | Ga0373949_0294284 | |||
| 1816 | Ga0373939_0053081 | |||
| 1817 | Ga0373935_0201381 | |||
| 1818 | Ga0395899_0000078 | |||
| 1819 | Ga0395899_0005833 | |||
| 1820 | Ga0395899_0668497 | |||
| 1821 | Ga0395899_0683208 | |||
| 1822 | Ga0395899_1008921 | |||
| 1823 | Ga0395900_0082284 | |||
| 1824 | Ga0395900_0195712 | |||
| 1825 | Ga0395900_0249092 | |||
| 1826 | Ga0395900_0560241 | |||
| 1827 | Ga0395900_1850502 | |||
| 1828 | Ga0395898_0695698 | |||
| 1829 | Ga0395898_1601238 | |||
| 1830 | Ga0395905_0000549 | |||
| 1831 | Ga0395905_0007900 | |||
| 1832 | Ga0395905_0011730 | |||
| 1833 | Ga0395905_0092664 | |||
| 1834 | Ga0395905_0150590 | |||
| 1835 | Ga0395905_0537645 | |||
| 1836 | Ga0395905_1906850 | |||
| 1837 | Ga0395901_0004460 | |||
| 1838 | Ga0395901_0094399 | |||
| 1839 | Ga0395901_0164294 | |||
| 1840 | Ga0395901_0464144 | |||
| 1841 | Ga0395901_0548664 | |||
| 1842 | Ga0395901_1464874 | |||
| 1843 | Ga0436361_0004974 | |||
| 1844 | Ga0436361_0171206 | |||
| 1845 | Ga0436361_0578689 | |||
| 1846 | Ga0436361_0743577 | |||
| 1847 | Ga0436361_0767937 | |||
| 1848 | Ga0436361_1038070 | |||
| 1849 | Ga0439465_0049368 | |||
| 1850 | Ga0451833_0022593 | |||
| 1851 | Ga0451853_2414847 | |||
| 1852 | Ga0439442_092526 | |||
| 1853 | Ga0439448_0261686 | |||
| 1854 | Ga0439432_126317 | |||
| 1855 | Ga0439449_0244662 | |||
| 1856 | Ga0439450_013480 | |||
| 1857 | Ga0439450_048323 | |||
| 1858 | Ga0439455_0027559 | |||
| 1859 | Ga0439455_0069102 | |||
| 1860 | Ga0439455_0166579 | |||
| 1861 | Ga0450921_020664 | |||
| 1862 | Ga0450890_033574 | |||
| 1863 | Ga0450895_019290 | |||
| 1864 | Ga0450898_013755 | |||
| 1865 | Ga0450904_004772 | |||
| 1866 | Ga0439446_0168394 | |||
| 1867 | Ga0439458_0076007 | |||
| 1868 | Ga0439434_0057775 | |||
| 1869 | Ga0439464_0028984 | |||
| 1870 | Ga0466972_0005095 | |||
| 1871 | Ga0466972_0052412 | |||
| 1872 | Ga0466965_0043592 | |||
| 1873 | Ga0466965_0231235 | |||
| 1874 | Ga0466965_0247551 | |||
| 1875 | Ga0466965_0373023 | |||
| 1876 | Ga0466965_0595604 | |||
| 1877 | Ga0466966_0038419 | |||
| 1878 | Ga0466966_0978184 | |||
| 1879 | Ga0466964_0024210 | |||
| 1880 | Ga0466964_0087285 | |||
| 1881 | Ga0466964_0152185 | |||
| 1882 | Ga0466964_0242638 | |||
| 1883 | Ga0466971_0221878 | |||
| 1884 | Ga0466971_0240173 | |||
| 1885 | Ga0466968_0012025 | |||
| 1886 | Ga0466968_0207495 | |||
| 1887 | Ga0466968_0284188 | |||
| 1888 | Ga0466968_0327837 | |||
| 1889 | Ga0466970_0057746 | |||
| 1890 | Ga0466970_0232590 | |||
| 1891 | Ga0466957_0167221 | |||
| 1892 | Ga0466957_0233015 | |||
| 1893 | Ga0466957_0286206 | |||
| 1894 | Ga0466957_0983406 | |||
| 1895 | Ga0466960_0943304 | |||
| 1896 | Ga0466959_0204553 | |||
| 1897 | Ga0451576_1776876 | |||
| 1898 | Ga0466958_0896361 | |||
| 1899 | Ga0466967_0948199 | |||
| 1900 | Ga0466967_1169271 | |||
| 1901 | Ga0466967_1605038 | |||
| 1902 | Ga0466967_1689390 | |||
| 1903 | Ga0495617_001026 | |||
| 1904 | Ga0495617_004204 | |||
| 1905 | Ga0495617_197794 | |||
| 1906 | Ga0495627_026656 | |||
| 1907 | Ga0495627_045406 | |||
| 1908 | Ga0495592_0139781 | |||
| 1909 | Ga0495603_0007446 | |||
| 1910 | Ga0495603_0066125 | |||
| 1911 | Ga0495603_0164238 | |||
| 1912 | Ga0495603_0533480 | |||
| 1913 | Ga0495590_0000020 | |||
| 1914 | Ga0495590_0005309 | |||
| 1915 | Ga0495590_0018848 | |||
| 1916 | Ga0495590_0029266 | |||
| 1917 | Ga0495590_0037945 | |||
| 1918 | Ga0495590_0124562 | |||
| 1919 | Ga0495590_0233781 | |||
| 1920 | Ga0495590_0249208 | |||
| 1921 | Ga0495591_008200 | |||
| 1922 | Ga0495591_061027 | |||
| 1923 | Ga0495629_0415305 | |||
| 1924 | Ga0495638_0000408 | |||
| 1925 | Ga0495638_0010010 | |||
| 1926 | Ga0495638_0010721 | |||
| 1927 | Ga0495638_0069655 | |||
| 1928 | Ga0495638_0463668 | |||
| 1929 | Ga0495651_0061481 | |||
| 1930 | Ga0495651_0108148 | |||
| 1931 | Ga0495653_0003544 | |||
| 1932 | Ga0495653_0025764 | |||
| 1933 | Ga0495653_0042103 | |||
| 1934 | Ga0495653_0504877 | |||
| 1935 | Ga0495650_0008022 | |||
| 1936 | Ga0495650_0009500 | |||
| 1937 | Ga0495650_0017326 | |||
| 1938 | Ga0495650_0032252 | |||
| 1939 | Ga0495650_0058728 | |||
| 1940 | Ga0495580_0008648 | |||
| 1941 | Ga0495580_0245555 | |||
| 1942 | Ga0495580_0370728 | |||
| 1943 | Ga0495580_0743097 | |||
| 1944 | Ga0495582_0013331 | |||
| 1945 | Ga0495582_0049936 | |||
| 1946 | Ga0495582_0057380 | |||
| 1947 | Ga0495605_0003232 | |||
| 1948 | Ga0495605_0013410 | |||
| 1949 | Ga0495605_0013696 | |||
| 1950 | Ga0495605_0071613 | |||
| 1951 | Ga0495605_0082794 | |||
| 1952 | Ga0495605_0103420 | |||
| 1953 | Ga0495605_0105953 | |||
