F494178

General Info

Members Datasets Scaffolds Average Seq Length
1467 544 2934 125

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11118759|Ga0105243_111187592
Length 140
Sequence MAGSSTKAPKVKRMSTNPVQTVGTSGDKLKVTLAVCAAIAGVVAFYFLSDKPTPVRAAALVAGLILAIALAWTSMTGRDFINFSKEAVRETKKVVWPTRKEAMQITAIVFGFVLIMALFLFGTDKLLEFLLYDLILGWKK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
37 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
52 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
55 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
104 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
197 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
198 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
199 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
200 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
201 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
228 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
229 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
230 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
231 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
232 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
233 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
234 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
235 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
272 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
336 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
337 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
338 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
339 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
340 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
341 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
342 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
345 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
346 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
347 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
348 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
349 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
350 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
351 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
352 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
385 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
408 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
409 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
410 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
411 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
412 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
413 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
414 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
415 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
416 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
417 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
418 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
422 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
426 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
427 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
430 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
431 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
434 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
435 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
436 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
437 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
438 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
439 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
493 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
494 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
495 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
496 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
497 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
498 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
499 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
500 2643221556 Massilia sp. Root1485 Isolate Unclassified
501 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
502 2643221645 Massilia sp. Root351 Isolate Unclassified
503 2643221664 Massilia sp. Root418 Isolate Unclassified
504 2643221684 Massilia sp. Root133 Isolate Unclassified
505 2738541280 Massilia sp. GV090 Isolate Unclassified
506 2738541297 Duganella sp. GV083 Isolate Unclassified
507 2738541300 Massilia sp. GV016 Isolate Unclassified
508 2738541357 Duganella sp. GV053 Isolate Unclassified
509 2738543003 Duganella sp. GV066 Isolate Unclassified
510 2738543018 Massilia sp. GV045 Isolate Unclassified
511 2738543026 Duganella sp. GV089 Isolate Unclassified
512 2738543029 Duganella sp. GV039 Isolate Unclassified
513 2738543030 Massilia sp. GV097 Isolate Unclassified
514 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
515 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
516 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
517 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
518 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
519 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
520 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
521 2821131069 Duganella sp. 1224 Isolate Unclassified
522 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
523 2842711865 Duganella sp. R-73148 Isolate Unclassified
524 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
525 2857558681 Duganella sp. R-74565 Isolate Unclassified
526 2857564685 Duganella sp. R-74599 Isolate Unclassified
527 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
528 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
529 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
530 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
531 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
532 2904424332 Duganella sp. 1411 Isolate Rhizosphere
533 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
534 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
535 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
536 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
537 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
538 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
539 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
540 2919476304 Duganella sp. 3397 Isolate Unclassified
541 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
542 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
543 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
544 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.73
Metatranscriptomes 17.72
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 0.34
Rhizoplane 4.16
Rhizosphere 82.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_11118759 3300009148 Bacteria 797
2 JGI25155J39150_1001422 3300002704 Bacteria 1719
3 JGI25162J39368_1003029 3300002737 Bacteria 5487
4 JGI25162J39368_1013612 3300002737 Bacteria 893
5 JGI25154J39366_1001113 3300002738 Bacteria 10452
6 JGI25157J39369_1002793 3300002741 Bacteria 3986
7 JGI25163J39215_1004486 3300002771 Bacteria 975
8 Ga0006761J43178_107453 3300002865 Bacteria 787
9 Ga0006763J43179_103551 3300002870 Bacteria 1885
10 Ga0006762J43184_104088 3300002872 Bacteria 3536
11 Ga0006765J45826_105488 3300003161 Bacteria 3656
12 Ga0006765J45826_112366 3300003161 Bacteria 517
13 Ga0006778J45830_1013353 3300003162 Bacteria 3860
14 Ga0006778J45830_1040529 3300003162 Bacteria 1293
15 Ga0006759J45824_1008312 3300003163 Bacteria 3423
16 Ga0006759J45824_1017914 3300003163 Bacteria 783
17 Ga0006759J45824_1050895 3300003163 Bacteria 532
18 JGI25151J46595_10026667 3300003187 Bacteria 2327
19 JGI25165J46597_1001017 3300003214 Bacteria 18492
20 JGI25153J46596_10069502 3300003215 Bacteria 918
21 Ga0007428J48920_101816 3300003288 Bacteria 1673
22 Ga0007421J48921_108960 3300003291 Bacteria 985
23 Ga0006758J48902_1003362 3300003300 Bacteria 5424
24 Ga0006758J48902_1007376 3300003300 Bacteria 802
25 Ga0006758J48902_1008629 3300003300 Bacteria 4431
26 Ga0006758J48902_1013049 3300003300 Bacteria 550
27 Ga0006770J48903_1029811 3300003305 Bacteria 1264
28 Ga0006770J48903_1044284 3300003305 Bacteria 617
29 Ga0006777J48905_1023760 3300003308 Bacteria 1382
30 Ga0006777J48905_1039864 3300003308 Bacteria 1285
31 rootH2_10111913 3300003320 Bacteria 1421
32 JGI25160J50197_1016863 3300003354 Bacteria 2336
33 Ga0007417J51691_1002081 3300003544 Bacteria 10064
34 Ga0007417J51691_1010301 3300003544 Bacteria 12984
35 Ga0007417J51691_1012480 3300003544 Bacteria 3735
36 Ga0007417J51691_1047057 3300003544 Bacteria 1157
37 Ga0007427J51700_104977 3300003559 Bacteria 3786
38 Ga0006781J51513_1012464 3300003568 Bacteria 1740
39 Ga0007410J51695_1007231 3300003574 Bacteria 17470
40 Ga0007410J51695_1020989 3300003574 Bacteria 1047
41 Ga0007409J51694_1001845 3300003575 Bacteria 1222
42 Ga0007409J51694_1004205 3300003575 Bacteria 13192
43 Ga0007409J51694_1052234 3300003575 Bacteria 546
44 Ga0007416J51690_1008732 3300003577 Bacteria 13163
45 Ga0007416J51690_1012477 3300003577 Bacteria 2533
46 Ga0007416J51690_1013143 3300003577 Bacteria 3753
47 Ga0007429J51699_1009554 3300003579 Bacteria 5322
48 Ga0007429J51699_1048446 3300003579 Bacteria 4130
49 Ga0007411J51799_105052 3300003611 Bacteria 7712
50 Ga0007411J51799_105765 3300003611 Bacteria 1376
51 Ga0007415J51800_105799 3300003613 Bacteria 1906
52 Ga0007415J51800_107921 3300003613 Bacteria 564
53 Ga0032354_1003507 3300003693 Bacteria 1535
54 Ga0032354_1011615 3300003693 Bacteria 13713
55 Ga0032354_1050188 3300003693 Bacteria 946
56 Ga0032354_1055041 3300003693 Bacteria 1008
57 Ga0006780_1004575 3300003735 Bacteria 5394
58 Ga0006780_1014123 3300003735 Bacteria 1224
59 Ga0055538_1000375 3300003751 Bacteria 18492
60 Ga0055538_1002307 3300003751 Bacteria 2880
61 Ga0055539_1000377 3300003752 Bacteria 18492
62 Ga0055539_1002407 3300003752 Bacteria 2880
63 Ga0055533_1000371 3300003756 Bacteria 18492
64 Ga0055533_1003837 3300003756 Bacteria 2880
65 Ga0055532_1000420 3300003758 Bacteria 20446
66 Ga0055525_1000147 3300003759 Bacteria 96457
67 Ga0055525_1000523 3300003759 Bacteria 18492
68 Ga0055525_1001833 3300003759 Bacteria 2880
69 Ga0055535_1005381 3300003761 Bacteria 2823
70 Ga0055529_1000375 3300003763 Bacteria 48263
71 Ga0055526_1021258 3300003771 Bacteria 2266
72 Ga0055526_1021298 3300003771 Bacteria 2261
73 Ga0055537_1007354 3300003773 Bacteria 2661
74 Ga0055537_1012735 3300003773 Bacteria 1621
75 Ga0055524_1035570 3300003775 Bacteria 1356
76 Ga0055524_1039973 3300003775 Bacteria 1203
77 Ga0055534_1006810 3300003784 Bacteria 2819
78 Ga0055534_1023815 3300003784 Bacteria 998
79 Ga0055528_1007975 3300003790 Bacteria 4609
80 Ga0055528_1012187 3300003790 Bacteria 3355
81 Ga0055530_10034470 3300003791 Bacteria 1293
82 Ga0055540_1071237 3300003792 Bacteria 678
83 Ga0055531_10055730 3300003794 Bacteria 1003
84 Ga0055541_1000262 3300003841 Bacteria 18492
85 Ga0055541_1003620 3300003841 Bacteria 2880
86 Ga0055543_1028398 3300004625 Bacteria 985
87 Ga0055543_1061760 3300004625 Bacteria 599
88 Ga0058859_11830236 3300004798 Bacteria 602
89 Ga0058863_10053884 3300004799 Bacteria 1211
90 Ga0058861_10192042 3300004800 Bacteria 1266
91 Ga0058860_12202994 3300004801 Bacteria 531
92 Ga0058862_10285807 3300004803 Bacteria 831
93 Ga0065165_1003318 3300005262 Bacteria 11513
94 Ga0065165_1131124 3300005262 Bacteria 599
95 Ga0065714_10039928 3300005288 Bacteria 728
96 Ga0065714_10228053 3300005288 Bacteria 822
97 Ga0065714_10510726 3300005288 Bacteria 518
98 Ga0065704_10158451 3300005289 Bacteria 1373
99 Ga0065715_10965565 3300005293 Bacteria 555
100 Ga0070676_10119214 3300005328 Bacteria 1654
101 Ga0070670_100067314 3300005331 Bacteria 3073
102 Ga0070670_100670173 3300005331 Bacteria 931
103 Ga0068869_100160311 3300005334 Bacteria 1751
104 Ga0070680_100212917 3300005336 Bacteria 1630
105 Ga0070680_100331491 3300005336 Bacteria 1293
106 Ga0070682_100049501 3300005337 Bacteria 2620
107 Ga0070682_100139754 3300005337 Bacteria 1649
108 Ga0070660_100054384 3300005339 Bacteria 3091
109 Ga0070661_100103030 3300005344 Bacteria 2125
110 Ga0070671_101904447 3300005355 Bacteria 529
111 Ga0070659_100022490 3300005366 Bacteria 4814
112 Ga0070663_100229308 3300005455 Bacteria 1462
113 Ga0070662_100788233 3300005457 Bacteria 807
114 Ga0070681_10693651 3300005458 Bacteria 934
115 Ga0068867_100247809 3300005459 Bacteria 1447
116 Ga0070684_100335993 3300005535 Bacteria 1388
117 Ga0068853_100254548 3300005539 Bacteria 1612
118 Ga0070672_100523242 3300005543 Bacteria 1028
119 Ga0068855_100434090 3300005563 Bacteria 1435
120 Ga0068855_100593288 3300005563 Bacteria 1195
121 Ga0068855_101125821 3300005563 Bacteria 819
122 Ga0070664_100139315 3300005564 Bacteria 2135
123 Ga0070664_100796478 3300005564 Bacteria 883
124 Ga0068857_100025716 3300005577 Bacteria 5183
125 Ga0068854_100377989 3300005578 Bacteria 1166
126 Ga0068854_100576719 3300005578 Bacteria 957
127 Ga0068856_100085286 3300005614 Bacteria 3137
128 Ga0068856_100087143 3300005614 Bacteria 3103
129 Ga0068852_100062072 3300005616 Bacteria 3249
130 Ga0068851_10071502 3300005834 Bacteria 1795
131 Ga0068851_10112534 3300005834 Bacteria 1454
132 Ga0068851_10405320 3300005834 Bacteria 803
133 Ga0068862_101121132 3300005844 Bacteria 782
134 Ga0075363_100016273 3300006048 Bacteria 3672
135 Ga0075364_10849286 3300006051 Bacteria 622
136 Ga0070712_100507328 3300006175 Bacteria 1012
137 Ga0097621_100018618 3300006237 Bacteria 5310
138 Ga0068871_100137146 3300006358 Bacteria 2078
139 Ga0068865_100044877 3300006881 Bacteria 3027
140 Ga0099823_1087981 3300006944 Bacteria 1097
141 Ga0099794_10479873 3300007265 Bacteria 653
142 Ga0105251_10078126 3300009011 Bacteria 1533