| 1954 | Ga0495605_0190560 | |||
| 1955 | Ga0495605_0195503 | |||
| 1956 | Ga0495605_0224230 | |||
| 1957 | Ga0495639_0181988 | |||
| 1958 | Ga0495639_0570768 | |||
| 1959 | Ga0495584_0002812 | |||
| 1960 | Ga0495584_0020283 | |||
| 1961 | Ga0495584_0051866 | |||
| 1962 | Ga0495584_0060945 | |||
| 1963 | Ga0495584_0075775 | |||
| 1964 | Ga0495584_0081139 | |||
| 1965 | Ga0495584_0103631 | |||
| 1966 | Ga0495584_0113268 | |||
| 1967 | Ga0495584_0120831 | |||
| 1968 | Ga0495584_0125919 | |||
| 1969 | Ga0495584_0167318 | |||
| 1970 | Ga0495584_0287350 | |||
| 1971 | Ga0495584_0355186 | |||
| 1972 | Ga0495584_0452034 | |||
| 1973 | Ga0495584_0502519 | |||
| 1974 | Ga0495585_0012012 | |||
| 1975 | Ga0495585_0015837 | |||
| 1976 | Ga0495585_0047201 | |||
| 1977 | Ga0495585_0047852 | |||
| 1978 | Ga0495585_0063130 | |||
| 1979 | Ga0495585_0137156 | |||
| 1980 | Ga0495585_0137334 | |||
| 1981 | Ga0495585_0143002 | |||
| 1982 | Ga0495585_0149517 | |||
| 1983 | Ga0495585_0159448 | |||
| 1984 | Ga0495585_0174673 | |||
| 1985 | Ga0495585_0270942 | |||
| 1986 | Ga0495585_0290070 | |||
| 1987 | Ga0495585_0331337 | |||
| 1988 | Ga0495585_0357830 | |||
| 1989 | Ga0495585_0406997 | |||
| 1990 | Ga0495585_0436392 | |||
| 1991 | Ga0495585_0523948 | |||
| 1992 | Ga0495594_0020007 | |||
| 1993 | Ga0495594_0186729 | |||
| 1994 | Ga0495594_0302827 | |||
| 1995 | Ga0495594_0330178 | |||
| 1996 | Ga0495594_0338015 | |||
| 1997 | Ga0495594_0660763 | |||
| 1998 | Ga0495596_0005175 | |||
| 1999 | Ga0495596_0021654 | |||
| 2000 | Ga0495596_0040721 | |||
| 2001 | Ga0495596_0044056 | |||
| 2002 | Ga0495596_0059412 | |||
| 2003 | Ga0495596_0277946 | |||
| 2004 | Ga0495596_0295666 | |||
| 2005 | Ga0495596_0296545 | |||
| 2006 | Ga0495607_0090940 | |||
| 2007 | Ga0495607_0099837 | |||
| 2008 | Ga0495607_0123713 | |||
| 2009 | Ga0495607_0141517 | |||
| 2010 | Ga0495607_0162714 | |||
| 2011 | Ga0495607_0196673 | |||
| 2012 | Ga0495607_0283948 | |||
| 2013 | Ga0495607_0379756 | |||
| 2014 | Ga0495583_0000310 | |||
| 2015 | Ga0495583_0006309 | |||
| 2016 | Ga0495583_0008959 | |||
| 2017 | Ga0495583_0013755 | |||
| 2018 | Ga0495583_0039755 | |||
| 2019 | Ga0495583_0041060 | |||
| 2020 | Ga0495583_0047710 | |||
| 2021 | Ga0495583_0094961 | |||
| 2022 | Ga0495583_0096954 | |||
| 2023 | Ga0495583_0122294 | |||
| 2024 | Ga0495583_0131777 | |||
| 2025 | Ga0495583_0197012 | |||
| 2026 | Ga0495583_0251356 | |||
| 2027 | Ga0495606_0007181 | |||
| 2028 | Ga0495606_0013036 | |||
| 2029 | Ga0495606_0019502 | |||
| 2030 | Ga0495606_0039988 | |||
| 2031 | Ga0495606_0108118 | |||
| 2032 | Ga0495606_0109444 | |||
| 2033 | Ga0495606_0148706 | |||
| 2034 | Ga0495606_0149612 | |||
| 2035 | Ga0495606_0193919 | |||
| 2036 | Ga0495606_0217296 | |||
| 2037 | Ga0495606_0284940 | |||
| 2038 | Ga0495606_0293819 | |||
| 2039 | Ga0495606_0313019 | |||
| 2040 | Ga0495606_0325847 | |||
| 2041 | Ga0495606_0379068 | |||
| 2042 | Ga0495606_0435842 | |||
| 2043 | Ga0495606_0526404 | |||
| 2044 | Ga0495608_0027939 | |||
| 2045 | Ga0495608_0087527 | |||
| 2046 | Ga0495610_0003877 | |||
| 2047 | Ga0495610_0018155 | |||
| 2048 | Ga0495610_0023962 | |||
| 2049 | Ga0495610_0027750 | |||
| 2050 | Ga0495610_0198124 | |||
| 2051 | Ga0495610_0203181 | |||
| 2052 | Ga0495616_0002539 | |||
| 2053 | Ga0495616_0020539 | |||
| 2054 | Ga0495616_0022828 | |||
| 2055 | Ga0495616_0103362 | |||
| 2056 | Ga0495616_0160497 | |||
| 2057 | Ga0495616_0188240 | |||
| 2058 | Ga0495616_0209358 | |||
| 2059 | Ga0495616_0322294 | |||
| 2060 | Ga0495618_0079070 | |||
| 2061 | Ga0495618_0606092 | |||
| 2062 | Ga0495620_0011229 | |||
| 2063 | Ga0495628_0051980 | |||
| 2064 | Ga0495628_0153435 | |||
| 2065 | Ga0495630_0473133 | |||
| 2066 | Ga0495630_0528698 | |||
| 2067 | Ga0495631_0026738 | |||
| 2068 | Ga0495631_0037499 | |||
| 2069 | Ga0495631_0037577 | |||
| 2070 | Ga0495631_0073566 | |||
| 2071 | Ga0495631_0091500 | |||
| 2072 | Ga0495631_0093621 | |||
| 2073 | Ga0495631_0103090 | |||
| 2074 | Ga0495631_0106058 | |||
| 2075 | Ga0495631_0174114 | |||
| 2076 | Ga0495631_0182275 | |||
| 2077 | Ga0495631_0211047 | |||
| 2078 | Ga0495631_0269289 | |||
| 2079 | Ga0495632_0041954 | |||
| 2080 | Ga0495632_0052841 | |||
| 2081 | Ga0495632_0112463 | |||
| 2082 | Ga0495632_0154007 | |||
| 2083 | Ga0495632_0166880 | |||
| 2084 | Ga0495632_0195587 | |||
| 2085 | Ga0495637_0001714 | |||
| 2086 | Ga0495637_0013614 | |||
| 2087 | Ga0495637_0027010 | |||
| 2088 | Ga0495637_0044618 | |||
| 2089 | Ga0495637_0074308 | |||
| 2090 | Ga0495637_0107325 | |||
| 2091 | Ga0495637_0294839 | |||
| 2092 | Ga0495643_0010644 | |||
| 2093 | Ga0495643_0032093 | |||
| 2094 | Ga0495643_0065304 | |||
| 2095 | Ga0495643_0066699 | |||
| 2096 | Ga0495643_0078750 | |||
| 2097 | Ga0495643_0081093 | |||
| 2098 | Ga0495643_0085218 | |||
| 2099 | Ga0495643_0091504 | |||
| 2100 | Ga0495643_0118867 | |||
| 2101 | Ga0495643_0139286 | |||
| 2102 | Ga0495643_0192027 | |||
| 2103 | Ga0495643_0221022 | |||
| 2104 | Ga0495643_0226757 | |||
| 2105 | Ga0495644_0027051 | |||
| 2106 | Ga0495644_0035051 | |||
| 2107 | Ga0495644_0083860 | |||
| 2108 | Ga0495644_0084397 | |||
| 2109 | Ga0495644_0088545 | |||
| 2110 | Ga0495644_0098570 | |||
| 2111 | Ga0495644_0112630 | |||
| 2112 | Ga0495644_0113788 | |||
| 2113 | Ga0495644_0120039 | |||
| 2114 | Ga0495648_0013276 | |||
| 2115 | Ga0495648_0034037 | |||
| 2116 | Ga0495648_0042742 | |||
| 2117 | Ga0495648_0069259 | |||
| 2118 | Ga0495648_0107232 | |||
| 2119 | Ga0495648_0167280 | |||
| 2120 | Ga0495648_0175469 | |||
| 2121 | Ga0495648_0179256 | |||
| 2122 | Ga0495663_0010607 | |||
| 2123 | Ga0495663_0031792 | |||
| 2124 | Ga0495663_0093960 | |||
| 2125 | Ga0495663_0123673 | |||
| 2126 | Ga0495663_0150239 | |||
| 2127 | Ga0495663_0181453 | |||
| 2128 | Ga0495666_0087815 | |||
| 2129 | Ga0495666_0178036 | |||
| 2130 | Ga0495666_0244369 | |||
| 2131 | Ga0495666_0268240 | |||
| 2132 | Ga0495666_0293812 | |||
| 2133 | Ga0495642_0004349 | |||
| 2134 | Ga0495642_0021122 | |||
| 2135 | Ga0495642_0027378 | |||
| 2136 | Ga0495642_0048979 | |||
| 2137 | Ga0495642_0052249 | |||
| 2138 | Ga0495642_0061666 | |||
| 2139 | Ga0495642_0066277 | |||
| 2140 | Ga0495642_0067965 | |||
| 2141 | Ga0495642_0096136 | |||
| 2142 | Ga0495642_0115352 | |||
| 2143 | Ga0495642_0124442 | |||
| 2144 | Ga0495642_0127967 | |||
| 2145 | Ga0495642_0178962 | |||
| 2146 | Ga0495642_0182863 | |||
| 2147 | Ga0495642_0213288 | |||
| 2148 | Ga0495642_0324610 | |||
| 2149 | Ga0495652_0027829 | |||
| 2150 | Ga0495652_0035148 | |||
| 2151 | Ga0495652_0271463 | |||
| 2152 | Ga0495652_0314968 | |||
| 2153 | Ga0495652_0503440 | |||
| 2154 | Ga0495654_0000115 | |||
| 2155 | Ga0495654_0065073 | |||
| 2156 | Ga0495654_0077712 | |||
| 2157 | Ga0495654_0082162 | |||
| 2158 | Ga0495654_0091742 | |||
| 2159 | Ga0495654_0115950 | |||
| 2160 | Ga0495654_0160159 | |||
| 2161 | Ga0495654_0168280 | |||
| 2162 | Ga0495665_0046360 | |||
| 2163 | Ga0495665_0055908 | |||
| 2164 | Ga0495665_0081402 | |||
| 2165 | Ga0495665_0192065 | |||
| 2166 | Ga0495665_0482052 | |||
| 2167 | Ga0495640_0305576 | |||
| 2168 | Ga0495640_0307279 | |||
| 2169 | Ga0495586_0034290 | |||
| 2170 | Ga0495586_0052978 | |||
| 2171 | Ga0495586_0121477 | |||
| 2172 | Ga0495587_0015602 | |||
| 2173 | Ga0495587_0118398 | |||
| 2174 | Ga0495587_0246276 | |||
| 2175 | Ga0495587_0334153 | |||
| 2176 | Ga0495598_0217997 | |||
| 2177 | Ga0495598_0264374 | |||
| 2178 | Ga0495609_0002112 | |||
| 2179 | Ga0495609_0003741 | |||
| 2180 | Ga0495609_0005231 | |||
| 2181 | Ga0495609_0010718 | |||
| 2182 | Ga0495609_0073530 | |||
| 2183 | Ga0495609_0088916 | |||
| 2184 | Ga0495609_0098226 | |||
| 2185 | Ga0495609_0135374 | |||
| 2186 | Ga0495609_0138755 | |||
| 2187 | Ga0495609_0324097 | |||
| 2188 | Ga0495621_0124882 | |||
| 2189 | Ga0495621_0129299 | |||
| 2190 | Ga0495621_0239139 | |||
| 2191 | Ga0495597_0008648 | |||
| 2192 | Ga0495597_0039483 | |||
| 2193 | Ga0495597_0051584 | |||
| 2194 | Ga0495597_0071899 | |||
| 2195 | Ga0495597_0090026 | |||
| 2196 | Ga0495597_0098005 | |||
| 2197 | Ga0495597_0112166 | |||
| 2198 | Ga0495597_0123957 | |||
| 2199 | Ga0495597_0137308 | |||
| 2200 | Ga0495597_0173986 | |||
| 2201 | Ga0495597_0184857 | |||
| 2202 | Ga0495597_0196766 | |||
| 2203 | Ga0495645_0099543 | |||
| 2204 | Ga0495645_0158047 | |||
| 2205 | Ga0495645_0380992 | |||
| 2206 | Ga0495622_0010681 | |||
| 2207 | Ga0495622_0075497 | |||
| 2208 | Ga0495622_0087025 | |||
| 2209 | Ga0495622_0142933 | |||
| 2210 | Ga0495622_0143997 | |||
| 2211 | Ga0495622_0197854 | |||
| 2212 | Ga0495622_0202751 | |||
| 2213 | Ga0495622_0209861 | |||
| 2214 | Ga0495622_0213533 | |||
| 2215 | Ga0495633_0016754 | |||
| 2216 | Ga0495633_0040031 | |||
| 2217 | Ga0495633_0046083 | |||
| 2218 | Ga0495633_0047892 | |||
| 2219 | Ga0495633_0069829 | |||
| 2220 | Ga0495633_0113004 | |||
| 2221 | Ga0495633_0131615 | |||
| 2222 | Ga0495633_0171891 | |||
| 2223 | Ga0495633_0254752 | |||
| 2224 | Ga0495633_0276289 | |||
| 2225 | Ga0495633_0282116 | |||
| 2226 | Ga0495633_0300229 | |||
| 2227 | Ga0495633_0345992 | |||
| 2228 | Ga0495633_0359431 | |||