143 Ga0105244_10015476 3300009036 Bacteria 4374
144 Ga0105244_10019926 3300009036 Bacteria 3729
145 Ga0105244_10039890 3300009036 Bacteria 2441
146 Ga0105250_10141157 3300009092 Bacteria 999
147 Ga0105250_10339321 3300009092 Bacteria 656
148 Ga0105240_10021815 3300009093 Bacteria 8510
149 Ga0105240_10209527 3300009093 Bacteria 2279
150 Ga0105240_10307686 3300009093 Bacteria 1811
151 Ga0105245_10043502 3300009098 Bacteria 4006
152 Ga0105243_10016441 3300009148 Bacteria 5595
153 Ga0105243_11533616 3300009148 Bacteria 691
154 Ga0105243_13037755 3300009148 Bacteria 509
155 Ga0105241_10173179 3300009174 Bacteria 1784
156 Ga0105242_10156388 3300009176 Bacteria 1992
157 Ga0105248_10786239 3300009177 Bacteria 1074
158 Ga0105248_10951637 3300009177 Bacteria 970
159 Ga0105237_10140721 3300009545 Bacteria 2407
160 Ga0105237_10176405 3300009545 Bacteria 2137
161 Ga0105238_10002020 3300009551 Bacteria 20484
162 Ga0105238_10313151 3300009551 Bacteria 1555
163 Ga0105238_10953002 3300009551 Bacteria 878
164 Ga0105249_11042875 3300009553 Bacteria 887
165 Ga0130086_1005042 3300009829 Bacteria 2342
166 Ga0130086_1075241 3300009829 Bacteria 2349
167 Ga0130086_1091490 3300009829 Bacteria 2006
168 Ga0130085_1017480 3300009850 Bacteria 2342
169 Ga0130085_1078041 3300009850 Bacteria 2349
170 Ga0130085_1107450 3300009850 Bacteria 2006
171 Ga0105239_10030541 3300010375 Bacteria 5924
172 Ga0105239_10138610 3300010375 Bacteria 2710
173 Ga0105239_10177507 3300010375 Bacteria 2382
174 Ga0105239_11227710 3300010375 Bacteria 864
175 Ga0105246_10340845 3300011119 Bacteria 1225
176 Ga0105246_10866596 3300011119 Bacteria 807
177 Ga0157325_1004116 3300012485 Bacteria 838
178 Ga0157373_10261474 3300013100 Bacteria 1225
179 Ga0157373_10718048 3300013100 Bacteria 733
180 Ga0157371_10000710 3300013102 Bacteria 39002
181 Ga0157370_10290342 3300013104 Bacteria 1510
182 Ga0157370_10955217 3300013104 Bacteria 777
183 Ga0157369_10404300 3300013105 Bacteria 1416
184 Ga0157378_12462498 3300013297 Bacteria 572
185 Ga0163162_10719007 3300013306 Bacteria 1119
186 Ga0157372_11159304 3300013307 Bacteria 893
187 Ga0157372_12979912 3300013307 Bacteria 541
188 Ga0157375_11086602 3300013308 Bacteria 936
189 Ga0182008_10004539 3300014497 Bacteria 8101
190 Ga0182008_10005790 3300014497 Bacteria 6992
191 Ga0182008_10171183 3300014497 Bacteria 1096
192 Ga0182008_10393084 3300014497 Bacteria 743
193 Ga0157377_10226863 3300014745 Bacteria 1199
194 Ga0157376_10163721 3300014969 Bacteria 2019
195 Ga0157376_11695674 3300014969 Bacteria 667
196 Ga0182006_1000186 3300015261 Bacteria 64784
197 Ga0182006_1010089 3300015261 Bacteria 4210
198 Ga0182006_1013810 3300015261 Bacteria 3494
199 Ga0182007_10000202 3300015262 Bacteria 40165
200 Ga0182007_10018893 3300015262 Bacteria 2488
201 Ga0182007_10031144 3300015262 Bacteria 1819
202 Ga0182007_10032705 3300015262 Bacteria 1766
203 Ga0182007_10232394 3300015262 Bacteria 655
204 Ga0182005_1001571 3300015265 Bacteria 9020
205 Ga0182005_1002884 3300015265 Bacteria 5976
206 Ga0163161_10231881 3300017792 Bacteria 1433
207 Ga0163161_10236417 3300017792 Bacteria 1419
208 Ga0163161_10238636 3300017792 Bacteria 1413
209 Ga0206355_1609219 3300020076 Bacteria 522
210 Ga0206351_10512755 3300020077 Bacteria 1607
211 Ga0206350_10480254 3300020080 Bacteria 1027
212 Ga0206354_10352477 3300020081 Bacteria 1495
213 Ga0213872_10052983 3300021361 Bacteria 1840
214 Ga0213872_10067471 3300021361 Bacteria 1614
215 Ga0209435_100186 3300025206 Bacteria 18475
216 Ga0209435_100191 3300025206 Bacteria 17985
217 Ga0209436_101414 3300025208 Bacteria 8429
218 Ga0209436_101521 3300025208 Bacteria 7947
219 Ga0209784_100010 3300025224 Bacteria 683664
220 Ga0209784_100035 3300025224 Bacteria 299760
221 Ga0209566_100008 3300025225 Bacteria 683664
222 Ga0209566_100040 3300025225 Bacteria 299760
223 Ga0209674_100019 3300025226 Bacteria 683664
224 Ga0209674_100057 3300025226 Bacteria 299760
225 Ga0209672_104073 3300025228 Bacteria 2815
226 Ga0209147_100060 3300025229 Bacteria 249588
227 Ga0209563_100011 3300025230 Bacteria 1187808
228 Ga0209563_100021 3300025230 Bacteria 683764
229 Ga0209563_100059 3300025230 Bacteria 299760
230 Ga0207427_100573 3300025231 Bacteria 18544
231 Ga0209437_100019 3300025233 Bacteria 683764
232 Ga0209437_100639 3300025233 Bacteria 20468
233 Ga0209437_118485 3300025233 Bacteria 893
234 Ga0209437_119366 3300025233 Bacteria 856
235 Ga0209258_100141 3300025242 Bacteria 166385
236 Ga0207425_1001042 3300025245 Bacteria 12856
237 Ga0207425_1022002 3300025245 Bacteria 1347
238 Ga0209646_1000246 3300025246 Bacteria 55219
239 Ga0209646_1001041 3300025246 Bacteria 8366
240 Ga0209026_1004204 3300025250 Bacteria 4388
241 Ga0209026_1007856 3300025250 Bacteria 2318
242 Ga0209677_100011 3300025253 Bacteria 683664
243 Ga0209677_100036 3300025253 Bacteria 299760
244 Ga0209677_111325 3300025253 Bacteria 1401
245 Ga0209148_1000323 3300025254 Bacteria 66396
246 Ga0209148_1011865 3300025254 Bacteria 1608
247 Ga0209759_1015039 3300025256 Bacteria 2016
248 Ga0209233_1000025 3300025261 Bacteria 683764
249 Ga0209565_1006443 3300025263 Bacteria 3290
250 Ga0209565_1010529 3300025263 Bacteria 2289
251 Ga0209565_1026547 3300025263 Bacteria 1160
252 Ga0209565_1048209 3300025263 Bacteria 772
253 Ga0209565_1067964 3300025263 Bacteria 606
254 Ga0209455_1000303 3300025272 Bacteria 50385
255 Ga0209455_1005403 3300025272 Bacteria 3955
256 Ga0209673_1003465 3300025273 Bacteria 9278
257 Ga0209673_1004929 3300025273 Bacteria 6945
258 Ga0209130_1002838 3300025284 Bacteria 8041
259 Ga0209675_1002952 3300025291 Bacteria 8387
260 Ga0209675_1009571 3300025291 Bacteria 3407
261 Ga0209025_1001281 3300025294 Bacteria 34537
262 Ga0209564_1000027 3300025295 Bacteria 518458
263 Ga0209564_1000230 3300025295 Bacteria 123814
264 Ga0209564_1013777 3300025295 Bacteria 3407
265 Ga0209564_1019927 3300025295 Bacteria 2482
266 Ga0209758_1011259 3300025297 Bacteria 5207
267 Ga0209050_1000292 3300025298 Bacteria 106140
268 Ga0209256_1004685 3300025299 Bacteria 8390
269 Ga0209256_1012344 3300025299 Bacteria 3290
270 Ga0207426_1002480 3300025302 Bacteria 11738
271 Ga0209051_1055224 3300025303 Bacteria 1290
272 Ga0209257_1000295 3300025304 Bacteria 109542
273 Ga0207656_10251696 3300025321 Bacteria 866
274 Ga0207656_10287302 3300025321 Bacteria 812
275 Ga0207655_1003094 3300025728 Bacteria 12643
276 Ga0207655_1027614 3300025728 Bacteria 2700
277 Ga0207655_1142968 3300025728 Bacteria 766
278 Ga0207713_1130135 3300025735 Bacteria 834
279 Ga0207647_10261112 3300025904 Bacteria 992
280 Ga0207645_10214311 3300025907 Bacteria 1269
281 Ga0207705_11005312 3300025909 Bacteria 644
282 Ga0207684_10913197 3300025910 Bacteria 738
283 Ga0207654_10002179 3300025911 Bacteria 10027
284 Ga0207707_10487097 3300025912 Bacteria 1053
285 Ga0207695_10003953 3300025913 Bacteria 20492
286 Ga0207695_10072393 3300025913 Bacteria 3517
287 Ga0207695_10401694 3300025913 Bacteria 1255
288 Ga0207695_10953808 3300025913 Bacteria 737
289 Ga0207671_10139299 3300025914 Bacteria 1868
290 Ga0207671_10178519 3300025914 Bacteria 1652
291 Ga0207671_10579222 3300025914 Bacteria 895
292 Ga0207693_10010110 3300025915 Bacteria 7664
293 Ga0207657_10006550 3300025919 Bacteria 12056
294 Ga0207649_10056050 3300025920 Bacteria 2459
295 Ga0207649_10350719 3300025920 Bacteria 1092
296 Ga0207694_10001435 3300025924 Bacteria 20449
297 Ga0207694_10281831 3300025924 Bacteria 1365
298 Ga0207694_10295775 3300025924 Bacteria 1332
299 Ga0207650_10088896 3300025925 Bacteria 2357
300 Ga0207659_11475330 3300025926 Bacteria 582
301 Ga0207687_10591242 3300025927 Bacteria 935
302 Ga0207690_11533167 3300025932 Bacteria 557
303 Ga0207706_10313632 3300025933 Bacteria 1365
304 Ga0207686_10112187 3300025934 Bacteria 1841
305 Ga0207709_10055004 3300025935 Bacteria 2457
306 Ga0207669_10511819 3300025937 Bacteria 962
307 Ga0207704_10095815 3300025938 Bacteria 1963
308 Ga0207691_10316183 3300025940 Bacteria 1339
309 Ga0207711_10480757 3300025941 Bacteria 1157
310 Ga0207711_10734557 3300025941 Bacteria 920
311 Ga0207689_10123864 3300025942 Bacteria 2126
312 Ga0207667_10023256 3300025949 Bacteria 6824
313 Ga0207667_10042185 3300025949 Bacteria 4851
314 Ga0207667_10143578 3300025949 Bacteria 2457
315 Ga0207640_10169293 3300025981 Bacteria 1626
316 Ga0207639_10312484 3300026041 Bacteria 1392
317 Ga0207678_10543520 3300026067 Bacteria 1015
318 Ga0207648_10531514 3300026089 Bacteria 1078
319 Ga0207674_10021420 3300026116 Bacteria 6959
320 Ga0207674_10637617 3300026116 Bacteria 1029
321 Ga0207683_10480854 3300026121 Bacteria 1146
322 Ga0207698_10012103 3300026142 Bacteria 5629
323 Ga0209281_1008175 3300027111 Bacteria 2563
324 Ga0268265_10147695 3300028380 Bacteria 1978
325 Ga0316177_1138179 3300030731 Bacteria 1552
326 Ga0316176_1045076 3300030732 Bacteria 941
327 Ga0316178_1018733 3300030735 Bacteria 1607
328 Ga0316180_1160791 3300030736 Bacteria 1307
329 Ga0316183_1020377 3300030742 Bacteria 1175
330 Ga0316182_1052816 3300030745 Bacteria 807
331 Ga0316182_1275498 3300030745 Bacteria 1503
332 Ga0307408_100144522 3300031548 Bacteria 1870
333 Ga0307408_102083828 3300031548 Bacteria 547
334 Ga0307408_102093717 3300031548 Bacteria 545
335 Ga0265314_10275927 3300031711 Bacteria 953
336 Ga0307516_10309306 3300031730 Bacteria 1254
337 Ga0307405_11287052 3300031731 Bacteria 636
338 Ga0307406_10406741 3300031901 Bacteria 1080
339 Ga0307407_11519995 3300031903 Bacteria 530
340 Ga0307412_10649115 3300031911 Bacteria 900
341 Ga0307416_100004760 3300032002 Bacteria 8239
342 Ga0307414_10006142 3300032004 Bacteria 6673
343 Ga0307411_10352971 3300032005 Bacteria 1200
344 Ga0307411_10495387 3300032005 Bacteria 1032
345 Ga0307411_10595392 3300032005 Bacteria 950
346 Ga0307411_11417131 3300032005 Bacteria 636
347 Ga0307510_10280273 3300033180 Bacteria 1138
348 Ga0373949_0294284 3300035090 Bacteria 513
349 Ga0373939_0053081 3300035114 Bacteria 1265
350 Ga0373935_0201381 3300035692 Bacteria 1376
351 Ga0395899_0000078 3300037312 Bacteria 174141
352 Ga0395899_0005833 3300037312 Bacteria 9559
353 Ga0395899_0668497 3300037312 Bacteria 654
354 Ga0395899_0683208 3300037312 Bacteria 645
355 Ga0395899_1008921 3300037312 Bacteria 501
356 Ga0395900_0082284 3300037418 Bacteria 3307
357 Ga0395900_0195712 3300037418 Bacteria 2048
358 Ga0395900_0249092 3300037418 Bacteria 1778
359 Ga0395900_0560241 3300037418 Bacteria 1086
360 Ga0395900_1850502 3300037418 Bacteria 514
361 Ga0395898_0695698 3300037466 Bacteria 958
362 Ga0395898_1601238 3300037466 Bacteria 575
363 Ga0395905_0000549 3300037471 Bacteria 51321
364 Ga0395905_0007900 3300037471 Bacteria 10523
365 Ga0395905_0011730 3300037471 Bacteria 8460
366 Ga0395905_0092664 3300037471 Bacteria 2833
367 Ga0395905_0150590 3300037471 Bacteria 2189
368 Ga0395905_0537645 3300037471 Bacteria 1069
369 Ga0395905_1906850 3300037471 Bacteria 500
370 Ga0395901_0004460 3300038443 Bacteria 14123
371 Ga0395901_0094399 3300038443 Bacteria 3133
372 Ga0395901_0164294 3300038443 Bacteria 2331
373 Ga0395901_0464144 3300038443 Bacteria 1293
374 Ga0395901_0548664 3300038443 Bacteria 1171
375 Ga0395901_1464874 3300038443 Bacteria 639
376 Ga0436361_0004974 3300039447 Bacteria 978
377 Ga0436361_0171206 3300039447 Bacteria 5353
378 Ga0436361_0578689 3300039447 Bacteria 1890
379 Ga0436361_0743577 3300039447 Bacteria 2264
380 Ga0436361_0767937 3300039447 Bacteria 874
381 Ga0436361_1038070 3300039447 Bacteria 9794
382 Ga0439465_0049368 3300041413 Bacteria 1374
383 Ga0451833_0022593 3300041491 Bacteria 603
384 Ga0451853_2414847 3300041512 Bacteria 1555
385 Ga0439442_092526 3300042002 Bacteria 651
386 Ga0439448_0261686 3300042005 Bacteria 611
387 Ga0439432_126317 3300042006 Bacteria 756
388 Ga0439449_0244662 3300042007 Bacteria 674
389 Ga0439450_013480 3300042008 Bacteria 1643
390 Ga0439450_048323 3300042008 Bacteria 1004
391 Ga0439455_0027559 3300042012 Bacteria 1393
392 Ga0439455_0069102 3300042012 Bacteria 946
393 Ga0439455_0166579 3300042012 Bacteria 631
394 Ga0450921_020664 3300042123 Bacteria 624
395 Ga0450890_033574 3300042127 Bacteria 738
396 Ga0450895_019290 3300042132 Bacteria 626
397 Ga0450898_013755 3300042134 Bacteria 1353
398 Ga0450904_004772 3300042139 Bacteria 1396
399 Ga0439446_0168394 3300042156 Bacteria 727
400 Ga0439458_0076007 3300042157 Bacteria 852
401 Ga0439434_0057775 3300042435 Bacteria 1210
402 Ga0439464_0028984 3300042439 Bacteria 1545
403 Ga0466972_0005095 3300044658 Bacteria 6583
404 Ga0466972_0052412 3300044658 Bacteria 1966
405 Ga0466965_0043592 3300044683 Bacteria 2215
406 Ga0466965_0231235 3300044683 Bacteria 987
407 Ga0466965_0247551 3300044683 Bacteria 955
408 Ga0466965_0373023 3300044683 Bacteria 784
409 Ga0466965_0595604 3300044683 Bacteria 628
410 Ga0466966_0038419 3300044684 Bacteria 3085
411 Ga0466966_0978184 3300044684 Bacteria 510
412 Ga0466964_0024210 3300044706 Bacteria 2364
413 Ga0466964_0087285 3300044706 Bacteria 1351
414 Ga0466964_0152185 3300044706 Bacteria 1073
415 Ga0466964_0242638 3300044706 Bacteria 884
416 Ga0466971_0221878 3300044719 Bacteria 896
417 Ga0466971_0240173 3300044719 Bacteria 861
418 Ga0466968_0012025 3300044735 Bacteria 3381
419 Ga0466968_0207495 3300044735 Bacteria 919
420 Ga0466968_0284188 3300044735 Bacteria 792
421 Ga0466968_0327837 3300044735 Bacteria 740
422 Ga0466970_0057746 3300044765 Bacteria 2076
423 Ga0466970_0232590 3300044765 Bacteria 1030
424 Ga0466957_0167221 3300044842 Bacteria 1431
425 Ga0466957_0233015 3300044842 Bacteria 1219
426 Ga0466957_0286206 3300044842 Bacteria 1104
427 Ga0466957_0983406 3300044842 Bacteria 605
428 Ga0466960_0943304 3300044901 Bacteria 528
429 Ga0466959_0204553 3300045049 Bacteria 1373
430 Ga0451576_1776876 3300045051 Bacteria 638
431 Ga0466958_0896361 3300045836 Bacteria 578