| 2229 | Ga0495667_0076074 | |||
| 2230 | Ga0495656_0006272 | |||
| 2231 | Ga0495656_0070784 | |||
| 2232 | Ga0495656_0101671 | |||
| 2233 | Ga0495656_0150503 | |||
| 2234 | Ga0495656_0288364 | |||
| 2235 | Ga0495656_0302232 | |||
| 2236 | Ga0495656_0310447 | |||
| 2237 | Ga0495668_0007707 | |||
| 2238 | Ga0495668_0020876 | |||
| 2239 | Ga0495668_0025580 | |||
| 2240 | Ga0495668_0054798 | |||
| 2241 | Ga0495668_0057793 | |||
| 2242 | Ga0495668_0067174 | |||
| 2243 | Ga0495668_0102990 | |||
| 2244 | Ga0495668_0157367 | |||
| 2245 | Ga0495668_0216198 | |||
| 2246 | Ga0495668_0216973 | |||
| 2247 | Ga0495668_0244514 | |||
| 2248 | Ga0495668_0283014 | |||
| 2249 | Ga0495668_0316831 | |||
| 2250 | Ga0495668_0438164 | |||
| 2251 | Ga0495668_0572655 | |||
| 2252 | Ga0495668_0810551 | |||
| 2253 | Ga0495634_0019079 | |||
| 2254 | Ga0495634_0192943 | |||
| 2255 | Ga0495611_0013452 | |||
| 2256 | Ga0495611_0051565 | |||
| 2257 | Ga0495611_0066175 | |||
| 2258 | Ga0495611_0077598 | |||
| 2259 | Ga0495611_0099340 | |||
| 2260 | Ga0495611_0167304 | |||
| 2261 | Ga0495611_0191501 | |||
| 2262 | Ga0495611_0309654 | |||
| 2263 | Ga0495625_0020104 | |||
| 2264 | Ga0495625_0021030 | |||
| 2265 | Ga0495625_0022675 | |||
| 2266 | Ga0495625_0053638 | |||
| 2267 | Ga0495625_0078068 | |||
| 2268 | Ga0495625_0134180 | |||
| 2269 | Ga0495625_0263877 | |||
| 2270 | Ga0495625_0322930 | |||
| 2271 | Ga0495625_0347986 | |||
| 2272 | Ga0495635_0014432 | |||
| 2273 | Ga0495635_0068579 | |||
| 2274 | Ga0495659_0012672 | |||
| 2275 | Ga0495659_0020773 | |||
| 2276 | Ga0495659_0047516 | |||
| 2277 | Ga0495659_0121116 | |||
| 2278 | Ga0495659_0309852 | |||
| 2279 | Ga0495659_0447522 | |||
| 2280 | Ga0495659_0470245 | |||
| 2281 | Ga0495661_0010669 | |||
| 2282 | Ga0495661_0018478 | |||
| 2283 | Ga0495661_0058552 | |||
| 2284 | Ga0495661_0058855 | |||
| 2285 | Ga0495661_0077557 | |||
| 2286 | Ga0495661_0088865 | |||
| 2287 | Ga0495661_0115856 | |||
| 2288 | Ga0495661_0124105 | |||
| 2289 | Ga0495661_0149912 | |||
| 2290 | Ga0495661_0153590 | |||
| 2291 | Ga0495661_0156350 | |||
| 2292 | Ga0495661_0167032 | |||
| 2293 | Ga0495661_0199840 | |||
| 2294 | Ga0495661_0223551 | |||
| 2295 | Ga0495661_0228249 | |||
| 2296 | Ga0495661_0241389 | |||
| 2297 | Ga0495661_0258570 | |||
| 2298 | Ga0495661_0397778 | |||
| 2299 | Ga0495661_0465733 | |||
| 2300 | Ga0495661_0478009 | |||
| 2301 | Ga0495661_0510115 | |||
| 2302 | Ga0495588_0010876 | |||
| 2303 | Ga0495588_0014904 | |||
| 2304 | Ga0495588_0040459 | |||
| 2305 | Ga0495588_0062419 | |||
| 2306 | Ga0495588_0114119 | |||
| 2307 | Ga0495588_0120582 | |||
| 2308 | Ga0495588_0126731 | |||
| 2309 | Ga0495588_0169163 | |||
| 2310 | Ga0495588_0269792 | |||
| 2311 | Ga0495588_0284320 | |||
| 2312 | Ga0495588_0383066 | |||
| 2313 | Ga0495588_0459929 | |||
| 2314 | Ga0495657_0029648 | |||
| 2315 | Ga0495657_0353281 | |||
| 2316 | Ga0495599_0007721 | |||
| 2317 | Ga0495599_0184025 | |||
| 2318 | Ga0495599_0416237 | |||
| 2319 | Ga0495623_0068842 | |||
| 2320 | Ga0495623_0076509 | |||
| 2321 | Ga0495623_0205957 | |||
| 2322 | Ga0495623_0218757 | |||
| 2323 | Ga0495623_0283811 | |||
| 2324 | Ga0495623_0312291 | |||
| 2325 | Ga0495623_0380325 | |||
| 2326 | Ga0495646_0112772 | |||
| 2327 | Ga0495646_0181463 | |||
| 2328 | Ga0495646_0253356 | |||
| 2329 | Ga0495646_0333161 | |||
| 2330 | Ga0495646_0637124 | |||
| 2331 | Ga0495658_0224387 | |||
| 2332 | Ga0495669_0021103 | |||
| 2333 | Ga0495669_0056751 | |||
| 2334 | Ga0495669_0065000 | |||
| 2335 | Ga0495669_0067620 | |||
| 2336 | Ga0495669_0086910 | |||
| 2337 | Ga0495669_0112795 | |||
| 2338 | Ga0495669_0215544 | |||
| 2339 | Ga0495669_0221649 | |||
| 2340 | Ga0495613_0065356 | |||
| 2341 | Ga0495613_0253770 | |||
| 2342 | Ga0495613_0394069 | |||
| 2343 | Ga0495624_0078632 | |||
| 2344 | Ga0495624_0121558 | |||
| 2345 | Ga0495624_0123298 | |||
| 2346 | Ga0495624_0777347 | |||
| 2347 | Ga0495670_0042081 | |||
| 2348 | Ga0495670_0044966 | |||
| 2349 | Ga0495670_0046118 | |||
| 2350 | Ga0495670_0082751 | |||
| 2351 | Ga0495670_0152880 | |||
| 2352 | Ga0495670_0165436 | |||
| 2353 | Ga0495670_0172779 | |||
| 2354 | Ga0495670_0200169 | |||
| 2355 | Ga0495670_0298224 | |||
| 2356 | Ga0495670_0329266 | |||
| 2357 | Ga0495670_0337191 | |||
| 2358 | Ga0495670_0638070 | |||
| 2359 | Ga0495671_0016693 | |||
| 2360 | Ga0495671_0029072 | |||
| 2361 | Ga0495671_0049468 | |||
| 2362 | Ga0495671_0078583 | |||
| 2363 | Ga0495671_0116767 | |||
| 2364 | Ga0495671_0145008 | |||
| 2365 | Ga0495671_0182117 | |||
| 2366 | Ga0495671_0210520 | |||
| 2367 | Ga0495671_0398155 | |||
| 2368 | Ga0495649_0014801 | |||
| 2369 | Ga0495649_0024341 | |||
| 2370 | Ga0495649_0053355 | |||
| 2371 | Ga0495649_0060727 | |||
| 2372 | Ga0495649_0120385 | |||
| 2373 | Ga0495649_0184805 | |||
| 2374 | Ga0495649_0198523 | |||
| 2375 | Ga0495649_0482298 | |||
| 2376 | Ga0495649_0588584 | |||
| 2377 | Ga0495589_0014565 | |||
| 2378 | Ga0495589_0022141 | |||
| 2379 | Ga0495589_0043731 | |||
| 2380 | Ga0495589_0085487 | |||
| 2381 | Ga0495589_0085914 | |||
| 2382 | Ga0495589_0088958 | |||
| 2383 | Ga0495589_0106067 | |||
| 2384 | Ga0495589_0120451 | |||
| 2385 | Ga0495589_0137014 | |||
| 2386 | Ga0495589_0177569 | |||
| 2387 | Ga0495589_0228246 | |||
| 2388 | Ga0495589_0306391 | |||
| 2389 | Ga0495589_0328935 | |||
| 2390 | Ga0495589_0411505 | |||
| 2391 | Ga0495600_0011381 | |||
| 2392 | Ga0495600_0075615 | |||
| 2393 | Ga0495600_0169292 | |||
| 2394 | Ga0495600_0300712 | |||
| 2395 | Ga0495660_0003674 | |||
| 2396 | Ga0495660_0007171 | |||
| 2397 | Ga0495660_0030863 | |||
| 2398 | Ga0495660_0054740 | |||
| 2399 | Ga0495660_0091402 | |||
| 2400 | Ga0495660_0147915 | |||
| 2401 | Ga0495660_0154468 | |||
| 2402 | Ga0495660_0168230 | |||
| 2403 | Ga0495660_0219733 | |||
| 2404 | Ga0495660_0232924 | |||
| 2405 | Ga0495660_0308179 | |||
| 2406 | Ga0495581_0011795 | |||
| 2407 | Ga0495581_0084029 | |||
| 2408 | Ga0495581_0360631 | |||
| 2409 | Ga0495581_0381506 | |||
| 2410 | Ga0495581_0723677 | |||
| 2411 | Ga0495604_0098589 | |||
| 2412 | Ga0495604_0113202 | |||
| 2413 | Ga0495604_0145750 | |||
| 2414 | Ga0495604_0351376 | |||
| 2415 | Ga0495604_0521019 | |||
| 2416 | Ga0495636_0006088 | |||
| 2417 | Ga0495636_0006698 | |||
| 2418 | Ga0495636_0007040 | |||
| 2419 | Ga0495636_0022781 | |||
| 2420 | Ga0495636_0162291 | |||
| 2421 | Ga0495636_0287990 | |||
| 2422 | Ga0495636_0535779 | |||
| 2423 | Ga0495674_0035014 | |||
| 2424 | Ga0495672_0019097 | |||
| 2425 | Ga0495672_0020418 | |||
| 2426 | Ga0495672_0026706 | |||
| 2427 | Ga0495672_0059705 | |||
| 2428 | Ga0495672_0078821 | |||
| 2429 | Ga0495672_0083387 | |||
| 2430 | Ga0495672_0144473 | |||
| 2431 | Ga0495672_0205361 | |||
| 2432 | Ga0495672_0350773 | |||
| 2433 | Ga0495676_0059819 | |||
| 2434 | Ga0495676_0093491 | |||
| 2435 | Ga0495676_0173448 | |||
| 2436 | Ga0495676_0257446 | |||
| 2437 | Ga0495676_0304389 | |||
| 2438 | Ga0495676_0495608 | |||
| 2439 | Ga0495680_0081403 | |||
| 2440 | Ga0495680_0082868 | |||
| 2441 | Ga0495680_0344851 | |||
| 2442 | Ga0495680_0537176 | |||
| 2443 | Ga0495683_0025191 | |||
| 2444 | Ga0495683_0037514 | |||
| 2445 | Ga0495683_0070704 | |||
| 2446 | Ga0495683_0140598 | |||
| 2447 | Ga0495683_0142576 | |||
| 2448 | Ga0495683_0151837 | |||
| 2449 | Ga0495683_0186374 | |||
| 2450 | Ga0495683_0233898 | |||
| 2451 | Ga0495683_0234859 | |||
| 2452 | Ga0495683_0322969 | |||
| 2453 | Ga0495683_0326250 | |||
| 2454 | Ga0495687_000370 | |||
| 2455 | Ga0495687_007822 | |||
| 2456 | Ga0495687_014326 | |||
| 2457 | Ga0495687_024856 | |||
| 2458 | Ga0495687_029913 | |||
| 2459 | Ga0495687_036882 | |||
| 2460 | Ga0495687_088588 | |||
| 2461 | Ga0495687_090810 | |||
| 2462 | Ga0495687_097393 | |||
| 2463 | Ga0495675_0151163 | |||
| 2464 | Ga0495675_0229325 | |||
| 2465 | Ga0495675_0243254 | |||
| 2466 | Ga0495675_0361090 | |||
| 2467 | Ga0495675_0526632 | |||
| 2468 | Ga0495677_0006314 | |||
| 2469 | Ga0495677_0006510 | |||
| 2470 | Ga0495677_0026532 | |||
| 2471 | Ga0495677_0032012 | |||
| 2472 | Ga0495677_0043835 | |||
| 2473 | Ga0495677_0070385 | |||
| 2474 | Ga0495677_0085894 | |||
| 2475 | Ga0495677_0087226 | |||
| 2476 | Ga0495677_0089584 | |||
| 2477 | Ga0495677_0093603 | |||
| 2478 | Ga0495677_0097213 | |||
| 2479 | Ga0495677_0181154 | |||
| 2480 | Ga0495677_0215504 | |||
| 2481 | Ga0495677_0278112 | |||
| 2482 | Ga0495677_0280702 | |||
| 2483 | Ga0495679_008823 | |||
| 2484 | Ga0495679_051789 | |||
| 2485 | Ga0495679_052553 | |||
| 2486 | Ga0495679_061198 | |||
| 2487 | Ga0495679_065665 | |||
| 2488 | Ga0495679_084892 | |||
| 2489 | Ga0495679_104770 | |||
| 2490 | Ga0495685_001797 | |||
| 2491 | Ga0495685_049119 | |||
| 2492 | Ga0495685_051223 | |||
| 2493 | Ga0495685_059807 | |||
| 2494 | Ga0495685_096110 | |||
| 2495 | Ga0495685_231982 | |||
| 2496 | Ga0495685_241979 | |||
| 2497 | Ga0495673_0000185 | |||
| 2498 | Ga0495673_0000338 | |||
| 2499 | Ga0495673_0002607 | |||
| 2500 | Ga0495673_0100936 | |||
| 2501 | Ga0495681_0018699 | |||
| 2502 | Ga0495681_0030651 | |||
| 2503 | Ga0495681_0061145 | |||
| 2504 | Ga0495681_0078367 | |||
| 2505 | Ga0495681_0106719 | |||