432 Ga0466967_0948199 3300045976 Bacteria 856
433 Ga0466967_1169271 3300045976 Bacteria 766
434 Ga0466967_1605038 3300045976 Bacteria 648
435 Ga0466967_1689390 3300045976 Bacteria 630
436 Ga0495617_001026 3300046452 Bacteria 12853
437 Ga0495617_004204 3300046452 Bacteria 5264
438 Ga0495617_197794 3300046452 Bacteria 629
439 Ga0495627_026656 3300046453 Bacteria 1861
440 Ga0495627_045406 3300046453 Bacteria 1338
441 Ga0495592_0139781 3300046454 Bacteria 1685
442 Ga0495603_0007446 3300046455 Bacteria 6583
443 Ga0495603_0066125 3300046455 Bacteria 2129
444 Ga0495603_0164238 3300046455 Bacteria 1287
445 Ga0495603_0533480 3300046455 Bacteria 672
446 Ga0495590_0000020 3300046457 Bacteria 212352
447 Ga0495590_0005309 3300046457 Bacteria 5113
448 Ga0495590_0018848 3300046457 Bacteria 2465
449 Ga0495590_0029266 3300046457 Bacteria 1931
450 Ga0495590_0037945 3300046457 Bacteria 1679
451 Ga0495590_0124562 3300046457 Bacteria 924
452 Ga0495590_0233781 3300046457 Bacteria 681
453 Ga0495590_0249208 3300046457 Bacteria 660
454 Ga0495591_008200 3300046458 Bacteria 4305
455 Ga0495591_061027 3300046458 Bacteria 1001
456 Ga0495629_0415305 3300046459 Bacteria 913
457 Ga0495638_0000408 3300046460 Bacteria 52490
458 Ga0495638_0010010 3300046460 Bacteria 6610
459 Ga0495638_0010721 3300046460 Bacteria 6343
460 Ga0495638_0069655 3300046460 Bacteria 2155
461 Ga0495638_0463668 3300046460 Bacteria 644
462 Ga0495651_0061481 3300046462 Bacteria 2874
463 Ga0495651_0108148 3300046462 Bacteria 2059
464 Ga0495653_0003544 3300046463 Bacteria 12573
465 Ga0495653_0025764 3300046463 Bacteria 4718
466 Ga0495653_0042103 3300046463 Bacteria 3559
467 Ga0495653_0504877 3300046463 Bacteria 753
468 Ga0495650_0008022 3300046471 Bacteria 6240
469 Ga0495650_0009500 3300046471 Bacteria 5522
470 Ga0495650_0017326 3300046471 Bacteria 3614
471 Ga0495650_0032252 3300046471 Bacteria 2345
472 Ga0495650_0058728 3300046471 Bacteria 1551
473 Ga0495580_0008648 3300046472 Bacteria 8072
474 Ga0495580_0245555 3300046472 Bacteria 1226
475 Ga0495580_0370728 3300046472 Bacteria 968
476 Ga0495580_0743097 3300046472 Bacteria 639
477 Ga0495582_0013331 3300046473 Bacteria 4524
478 Ga0495582_0049936 3300046473 Bacteria 2304
479 Ga0495582_0057380 3300046473 Bacteria 2146
480 Ga0495605_0003232 3300046474 Bacteria 9782
481 Ga0495605_0013410 3300046474 Bacteria 4516
482 Ga0495605_0013696 3300046474 Bacteria 4456
483 Ga0495605_0071613 3300046474 Bacteria 1636
484 Ga0495605_0082794 3300046474 Bacteria 1498
485 Ga0495605_0103420 3300046474 Bacteria 1306
486 Ga0495605_0105953 3300046474 Bacteria 1287
487 Ga0495605_0190560 3300046474 Bacteria 897
488 Ga0495605_0195503 3300046474 Bacteria 883
489 Ga0495605_0224230 3300046474 Bacteria 811
490 Ga0495639_0181988 3300046475 Bacteria 1023
491 Ga0495639_0570768 3300046475 Bacteria 580
492 Ga0495584_0002812 3300046491 Bacteria 9712
493 Ga0495584_0020283 3300046491 Bacteria 3378
494 Ga0495584_0051866 3300046491 Bacteria 2064
495 Ga0495584_0060945 3300046491 Bacteria 1896
496 Ga0495584_0075775 3300046491 Bacteria 1691
497 Ga0495584_0081139 3300046491 Bacteria 1632
498 Ga0495584_0103631 3300046491 Bacteria 1438
499 Ga0495584_0113268 3300046491 Bacteria 1372
500 Ga0495584_0120831 3300046491 Bacteria 1326
501 Ga0495584_0125919 3300046491 Bacteria 1298
502 Ga0495584_0167318 3300046491 Bacteria 1117
503 Ga0495584_0287350 3300046491 Bacteria 835
504 Ga0495584_0355186 3300046491 Bacteria 744
505 Ga0495584_0452034 3300046491 Bacteria 653
506 Ga0495584_0502519 3300046491 Bacteria 617
507 Ga0495585_0012012 3300046492 Bacteria 5110
508 Ga0495585_0015837 3300046492 Bacteria 4377
509 Ga0495585_0047201 3300046492 Bacteria 2399
510 Ga0495585_0047852 3300046492 Bacteria 2379
511 Ga0495585_0063130 3300046492 Bacteria 2033
512 Ga0495585_0137156 3300046492 Bacteria 1283
513 Ga0495585_0137334 3300046492 Bacteria 1282
514 Ga0495585_0143002 3300046492 Bacteria 1251
515 Ga0495585_0149517 3300046492 Bacteria 1218
516 Ga0495585_0159448 3300046492 Bacteria 1171
517 Ga0495585_0174673 3300046492 Bacteria 1107
518 Ga0495585_0270942 3300046492 Bacteria 841
519 Ga0495585_0290070 3300046492 Bacteria 806
520 Ga0495585_0331337 3300046492 Bacteria 742
521 Ga0495585_0357830 3300046492 Bacteria 708
522 Ga0495585_0406997 3300046492 Bacteria 654
523 Ga0495585_0436392 3300046492 Bacteria 627
524 Ga0495585_0523948 3300046492 Bacteria 561
525 Ga0495594_0020007 3300046499 Bacteria 3562
526 Ga0495594_0186729 3300046499 Bacteria 1180
527 Ga0495594_0302827 3300046499 Bacteria 910
528 Ga0495594_0330178 3300046499 Bacteria 868
529 Ga0495594_0338015 3300046499 Bacteria 857
530 Ga0495594_0660763 3300046499 Bacteria 591
531 Ga0495596_0005175 3300046500 Bacteria 6209
532 Ga0495596_0021654 3300046500 Bacteria 2621
533 Ga0495596_0040721 3300046500 Bacteria 1833
534 Ga0495596_0044056 3300046500 Bacteria 1757
535 Ga0495596_0059412 3300046500 Bacteria 1490
536 Ga0495596_0277946 3300046500 Bacteria 650
537 Ga0495596_0295666 3300046500 Bacteria 629
538 Ga0495596_0296545 3300046500 Bacteria 628
539 Ga0495607_0090940 3300046501 Bacteria 1653
540 Ga0495607_0099837 3300046501 Bacteria 1556
541 Ga0495607_0123713 3300046501 Bacteria 1354
542 Ga0495607_0141517 3300046501 Bacteria 1240
543 Ga0495607_0162714 3300046501 Bacteria 1132
544 Ga0495607_0196673 3300046501 Bacteria 1000
545 Ga0495607_0283948 3300046501 Bacteria 784
546 Ga0495607_0379756 3300046501 Bacteria 646
547 Ga0495583_0000310 3300046506 Bacteria 77200
548 Ga0495583_0006309 3300046506 Bacteria 7786
549 Ga0495583_0008959 3300046506 Bacteria 6037
550 Ga0495583_0013755 3300046506 Bacteria 4495
551 Ga0495583_0039755 3300046506 Bacteria 2213
552 Ga0495583_0041060 3300046506 Bacteria 2169
553 Ga0495583_0047710 3300046506 Bacteria 1968
554 Ga0495583_0094961 3300046506 Bacteria 1279
555 Ga0495583_0096954 3300046506 Bacteria 1262
556 Ga0495583_0122294 3300046506 Bacteria 1094
557 Ga0495583_0131777 3300046506 Bacteria 1045
558 Ga0495583_0197012 3300046506 Bacteria 819
559 Ga0495583_0251356 3300046506 Bacteria 709
560 Ga0495606_0007181 3300046507 Bacteria 10052
561 Ga0495606_0013036 3300046507 Bacteria 6605
562 Ga0495606_0019502 3300046507 Bacteria 5042
563 Ga0495606_0039988 3300046507 Bacteria 3154
564 Ga0495606_0108118 3300046507 Bacteria 1681
565 Ga0495606_0109444 3300046507 Bacteria 1668
566 Ga0495606_0148706 3300046507 Bacteria 1376
567 Ga0495606_0149612 3300046507 Bacteria 1371
568 Ga0495606_0193919 3300046507 Bacteria 1162
569 Ga0495606_0217296 3300046507 Bacteria 1079
570 Ga0495606_0284940 3300046507 Bacteria 901
571 Ga0495606_0293819 3300046507 Bacteria 883
572 Ga0495606_0313019 3300046507 Bacteria 846
573 Ga0495606_0325847 3300046507 Bacteria 823
574 Ga0495606_0379068 3300046507 Bacteria 742
575 Ga0495606_0435842 3300046507 Bacteria 674
576 Ga0495606_0526404 3300046507 Bacteria 592
577 Ga0495608_0027939 3300046511 Bacteria 3835
578 Ga0495608_0087527 3300046511 Bacteria 2017
579 Ga0495610_0003877 3300046512 Bacteria 11361
580 Ga0495610_0018155 3300046512 Bacteria 3981
581 Ga0495610_0023962 3300046512 Bacteria 3303
582 Ga0495610_0027750 3300046512 Bacteria 3003
583 Ga0495610_0198124 3300046512 Bacteria 824
584 Ga0495610_0203181 3300046512 Bacteria 810
585 Ga0495616_0002539 3300046513 Bacteria 12051
586 Ga0495616_0020539 3300046513 Bacteria 3590
587 Ga0495616_0022828 3300046513 Bacteria 3374
588 Ga0495616_0103362 3300046513 Bacteria 1333
589 Ga0495616_0160497 3300046513 Bacteria 1011
590 Ga0495616_0188240 3300046513 Bacteria 913
591 Ga0495616_0209358 3300046513 Bacteria 853
592 Ga0495616_0322294 3300046513 Bacteria 648
593 Ga0495618_0079070 3300046514 Bacteria 2097
594 Ga0495618_0606092 3300046514 Bacteria 651
595 Ga0495620_0011229 3300046515 Bacteria 4681
596 Ga0495628_0051980 3300046516 Bacteria 3237
597 Ga0495628_0153435 3300046516 Bacteria 1753
598 Ga0495630_0473133 3300046517 Bacteria 960
599 Ga0495630_0528698 3300046517 Bacteria 904
600 Ga0495631_0026738 3300046518 Bacteria 2645
601 Ga0495631_0037499 3300046518 Bacteria 2159
602 Ga0495631_0037577 3300046518 Bacteria 2156
603 Ga0495631_0073566 3300046518 Bacteria 1475
604 Ga0495631_0091500 3300046518 Bacteria 1309
605 Ga0495631_0093621 3300046518 Bacteria 1293
606 Ga0495631_0103090 3300046518 Bacteria 1227
607 Ga0495631_0106058 3300046518 Bacteria 1208
608 Ga0495631_0174114 3300046518 Bacteria 922
609 Ga0495631_0182275 3300046518 Bacteria 899
610 Ga0495631_0211047 3300046518 Bacteria 829
611 Ga0495631_0269289 3300046518 Bacteria 725
612 Ga0495632_0041954 3300046519 Bacteria 2295
613 Ga0495632_0052841 3300046519 Bacteria 1996
614 Ga0495632_0112463 3300046519 Bacteria 1277
615 Ga0495632_0154007 3300046519 Bacteria 1061
616 Ga0495632_0166880 3300046519 Bacteria 1012
617 Ga0495632_0195587 3300046519 Bacteria 922
618 Ga0495637_0001714 3300046520 Bacteria 12614
619 Ga0495637_0013614 3300046520 Bacteria 3857
620 Ga0495637_0027010 3300046520 Bacteria 2571
621 Ga0495637_0044618 3300046520 Bacteria 1886
622 Ga0495637_0074308 3300046520 Bacteria 1365
623 Ga0495637_0107325 3300046520 Bacteria 1085
624 Ga0495637_0294839 3300046520 Bacteria 576
625 Ga0495643_0010644 3300046522 Bacteria 5651
626 Ga0495643_0032093 3300046522 Bacteria 2917
627 Ga0495643_0065304 3300046522 Bacteria 1921
628 Ga0495643_0066699 3300046522 Bacteria 1897
629 Ga0495643_0078750 3300046522 Bacteria 1719
630 Ga0495643_0081093 3300046522 Bacteria 1687
631 Ga0495643_0085218 3300046522 Bacteria 1638
632 Ga0495643_0091504 3300046522 Bacteria 1568
633 Ga0495643_0118867 3300046522 Bacteria 1337
634 Ga0495643_0139286 3300046522 Bacteria 1211
635 Ga0495643_0192027 3300046522 Bacteria 985
636 Ga0495643_0221022 3300046522 Bacteria 898
637 Ga0495643_0226757 3300046522 Bacteria 883
638 Ga0495644_0027051 3300046523 Bacteria 2174
639 Ga0495644_0035051 3300046523 Bacteria 1894
640 Ga0495644_0083860 3300046523 Bacteria 1201
641 Ga0495644_0084397 3300046523 Bacteria 1197
642 Ga0495644_0088545 3300046523 Bacteria 1167
643 Ga0495644_0098570 3300046523 Bacteria 1105
644 Ga0495644_0112630 3300046523 Bacteria 1032
645 Ga0495644_0113788 3300046523 Bacteria 1027
646 Ga0495644_0120039 3300046523 Bacteria 999
647 Ga0495648_0013276 3300046524 Bacteria 6100
648 Ga0495648_0034037 3300046524 Bacteria 3321
649 Ga0495648_0042742 3300046524 Bacteria 2848
650 Ga0495648_0069259 3300046524 Bacteria 2054
651 Ga0495648_0107232 3300046524 Bacteria 1527
652 Ga0495648_0167280 3300046524 Bacteria 1130
653 Ga0495648_0175469 3300046524 Bacteria 1094
654 Ga0495648_0179256 3300046524 Bacteria 1078
655 Ga0495663_0010607 3300046525 Bacteria 2563
656 Ga0495663_0031792 3300046525 Bacteria 1569
657 Ga0495663_0093960 3300046525 Bacteria 980
658 Ga0495663_0123673 3300046525 Bacteria 868
659 Ga0495663_0150239 3300046525 Bacteria 794
660 Ga0495663_0181453 3300046525 Bacteria 729
661 Ga0495666_0087815 3300046526 Bacteria 1468
662 Ga0495666_0178036 3300046526 Bacteria 982
663 Ga0495666_0244369 3300046526 Bacteria 818
664 Ga0495666_0268240 3300046526 Bacteria 775
665 Ga0495666_0293812 3300046526 Bacteria 735
666 Ga0495642_0004349 3300046528 Bacteria 5500
667 Ga0495642_0021122 3300046528 Bacteria 2559
668 Ga0495642_0027378 3300046528 Bacteria 2268
669 Ga0495642_0048979 3300046528 Bacteria 1734
670 Ga0495642_0052249 3300046528 Bacteria 1682
671 Ga0495642_0061666 3300046528 Bacteria 1556
672 Ga0495642_0066277 3300046528 Bacteria 1504
673 Ga0495642_0067965 3300046528 Bacteria 1486
674 Ga0495642_0096136 3300046528 Bacteria 1257
675 Ga0495642_0115352 3300046528 Bacteria 1150
676 Ga0495642_0124442 3300046528 Bacteria 1107
677 Ga0495642_0127967 3300046528 Bacteria 1092
678 Ga0495642_0178962 3300046528 Bacteria 922
679 Ga0495642_0182863 3300046528 Bacteria 912
680 Ga0495642_0213288 3300046528 Bacteria 842
681 Ga0495642_0324610 3300046528 Bacteria 675
682 Ga0495652_0027829 3300046529 Bacteria 4980
683 Ga0495652_0035148 3300046529 Bacteria 4362
684 Ga0495652_0271463 3300046529 Bacteria 1246
685 Ga0495652_0314968 3300046529 Bacteria 1132
686 Ga0495652_0503440 3300046529 Bacteria 839
687 Ga0495654_0000115 3300046530 Bacteria 91440
688 Ga0495654_0065073 3300046530 Bacteria 1741
689 Ga0495654_0077712 3300046530 Bacteria 1561
690 Ga0495654_0082162 3300046530 Bacteria 1508
691 Ga0495654_0091742 3300046530 Bacteria 1408
692 Ga0495654_0115950 3300046530 Bacteria 1217
693 Ga0495654_0160159 3300046530 Bacteria 988
694 Ga0495654_0168280 3300046530 Bacteria 957
695 Ga0495665_0046360 3300046531 Bacteria 2307
696 Ga0495665_0055908 3300046531 Bacteria 2083
697 Ga0495665_0081402 3300046531 Bacteria 1702
698 Ga0495665_0192065 3300046531 Bacteria 1059
699 Ga0495665_0482052 3300046531 Bacteria 625
700 Ga0495640_0305576 3300046533 Bacteria 987
701 Ga0495640_0307279 3300046533 Bacteria 984
702 Ga0495586_0034290 3300046535 Bacteria 2725
703 Ga0495586_0052978 3300046535 Bacteria 2197
704 Ga0495586_0121477 3300046535 Bacteria 1459
705 Ga0495587_0015602 3300046536 Bacteria 4739
706 Ga0495587_0118398 3300046536 Bacteria 1517
707 Ga0495587_0246276 3300046536 Bacteria 1005
708 Ga0495587_0334153 3300046536 Bacteria 845
709 Ga0495598_0217997 3300046537 Bacteria 695
710 Ga0495598_0264374 3300046537 Bacteria 641
711 Ga0495609_0002112 3300046538 Bacteria 12496
712 Ga0495609_0003741 3300046538 Bacteria 8588
713 Ga0495609_0005231 3300046538 Bacteria 6903
714 Ga0495609_0010718 3300046538 Bacteria 4385
715 Ga0495609_0073530 3300046538 Bacteria 1499
716 Ga0495609_0088916 3300046538 Bacteria 1344
717 Ga0495609_0098226 3300046538 Bacteria 1269
718 Ga0495609_0135374 3300046538 Bacteria 1053
719 Ga0495609_0138755 3300046538 Bacteria 1038
720 Ga0495609_0324097 3300046538 Bacteria 624
721 Ga0495621_0124882 3300046539 Bacteria 997
722 Ga0495621_0129299 3300046539 Bacteria 981
723 Ga0495621_0239139 3300046539 Bacteria 739
724 Ga0495597_0008648 3300046542 Bacteria 5090