| 2506 | Ga0495681_0139883 | |||
| 2507 | Ga0495681_0152247 | |||
| 2508 | Ga0495681_0232725 | |||
| 2509 | Ga0495681_0271659 | |||
| 2510 | Ga0495686_0005000 | |||
| 2511 | Ga0495686_0041880 | |||
| 2512 | Ga0495686_0116547 | |||
| 2513 | Ga0495686_0121709 | |||
| 2514 | Ga0495686_0203037 | |||
| 2515 | Ga0495686_0452869 | |||
| 2516 | Ga0495686_0727384 | |||
| 2517 | Ga0495593_0012462 | |||
| 2518 | Ga0495593_0195327 | |||
| 2519 | Ga0495593_0374729 | |||
| 2520 | Ga0495593_0682892 | |||
| 2521 | Ga0495602_0058801 | |||
| 2522 | Ga0495602_0277034 | |||
| 2523 | Ga0495602_0734444 | |||
| 2524 | Ga0495614_0029810 | |||
| 2525 | Ga0495614_0060035 | |||
| 2526 | Ga0495614_0107230 | |||
| 2527 | Ga0495615_0020588 | |||
| 2528 | Ga0495615_0042504 | |||
| 2529 | Ga0495615_0078113 | |||
| 2530 | Ga0495626_0003909 | |||
| 2531 | Ga0495626_0010744 | |||
| 2532 | Ga0495626_0012906 | |||
| 2533 | Ga0495626_0016437 | |||
| 2534 | Ga0495626_0027831 | |||
| 2535 | Ga0495626_0032859 | |||
| 2536 | Ga0495626_0077411 | |||
| 2537 | Ga0495626_0080378 | |||
| 2538 | Ga0495626_0081637 | |||
| 2539 | Ga0495626_0125936 | |||
| 2540 | Ga0495626_0133404 | |||
| 2541 | Ga0495626_0345249 | |||
| 2542 | Ga0496100_0018888 | |||
| 2543 | Ga0496100_0632587 | |||
| 2544 | Ga0496100_0647665 | |||
| 2545 | Ga0496100_0972939 | |||
| 2546 | Ga0496101_0319243 | |||
| 2547 | Ga0496102_0068828 | |||
| 2548 | Ga0496102_0088863 | |||
| 2549 | Ga0496102_0137406 | |||
| 2550 | Ga0496102_0803991 | |||
| 2551 | Ga0496102_1070135 | |||
| 2552 | Ga0496102_1077448 | |||
| 2553 | Ga0496102_1348585 | |||
| 2554 | Ga0496103_0058673 | |||
| 2555 | Ga0496103_0070829 | |||
| 2556 | Ga0496103_0090188 | |||
| 2557 | Ga0496103_0091802 | |||
| 2558 | Ga0496103_0180310 | |||
| 2559 | Ga0496103_0419965 | |||
| 2560 | Ga0496103_0612122 | |||
| 2561 | Ga0496104_0178000 | |||
| 2562 | Ga0496104_0570097 | |||
| 2563 | Ga0496104_1134155 | |||
| 2564 | Ga0496105_0442086 | |||
| 2565 | Ga0496105_0534987 | |||
| 2566 | Ga0496105_0547476 | |||
| 2567 | Ga0496105_0952840 | |||
| 2568 | Ga0496106_0253104 | |||
| 2569 | Ga0496106_0535103 | |||
| 2570 | Ga0496107_0248001 | |||
| 2571 | Ga0496107_0398111 | |||
| 2572 | Ga0496107_0479689 | |||
| 2573 | Ga0496107_0860266 | |||
| 2574 | Ga0496108_0191326 | |||
| 2575 | Ga0496108_0599219 | |||
| 2576 | Ga0496108_0849703 | |||
| 2577 | Ga0496109_0072916 | |||
| 2578 | Ga0496109_0186739 | |||
| 2579 | Ga0496109_0783590 | |||
| 2580 | Ga0496109_1056140 | |||
| 2581 | Ga0496110_0080386 | |||
| 2582 | Ga0496110_0491583 | |||
| 2583 | Ga0496110_0690196 | |||
| 2584 | Ga0496110_0861253 | |||
| 2585 | Ga0496110_0936409 | |||
| 2586 | Ga0496110_1164934 | |||
| 2587 | Ga0496111_0091872 | |||
| 2588 | Ga0496111_0146589 | |||
| 2589 | Ga0496111_0521994 | |||
| 2590 | Ga0496112_0306153 | |||
| 2591 | Ga0496113_0099847 | |||
| 2592 | Ga0496113_0385700 | |||
| 2593 | Ga0496114_0022403 | |||
| 2594 | Ga0496114_0289742 | |||
| 2595 | Ga0496114_0438915 | |||
| 2596 | Ga0496114_0637577 | |||
| 2597 | Ga0496114_0641742 | |||
| 2598 | Ga0496115_0050867 | |||
| 2599 | Ga0496115_0221193 | |||
| 2600 | Ga0496115_0321110 | |||
| 2601 | Ga0496115_0801713 | |||
| 2602 | Ga0496116_0091755 | |||
| 2603 | Ga0496116_0253322 | |||
| 2604 | Ga0496118_0183090 | |||
| 2605 | Ga0496120_0124356 | |||
| 2606 | Ga0496121_0243249 | |||
| 2607 | Ga0496121_0329613 | |||
| 2608 | Ga0496121_0537195 | |||
| 2609 | Ga0496121_0676800 | |||
| 2610 | Ga0496122_0077023 | |||
| 2611 | Ga0496122_0109128 | |||
| 2612 | Ga0496122_0194708 | |||
| 2613 | Ga0496122_0426972 | |||
| 2614 | Ga0496123_0013659 | |||
| 2615 | Ga0496123_0031651 | |||
| 2616 | Ga0496123_0069843 | |||
| 2617 | Ga0496124_0106187 | |||
| 2618 | Ga0496124_0129517 | |||
| 2619 | Ga0496124_0132720 | |||
| 2620 | Ga0496124_0150483 | |||
| 2621 | Ga0496124_0323784 | |||
| 2622 | Ga0496124_0348155 | |||
| 2623 | Ga0496124_0355597 | |||
| 2624 | Ga0496124_0745176 | |||
| 2625 | Ga0496124_0787945 | |||
| 2626 | Ga0496124_0801049 | |||
| 2627 | Ga0496125_0021606 | |||
| 2628 | Ga0496125_0060592 | |||
| 2629 | Ga0496125_0063503 | |||
| 2630 | Ga0496125_0427486 | |||
| 2631 | Ga0496126_0031527 | |||
| 2632 | Ga0496126_0345681 | |||
| 2633 | Ga0496126_0708504 | |||
| 2634 | Ga0501306_000150 | |||
| 2635 | Ga0501306_003340 | |||
| 2636 | Ga0501306_009215 | |||
| 2637 | Ga0501306_058971 | |||
| 2638 | Ga0501306_077581 | |||
| 2639 | Ga0501306_079075 | |||
| 2640 | Ga0501308_000398 | |||
| 2641 | Ga0501308_002408 | |||
| 2642 | Ga0501308_018121 | |||
| 2643 | Ga0501309_004241 | |||
| 2644 | Ga0501309_011386 | |||
| 2645 | Ga0501310_001072 | |||
| 2646 | Ga0501310_006078 | |||
| 2647 | Ga0501310_016049 | |||
| 2648 | Ga0501343_000533 | |||
| 2649 | Ga0501343_007025 | |||
| 2650 | Ga0501343_010267 | |||
| 2651 | Ga0501304_001138 | |||
| 2652 | Ga0501304_002860 | |||
| 2653 | Ga0501304_005072 | |||
| 2654 | Ga0501304_008888 | |||
| 2655 | Ga0501305_005503 | |||
| 2656 | Ga0501305_006325 | |||
| 2657 | Ga0501305_028998 | |||
| 2658 | Ga0501305_047139 | |||
| 2659 | Ga0501305_075734 | |||
| 2660 | Ga0501305_081335 | |||
| 2661 | Ga0501305_082426 | |||
| 2662 | Ga0501307_002498 | |||
| 2663 | Ga0501307_002525 | |||
| 2664 | Ga0501307_004154 | |||
| 2665 | Ga0501307_004969 | |||
| 2666 | Ga0501307_024948 | |||
| 2667 | Ga0501307_067261 | |||
| 2668 | Ga0495678_006998 | |||
| 2669 | Ga0495678_025193 | |||
| 2670 | Ga0495678_027928 | |||
| 2671 | Ga0495678_059401 | |||
| 2672 | Ga0495678_066094 | |||
| 2673 | Ga0495678_069294 | |||
| 2674 | Ga0495678_091123 | |||
| 2675 | Ga0495678_092832 | |||
| 2676 | Ga0495682_0063615 | |||
| 2677 | Ga0495682_0080123 | |||
| 2678 | Ga0495682_0124886 | |||
| 2679 | Ga0501297_011034 | |||
| 2680 | Ga0501311_000165 | |||
| 2681 | Ga0501311_020593 | |||
| 2682 | Ga0501311_023545 | |||
| 2683 | Ga0501311_089829 | |||
| 2684 | Ga0501312_004623 | |||
| 2685 | Ga0501312_012905 | |||
| 2686 | Ga0501312_025618 | |||
| 2687 | Ga0501312_032245 | |||
| 2688 | Ga0501312_053251 | |||
| 2689 | Ga0501312_090417 | |||
| 2690 | Ga0501313_000756 | |||
| 2691 | Ga0501313_001122 | |||
| 2692 | Ga0501314_005033 | |||
| 2693 | Ga0501314_008905 | |||
| 2694 | Ga0501314_021302 | |||
| 2695 | Ga0501315_000556 | |||
| 2696 | Ga0501315_002286 | |||
| 2697 | Ga0501315_003217 | |||
| 2698 | Ga0501315_003289 | |||
| 2699 | Ga0501315_012963 | |||
| 2700 | Ga0501315_013154 | |||
| 2701 | Ga0501315_082020 | |||
| 2702 | Ga0501316_000848 | |||
| 2703 | Ga0501316_006293 | |||
| 2704 | Ga0501316_007300 | |||
| 2705 | Ga0501316_043078 | |||
| 2706 | Ga0501317_016468 | |||
| 2707 | Ga0501317_016650 | |||
| 2708 | Ga0501317_022573 | |||
| 2709 | Ga0501319_026436 | |||
| 2710 | Ga0501320_003037 | |||
| 2711 | Ga0501320_003150 | |||
| 2712 | Ga0501320_003152 | |||
| 2713 | Ga0501320_009090 | |||
| 2714 | Ga0501320_009230 | |||
| 2715 | Ga0501321_003885 | |||
| 2716 | Ga0501321_021050 | |||
| 2717 | Ga0501321_025452 | |||
| 2718 | Ga0501321_026065 | |||
| 2719 | Ga0501321_039662 | |||
| 2720 | Ga0501322_003710 | |||
| 2721 | Ga0501323_017947 | |||
| 2722 | Ga0501323_038409 | |||
| 2723 | Ga0501323_055330 | |||
| 2724 | Ga0501323_086114 | |||
| 2725 | Ga0501324_000146 | |||
| 2726 | Ga0501324_032909 | |||
| 2727 | Ga0501324_039127 | |||
| 2728 | Ga0501325_002483 | |||
| 2729 | Ga0501326_03837 | |||
| 2730 | Ga0501327_07824 | |||
| 2731 | Ga0501330_015869 | |||
| 2732 | Ga0501334_02030 | |||
| 2733 | Ga0501334_11604 | |||
| 2734 | Ga0501335_016552 | |||
| 2735 | Ga0501335_030466 | |||
| 2736 | Ga0501336_001604 | |||
| 2737 | Ga0501336_021445 | |||
| 2738 | Ga0501337_003695 | |||
| 2739 | Ga0501036_0168725 | |||
| 2740 | Ga0501211_003467 | |||
| 2741 | Ga0501222_052889 | |||
| 2742 | Ga0501227_001669 | |||
| 2743 | Ga0501233_046721 | |||
| 2744 | Ga0501238_028740 | |||
| 2745 | Ga0501249_011012 | |||
| 2746 | Ga0501257_178657 | |||
| 2747 | Ga0501234_014155 | |||
| 2748 | Ga0501232_048342 | |||
| 2749 | Ga0501263_009328 | |||
| 2750 | Ga0501268_014162 | |||
| 2751 | Ga0501268_048277 | |||
| 2752 | Ga0501279_003775 | |||
| 2753 | Ga0501279_014665 | |||
| 2754 | Ga0501035_0035964 | |||
| 2755 | Ga0501044_1175829 | |||
| 2756 | nmdc:mga03683_124751_c1 | |||
| 2757 | nmdc:mga03n38_79853_c1 | |||
| 2758 | nmdc:mga0k408_362329_c1 | |||
| 2759 | nmdc:mga07m45_367000_c1 | |||
| 2760 | nmdc:mga07m45_95626_c1 | |||
| 2761 | Ga0495601_0011363 | |||
| 2762 | Ga0495655_0195039 | |||
| 2763 | Ga0500646_0325529 | |||
| 2764 | Ga0500594_0105109 | |||
| 2765 | Ga0500595_081341 | |||
| 2766 | Ga0500618_004294 | |||
| 2767 | Ga0500621_188196 | |||
| 2768 | Ga0500559_0112531 | |||
| 2769 | Ga0500573_0380923 | |||
| 2770 | Ga0500574_000852 | |||
| 2771 | Ga0500586_092624 | |||
| 2772 | Ga0500586_130803 | |||
| 2773 | Ga0500619_083039 | |||
| 2774 | Ga0500624_071695 | |||
| 2775 | Ga0500636_0475721 | |||
| 2776 | Ga0587084_006452 | |||
| 2777 | Ga0587084_017124 | |||
| 2778 | Ga0587084_027909 | |||
| 2779 | Ga0587093_001802 | |||
| 2780 | Ga0587093_003356 | |||
| 2781 | Ga0587066_002048 | |||
| 2782 | Ga0587066_025732 | |||
| 2783 | Ga0587070_011858 | |||
| 2784 | Ga0587070_012033 | |||