725 Ga0495597_0039483 3300046542 Bacteria 2113
726 Ga0495597_0051584 3300046542 Bacteria 1813
727 Ga0495597_0071899 3300046542 Bacteria 1488
728 Ga0495597_0090026 3300046542 Bacteria 1303
729 Ga0495597_0098005 3300046542 Bacteria 1238
730 Ga0495597_0112166 3300046542 Bacteria 1142
731 Ga0495597_0123957 3300046542 Bacteria 1075
732 Ga0495597_0137308 3300046542 Bacteria 1010
733 Ga0495597_0173986 3300046542 Bacteria 872
734 Ga0495597_0184857 3300046542 Bacteria 840
735 Ga0495597_0196766 3300046542 Bacteria 808
736 Ga0495645_0099543 3300046543 Bacteria 2068
737 Ga0495645_0158047 3300046543 Bacteria 1569
738 Ga0495645_0380992 3300046543 Bacteria 902
739 Ga0495622_0010681 3300046557 Bacteria 4235
740 Ga0495622_0075497 3300046557 Bacteria 1553
741 Ga0495622_0087025 3300046557 Bacteria 1436
742 Ga0495622_0142933 3300046557 Bacteria 1086
743 Ga0495622_0143997 3300046557 Bacteria 1081
744 Ga0495622_0197854 3300046557 Bacteria 896
745 Ga0495622_0202751 3300046557 Bacteria 883
746 Ga0495622_0209861 3300046557 Bacteria 865
747 Ga0495622_0213533 3300046557 Bacteria 856
748 Ga0495633_0016754 3300046558 Bacteria 3768
749 Ga0495633_0040031 3300046558 Bacteria 2234
750 Ga0495633_0046083 3300046558 Bacteria 2063
751 Ga0495633_0047892 3300046558 Bacteria 2020
752 Ga0495633_0069829 3300046558 Bacteria 1639
753 Ga0495633_0113004 3300046558 Bacteria 1259
754 Ga0495633_0131615 3300046558 Bacteria 1157
755 Ga0495633_0171891 3300046558 Bacteria 998
756 Ga0495633_0254752 3300046558 Bacteria 800
757 Ga0495633_0276289 3300046558 Bacteria 764
758 Ga0495633_0282116 3300046558 Bacteria 755
759 Ga0495633_0300229 3300046558 Bacteria 729
760 Ga0495633_0345992 3300046558 Bacteria 674
761 Ga0495633_0359431 3300046558 Bacteria 659
762 Ga0495667_0076074 3300046559 Bacteria 2184
763 Ga0495656_0006272 3300046615 Bacteria 4164
764 Ga0495656_0070784 3300046615 Bacteria 1548
765 Ga0495656_0101671 3300046615 Bacteria 1330
766 Ga0495656_0150503 3300046615 Bacteria 1123
767 Ga0495656_0288364 3300046615 Bacteria 838
768 Ga0495656_0302232 3300046615 Bacteria 820
769 Ga0495656_0310447 3300046615 Bacteria 810
770 Ga0495668_0007707 3300046616 Bacteria 6842
771 Ga0495668_0020876 3300046616 Bacteria 3761
772 Ga0495668_0025580 3300046616 Bacteria 3353
773 Ga0495668_0054798 3300046616 Bacteria 2202
774 Ga0495668_0057793 3300046616 Bacteria 2140
775 Ga0495668_0067174 3300046616 Bacteria 1972
776 Ga0495668_0102990 3300046616 Bacteria 1561
777 Ga0495668_0157367 3300046616 Bacteria 1244
778 Ga0495668_0216198 3300046616 Bacteria 1049
779 Ga0495668_0216973 3300046616 Bacteria 1047
780 Ga0495668_0244514 3300046616 Bacteria 982
781 Ga0495668_0283014 3300046616 Bacteria 908
782 Ga0495668_0316831 3300046616 Bacteria 855
783 Ga0495668_0438164 3300046616 Bacteria 719
784 Ga0495668_0572655 3300046616 Bacteria 623
785 Ga0495668_0810551 3300046616 Bacteria 518
786 Ga0495634_0019079 3300046642 Bacteria 4874
787 Ga0495634_0192943 3300046642 Bacteria 1269
788 Ga0495611_0013452 3300046648 Bacteria 3484
789 Ga0495611_0051565 3300046648 Bacteria 1854
790 Ga0495611_0066175 3300046648 Bacteria 1647
791 Ga0495611_0077598 3300046648 Bacteria 1523
792 Ga0495611_0099340 3300046648 Bacteria 1350
793 Ga0495611_0167304 3300046648 Bacteria 1027
794 Ga0495611_0191501 3300046648 Bacteria 954
795 Ga0495611_0309654 3300046648 Bacteria 727
796 Ga0495625_0020104 3300046660 Bacteria 5160
797 Ga0495625_0021030 3300046660 Bacteria 5029
798 Ga0495625_0022675 3300046660 Bacteria 4809
799 Ga0495625_0053638 3300046660 Bacteria 2882
800 Ga0495625_0078068 3300046660 Bacteria 2311
801 Ga0495625_0134180 3300046660 Bacteria 1675
802 Ga0495625_0263877 3300046660 Bacteria 1114
803 Ga0495625_0322930 3300046660 Bacteria 982
804 Ga0495625_0347986 3300046660 Bacteria 937
805 Ga0495635_0014432 3300046663 Bacteria 5526
806 Ga0495635_0068579 3300046663 Bacteria 2432
807 Ga0495659_0012672 3300046664 Bacteria 2735
808 Ga0495659_0020773 3300046664 Bacteria 2208
809 Ga0495659_0047516 3300046664 Bacteria 1552
810 Ga0495659_0121116 3300046664 Bacteria 1030
811 Ga0495659_0309852 3300046664 Bacteria 668
812 Ga0495659_0447522 3300046664 Bacteria 562
813 Ga0495659_0470245 3300046664 Bacteria 549
814 Ga0495661_0010669 3300046665 Bacteria 6258
815 Ga0495661_0018478 3300046665 Bacteria 4584
816 Ga0495661_0058552 3300046665 Bacteria 2296
817 Ga0495661_0058855 3300046665 Bacteria 2288
818 Ga0495661_0077557 3300046665 Bacteria 1924
819 Ga0495661_0088865 3300046665 Bacteria 1762
820 Ga0495661_0115856 3300046665 Bacteria 1487
821 Ga0495661_0124105 3300046665 Bacteria 1422
822 Ga0495661_0149912 3300046665 Bacteria 1260
823 Ga0495661_0153590 3300046665 Bacteria 1241
824 Ga0495661_0156350 3300046665 Bacteria 1227
825 Ga0495661_0167032 3300046665 Bacteria 1176
826 Ga0495661_0199840 3300046665 Bacteria 1047
827 Ga0495661_0223551 3300046665 Bacteria 974
828 Ga0495661_0228249 3300046665 Bacteria 961
829 Ga0495661_0241389 3300046665 Bacteria 926
830 Ga0495661_0258570 3300046665 Bacteria 885
831 Ga0495661_0397778 3300046665 Bacteria 670
832 Ga0495661_0465733 3300046665 Bacteria 606
833 Ga0495661_0478009 3300046665 Bacteria 596
834 Ga0495661_0510115 3300046665 Bacteria 572
835 Ga0495588_0010876 3300046674 Bacteria 4252
836 Ga0495588_0014904 3300046674 Bacteria 3730
837 Ga0495588_0040459 3300046674 Bacteria 2377
838 Ga0495588_0062419 3300046674 Bacteria 1931
839 Ga0495588_0114119 3300046674 Bacteria 1423
840 Ga0495588_0120582 3300046674 Bacteria 1382
841 Ga0495588_0126731 3300046674 Bacteria 1346
842 Ga0495588_0169163 3300046674 Bacteria 1155
843 Ga0495588_0269792 3300046674 Bacteria 896
844 Ga0495588_0284320 3300046674 Bacteria 871
845 Ga0495588_0383066 3300046674 Bacteria 738
846 Ga0495588_0459929 3300046674 Bacteria 667
847 Ga0495657_0029648 3300046675 Bacteria 3836
848 Ga0495657_0353281 3300046675 Bacteria 870
849 Ga0495599_0007721 3300046678 Bacteria 6532
850 Ga0495599_0184025 3300046678 Bacteria 1287
851 Ga0495599_0416237 3300046678 Bacteria 799
852 Ga0495623_0068842 3300046679 Bacteria 2206
853 Ga0495623_0076509 3300046679 Bacteria 2076
854 Ga0495623_0205957 3300046679 Bacteria 1128
855 Ga0495623_0218757 3300046679 Bacteria 1086
856 Ga0495623_0283811 3300046679 Bacteria 920
857 Ga0495623_0312291 3300046679 Bacteria 865
858 Ga0495623_0380325 3300046679 Bacteria 763
859 Ga0495646_0112772 3300046680 Bacteria 1546
860 Ga0495646_0181463 3300046680 Bacteria 1155
861 Ga0495646_0253356 3300046680 Bacteria 942
862 Ga0495646_0333161 3300046680 Bacteria 797
863 Ga0495646_0637124 3300046680 Bacteria 539
864 Ga0495658_0224387 3300046683 Bacteria 1177
865 Ga0495669_0021103 3300046684 Bacteria 2824
866 Ga0495669_0056751 3300046684 Bacteria 1765
867 Ga0495669_0065000 3300046684 Bacteria 1655
868 Ga0495669_0067620 3300046684 Bacteria 1624
869 Ga0495669_0086910 3300046684 Bacteria 1440
870 Ga0495669_0112795 3300046684 Bacteria 1270
871 Ga0495669_0215544 3300046684 Bacteria 919
872 Ga0495669_0221649 3300046684 Bacteria 906
873 Ga0495613_0065356 3300046689 Bacteria 2658
874 Ga0495613_0253770 3300046689 Bacteria 1227
875 Ga0495613_0394069 3300046689 Bacteria 945
876 Ga0495624_0078632 3300046690 Bacteria 2045
877 Ga0495624_0121558 3300046690 Bacteria 1603
878 Ga0495624_0123298 3300046690 Bacteria 1591
879 Ga0495624_0777347 3300046690 Bacteria 566
880 Ga0495670_0042081 3300046691 Bacteria 2279
881 Ga0495670_0044966 3300046691 Bacteria 2204
882 Ga0495670_0046118 3300046691 Bacteria 2176
883 Ga0495670_0082751 3300046691 Bacteria 1636
884 Ga0495670_0152880 3300046691 Bacteria 1210
885 Ga0495670_0165436 3300046691 Bacteria 1163
886 Ga0495670_0172779 3300046691 Bacteria 1138
887 Ga0495670_0200169 3300046691 Bacteria 1057
888 Ga0495670_0298224 3300046691 Bacteria 863
889 Ga0495670_0329266 3300046691 Bacteria 820
890 Ga0495670_0337191 3300046691 Bacteria 810
891 Ga0495670_0638070 3300046691 Bacteria 580
892 Ga0495671_0016693 3300046692 Bacteria 3916
893 Ga0495671_0029072 3300046692 Bacteria 2841
894 Ga0495671_0049468 3300046692 Bacteria 2095
895 Ga0495671_0078583 3300046692 Bacteria 1617
896 Ga0495671_0116767 3300046692 Bacteria 1302
897 Ga0495671_0145008 3300046692 Bacteria 1156
898 Ga0495671_0182117 3300046692 Bacteria 1020
899 Ga0495671_0210520 3300046692 Bacteria 942
900 Ga0495671_0398155 3300046692 Bacteria 659
901 Ga0495649_0014801 3300046694 Bacteria 4457
902 Ga0495649_0024341 3300046694 Bacteria 3376
903 Ga0495649_0053355 3300046694 Bacteria 2188
904 Ga0495649_0060727 3300046694 Bacteria 2033
905 Ga0495649_0120385 3300046694 Bacteria 1388
906 Ga0495649_0184805 3300046694 Bacteria 1086
907 Ga0495649_0198523 3300046694 Bacteria 1042
908 Ga0495649_0482298 3300046694 Bacteria 617
909 Ga0495649_0588584 3300046694 Bacteria 549
910 Ga0495589_0014565 3300046794 Bacteria 4046
911 Ga0495589_0022141 3300046794 Bacteria 3245
912 Ga0495589_0043731 3300046794 Bacteria 2228
913 Ga0495589_0085487 3300046794 Bacteria 1532
914 Ga0495589_0085914 3300046794 Bacteria 1528
915 Ga0495589_0088958 3300046794 Bacteria 1499
916 Ga0495589_0106067 3300046794 Bacteria 1357
917 Ga0495589_0120451 3300046794 Bacteria 1263
918 Ga0495589_0137014 3300046794 Bacteria 1173
919 Ga0495589_0177569 3300046794 Bacteria 1011
920 Ga0495589_0228246 3300046794 Bacteria 873
921 Ga0495589_0306391 3300046794 Bacteria 735
922 Ga0495589_0328935 3300046794 Bacteria 705
923 Ga0495589_0411505 3300046794 Bacteria 620
924 Ga0495600_0011381 3300046809 Bacteria 5543
925 Ga0495600_0075615 3300046809 Bacteria 2199
926 Ga0495600_0169292 3300046809 Bacteria 1410
927 Ga0495600_0300712 3300046809 Bacteria 1012
928 Ga0495660_0003674 3300046810 Bacteria 9441
929 Ga0495660_0007171 3300046810 Bacteria 6566
930 Ga0495660_0030863 3300046810 Bacteria 3017
931 Ga0495660_0054740 3300046810 Bacteria 2161
932 Ga0495660_0091402 3300046810 Bacteria 1581
933 Ga0495660_0147915 3300046810 Bacteria 1162
934 Ga0495660_0154468 3300046810 Bacteria 1130
935 Ga0495660_0168230 3300046810 Bacteria 1069
936 Ga0495660_0219733 3300046810 Bacteria 896
937 Ga0495660_0232924 3300046810 Bacteria 862
938 Ga0495660_0308179 3300046810 Bacteria 715
939 Ga0495581_0011795 3300047315 Bacteria 5059
940 Ga0495581_0084029 3300047315 Bacteria 1844
941 Ga0495581_0360631 3300047315 Bacteria 848
942 Ga0495581_0381506 3300047315 Bacteria 822
943 Ga0495581_0723677 3300047315 Bacteria 573
944 Ga0495604_0098589 3300047317 Bacteria 2152
945 Ga0495604_0113202 3300047317 Bacteria 1975
946 Ga0495604_0145750 3300047317 Bacteria 1687
947 Ga0495604_0351376 3300047317 Bacteria 979
948 Ga0495604_0521019 3300047317 Bacteria 769
949 Ga0495636_0006088 3300047318 Bacteria 4736
950 Ga0495636_0006698 3300047318 Bacteria 4530
951 Ga0495636_0007040 3300047318 Bacteria 4424
952 Ga0495636_0022781 3300047318 Bacteria 2534
953 Ga0495636_0162291 3300047318 Bacteria 1007
954 Ga0495636_0287990 3300047318 Bacteria 766
955 Ga0495636_0535779 3300047318 Bacteria 568
956 Ga0495674_0035014 3300047319 Bacteria 4533
957 Ga0495672_0019097 3300047320 Bacteria 4531
958 Ga0495672_0020418 3300047320 Bacteria 4343
959 Ga0495672_0026706 3300047320 Bacteria 3679
960 Ga0495672_0059705 3300047320 Bacteria 2205
961 Ga0495672_0078821 3300047320 Bacteria 1841
962 Ga0495672_0083387 3300047320 Bacteria 1775
963 Ga0495672_0144473 3300047320 Bacteria 1239
964 Ga0495672_0205361 3300047320 Bacteria 982
965 Ga0495672_0350773 3300047320 Bacteria 685
966 Ga0495676_0059819 3300047321 Bacteria 2989
967 Ga0495676_0093491 3300047321 Bacteria 2242
968 Ga0495676_0173448 3300047321 Bacteria 1516
969 Ga0495676_0257446 3300047321 Bacteria 1188
970 Ga0495676_0304389 3300047321 Bacteria 1074
971 Ga0495676_0495608 3300047321 Bacteria 802
972 Ga0495680_0081403 3300047322 Bacteria 2444
973 Ga0495680_0082868 3300047322 Bacteria 2419
974 Ga0495680_0344851 3300047322 Bacteria 1038
975 Ga0495680_0537176 3300047322 Bacteria 789
976 Ga0495683_0025191 3300047323 Bacteria 3050
977 Ga0495683_0037514 3300047323 Bacteria 2456
978 Ga0495683_0070704 3300047323 Bacteria 1713
979 Ga0495683_0140598 3300047323 Bacteria 1131
980 Ga0495683_0142576 3300047323 Bacteria 1121
981 Ga0495683_0151837 3300047323 Bacteria 1077
982 Ga0495683_0186374 3300047323 Bacteria 944
983 Ga0495683_0233898 3300047323 Bacteria 813
984 Ga0495683_0234859 3300047323 Bacteria 811
985 Ga0495683_0322969 3300047323 Bacteria 657
986 Ga0495683_0326250 3300047323 Bacteria 653
987 Ga0495687_000370 3300047443 Bacteria 56035
988 Ga0495687_007822 3300047443 Bacteria 6222
989 Ga0495687_014326 3300047443 Bacteria 4086
990 Ga0495687_024856 3300047443 Bacteria 2840
991 Ga0495687_029913 3300047443 Bacteria 2513
992 Ga0495687_036882 3300047443 Bacteria 2182
993 Ga0495687_088588 3300047443 Bacteria 1191
994 Ga0495687_090810 3300047443 Bacteria 1169
995 Ga0495687_097393 3300047443 Bacteria 1111
996 Ga0495675_0151163 3300047444 Bacteria 1434
997 Ga0495675_0229325 3300047444 Bacteria 1121
998 Ga0495675_0243254 3300047444 Bacteria 1082
999 Ga0495675_0361090 3300047444 Bacteria 852
1000 Ga0495675_0526632 3300047444 Bacteria 676
1001 Ga0495677_0006314 3300047445 Bacteria 4477
1002 Ga0495677_0006510 3300047445 Bacteria 4412
1003 Ga0495677_0026532 3300047445 Bacteria 2101
1004 Ga0495677_0032012 3300047445 Bacteria 1914
1005 Ga0495677_0043835 3300047445 Bacteria 1640
1006 Ga0495677_0070385 3300047445 Bacteria 1303
1007 Ga0495677_0085894 3300047445 Bacteria 1182
1008 Ga0495677_0087226 3300047445 Bacteria 1173
1009 Ga0495677_0089584 3300047445 Bacteria 1158
1010 Ga0495677_0093603 3300047445 Bacteria 1133
1011 Ga0495677_0097213 3300047445 Bacteria 1112
1012 Ga0495677_0181154 3300047445 Bacteria 816
1013 Ga0495677_0215504 3300047445 Bacteria 747
1014 Ga0495677_0278112 3300047445 Bacteria 656
1015 Ga0495677_0280702 3300047445 Bacteria 653
1016 Ga0495679_008823 3300047446 Bacteria 4069
1017 Ga0495679_051789 3300047446 Bacteria 1229
1018 Ga0495679_052553 3300047446 Bacteria 1218
1019 Ga0495679_061198 3300047446 Bacteria 1103
1020 Ga0495679_065665 3300047446 Bacteria 1055
1021 Ga0495679_084892 3300047446 Bacteria 894
1022 Ga0495679_104770 3300047446 Bacteria 783
1023 Ga0495685_001797 3300047447 Bacteria 6613
1024 Ga0495685_049119 3300047447 Bacteria 1433
1025 Ga0495685_051223 3300047447 Bacteria 1400
1026 Ga0495685_059807 3300047447 Bacteria 1285
1027 Ga0495685_096110 3300047447 Bacteria 979
1028 Ga0495685_231982 3300047447 Bacteria 587
1029 Ga0495685_241979 3300047447 Bacteria 573
1030 Ga0495673_0000185 3300047469 Bacteria 100703
1031 Ga0495673_0000338 3300047469 Bacteria 59988
1032 Ga0495673_0002607 3300047469 Bacteria 12542
1033 Ga0495673_0100936 3300047469 Bacteria 1166
1034 Ga0495681_0018699 3300047470 Bacteria 3808
1035 Ga0495681_0030651 3300047470 Bacteria 2735
1036 Ga0495681_0061145 3300047470 Bacteria 1735
1037 Ga0495681_0078367 3300047470 Bacteria 1480
1038 Ga0495681_0106719 3300047470 Bacteria 1217
1039 Ga0495681_0139883 3300047470 Bacteria 1023
1040 Ga0495681_0152247 3300047470 Bacteria 969
1041 Ga0495681_0232725 3300047470 Bacteria 734
1042 Ga0495681_0271659 3300047470 Bacteria 663
1043 Ga0495686_0005000 3300047472 Bacteria 10648
1044 Ga0495686_0041880 3300047472 Bacteria 2914
1045 Ga0495686_0116547 3300047472 Bacteria 1596
1046 Ga0495686_0121709 3300047472 Bacteria 1554
1047 Ga0495686_0203037 3300047472 Bacteria 1136
1048 Ga0495686_0452869 3300047472 Bacteria 681
1049 Ga0495686_0727384 3300047472 Bacteria 504
1050 Ga0495593_0012462 3300047673 Bacteria 4859
1051 Ga0495593_0195327 3300047673 Bacteria 1017
1052 Ga0495593_0374729 3300047673 Bacteria 711
1053 Ga0495593_0682892 3300047673 Bacteria 515
1054 Ga0495602_0058801 3300048088 Bacteria 3362
1055 Ga0495602_0277034 3300048088 Bacteria 1237
1056 Ga0495602_0734444 3300048088 Bacteria 667
1057 Ga0495614_0029810 3300048089 Bacteria 2347
1058 Ga0495614_0060035 3300048089 Bacteria 1634
1059 Ga0495614_0107230 3300048089 Bacteria 1224
1060 Ga0495615_0020588 3300048090 Bacteria 1480
1061 Ga0495615_0042504 3300048090 Bacteria 1140
1062 Ga0495615_0078113 3300048090 Bacteria 903
1063 Ga0495626_0003909 3300048091 Bacteria 9334
1064 Ga0495626_0010744 3300048091 Bacteria 4868
1065 Ga0495626_0012906 3300048091 Bacteria 4359
1066 Ga0495626_0016437 3300048091 Bacteria 3756
1067 Ga0495626_0027831 3300048091 Bacteria 2745
1068 Ga0495626_0032859 3300048091 Bacteria 2489
1069 Ga0495626_0077411 3300048091 Bacteria 1482
1070 Ga0495626_0080378 3300048091 Bacteria 1449
1071 Ga0495626_0081637 3300048091 Bacteria 1435
1072 Ga0495626_0125936 3300048091 Bacteria 1097
1073 Ga0495626_0133404 3300048091 Bacteria 1058
1074 Ga0495626_0345249 3300048091 Bacteria 581
1075 Ga0496100_0018888 3300048903 Bacteria 4101
1076 Ga0496100_0632587 3300048903 Bacteria 832
1077 Ga0496100_0647665 3300048903 Bacteria 822
1078 Ga0496100_0972939 3300048903 Bacteria 667
1079 Ga0496101_0319243 3300048904 Bacteria 1218
1080 Ga0496102_0068828 3300048905 Bacteria 3248
1081 Ga0496102_0088863 3300048905 Bacteria 2857
1082 Ga0496102_0137406 3300048905 Bacteria 2290
1083 Ga0496102_0803991 3300048905 Bacteria 862
1084 Ga0496102_1070135 3300048905 Bacteria 726
1085 Ga0496102_1077448 3300048905 Bacteria 723
1086 Ga0496102_1348585 3300048905 Bacteria 632
1087 Ga0496103_0058673 3300048906 Bacteria 2391
1088 Ga0496103_0070829 3300048906 Bacteria 2181
1089 Ga0496103_0090188 3300048906 Bacteria 1934
1090 Ga0496103_0091802 3300048906 Bacteria 1916
1091 Ga0496103_0180310 3300048906 Bacteria 1357
1092 Ga0496103_0419965 3300048906 Bacteria 858
1093 Ga0496103_0612122 3300048906 Bacteria 693
1094 Ga0496104_0178000 3300048907 Bacteria 2037
1095 Ga0496104_0570097 3300048907 Bacteria 1042
1096 Ga0496104_1134155 3300048907 Bacteria 685
1097 Ga0496105_0442086 3300048908 Bacteria 1027
1098 Ga0496105_0534987 3300048908 Bacteria 916
1099 Ga0496105_0547476 3300048908 Bacteria 903
1100 Ga0496105_0952840 3300048908 Bacteria 644
1101 Ga0496106_0253104 3300048909 Bacteria 1408
1102 Ga0496106_0535103 3300048909 Bacteria 940
1103 Ga0496107_0248001 3300048910 Bacteria 1325
1104 Ga0496107_0398111 3300048910 Bacteria 1024
1105 Ga0496107_0479689 3300048910 Bacteria 923
1106 Ga0496107_0860266 3300048910 Bacteria 662
1107 Ga0496108_0191326 3300048911 Bacteria 1773
1108 Ga0496108_0599219 3300048911 Bacteria 960
1109 Ga0496108_0849703 3300048911 Bacteria 785
1110 Ga0496109_0072916 3300048912 Bacteria 3155
1111 Ga0496109_0186739 3300048912 Bacteria 1947
1112 Ga0496109_0783590 3300048912 Bacteria 891
1113 Ga0496109_1056140 3300048912 Bacteria 749
1114 Ga0496110_0080386 3300048913 Bacteria 2904
1115 Ga0496110_0491583 3300048913 Bacteria 1117
1116 Ga0496110_0690196 3300048913 Bacteria 922
1117 Ga0496110_0861253 3300048913 Bacteria 811
1118 Ga0496110_0936409 3300048913 Bacteria 773
1119 Ga0496110_1164934 3300048913 Bacteria 679
1120 Ga0496111_0091872 3300048914 Bacteria 2224
1121 Ga0496111_0146589 3300048914 Bacteria 1750
1122 Ga0496111_0521994 3300048914 Bacteria 873
1123 Ga0496112_0306153 3300048915 Bacteria 1534
1124 Ga0496113_0099847 3300048916 Bacteria 2248
1125 Ga0496113_0385700 3300048916 Bacteria 1124
1126 Ga0496114_0022403 3300048917 Bacteria 5149
1127 Ga0496114_0289742 3300048917 Bacteria 1444
1128 Ga0496114_0438915 3300048917 Bacteria 1156
1129 Ga0496114_0637577 3300048917 Bacteria 938
1130 Ga0496114_0641742 3300048917 Bacteria 934
1131 Ga0496115_0050867 3300048918 Bacteria 3321
1132 Ga0496115_0221193 3300048918 Bacteria 1562
1133 Ga0496115_0321110 3300048918 Bacteria 1266
1134 Ga0496115_0801713 3300048918 Bacteria 733
1135 Ga0496116_0091755 3300048919 Bacteria 1845
1136 Ga0496116_0253322 3300048919 Bacteria 874
1137 Ga0496118_0183090 3300048921 Bacteria 1263
1138 Ga0496120_0124356 3300048923 Bacteria 1329
1139 Ga0496121_0243249 3300048924 Bacteria 1252
1140 Ga0496121_0329613 3300048924 Bacteria 1024
1141 Ga0496121_0537195 3300048924 Bacteria 734
1142 Ga0496121_0676800 3300048924 Bacteria 624
1143 Ga0496122_0077023 3300048925 Bacteria 2344
1144 Ga0496122_0109128 3300048925 Bacteria 1822
1145 Ga0496122_0194708 3300048925 Bacteria 1192
1146 Ga0496122_0426972 3300048925 Bacteria 664
1147 Ga0496123_0013659 3300048926 Bacteria 6791
1148 Ga0496123_0031651 3300048926 Bacteria 3845
1149 Ga0496123_0069843 3300048926 Bacteria 2202
1150 Ga0496124_0106187 3300048927 Bacteria 2267
1151 Ga0496124_0129517 3300048927 Bacteria 2006
1152 Ga0496124_0132720 3300048927 Bacteria 1976
1153 Ga0496124_0150483 3300048927 Bacteria 1826
1154 Ga0496124_0323784 3300048927 Bacteria 1102
1155 Ga0496124_0348155 3300048927 Bacteria 1049
1156 Ga0496124_0355597 3300048927 Bacteria 1034
1157 Ga0496124_0745176 3300048927 Bacteria 614
1158 Ga0496124_0787945 3300048927 Bacteria 590
1159 Ga0496124_0801049 3300048927 Bacteria 583
1160 Ga0496125_0021606 3300048928 Bacteria 5998
1161 Ga0496125_0060592 3300048928 Bacteria 3040
1162 Ga0496125_0063503 3300048928 Bacteria 2944
1163 Ga0496125_0427486 3300048928 Bacteria 765
1164 Ga0496126_0031527 3300048929 Bacteria 5006
1165 Ga0496126_0345681 3300048929 Bacteria 1218
1166 Ga0496126_0708504 3300048929 Bacteria 781
1167 Ga0501306_000150 3300049127 Bacteria 4359
1168 Ga0501306_003340 3300049127 Bacteria 1723
1169 Ga0501306_009215 3300049127 Bacteria 1221
1170 Ga0501306_058971 3300049127 Bacteria 629
1171 Ga0501306_077581 3300049127 Bacteria 569
1172 Ga0501306_079075 3300049127 Bacteria 565
1173 Ga0501308_000398 3300049128 Bacteria 2773
1174 Ga0501308_002408 3300049128 Bacteria 1638
1175 Ga0501308_018121 3300049128 Bacteria 859
1176 Ga0501309_004241 3300049129 Bacteria 1663
1177 Ga0501309_011386 3300049129 Bacteria 1159
1178 Ga0501310_001072 3300049130 Bacteria 2465
1179 Ga0501310_006078 3300049130 Bacteria 1258
1180 Ga0501310_016049 3300049130 Bacteria 894
1181 Ga0501343_000533 3300049132 Bacteria 2250
1182 Ga0501343_007025 3300049132 Bacteria 885
1183 Ga0501343_010267 3300049132 Bacteria 763
1184 Ga0501304_001138 3300049160 Bacteria 1639
1185 Ga0501304_002860 3300049160 Bacteria 1229
1186 Ga0501304_005072 3300049160 Bacteria 1021
1187 Ga0501304_008888 3300049160 Bacteria 853
1188 Ga0501305_005503 3300049161 Bacteria 1538
1189 Ga0501305_006325 3300049161 Bacteria 1467
1190 Ga0501305_028998 3300049161 Bacteria 854
1191 Ga0501305_047139 3300049161 Bacteria 715
1192 Ga0501305_075734 3300049161 Bacteria 598
1193 Ga0501305_081335 3300049161 Bacteria 583
1194 Ga0501305_082426 3300049161 Bacteria 580
1195 Ga0501307_002498 3300049162 Bacteria 1720
1196 Ga0501307_002525 3300049162 Bacteria 1715
1197 Ga0501307_004154 3300049162 Bacteria 1463
1198 Ga0501307_004969 3300049162 Bacteria 1383
1199 Ga0501307_024948 3300049162 Bacteria 800
1200 Ga0501307_067261 3300049162 Bacteria 566
1201 Ga0495678_006998 3300049459 Bacteria 5916
1202 Ga0495678_025193 3300049459 Bacteria 2558
1203 Ga0495678_027928 3300049459 Bacteria 2387
1204 Ga0495678_059401 3300049459 Bacteria 1441
1205 Ga0495678_066094 3300049459 Bacteria 1340
1206 Ga0495678_069294 3300049459 Bacteria 1297
1207 Ga0495678_091123 3300049459 Bacteria 1073
1208 Ga0495678_092832 3300049459 Bacteria 1059
1209 Ga0495682_0063615 3300049460 Bacteria 1330
1210 Ga0495682_0080123 3300049460 Bacteria 1174
1211 Ga0495682_0124886 3300049460 Bacteria 921
1212 Ga0501297_011034 3300049520 Bacteria 1031
1213 Ga0501311_000165 3300049527 Bacteria 3696
1214 Ga0501311_020593 3300049527 Bacteria 893
1215 Ga0501311_023545 3300049527 Bacteria 853
1216 Ga0501311_089829 3300049527 Bacteria 532
1217 Ga0501312_004623 3300049528 Bacteria 1633
1218 Ga0501312_012905 3300049528 Bacteria 1155
1219 Ga0501312_025618 3300049528 Bacteria 900
1220 Ga0501312_032245 3300049528 Bacteria 826
1221 Ga0501312_053251 3300049528 Bacteria 687
1222 Ga0501312_090417 3300049528 Bacteria 564
1223 Ga0501313_000756 3300049529 Bacteria 2434
1224 Ga0501313_001122 3300049529 Bacteria 2196
1225 Ga0501314_005033 3300049530 Bacteria 1115
1226 Ga0501314_008905 3300049530 Bacteria 914
1227 Ga0501314_021302 3300049530 Bacteria 676
1228 Ga0501315_000556 3300049531 Bacteria 2665
1229 Ga0501315_002286 3300049531 Bacteria 1779
1230 Ga0501315_003217 3300049531 Bacteria 1616
1231 Ga0501315_003289 3300049531 Bacteria 1603
1232 Ga0501315_012963 3300049531 Bacteria 1038
1233 Ga0501315_013154 3300049531 Bacteria 1033
1234 Ga0501315_082020 3300049531 Bacteria 549
1235 Ga0501316_000848 3300049532 Bacteria 2366
1236 Ga0501316_006293 3300049532 Bacteria 1260
1237 Ga0501316_007300 3300049532 Bacteria 1197
1238 Ga0501316_043078 3300049532 Bacteria 634
1239 Ga0501317_016468 3300049533 Bacteria 959
1240 Ga0501317_016650 3300049533 Bacteria 956
1241 Ga0501317_022573 3300049533 Bacteria 863
1242 Ga0501319_026436 3300049535 Bacteria 543
1243 Ga0501320_003037 3300049536 Bacteria 1393
1244 Ga0501320_003150 3300049536 Bacteria 1378
1245 Ga0501320_003152 3300049536 Bacteria 1378
1246 Ga0501320_009090 3300049536 Bacteria 990
1247 Ga0501320_009230 3300049536 Bacteria 984
1248 Ga0501321_003885 3300049537 Bacteria 1399
1249 Ga0501321_021050 3300049537 Bacteria 811
1250 Ga0501321_025452 3300049537 Bacteria 763
1251 Ga0501321_026065 3300049537 Bacteria 757
1252 Ga0501321_039662 3300049537 Bacteria 658
1253 Ga0501322_003710 3300049538 Bacteria 1000
1254 Ga0501323_017947 3300049539 Bacteria 912
1255 Ga0501323_038409 3300049539 Bacteria 695
1256 Ga0501323_055330 3300049539 Bacteria 610
1257 Ga0501323_086114 3300049539 Bacteria 519
1258 Ga0501324_000146 3300049540 Bacteria 3029
1259 Ga0501324_032909 3300049540 Bacteria 572
1260 Ga0501324_039127 3300049540 Bacteria 538
1261 Ga0501325_002483 3300049541 Bacteria 1266
1262 Ga0501326_03837 3300049542 Bacteria 783
1263 Ga0501327_07824 3300049543 Bacteria 671
1264 Ga0501330_015869 3300049546 Bacteria 575
1265 Ga0501334_02030 3300049550 Bacteria 1172
1266 Ga0501334_11604 3300049550 Bacteria 647
1267 Ga0501335_016552 3300049551 Bacteria 760
1268 Ga0501335_030466 3300049551 Bacteria 608
1269 Ga0501336_001604 3300049552 Bacteria 1373
1270 Ga0501336_021445 3300049552 Bacteria 590
1271 Ga0501337_003695 3300049553 Bacteria 979
1272 Ga0501036_0168725 3300049572 Bacteria 1844
1273 Ga0501211_003467 3300049658 Bacteria 1625
1274 Ga0501222_052889 3300049662 Bacteria 599
1275 Ga0501227_001669 3300049665 Bacteria 4945
1276 Ga0501233_046721 3300049668 Bacteria 1036
1277 Ga0501238_028740 3300049671 Bacteria 800
1278 Ga0501249_011012 3300049679 Bacteria 1895
1279 Ga0501257_178657 3300049686 Bacteria 600
1280 Ga0501234_014155 3300049707 Bacteria 1252
1281 Ga0501232_048342 3300049757 Bacteria 648
1282 Ga0501263_009328 3300049760 Bacteria 1186
1283 Ga0501268_014162 3300049765 Bacteria 1297
1284 Ga0501268_048277 3300049765 Bacteria 818
1285 Ga0501279_003775 3300049775 Bacteria 1982
1286 Ga0501279_014665 3300049775 Bacteria 1080
1287 Ga0501035_0035964 3300049822 Bacteria 4492
1288 Ga0501044_1175829 3300049823 Bacteria 635
1289 nmdc:mga03683_124751_c1 3300050489 Bacteria 1148
1290 nmdc:mga03n38_79853_c1 3300050490 Bacteria 1535
1291 nmdc:mga0k408_362329_c1 3300050493 Bacteria 864
1292 nmdc:mga07m45_367000_c1 3300050496 Bacteria 836
1293 nmdc:mga07m45_95626_c1 3300050496 Bacteria 1704
1294 Ga0495601_0011363 3300053077 Bacteria 5322
1295 Ga0495655_0195039 3300053083 Bacteria 659
1296 Ga0500646_0325529 3300053090 Bacteria 556
1297 Ga0500594_0105109 3300053118 Bacteria 873
1298 Ga0500595_081341 3300053119 Bacteria 947
1299 Ga0500618_004294 3300053125 Bacteria 4610
1300 Ga0500621_188196 3300053126 Bacteria 742
1301 Ga0500559_0112531 3300053136 Bacteria 1262
1302 Ga0500573_0380923 3300053140 Bacteria 674
1303 Ga0500574_000852 3300053141 Bacteria 4160
1304 Ga0500586_092624 3300053145 Bacteria 1061
1305 Ga0500586_130803 3300053145 Bacteria 868
1306 Ga0500619_083039 3300053154 Bacteria 1077
1307 Ga0500624_071695 3300053157 Bacteria 678
1308 Ga0500636_0475721 3300053177 Bacteria 558
1309 Ga0587084_006452 3300059477 Bacteria 1425
1310 Ga0587084_017124 3300059477 Bacteria 1043
1311 Ga0587084_027909 3300059477 Bacteria 890
1312 Ga0587093_001802 3300059478 Bacteria 1885
1313 Ga0587093_003356 3300059478 Bacteria 1567
1314 Ga0587066_002048 3300059490 Bacteria 2157
1315 Ga0587066_025732 3300059490 Bacteria 1011
1316 Ga0587070_011858 3300059491 Bacteria 1313
1317 Ga0587070_012033 3300059491 Bacteria 1307
1318 Ga0587070_037857 3300059491 Bacteria 909
1319 Ga0587073_0000405 3300059492 Bacteria 3811
1320 Ga0587073_0152513 3300059492 Bacteria 655
1321 Ga0587077_008903 3300059493 Bacteria 1508
1322 Ga0587077_009273 3300059493 Bacteria 1489
1323 Ga0587080_003728 3300059503 Bacteria 1923
1324 Ga0587080_019330 3300059503 Bacteria 1103
1325 Ga0587080_053033 3300059503 Bacteria 771
1326 Ga0587082_000814 3300059504 Bacteria 2909
1327 Ga0587082_062171 3300059504 Bacteria 739
1328 Ga0587083_0032996 3300059505 Bacteria 1042
1329 Ga0587083_0039846 3300059505 Bacteria 978
1330 Ga0587085_006188 3300059506 Bacteria 1445
1331 Ga0587085_013499 3300059506 Bacteria 1138
1332 Ga0587086_000667 3300059507 Bacteria 2638
1333 Ga0587086_003732 3300059507 Bacteria 1551
1334 Ga0587086_012653 3300059507 Bacteria 1052
1335 Ga0587088_000683 3300059508 Bacteria 3024
1336 Ga0587088_006876 3300059508 Bacteria 1552
1337 Ga0587088_039639 3300059508 Bacteria 882
1338 Ga0587089_009849 3300059509 Bacteria 1181
1339 Ga0587089_018181 3300059509 Bacteria 951
1340 Ga0587089_031477 3300059509 Bacteria 784
1341 Ga0587090_003488 3300059510 Bacteria 1832
1342 Ga0587090_007045 3300059510 Bacteria 1464
1343 Ga0587091_002980 3300059511 Bacteria 2079
1344 Ga0587091_021583 3300059511 Bacteria 1129
1345 Ga0587092_005373 3300059512 Bacteria 1577
1346 Ga0587092_008921 3300059512 Bacteria 1336
1347 Ga0587094_002657 3300059513 Bacteria 1867
1348 Ga0587094_003403 3300059513 Bacteria 1731
1349 Ga0587094_003513 3300059513 Bacteria 1716
1350 Ga0587095_000862 3300059514 Bacteria 1720
1351 Ga0587095_001423 3300059514 Bacteria 1470
1352 Ga0587097_00287 3300059603 Bacteria 1337
1353 Ga0587097_01444 3300059603 Bacteria 857
1354 Ga0587098_001919 3300059604 Bacteria 1686
1355 Ga0587098_028142 3300059604 Bacteria 758
1356 Ga0587121_01643 3300059606 Bacteria 1126
1357 Ga0587125_000574 3300059607 Bacteria 2242
1358 Ga0587129_003518 3300059608 Bacteria 988
1359 Ga0587099_005269 3300059622 Bacteria 1156
1360 Ga0587101_000524 3300059623 Bacteria 2775
1361 Ga0587101_002989 3300059623 Bacteria 1678
1362 Ga0587101_008422 3300059623 Bacteria 1245
1363 Ga0587101_033901 3300059623 Bacteria 811
1364 Ga0587109_014290 3300059624 Bacteria 1330
1365 Ga0587109_031962 3300059624 Bacteria 1004
1366 Ga0587115_006225 3300059626 Bacteria 1369
1367 Ga0587117_015916 3300059627 Bacteria 994
1368 Ga0587128_005351 3300059630 Bacteria 1529
1369 Ga0587128_036484 3300059630 Bacteria 841
1370 Ga0587062_015555 3300059639 Bacteria 1018
1371 Ga0587062_016957 3300059639 Bacteria 991
1372 Ga0587062_064065 3300059639 Bacteria 651
1373 Ga0587068_006343 3300059641 Bacteria 1653
1374 Ga0587068_025778 3300059641 Bacteria 991
1375 Ga0587069_000151 3300059642 Bacteria 4141
1376 Ga0587069_008398 3300059642 Bacteria 1305
1377 Ga0587072_019128 3300059643 Bacteria 1196
1378 Ga0587072_039981 3300059643 Bacteria 908
1379 Ga0587075_002302 3300059644 Bacteria 2003
1380 Ga0587075_008575 3300059644 Bacteria 1312
1381 Ga0587076_000769 3300059645 Bacteria 2890
1382 Ga0587076_008880 3300059645 Bacteria 1415
1383 Ga0587078_021377 3300059646 Bacteria 820
1384 Ga0587079_000436 3300059647 Bacteria 3627
1385 Ga0587079_022980 3300059647 Bacteria 1137
1386 Ga0587079_034095 3300059647 Bacteria 994
1387 Ga0587079_037059 3300059647 Bacteria 967
1388 Ga0587079_048272 3300059647 Bacteria 885
1389 Ga0587100_005333 3300059648 Bacteria 954
1390 Ga0587102_000673 3300059649 Bacteria 2076
1391 Ga0587102_001335 3300059649 Bacteria 1704
1392 Ga0587102_011088 3300059649 Bacteria 901
1393 Ga0587104_000706 3300059650 Bacteria 1539
1394 Ga0587105_002305 3300059651 Bacteria 1080
1395 Ga0587107_008387 3300059652 Bacteria 1192
1396 Ga0587108_000215 3300059653 Bacteria 2673
1397 Ga0587110_001895 3300059654 Bacteria 1590
1398 Ga0587116_04152 3300059656 Bacteria 835
1399 Ga0587118_02411 3300059657 Bacteria 1210
1400 Ga0587119_001725 3300059658 Bacteria 1859
1401 Ga0587119_015430 3300059658 Bacteria 925
1402 Ga0587120_000930 3300059659 Bacteria 1689
1403 Ga0587065_06038 3300060245 Bacteria 714
1404 Ga0587081_13236 3300060246 Bacteria 610
1405 Ga0587096_00225 3300060247 Bacteria 1357
1406 Ga0587071_000779 3300060344 Bacteria 3530
1407 Ga0587071_015766 3300060344 Bacteria 1329
1408 Ga0587071_025527 3300060344 Bacteria 1109
1409 Ga0587071_048707 3300060344 Bacteria 870
1410 Ga0587111_0002093 3300060346 Bacteria 2589
1411 Ga0587111_0005555 3300060346 Bacteria 1953
1412 Ga0587111_0006057 3300060346 Bacteria 1899
1413 Ga0587111_0026675 3300060346 Bacteria 1153
1414 Ga0587111_0080351 3300060346 Bacteria 778
1415 Ga0466962_0268453 3300061719 Bacteria 840
1416 2511247426 2511231003 Bacteria 5606035
1417 2511384278 2511231026 Bacteria 5225445
1418 2521560845 2521172590 Bacteria 5047645
1419 2550696713 2548876994 Bacteria 4904866
1420 2553008127 2551306416 Bacteria 6152985
1421 2601667097 2600255292 Bacteria 6300551
1422 2643789313 2643221554 Bacteria 6603920
1423 2643799317 2643221556 Bacteria 7251154
1424 2644030560 2643221603 Bacteria 6147767
1425 2644251646 2643221645 Bacteria 7207331
1426 2644356009 2643221664 Bacteria 7272945
1427 2644472513 2643221684 Bacteria 7145183
1428 2738738195 2738541280 Bacteria 6630198
1429 2738826685 2738541297 Bacteria 6549566
1430 2738842999 2738541300 Bacteria 6675882
1431 2739150482 2738541357 Bacteria 6549408
1432 2739192401 2738543003 Bacteria 6549560
1433 2739273747 2738543018 Bacteria 6718814
1434 2739318878 2738543026 Bacteria 6549408
1435 2739337119 2738543029 Bacteria 6549249
1436 2739342791 2738543030 Bacteria 6719714
1437 2765567279 2765235838 Bacteria 5445269
1438 2808984192 2808606386 Bacteria 4471946
1439 2809131996 2808606415 Bacteria 4576710
1440 2809145972 2808606418 Bacteria 6724496
1441 2809151619 2808606419 Bacteria 4576925
1442 2819594380 2818991445 Bacteria 4955017
1443 2819618852 2818991449 Bacteria 5518009
1444 2821136285 2821131069 Bacteria 6108407
1445 2839095493 2839094727 Bacteria 5534556
1446 2842717719 2842711865 Bacteria 7155354
1447 2852622921 2852618963 Bacteria 4577824
1448 2857563377 2857558681 Bacteria 6617694
1449 2857567908 2857564685 Bacteria 6290584
1450 2884814298 2884811622 Bacteria 5552861
1451 2884840777 2884836552 Bacteria 5219991
1452 2884857627 2884852848 Bacteria 5221161
1453 2885080589 2885080285 Bacteria 6355622
1454 2896158567 2896154374 Bacteria 5221518
1455 2904427831 2904424332 Bacteria 7633521
1456 2904445257 2904439833 Bacteria 5931679
1457 2904533798 2904530477 Bacteria 5876334
1458 2904589365 2904584206 Bacteria 6028872
1459 2904595068 2904589729 Bacteria 6113573
1460 2904606734 2904601388 Bacteria 5884906
1461 2919050778 2919046199 Bacteria 5567169
1462 2919084998 2919079590 Bacteria 5946433
1463 2919476868 2919476304 Bacteria 5888696
1464 2923514686 2923510766 Bacteria 5926163
1465 2928135734 2928130867 Bacteria 5467269
1466 2932422363 2932416698 Bacteria 6315112
1467 8047676180 8047673197 Bacteria 7395230
1468 Ga0105243_11118759
1469 JGI25155J39150_1001422
1470 JGI25162J39368_1003029
1471 JGI25162J39368_1013612
1472 JGI25154J39366_1001113
1473 JGI25157J39369_1002793
1474 JGI25163J39215_1004486
1475 Ga0006761J43178_107453
1476 Ga0006763J43179_103551
1477 Ga0006762J43184_104088
1478 Ga0006765J45826_105488
1479 Ga0006765J45826_112366
1480 Ga0006778J45830_1013353
1481 Ga0006778J45830_1040529
1482 Ga0006759J45824_1008312
1483 Ga0006759J45824_1017914
1484 Ga0006759J45824_1050895
1485 JGI25151J46595_10026667
1486 JGI25165J46597_1001017
1487 JGI25153J46596_10069502
1488 Ga0007428J48920_101816
1489 Ga0007421J48921_108960
1490 Ga0006758J48902_1003362
1491 Ga0006758J48902_1007376
1492 Ga0006758J48902_1008629
1493 Ga0006758J48902_1013049
1494 Ga0006770J48903_1029811
1495 Ga0006770J48903_1044284
1496 Ga0006777J48905_1023760
1497 Ga0006777J48905_1039864
1498 rootH2_10111913
1499 JGI25160J50197_1016863
1500 Ga0007417J51691_1002081
1501 Ga0007417J51691_1010301
1502 Ga0007417J51691_1012480
1503 Ga0007417J51691_1047057
1504 Ga0007427J51700_104977
1505 Ga0006781J51513_1012464
1506 Ga0007410J51695_1007231
1507 Ga0007410J51695_1020989
1508 Ga0007409J51694_1001845
1509 Ga0007409J51694_1004205
1510 Ga0007409J51694_1052234
1511 Ga0007416J51690_1008732
1512 Ga0007416J51690_1012477
1513 Ga0007416J51690_1013143
1514 Ga0007429J51699_1009554
1515 Ga0007429J51699_1048446
1516 Ga0007411J51799_105052
1517 Ga0007411J51799_105765
1518 Ga0007415J51800_105799
1519 Ga0007415J51800_107921
1520 Ga0032354_1003507
1521 Ga0032354_1011615
1522 Ga0032354_1050188
1523 Ga0032354_1055041
1524 Ga0006780_1004575
1525 Ga0006780_1014123
1526 Ga0055538_1000375
1527 Ga0055538_1002307
1528 Ga0055539_1000377
1529 Ga0055539_1002407
1530 Ga0055533_1000371
1531 Ga0055533_1003837
1532 Ga0055532_1000420
1533 Ga0055525_1000147
1534 Ga0055525_1000523
1535 Ga0055525_1001833
1536 Ga0055535_1005381
1537 Ga0055529_1000375
1538 Ga0055526_1021258
1539 Ga0055526_1021298
1540 Ga0055537_1007354
1541 Ga0055537_1012735
1542 Ga0055524_1035570
1543 Ga0055524_1039973
1544 Ga0055534_1006810
1545 Ga0055534_1023815
1546 Ga0055528_1007975
1547 Ga0055528_1012187
1548 Ga0055530_10034470
1549 Ga0055540_1071237
1550 Ga0055531_10055730
1551 Ga0055541_1000262
1552 Ga0055541_1003620
1553 Ga0055543_1028398
1554 Ga0055543_1061760
1555 Ga0058859_11830236
1556 Ga0058863_10053884
1557 Ga0058861_10192042
1558 Ga0058860_12202994
1559 Ga0058862_10285807
1560 Ga0065165_1003318
1561 Ga0065165_1131124
1562 Ga0065714_10039928
1563 Ga0065714_10228053
1564 Ga0065714_10510726
1565 Ga0065704_10158451
1566 Ga0065715_10965565
1567 Ga0070676_10119214
1568 Ga0070670_100067314
1569 Ga0070670_100670173
1570 Ga0068869_100160311
1571 Ga0070680_100212917
1572 Ga0070680_100331491
1573 Ga0070682_100049501
1574 Ga0070682_100139754
1575 Ga0070660_100054384
1576 Ga0070661_100103030
1577 Ga0070671_101904447
1578 Ga0070659_100022490
1579 Ga0070663_100229308
1580 Ga0070662_100788233
1581 Ga0070681_10693651
1582 Ga0068867_100247809
1583 Ga0070684_100335993
1584 Ga0068853_100254548
1585 Ga0070672_100523242
1586 Ga0068855_100434090
1587 Ga0068855_100593288
1588 Ga0068855_101125821
1589 Ga0070664_100139315
1590 Ga0070664_100796478
1591 Ga0068857_100025716
1592 Ga0068854_100377989
1593 Ga0068854_100576719
1594 Ga0068856_100085286
1595 Ga0068856_100087143
1596 Ga0068852_100062072
1597 Ga0068851_10071502
1598 Ga0068851_10112534
1599 Ga0068851_10405320
1600 Ga0068862_101121132
1601 Ga0075363_100016273
1602 Ga0075364_10849286
1603 Ga0070712_100507328
1604 Ga0097621_100018618
1605 Ga0068871_100137146
1606 Ga0068865_100044877
1607 Ga0099823_1087981
1608 Ga0099794_10479873
1609 Ga0105251_10078126
1610 Ga0105244_10015476
1611 Ga0105244_10019926
1612 Ga0105244_10039890
1613 Ga0105250_10141157
1614 Ga0105250_10339321
1615 Ga0105240_10021815
1616 Ga0105240_10209527
1617 Ga0105240_10307686
1618 Ga0105245_10043502
1619 Ga0105243_10016441
1620 Ga0105243_11533616
1621 Ga0105243_13037755
1622 Ga0105241_10173179
1623 Ga0105242_10156388
1624 Ga0105248_10786239
1625 Ga0105248_10951637
1626 Ga0105237_10140721
1627 Ga0105237_10176405
1628 Ga0105238_10002020
1629 Ga0105238_10313151
1630 Ga0105238_10953002
1631 Ga0105249_11042875
1632 Ga0130086_1005042
1633 Ga0130086_1075241
1634 Ga0130086_1091490
1635 Ga0130085_1017480
1636 Ga0130085_1078041
1637 Ga0130085_1107450
1638 Ga0105239_10030541
1639 Ga0105239_10138610
1640 Ga0105239_10177507
1641 Ga0105239_11227710
1642 Ga0105246_10340845
1643 Ga0105246_10866596
1644 Ga0157325_1004116
1645 Ga0157373_10261474
1646 Ga0157373_10718048
1647 Ga0157371_10000710
1648 Ga0157370_10290342
1649 Ga0157370_10955217
1650 Ga0157369_10404300
1651 Ga0157378_12462498
1652 Ga0163162_10719007
1653 Ga0157372_11159304
1654 Ga0157372_12979912
1655 Ga0157375_11086602
1656 Ga0182008_10004539
1657 Ga0182008_10005790
1658 Ga0182008_10171183
1659 Ga0182008_10393084
1660 Ga0157377_10226863
1661 Ga0157376_10163721
1662 Ga0157376_11695674
1663 Ga0182006_1000186
1664 Ga0182006_1010089
1665 Ga0182006_1013810
1666 Ga0182007_10000202
1667 Ga0182007_10018893
1668 Ga0182007_10031144
1669 Ga0182007_10032705
1670 Ga0182007_10232394
1671 Ga0182005_1001571
1672 Ga0182005_1002884
1673 Ga0163161_10231881
1674 Ga0163161_10236417
1675 Ga0163161_10238636
1676 Ga0206355_1609219
1677 Ga0206351_10512755
1678 Ga0206350_10480254
1679 Ga0206354_10352477
1680 Ga0213872_10052983
1681 Ga0213872_10067471
1682 Ga0209435_100186
1683 Ga0209435_100191
1684 Ga0209436_101414
1685 Ga0209436_101521
1686 Ga0209784_100010
1687 Ga0209784_100035
1688 Ga0209566_100008
1689 Ga0209566_100040
1690 Ga0209674_100019
1691 Ga0209674_100057
1692 Ga0209672_104073
1693 Ga0209147_100060
1694 Ga0209563_100011
1695 Ga0209563_100021
1696 Ga0209563_100059
1697 Ga0207427_100573
1698 Ga0209437_100019
1699 Ga0209437_100639
1700 Ga0209437_118485
1701 Ga0209437_119366
1702 Ga0209258_100141
1703 Ga0207425_1001042
1704 Ga0207425_1022002
1705 Ga0209646_1000246
1706 Ga0209646_1001041
1707 Ga0209026_1004204
1708 Ga0209026_1007856
1709 Ga0209677_100011
1710 Ga0209677_100036
1711 Ga0209677_111325
1712 Ga0209148_1000323
1713 Ga0209148_1011865
1714 Ga0209759_1015039
1715 Ga0209233_1000025
1716 Ga0209565_1006443
1717 Ga0209565_1010529
1718 Ga0209565_1026547
1719 Ga0209565_1048209
1720 Ga0209565_1067964
1721 Ga0209455_1000303
1722 Ga0209455_1005403
1723 Ga0209673_1003465
1724 Ga0209673_1004929
1725 Ga0209130_1002838
1726 Ga0209675_1002952
1727 Ga0209675_1009571
1728 Ga0209025_1001281
1729 Ga0209564_1000027
1730 Ga0209564_1000230
1731 Ga0209564_1013777
1732 Ga0209564_1019927
1733 Ga0209758_1011259
1734 Ga0209050_1000292
1735 Ga0209256_1004685
1736 Ga0209256_1012344
1737 Ga0207426_1002480
1738 Ga0209051_1055224
1739 Ga0209257_1000295
1740 Ga0207656_10251696
1741 Ga0207656_10287302
1742 Ga0207655_1003094
1743 Ga0207655_1027614
1744 Ga0207655_1142968
1745 Ga0207713_1130135
1746 Ga0207647_10261112
1747 Ga0207645_10214311
1748 Ga0207705_11005312
1749 Ga0207684_10913197
1750 Ga0207654_10002179
1751 Ga0207707_10487097
1752 Ga0207695_10003953
1753 Ga0207695_10072393
1754 Ga0207695_10401694
1755 Ga0207695_10953808
1756 Ga0207671_10139299
1757 Ga0207671_10178519
1758 Ga0207671_10579222
1759 Ga0207693_10010110
1760 Ga0207657_10006550
1761 Ga0207649_10056050
1762 Ga0207649_10350719
1763 Ga0207694_10001435
1764 Ga0207694_10281831
1765 Ga0207694_10295775
1766 Ga0207650_10088896
1767 Ga0207659_11475330
1768 Ga0207687_10591242
1769 Ga0207690_11533167
1770 Ga0207706_10313632
1771 Ga0207686_10112187
1772 Ga0207709_10055004
1773 Ga0207669_10511819
1774 Ga0207704_10095815
1775 Ga0207691_10316183
1776 Ga0207711_10480757
1777 Ga0207711_10734557
1778 Ga0207689_10123864
1779 Ga0207667_10023256
1780 Ga0207667_10042185
1781 Ga0207667_10143578
1782 Ga0207640_10169293
1783 Ga0207639_10312484
1784 Ga0207678_10543520
1785 Ga0207648_10531514
1786 Ga0207674_10021420
1787 Ga0207674_10637617
1788 Ga0207683_10480854
1789 Ga0207698_10012103
1790 Ga0209281_1008175
1791 Ga0268265_10147695
1792 Ga0316177_1138179
1793 Ga0316176_1045076
1794 Ga0316178_1018733
1795 Ga0316180_1160791
1796 Ga0316183_1020377
1797 Ga0316182_1052816
1798 Ga0316182_1275498
1799 Ga0307408_100144522
1800 Ga0307408_102083828
1801 Ga0307408_102093717
1802 Ga0265314_10275927
1803 Ga0307516_10309306
1804 Ga0307405_11287052
1805 Ga0307406_10406741
1806 Ga0307407_11519995
1807 Ga0307412_10649115
1808 Ga0307416_100004760
1809 Ga0307414_10006142
1810 Ga0307411_10352971
1811 Ga0307411_10495387
1812 Ga0307411_10595392
1813 Ga0307411_11417131
1814 Ga0307510_10280273
1815 Ga0373949_0294284
1816 Ga0373939_0053081
1817 Ga0373935_0201381
1818 Ga0395899_0000078
1819 Ga0395899_0005833
1820 Ga0395899_0668497
1821 Ga0395899_0683208
1822 Ga0395899_1008921
1823 Ga0395900_0082284
1824 Ga0395900_0195712
1825 Ga0395900_0249092
1826 Ga0395900_0560241
1827 Ga0395900_1850502
1828 Ga0395898_0695698
1829 Ga0395898_1601238
1830 Ga0395905_0000549
1831 Ga0395905_0007900
1832 Ga0395905_0011730
1833 Ga0395905_0092664
1834 Ga0395905_0150590
1835 Ga0395905_0537645
1836 Ga0395905_1906850
1837 Ga0395901_0004460
1838 Ga0395901_0094399
1839 Ga0395901_0164294
1840 Ga0395901_0464144
1841 Ga0395901_0548664
1842 Ga0395901_1464874
1843 Ga0436361_0004974
1844 Ga0436361_0171206
1845 Ga0436361_0578689
1846 Ga0436361_0743577
1847 Ga0436361_0767937
1848 Ga0436361_1038070
1849 Ga0439465_0049368
1850 Ga0451833_0022593
1851 Ga0451853_2414847
1852 Ga0439442_092526
1853 Ga0439448_0261686
1854 Ga0439432_126317
1855 Ga0439449_0244662
1856 Ga0439450_013480
1857 Ga0439450_048323
1858 Ga0439455_0027559
1859 Ga0439455_0069102
1860 Ga0439455_0166579
1861 Ga0450921_020664
1862 Ga0450890_033574
1863 Ga0450895_019290
1864 Ga0450898_013755
1865 Ga0450904_004772
1866 Ga0439446_0168394
1867 Ga0439458_0076007
1868 Ga0439434_0057775
1869 Ga0439464_0028984
1870 Ga0466972_0005095
1871 Ga0466972_0052412
1872 Ga0466965_0043592
1873 Ga0466965_0231235
1874 Ga0466965_0247551
1875 Ga0466965_0373023
1876 Ga0466965_0595604
1877 Ga0466966_0038419
1878 Ga0466966_0978184
1879 Ga0466964_0024210
1880 Ga0466964_0087285
1881 Ga0466964_0152185
1882 Ga0466964_0242638
1883 Ga0466971_0221878
1884 Ga0466971_0240173
1885 Ga0466968_0012025
1886 Ga0466968_0207495
1887 Ga0466968_0284188
1888 Ga0466968_0327837
1889 Ga0466970_0057746
1890 Ga0466970_0232590
1891 Ga0466957_0167221
1892 Ga0466957_0233015
1893 Ga0466957_0286206
1894 Ga0466957_0983406
1895 Ga0466960_0943304
1896 Ga0466959_0204553
1897 Ga0451576_1776876
1898 Ga0466958_0896361
1899 Ga0466967_0948199
1900 Ga0466967_1169271
1901 Ga0466967_1605038
1902 Ga0466967_1689390
1903 Ga0495617_001026
1904 Ga0495617_004204
1905 Ga0495617_197794
1906 Ga0495627_026656
1907 Ga0495627_045406
1908 Ga0495592_0139781
1909 Ga0495603_0007446
1910 Ga0495603_0066125
1911 Ga0495603_0164238
1912 Ga0495603_0533480
1913 Ga0495590_0000020
1914 Ga0495590_0005309
1915 Ga0495590_0018848
1916 Ga0495590_0029266
1917 Ga0495590_0037945
1918 Ga0495590_0124562
1919 Ga0495590_0233781
1920 Ga0495590_0249208
1921 Ga0495591_008200
1922 Ga0495591_061027
1923 Ga0495629_0415305
1924 Ga0495638_0000408
1925 Ga0495638_0010010
1926 Ga0495638_0010721
1927 Ga0495638_0069655
1928 Ga0495638_0463668
1929 Ga0495651_0061481
1930 Ga0495651_0108148
1931 Ga0495653_0003544
1932 Ga0495653_0025764
1933 Ga0495653_0042103
1934 Ga0495653_0504877
1935 Ga0495650_0008022
1936 Ga0495650_0009500
1937 Ga0495650_0017326
1938 Ga0495650_0032252
1939 Ga0495650_0058728
1940 Ga0495580_0008648
1941 Ga0495580_0245555
1942 Ga0495580_0370728
1943 Ga0495580_0743097
1944 Ga0495582_0013331
1945 Ga0495582_0049936
1946 Ga0495582_0057380
1947 Ga0495605_0003232
1948 Ga0495605_0013410
1949 Ga0495605_0013696
1950 Ga0495605_0071613
1951 Ga0495605_0082794
1952 Ga0495605_0103420
1953 Ga0495605_0105953
1954 Ga0495605_0190560
1955 Ga0495605_0195503
1956 Ga0495605_0224230
1957 Ga0495639_0181988
1958 Ga0495639_0570768
1959 Ga0495584_0002812
1960 Ga0495584_0020283
1961 Ga0495584_0051866
1962 Ga0495584_0060945
1963 Ga0495584_0075775
1964 Ga0495584_0081139
1965 Ga0495584_0103631
1966 Ga0495584_0113268
1967 Ga0495584_0120831
1968 Ga0495584_0125919
1969 Ga0495584_0167318
1970 Ga0495584_0287350
1971 Ga0495584_0355186
1972 Ga0495584_0452034
1973 Ga0495584_0502519
1974 Ga0495585_0012012
1975 Ga0495585_0015837
1976 Ga0495585_0047201
1977 Ga0495585_0047852
1978 Ga0495585_0063130
1979 Ga0495585_0137156
1980 Ga0495585_0137334
1981 Ga0495585_0143002
1982 Ga0495585_0149517
1983 Ga0495585_0159448
1984 Ga0495585_0174673
1985 Ga0495585_0270942
1986 Ga0495585_0290070
1987 Ga0495585_0331337
1988 Ga0495585_0357830
1989 Ga0495585_0406997
1990 Ga0495585_0436392
1991 Ga0495585_0523948
1992 Ga0495594_0020007
1993 Ga0495594_0186729
1994 Ga0495594_0302827
1995 Ga0495594_0330178
1996 Ga0495594_0338015
1997 Ga0495594_0660763
1998 Ga0495596_0005175
1999 Ga0495596_0021654
2000 Ga0495596_0040721
2001 Ga0495596_0044056
2002 Ga0495596_0059412
2003 Ga0495596_0277946
2004 Ga0495596_0295666
2005 Ga0495596_0296545
2006 Ga0495607_0090940
2007 Ga0495607_0099837
2008 Ga0495607_0123713
2009 Ga0495607_0141517
2010 Ga0495607_0162714
2011 Ga0495607_0196673
2012 Ga0495607_0283948
2013 Ga0495607_0379756
2014 Ga0495583_0000310
2015 Ga0495583_0006309
2016 Ga0495583_0008959
2017 Ga0495583_0013755
2018 Ga0495583_0039755
2019 Ga0495583_0041060
2020 Ga0495583_0047710
2021 Ga0495583_0094961
2022 Ga0495583_0096954
2023 Ga0495583_0122294
2024 Ga0495583_0131777
2025 Ga0495583_0197012
2026 Ga0495583_0251356
2027 Ga0495606_0007181
2028 Ga0495606_0013036
2029 Ga0495606_0019502
2030 Ga0495606_0039988
2031 Ga0495606_0108118
2032 Ga0495606_0109444
2033 Ga0495606_0148706
2034 Ga0495606_0149612
2035 Ga0495606_0193919
2036 Ga0495606_0217296
2037 Ga0495606_0284940
2038 Ga0495606_0293819
2039 Ga0495606_0313019
2040 Ga0495606_0325847
2041 Ga0495606_0379068
2042 Ga0495606_0435842
2043 Ga0495606_0526404
2044 Ga0495608_0027939
2045 Ga0495608_0087527
2046 Ga0495610_0003877
2047 Ga0495610_0018155
2048 Ga0495610_0023962
2049 Ga0495610_0027750
2050 Ga0495610_0198124
2051 Ga0495610_0203181
2052 Ga0495616_0002539
2053 Ga0495616_0020539
2054 Ga0495616_0022828
2055 Ga0495616_0103362
2056 Ga0495616_0160497
2057 Ga0495616_0188240
2058 Ga0495616_0209358
2059 Ga0495616_0322294
2060 Ga0495618_0079070
2061 Ga0495618_0606092
2062 Ga0495620_0011229
2063 Ga0495628_0051980
2064 Ga0495628_0153435
2065 Ga0495630_0473133
2066 Ga0495630_0528698
2067 Ga0495631_0026738
2068 Ga0495631_0037499
2069 Ga0495631_0037577
2070 Ga0495631_0073566
2071 Ga0495631_0091500
2072 Ga0495631_0093621
2073 Ga0495631_0103090
2074 Ga0495631_0106058
2075 Ga0495631_0174114
2076 Ga0495631_0182275
2077 Ga0495631_0211047
2078 Ga0495631_0269289
2079 Ga0495632_0041954
2080 Ga0495632_0052841
2081 Ga0495632_0112463
2082 Ga0495632_0154007
2083 Ga0495632_0166880
2084 Ga0495632_0195587
2085 Ga0495637_0001714
2086 Ga0495637_0013614
2087 Ga0495637_0027010
2088 Ga0495637_0044618
2089 Ga0495637_0074308
2090 Ga0495637_0107325
2091 Ga0495637_0294839
2092 Ga0495643_0010644
2093 Ga0495643_0032093
2094 Ga0495643_0065304
2095 Ga0495643_0066699
2096 Ga0495643_0078750
2097 Ga0495643_0081093
2098 Ga0495643_0085218
2099 Ga0495643_0091504
2100 Ga0495643_0118867
2101 Ga0495643_0139286
2102 Ga0495643_0192027
2103 Ga0495643_0221022
2104 Ga0495643_0226757
2105 Ga0495644_0027051
2106 Ga0495644_0035051
2107 Ga0495644_0083860
2108 Ga0495644_0084397
2109 Ga0495644_0088545
2110 Ga0495644_0098570
2111 Ga0495644_0112630
2112 Ga0495644_0113788
2113 Ga0495644_0120039
2114 Ga0495648_0013276
2115 Ga0495648_0034037
2116 Ga0495648_0042742
2117 Ga0495648_0069259
2118 Ga0495648_0107232
2119 Ga0495648_0167280
2120 Ga0495648_0175469
2121 Ga0495648_0179256
2122 Ga0495663_0010607
2123 Ga0495663_0031792
2124 Ga0495663_0093960
2125 Ga0495663_0123673
2126 Ga0495663_0150239
2127 Ga0495663_0181453
2128 Ga0495666_0087815
2129 Ga0495666_0178036
2130 Ga0495666_0244369
2131 Ga0495666_0268240
2132 Ga0495666_0293812
2133 Ga0495642_0004349
2134 Ga0495642_0021122
2135 Ga0495642_0027378
2136 Ga0495642_0048979
2137 Ga0495642_0052249
2138 Ga0495642_0061666
2139 Ga0495642_0066277
2140 Ga0495642_0067965
2141 Ga0495642_0096136
2142 Ga0495642_0115352
2143 Ga0495642_0124442
2144 Ga0495642_0127967
2145 Ga0495642_0178962
2146 Ga0495642_0182863
2147 Ga0495642_0213288
2148 Ga0495642_0324610
2149 Ga0495652_0027829
2150 Ga0495652_0035148
2151 Ga0495652_0271463
2152 Ga0495652_0314968
2153 Ga0495652_0503440
2154 Ga0495654_0000115
2155 Ga0495654_0065073
2156 Ga0495654_0077712
2157 Ga0495654_0082162
2158 Ga0495654_0091742
2159 Ga0495654_0115950
2160 Ga0495654_0160159
2161 Ga0495654_0168280
2162 Ga0495665_0046360
2163 Ga0495665_0055908
2164 Ga0495665_0081402
2165 Ga0495665_0192065
2166 Ga0495665_0482052
2167 Ga0495640_0305576
2168 Ga0495640_0307279
2169 Ga0495586_0034290
2170 Ga0495586_0052978
2171 Ga0495586_0121477
2172 Ga0495587_0015602
2173 Ga0495587_0118398
2174 Ga0495587_0246276
2175 Ga0495587_0334153
2176 Ga0495598_0217997
2177 Ga0495598_0264374
2178 Ga0495609_0002112
2179 Ga0495609_0003741
2180 Ga0495609_0005231
2181 Ga0495609_0010718
2182 Ga0495609_0073530
2183 Ga0495609_0088916
2184 Ga0495609_0098226
2185 Ga0495609_0135374
2186 Ga0495609_0138755
2187 Ga0495609_0324097
2188 Ga0495621_0124882
2189 Ga0495621_0129299
2190 Ga0495621_0239139
2191 Ga0495597_0008648
2192 Ga0495597_0039483
2193 Ga0495597_0051584
2194 Ga0495597_0071899
2195 Ga0495597_0090026
2196 Ga0495597_0098005
2197 Ga0495597_0112166
2198 Ga0495597_0123957
2199 Ga0495597_0137308
2200 Ga0495597_0173986
2201 Ga0495597_0184857
2202 Ga0495597_0196766
2203 Ga0495645_0099543
2204 Ga0495645_0158047
2205 Ga0495645_0380992
2206 Ga0495622_0010681
2207 Ga0495622_0075497
2208 Ga0495622_0087025
2209 Ga0495622_0142933
2210 Ga0495622_0143997
2211 Ga0495622_0197854
2212 Ga0495622_0202751
2213 Ga0495622_0209861
2214 Ga0495622_0213533
2215 Ga0495633_0016754
2216 Ga0495633_0040031
2217 Ga0495633_0046083
2218 Ga0495633_0047892
2219 Ga0495633_0069829
2220 Ga0495633_0113004
2221 Ga0495633_0131615
2222 Ga0495633_0171891
2223 Ga0495633_0254752
2224 Ga0495633_0276289
2225 Ga0495633_0282116
2226 Ga0495633_0300229
2227 Ga0495633_0345992
2228 Ga0495633_0359431
2229 Ga0495667_0076074
2230 Ga0495656_0006272
2231 Ga0495656_0070784
2232 Ga0495656_0101671
2233 Ga0495656_0150503
2234 Ga0495656_0288364
2235 Ga0495656_0302232
2236 Ga0495656_0310447
2237 Ga0495668_0007707
2238 Ga0495668_0020876
2239 Ga0495668_0025580
2240 Ga0495668_0054798
2241 Ga0495668_0057793
2242 Ga0495668_0067174
2243 Ga0495668_0102990
2244 Ga0495668_0157367
2245 Ga0495668_0216198
2246 Ga0495668_0216973
2247 Ga0495668_0244514
2248 Ga0495668_0283014
2249 Ga0495668_0316831
2250 Ga0495668_0438164
2251 Ga0495668_0572655
2252 Ga0495668_0810551
2253 Ga0495634_0019079
2254 Ga0495634_0192943
2255 Ga0495611_0013452
2256 Ga0495611_0051565
2257 Ga0495611_0066175
2258 Ga0495611_0077598
2259 Ga0495611_0099340
2260 Ga0495611_0167304
2261 Ga0495611_0191501
2262 Ga0495611_0309654
2263 Ga0495625_0020104
2264 Ga0495625_0021030
2265 Ga0495625_0022675
2266 Ga0495625_0053638
2267 Ga0495625_0078068
2268 Ga0495625_0134180
2269 Ga0495625_0263877
2270 Ga0495625_0322930
2271 Ga0495625_0347986
2272 Ga0495635_0014432
2273 Ga0495635_0068579
2274 Ga0495659_0012672
2275 Ga0495659_0020773
2276 Ga0495659_0047516
2277 Ga0495659_0121116
2278 Ga0495659_0309852
2279 Ga0495659_0447522
2280 Ga0495659_0470245
2281 Ga0495661_0010669
2282 Ga0495661_0018478
2283 Ga0495661_0058552
2284 Ga0495661_0058855
2285 Ga0495661_0077557
2286 Ga0495661_0088865
2287 Ga0495661_0115856
2288 Ga0495661_0124105
2289 Ga0495661_0149912
2290 Ga0495661_0153590
2291 Ga0495661_0156350
2292 Ga0495661_0167032
2293 Ga0495661_0199840
2294 Ga0495661_0223551
2295 Ga0495661_0228249
2296 Ga0495661_0241389
2297 Ga0495661_0258570
2298 Ga0495661_0397778
2299 Ga0495661_0465733
2300 Ga0495661_0478009
2301 Ga0495661_0510115
2302 Ga0495588_0010876
2303 Ga0495588_0014904
2304 Ga0495588_0040459
2305 Ga0495588_0062419
2306 Ga0495588_0114119
2307 Ga0495588_0120582
2308 Ga0495588_0126731
2309 Ga0495588_0169163
2310 Ga0495588_0269792
2311 Ga0495588_0284320
2312 Ga0495588_0383066
2313 Ga0495588_0459929
2314 Ga0495657_0029648
2315 Ga0495657_0353281
2316 Ga0495599_0007721
2317 Ga0495599_0184025
2318 Ga0495599_0416237
2319 Ga0495623_0068842
2320 Ga0495623_0076509
2321 Ga0495623_0205957
2322 Ga0495623_0218757
2323 Ga0495623_0283811
2324 Ga0495623_0312291
2325 Ga0495623_0380325
2326 Ga0495646_0112772
2327 Ga0495646_0181463
2328 Ga0495646_0253356
2329 Ga0495646_0333161
2330 Ga0495646_0637124
2331 Ga0495658_0224387
2332 Ga0495669_0021103
2333 Ga0495669_0056751
2334 Ga0495669_0065000
2335 Ga0495669_0067620
2336 Ga0495669_0086910
2337 Ga0495669_0112795
2338 Ga0495669_0215544
2339 Ga0495669_0221649
2340 Ga0495613_0065356
2341 Ga0495613_0253770
2342 Ga0495613_0394069
2343 Ga0495624_0078632
2344 Ga0495624_0121558
2345 Ga0495624_0123298
2346 Ga0495624_0777347
2347 Ga0495670_0042081
2348 Ga0495670_0044966
2349 Ga0495670_0046118
2350 Ga0495670_0082751
2351 Ga0495670_0152880
2352 Ga0495670_0165436
2353 Ga0495670_0172779
2354 Ga0495670_0200169
2355 Ga0495670_0298224
2356 Ga0495670_0329266
2357 Ga0495670_0337191
2358 Ga0495670_0638070
2359 Ga0495671_0016693
2360 Ga0495671_0029072
2361 Ga0495671_0049468
2362 Ga0495671_0078583
2363 Ga0495671_0116767
2364 Ga0495671_0145008
2365 Ga0495671_0182117
2366 Ga0495671_0210520
2367 Ga0495671_0398155
2368 Ga0495649_0014801
2369 Ga0495649_0024341
2370 Ga0495649_0053355
2371 Ga0495649_0060727
2372 Ga0495649_0120385
2373 Ga0495649_0184805
2374 Ga0495649_0198523
2375 Ga0495649_0482298
2376 Ga0495649_0588584
2377 Ga0495589_0014565
2378 Ga0495589_0022141
2379 Ga0495589_0043731
2380 Ga0495589_0085487
2381 Ga0495589_0085914
2382 Ga0495589_0088958
2383 Ga0495589_0106067
2384 Ga0495589_0120451
2385 Ga0495589_0137014
2386 Ga0495589_0177569
2387 Ga0495589_0228246
2388 Ga0495589_0306391
2389 Ga0495589_0328935
2390 Ga0495589_0411505
2391 Ga0495600_0011381
2392 Ga0495600_0075615
2393 Ga0495600_0169292
2394 Ga0495600_0300712
2395 Ga0495660_0003674
2396 Ga0495660_0007171
2397 Ga0495660_0030863
2398 Ga0495660_0054740
2399 Ga0495660_0091402
2400 Ga0495660_0147915
2401 Ga0495660_0154468
2402 Ga0495660_0168230
2403 Ga0495660_0219733
2404 Ga0495660_0232924
2405 Ga0495660_0308179
2406 Ga0495581_0011795
2407 Ga0495581_0084029
2408 Ga0495581_0360631
2409 Ga0495581_0381506
2410 Ga0495581_0723677
2411 Ga0495604_0098589
2412 Ga0495604_0113202
2413 Ga0495604_0145750
2414 Ga0495604_0351376
2415 Ga0495604_0521019
2416 Ga0495636_0006088
2417 Ga0495636_0006698
2418 Ga0495636_0007040
2419 Ga0495636_0022781
2420 Ga0495636_0162291
2421 Ga0495636_0287990
2422 Ga0495636_0535779
2423 Ga0495674_0035014
2424 Ga0495672_0019097
2425 Ga0495672_0020418
2426 Ga0495672_0026706
2427 Ga0495672_0059705
2428 Ga0495672_0078821
2429 Ga0495672_0083387
2430 Ga0495672_0144473
2431 Ga0495672_0205361
2432 Ga0495672_0350773
2433 Ga0495676_0059819
2434 Ga0495676_0093491
2435 Ga0495676_0173448
2436 Ga0495676_0257446
2437 Ga0495676_0304389
2438 Ga0495676_0495608
2439 Ga0495680_0081403
2440 Ga0495680_0082868
2441 Ga0495680_0344851
2442 Ga0495680_0537176
2443 Ga0495683_0025191
2444 Ga0495683_0037514
2445 Ga0495683_0070704
2446 Ga0495683_0140598
2447 Ga0495683_0142576
2448 Ga0495683_0151837
2449 Ga0495683_0186374
2450 Ga0495683_0233898
2451 Ga0495683_0234859
2452 Ga0495683_0322969
2453 Ga0495683_0326250
2454 Ga0495687_000370
2455 Ga0495687_007822
2456 Ga0495687_014326
2457 Ga0495687_024856
2458 Ga0495687_029913
2459 Ga0495687_036882
2460 Ga0495687_088588
2461 Ga0495687_090810
2462 Ga0495687_097393
2463 Ga0495675_0151163
2464 Ga0495675_0229325
2465 Ga0495675_0243254
2466 Ga0495675_0361090
2467 Ga0495675_0526632
2468 Ga0495677_0006314
2469 Ga0495677_0006510
2470 Ga0495677_0026532
2471 Ga0495677_0032012
2472 Ga0495677_0043835
2473 Ga0495677_0070385
2474 Ga0495677_0085894
2475 Ga0495677_0087226
2476 Ga0495677_0089584
2477 Ga0495677_0093603
2478 Ga0495677_0097213
2479 Ga0495677_0181154
2480 Ga0495677_0215504
2481 Ga0495677_0278112
2482 Ga0495677_0280702
2483 Ga0495679_008823
2484 Ga0495679_051789
2485 Ga0495679_052553
2486 Ga0495679_061198
2487 Ga0495679_065665
2488 Ga0495679_084892
2489 Ga0495679_104770
2490 Ga0495685_001797
2491 Ga0495685_049119
2492 Ga0495685_051223
2493 Ga0495685_059807
2494 Ga0495685_096110
2495 Ga0495685_231982
2496 Ga0495685_241979
2497 Ga0495673_0000185
2498 Ga0495673_0000338
2499 Ga0495673_0002607
2500 Ga0495673_0100936
2501 Ga0495681_0018699
2502 Ga0495681_0030651
2503 Ga0495681_0061145
2504 Ga0495681_0078367
2505 Ga0495681_0106719
2506 Ga0495681_0139883
2507 Ga0495681_0152247
2508 Ga0495681_0232725
2509 Ga0495681_0271659
2510 Ga0495686_0005000
2511 Ga0495686_0041880
2512 Ga0495686_0116547
2513 Ga0495686_0121709
2514 Ga0495686_0203037
2515 Ga0495686_0452869
2516 Ga0495686_0727384
2517 Ga0495593_0012462
2518 Ga0495593_0195327
2519 Ga0495593_0374729
2520 Ga0495593_0682892
2521 Ga0495602_0058801
2522 Ga0495602_0277034
2523 Ga0495602_0734444
2524 Ga0495614_0029810
2525 Ga0495614_0060035
2526 Ga0495614_0107230
2527 Ga0495615_0020588
2528 Ga0495615_0042504
2529 Ga0495615_0078113
2530 Ga0495626_0003909
2531 Ga0495626_0010744
2532 Ga0495626_0012906
2533 Ga0495626_0016437
2534 Ga0495626_0027831
2535 Ga0495626_0032859
2536 Ga0495626_0077411
2537 Ga0495626_0080378
2538 Ga0495626_0081637
2539 Ga0495626_0125936
2540 Ga0495626_0133404
2541 Ga0495626_0345249
2542 Ga0496100_0018888
2543 Ga0496100_0632587
2544 Ga0496100_0647665
2545 Ga0496100_0972939
2546 Ga0496101_0319243
2547 Ga0496102_0068828
2548 Ga0496102_0088863
2549 Ga0496102_0137406
2550 Ga0496102_0803991
2551 Ga0496102_1070135
2552 Ga0496102_1077448
2553 Ga0496102_1348585
2554 Ga0496103_0058673
2555 Ga0496103_0070829
2556 Ga0496103_0090188
2557 Ga0496103_0091802
2558 Ga0496103_0180310
2559 Ga0496103_0419965
2560 Ga0496103_0612122
2561 Ga0496104_0178000
2562 Ga0496104_0570097
2563 Ga0496104_1134155
2564 Ga0496105_0442086
2565 Ga0496105_0534987
2566 Ga0496105_0547476
2567 Ga0496105_0952840
2568 Ga0496106_0253104
2569 Ga0496106_0535103
2570 Ga0496107_0248001
2571 Ga0496107_0398111
2572 Ga0496107_0479689
2573 Ga0496107_0860266
2574 Ga0496108_0191326
2575 Ga0496108_0599219
2576 Ga0496108_0849703
2577 Ga0496109_0072916
2578 Ga0496109_0186739
2579 Ga0496109_0783590
2580 Ga0496109_1056140
2581 Ga0496110_0080386
2582 Ga0496110_0491583
2583 Ga0496110_0690196
2584 Ga0496110_0861253
2585 Ga0496110_0936409
2586 Ga0496110_1164934
2587 Ga0496111_0091872
2588 Ga0496111_0146589
2589 Ga0496111_0521994
2590 Ga0496112_0306153
2591 Ga0496113_0099847
2592 Ga0496113_0385700
2593 Ga0496114_0022403
2594 Ga0496114_0289742
2595 Ga0496114_0438915
2596 Ga0496114_0637577
2597 Ga0496114_0641742
2598 Ga0496115_0050867
2599 Ga0496115_0221193
2600 Ga0496115_0321110
2601 Ga0496115_0801713
2602 Ga0496116_0091755
2603 Ga0496116_0253322
2604 Ga0496118_0183090
2605 Ga0496120_0124356
2606 Ga0496121_0243249
2607 Ga0496121_0329613
2608 Ga0496121_0537195
2609 Ga0496121_0676800
2610 Ga0496122_0077023
2611 Ga0496122_0109128
2612 Ga0496122_0194708
2613 Ga0496122_0426972
2614 Ga0496123_0013659
2615 Ga0496123_0031651
2616 Ga0496123_0069843
2617 Ga0496124_0106187
2618 Ga0496124_0129517
2619 Ga0496124_0132720
2620 Ga0496124_0150483
2621 Ga0496124_0323784
2622 Ga0496124_0348155
2623 Ga0496124_0355597
2624 Ga0496124_0745176
2625 Ga0496124_0787945
2626 Ga0496124_0801049
2627 Ga0496125_0021606
2628 Ga0496125_0060592
2629 Ga0496125_0063503
2630 Ga0496125_0427486
2631 Ga0496126_0031527
2632 Ga0496126_0345681
2633 Ga0496126_0708504
2634 Ga0501306_000150
2635 Ga0501306_003340
2636 Ga0501306_009215
2637 Ga0501306_058971
2638 Ga0501306_077581
2639 Ga0501306_079075
2640 Ga0501308_000398
2641 Ga0501308_002408
2642 Ga0501308_018121
2643 Ga0501309_004241
2644 Ga0501309_011386
2645 Ga0501310_001072
2646 Ga0501310_006078
2647 Ga0501310_016049
2648 Ga0501343_000533
2649 Ga0501343_007025
2650 Ga0501343_010267
2651 Ga0501304_001138
2652 Ga0501304_002860
2653 Ga0501304_005072
2654 Ga0501304_008888
2655 Ga0501305_005503
2656 Ga0501305_006325
2657 Ga0501305_028998
2658 Ga0501305_047139
2659 Ga0501305_075734
2660 Ga0501305_081335
2661 Ga0501305_082426
2662 Ga0501307_002498
2663 Ga0501307_002525
2664 Ga0501307_004154
2665 Ga0501307_004969
2666 Ga0501307_024948
2667 Ga0501307_067261
2668 Ga0495678_006998
2669 Ga0495678_025193
2670 Ga0495678_027928
2671 Ga0495678_059401
2672 Ga0495678_066094
2673 Ga0495678_069294
2674 Ga0495678_091123
2675 Ga0495678_092832
2676 Ga0495682_0063615
2677 Ga0495682_0080123
2678 Ga0495682_0124886
2679 Ga0501297_011034
2680 Ga0501311_000165
2681 Ga0501311_020593
2682 Ga0501311_023545
2683 Ga0501311_089829
2684 Ga0501312_004623
2685 Ga0501312_012905
2686 Ga0501312_025618
2687 Ga0501312_032245
2688 Ga0501312_053251
2689 Ga0501312_090417
2690 Ga0501313_000756
2691 Ga0501313_001122
2692 Ga0501314_005033
2693 Ga0501314_008905
2694 Ga0501314_021302
2695 Ga0501315_000556
2696 Ga0501315_002286
2697 Ga0501315_003217
2698 Ga0501315_003289
2699 Ga0501315_012963
2700 Ga0501315_013154
2701 Ga0501315_082020
2702 Ga0501316_000848
2703 Ga0501316_006293
2704 Ga0501316_007300
2705 Ga0501316_043078
2706 Ga0501317_016468
2707 Ga0501317_016650
2708 Ga0501317_022573
2709 Ga0501319_026436
2710 Ga0501320_003037
2711 Ga0501320_003150
2712 Ga0501320_003152
2713 Ga0501320_009090
2714 Ga0501320_009230
2715 Ga0501321_003885
2716 Ga0501321_021050
2717 Ga0501321_025452
2718 Ga0501321_026065
2719 Ga0501321_039662
2720 Ga0501322_003710
2721 Ga0501323_017947
2722 Ga0501323_038409
2723 Ga0501323_055330
2724 Ga0501323_086114
2725 Ga0501324_000146
2726 Ga0501324_032909
2727 Ga0501324_039127
2728 Ga0501325_002483
2729 Ga0501326_03837
2730 Ga0501327_07824
2731 Ga0501330_015869
2732 Ga0501334_02030
2733 Ga0501334_11604
2734 Ga0501335_016552
2735 Ga0501335_030466
2736 Ga0501336_001604
2737 Ga0501336_021445
2738 Ga0501337_003695
2739 Ga0501036_0168725
2740 Ga0501211_003467
2741 Ga0501222_052889
2742 Ga0501227_001669
2743 Ga0501233_046721
2744 Ga0501238_028740
2745 Ga0501249_011012
2746 Ga0501257_178657
2747 Ga0501234_014155
2748 Ga0501232_048342
2749 Ga0501263_009328
2750 Ga0501268_014162
2751 Ga0501268_048277
2752 Ga0501279_003775
2753 Ga0501279_014665
2754 Ga0501035_0035964
2755 Ga0501044_1175829
2756 nmdc:mga03683_124751_c1
2757 nmdc:mga03n38_79853_c1
2758 nmdc:mga0k408_362329_c1
2759 nmdc:mga07m45_367000_c1
2760 nmdc:mga07m45_95626_c1
2761 Ga0495601_0011363
2762 Ga0495655_0195039
2763 Ga0500646_0325529
2764 Ga0500594_0105109
2765 Ga0500595_081341
2766 Ga0500618_004294
2767 Ga0500621_188196
2768 Ga0500559_0112531
2769 Ga0500573_0380923
2770 Ga0500574_000852
2771 Ga0500586_092624
2772 Ga0500586_130803
2773 Ga0500619_083039
2774 Ga0500624_071695
2775 Ga0500636_0475721
2776 Ga0587084_006452
2777 Ga0587084_017124
2778 Ga0587084_027909
2779 Ga0587093_001802
2780 Ga0587093_003356
2781 Ga0587066_002048
2782 Ga0587066_025732
2783 Ga0587070_011858
2784 Ga0587070_012033
2785 Ga0587070_037857
2786 Ga0587073_0000405
2787 Ga0587073_0152513
2788 Ga0587077_008903
2789 Ga0587077_009273
2790 Ga0587080_003728
2791 Ga0587080_019330
2792 Ga0587080_053033
2793 Ga0587082_000814
2794 Ga0587082_062171
2795 Ga0587083_0032996
2796 Ga0587083_0039846
2797 Ga0587085_006188
2798 Ga0587085_013499
2799 Ga0587086_000667
2800 Ga0587086_003732
2801 Ga0587086_012653
2802 Ga0587088_000683
2803 Ga0587088_006876
2804 Ga0587088_039639
2805 Ga0587089_009849
2806 Ga0587089_018181
2807 Ga0587089_031477
2808 Ga0587090_003488
2809 Ga0587090_007045
2810 Ga0587091_002980
2811 Ga0587091_021583
2812 Ga0587092_005373
2813 Ga0587092_008921
2814 Ga0587094_002657
2815 Ga0587094_003403
2816 Ga0587094_003513
2817 Ga0587095_000862
2818 Ga0587095_001423
2819 Ga0587097_00287
2820 Ga0587097_01444
2821 Ga0587098_001919
2822 Ga0587098_028142
2823 Ga0587121_01643
2824 Ga0587125_000574
2825 Ga0587129_003518
2826 Ga0587099_005269
2827 Ga0587101_000524
2828 Ga0587101_002989
2829 Ga0587101_008422
2830 Ga0587101_033901
2831 Ga0587109_014290
2832 Ga0587109_031962
2833 Ga0587115_006225
2834 Ga0587117_015916
2835 Ga0587128_005351
2836 Ga0587128_036484
2837 Ga0587062_015555
2838 Ga0587062_016957
2839 Ga0587062_064065
2840 Ga0587068_006343
2841 Ga0587068_025778
2842 Ga0587069_000151
2843 Ga0587069_008398
2844 Ga0587072_019128
2845 Ga0587072_039981
2846 Ga0587075_002302
2847 Ga0587075_008575
2848 Ga0587076_000769
2849 Ga0587076_008880
2850 Ga0587078_021377
2851 Ga0587079_000436
2852 Ga0587079_022980
2853 Ga0587079_034095
2854 Ga0587079_037059
2855 Ga0587079_048272
2856 Ga0587100_005333
2857 Ga0587102_000673
2858 Ga0587102_001335
2859 Ga0587102_011088
2860 Ga0587104_000706
2861 Ga0587105_002305
2862 Ga0587107_008387
2863 Ga0587108_000215
2864 Ga0587110_001895
2865 Ga0587116_04152
2866 Ga0587118_02411
2867 Ga0587119_001725
2868 Ga0587119_015430
2869 Ga0587120_000930
2870 Ga0587065_06038
2871 Ga0587081_13236
2872 Ga0587096_00225
2873 Ga0587071_000779
2874 Ga0587071_015766
2875 Ga0587071_025527
2876 Ga0587071_048707
2877 Ga0587111_0002093
2878 Ga0587111_0005555
2879 Ga0587111_0006057
2880 Ga0587111_0026675
2881 Ga0587111_0080351
2882 Ga0466962_0268453
2883 2511247426
2884 2511384278
2885 2521560845
2886 2550696713
2887 2553008127
2888 2601667097
2889 2643789313
2890 2643799317
2891 2644030560
2892 2644251646
2893 2644356009
2894 2644472513
2895 2738738195
2896 2738826685
2897 2738842999
2898 2739150482
2899 2739192401
2900 2739273747
2901 2739318878
2902 2739337119
2903 2739342791
2904 2765567279
2905 2808984192
2906 2809131996
2907 2809145972
2908 2809151619
2909 2819594380
2910 2819618852
2911 2821136285
2912 2839095493
2913 2842717719
2914 2852622921
2915 2857563377
2916 2857567908
2917 2884814298
2918 2884840777
2919 2884857627
2920 2885080589
2921 2896158567
2922 2904427831
2923 2904445257
2924 2904533798
2925 2904589365
2926 2904595068
2927 2904606734
2928 2919050778
2929 2919084998
2930 2919476868
2931 2923514686
2932 2928135734
2933 2932422363
2934 8047676180

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

81

136

0.96

Map