| 2785 | Ga0587070_037857 | |||
| 2786 | Ga0587073_0000405 | |||
| 2787 | Ga0587073_0152513 | |||
| 2788 | Ga0587077_008903 | |||
| 2789 | Ga0587077_009273 | |||
| 2790 | Ga0587080_003728 | |||
| 2791 | Ga0587080_019330 | |||
| 2792 | Ga0587080_053033 | |||
| 2793 | Ga0587082_000814 | |||
| 2794 | Ga0587082_062171 | |||
| 2795 | Ga0587083_0032996 | |||
| 2796 | Ga0587083_0039846 | |||
| 2797 | Ga0587085_006188 | |||
| 2798 | Ga0587085_013499 | |||
| 2799 | Ga0587086_000667 | |||
| 2800 | Ga0587086_003732 | |||
| 2801 | Ga0587086_012653 | |||
| 2802 | Ga0587088_000683 | |||
| 2803 | Ga0587088_006876 | |||
| 2804 | Ga0587088_039639 | |||
| 2805 | Ga0587089_009849 | |||
| 2806 | Ga0587089_018181 | |||
| 2807 | Ga0587089_031477 | |||
| 2808 | Ga0587090_003488 | |||
| 2809 | Ga0587090_007045 | |||
| 2810 | Ga0587091_002980 | |||
| 2811 | Ga0587091_021583 | |||
| 2812 | Ga0587092_005373 | |||
| 2813 | Ga0587092_008921 | |||
| 2814 | Ga0587094_002657 | |||
| 2815 | Ga0587094_003403 | |||
| 2816 | Ga0587094_003513 | |||
| 2817 | Ga0587095_000862 | |||
| 2818 | Ga0587095_001423 | |||
| 2819 | Ga0587097_00287 | |||
| 2820 | Ga0587097_01444 | |||
| 2821 | Ga0587098_001919 | |||
| 2822 | Ga0587098_028142 | |||
| 2823 | Ga0587121_01643 | |||
| 2824 | Ga0587125_000574 | |||
| 2825 | Ga0587129_003518 | |||
| 2826 | Ga0587099_005269 | |||
| 2827 | Ga0587101_000524 | |||
| 2828 | Ga0587101_002989 | |||
| 2829 | Ga0587101_008422 | |||
| 2830 | Ga0587101_033901 | |||
| 2831 | Ga0587109_014290 | |||
| 2832 | Ga0587109_031962 | |||
| 2833 | Ga0587115_006225 | |||
| 2834 | Ga0587117_015916 | |||
| 2835 | Ga0587128_005351 | |||
| 2836 | Ga0587128_036484 | |||
| 2837 | Ga0587062_015555 | |||
| 2838 | Ga0587062_016957 | |||
| 2839 | Ga0587062_064065 | |||
| 2840 | Ga0587068_006343 | |||
| 2841 | Ga0587068_025778 | |||
| 2842 | Ga0587069_000151 | |||
| 2843 | Ga0587069_008398 | |||
| 2844 | Ga0587072_019128 | |||
| 2845 | Ga0587072_039981 | |||
| 2846 | Ga0587075_002302 | |||
| 2847 | Ga0587075_008575 | |||
| 2848 | Ga0587076_000769 | |||
| 2849 | Ga0587076_008880 | |||
| 2850 | Ga0587078_021377 | |||
| 2851 | Ga0587079_000436 | |||
| 2852 | Ga0587079_022980 | |||
| 2853 | Ga0587079_034095 | |||
| 2854 | Ga0587079_037059 | |||
| 2855 | Ga0587079_048272 | |||
| 2856 | Ga0587100_005333 | |||
| 2857 | Ga0587102_000673 | |||
| 2858 | Ga0587102_001335 | |||
| 2859 | Ga0587102_011088 | |||
| 2860 | Ga0587104_000706 | |||
| 2861 | Ga0587105_002305 | |||
| 2862 | Ga0587107_008387 | |||
| 2863 | Ga0587108_000215 | |||
| 2864 | Ga0587110_001895 | |||
| 2865 | Ga0587116_04152 | |||
| 2866 | Ga0587118_02411 | |||
| 2867 | Ga0587119_001725 | |||
| 2868 | Ga0587119_015430 | |||
| 2869 | Ga0587120_000930 | |||
| 2870 | Ga0587065_06038 | |||
| 2871 | Ga0587081_13236 | |||
| 2872 | Ga0587096_00225 | |||
| 2873 | Ga0587071_000779 | |||
| 2874 | Ga0587071_015766 | |||
| 2875 | Ga0587071_025527 | |||
| 2876 | Ga0587071_048707 | |||
| 2877 | Ga0587111_0002093 | |||
| 2878 | Ga0587111_0005555 | |||
| 2879 | Ga0587111_0006057 | |||
| 2880 | Ga0587111_0026675 | |||
| 2881 | Ga0587111_0080351 | |||
| 2882 | Ga0466962_0268453 | |||
| 2883 | 2511247426 | |||
| 2884 | 2511384278 | |||
| 2885 | 2521560845 | |||
| 2886 | 2550696713 | |||
| 2887 | 2553008127 | |||
| 2888 | 2601667097 | |||
| 2889 | 2643789313 | |||
| 2890 | 2643799317 | |||
| 2891 | 2644030560 | |||
| 2892 | 2644251646 | |||
| 2893 | 2644356009 | |||
| 2894 | 2644472513 | |||
| 2895 | 2738738195 | |||
| 2896 | 2738826685 | |||
| 2897 | 2738842999 | |||
| 2898 | 2739150482 | |||
| 2899 | 2739192401 | |||
| 2900 | 2739273747 | |||
| 2901 | 2739318878 | |||
| 2902 | 2739337119 | |||
| 2903 | 2739342791 | |||
| 2904 | 2765567279 | |||
| 2905 | 2808984192 | |||
| 2906 | 2809131996 | |||
| 2907 | 2809145972 | |||
| 2908 | 2809151619 | |||
| 2909 | 2819594380 | |||
| 2910 | 2819618852 | |||
| 2911 | 2821136285 | |||
| 2912 | 2839095493 | |||
| 2913 | 2842717719 | |||
| 2914 | 2852622921 | |||
| 2915 | 2857563377 | |||
| 2916 | 2857567908 | |||
| 2917 | 2884814298 | |||
| 2918 | 2884840777 | |||
| 2919 | 2884857627 | |||
| 2920 | 2885080589 | |||
| 2921 | 2896158567 | |||
| 2922 | 2904427831 | |||
| 2923 | 2904445257 | |||
| 2924 | 2904533798 | |||
| 2925 | 2904589365 | |||
| 2926 | 2904595068 | |||
| 2927 | 2904606734 | |||
| 2928 | 2919050778 | |||
| 2929 | 2919084998 | |||
| 2930 | 2919476868 | |||
| 2931 | 2923514686 | |||
| 2932 | 2928135734 | |||
| 2933 | 2932422363 | |||
| 2934 | 8047676180 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy