F494148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1463 | 733 | 1235 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0310543|Ga0496102_0310543_638_1453 |
| Length | 271 |
| Sequence | LLRIFVVRWSASGDPPTFSDNDYPTSPSREEAKMSPSQFSRLSLLAAAIGAVALSALTISYSKAAEEAVIIPPPAMDVQAASGMQTAVLAGGCFWGVQGVFQHTAGVVNAVSGYAGGSKMTADYNMVSTGTTGHAESVEIKYDPKKISYGKILQIFFSVVHDPTQLNRQGPDTGTQYRSAIFTTNDEQKKVAEAYISQLNAAKVYKKPIVTKISALDAFFPAEAYHQDYLTLHPNQPYIAYNDIPKVENLKKIFAENYVEKPTLVSARVTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 14 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 15 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 16 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 17 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 26 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 31 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 32 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 33 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 34 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 35 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 36 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 37 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 38 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 39 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 40 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 41 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 42 | 2791355199 | |||
| 43 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 44 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 45 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 46 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 47 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 48 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 49 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 50 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 51 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 52 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 53 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 54 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 55 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 56 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 57 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 58 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 59 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 60 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 61 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 62 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 63 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 64 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 77 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 78 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 79 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 80 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 81 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 82 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 83 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 84 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 85 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 86 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 87 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 88 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 89 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 90 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 91 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 92 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 93 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 94 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 95 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 96 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 97 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 98 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 99 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 100 | 2904699407 | |||
| 101 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 102 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 103 | 2906610324 | |||
| 104 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 105 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 106 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 107 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 108 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 109 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 110 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 111 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 112 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 113 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 114 | 2922368715 | |||
| 115 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 119 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 120 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 121 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 122 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 123 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 124 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 125 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 126 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 127 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 128 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 129 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 130 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 131 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 132 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 133 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 134 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 135 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 136 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 137 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 138 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 139 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 140 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 141 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 142 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 143 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 144 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 145 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 146 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 147 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 148 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 149 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 150 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 151 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 152 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 153 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 154 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 155 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 156 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 157 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 158 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 159 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 160 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 161 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 162 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 163 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 164 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 165 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 166 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 177 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 178 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 179 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 180 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 181 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 182 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 183 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 184 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 185 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 186 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 187 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 188 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 189 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 190 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 191 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 192 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 193 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 194 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 195 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 196 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 197 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 198 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 199 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 200 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 201 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 202 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 203 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 204 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 205 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 206 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 207 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 208 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 209 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 210 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 211 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 213 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 214 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 215 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 216 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 217 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 218 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 219 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 220 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 221 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 223 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 230 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 232 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 233 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 240 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 243 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 248 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 252 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 253 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 254 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 255 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 260 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 265 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 267 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 268 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 269 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 270 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 271 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 272 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 273 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 274 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 275 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 276 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 277 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 278 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 279 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 280 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 281 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 283 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 284 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 285 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 286 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 287 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 288 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 289 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 290 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 291 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 292 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 293 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 295 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 296 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 297 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 298 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 299 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 300 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 301 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 302 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 303 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 305 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 315 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 316 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 329 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 332 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 334 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 335 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 336 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 337 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 338 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 339 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 340 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 341 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 342 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 343 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 344 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 345 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 346 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 347 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 352 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 353 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 356 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 357 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 360 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 362 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 364 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 420 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 421 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 422 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 423 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 427 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 431 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 432 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 433 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 434 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 435 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 436 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 437 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 438 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 439 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 440 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 441 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 442 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 443 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 444 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 445 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 446 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 447 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 448 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 449 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 450 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 451 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 452 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 453 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 454 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 455 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 456 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 457 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 458 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 459 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 460 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 461 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 462 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 463 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 464 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 465 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 466 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 467 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 468 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 469 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 470 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 471 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 472 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 473 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 474 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 475 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 476 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 477 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 478 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 479 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 480 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 481 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 482 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 483 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 484 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 485 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 486 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 487 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 488 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 489 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 490 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 491 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 492 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 493 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 494 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 495 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 496 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 497 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 498 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 499 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 500 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 501 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 576 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 577 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 578 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 579 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 580 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 581 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 582 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 583 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 584 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 585 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 586 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 587 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 588 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 589 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 590 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 591 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 592 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 593 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 594 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 595 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 596 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 597 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 598 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 599 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 600 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 601 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 602 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 615 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 621 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 622 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 625 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 626 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 628 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 630 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 632 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 633 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 634 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 635 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 636 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 637 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 638 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 639 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 640 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 641 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 642 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 643 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 644 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 647 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 650 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 651 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 652 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 653 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 654 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 655 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 656 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 657 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 658 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 659 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 660 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 661 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 662 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 663 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 664 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 665 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 666 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 667 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 668 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 669 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 670 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 671 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 672 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 673 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 674 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 675 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 676 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 677 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 678 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 679 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 680 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 681 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 682 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 683 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 684 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 685 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 686 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 687 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 688 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 689 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 690 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 691 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 692 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 693 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 694 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 695 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 696 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 697 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 698 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 699 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 700 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 701 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 702 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 703 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 704 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 705 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 706 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 707 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 708 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 709 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 710 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 711 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 712 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 713 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 714 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 715 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 716 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 717 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 718 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 719 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 720 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 721 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 722 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 723 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 724 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 725 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 726 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 727 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 728 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 729 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 730 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 731 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 732 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 733 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.26 |
| Metatranscriptomes | 1.51 |
| Isolates | 15.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.92 |
| Nodule | 11.21 |
| Rhizoplane | 6.02 |
| Rhizosphere | 58.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1006154 | 3300000549 | Bacteria | 1502 |
| 2 | JGI24740J21852_10000767 | 3300001979 | Bacteria | 14071 |
| 3 | JGI25155J39150_1000198 | 3300002704 | Bacteria | 25200 |
| 4 | JGI25155J39150_1000408 | 3300002704 | Bacteria | 11785 |
| 5 | JGI25156J39149_1000057 | 3300002705 | Bacteria | 86392 |
| 6 | JGI25156J39149_1002321 | 3300002705 | Bacteria | 6937 |
| 7 | JGI25162J39368_1000277 | 3300002737 | Bacteria | 48696 |
| 8 | JGI25162J39368_1003686 | 3300002737 | Bacteria | 4182 |
| 9 | JGI25154J39366_1000087 | 3300002738 | Bacteria | 86392 |
| 10 | JGI25154J39366_1000925 | 3300002738 | Bacteria | 12344 |
| 11 | JGI25157J39369_1000336 | 3300002741 | Bacteria | 33359 |
| 12 | JGI25152J39213_1002781 | 3300002773 | Bacteria | 6332 |
| 13 | JGI25159J45721_1001498 | 3300002987 | Bacteria | 9580 |
| 14 | Ga0006778J45830_1005206 | 3300003162 | Bacteria | 1262 |
| 15 | Ga0006778J45830_1037934 | 3300003162 | Bacteria | 857 |
| 16 | JGI25406J46586_10000042 | 3300003203 | Bacteria | 56211 |
| 17 | JGI25406J46586_10001462 | 3300003203 | Bacteria | 11132 |
| 18 | JGI25406J46586_10029632 | 3300003203 | Bacteria | 2068 |
| 19 | JGI25165J46597_1003489 | 3300003214 | Bacteria | 3875 |
| 20 | JGI25165J46597_1004533 | 3300003214 | Bacteria | 2945 |
| 21 | JGI25153J46596_10001736 | 3300003215 | Bacteria | 12940 |
| 22 | JGI25153J46596_10003826 | 3300003215 | Bacteria | 8296 |
| 23 | JGI25153J46596_10004140 | 3300003215 | Bacteria | 7883 |
| 24 | JGI25153J46596_10005975 | 3300003215 | Bacteria | 6266 |
| 25 | JGI25153J46596_10011700 | 3300003215 | Bacteria | 3855 |
| 26 | JGI25153J46596_10038013 | 3300003215 | Bacteria | 1523 |
| 27 | JGI25160J50197_1002670 | 3300003354 | Bacteria | 8209 |
| 28 | JGI25160J50197_1009335 | 3300003354 | Bacteria | 3650 |
| 29 | JGI25160J50197_1029710 | 3300003354 | Bacteria | 1439 |
| 30 | Ga0007417J51691_1021109 | 3300003544 | Bacteria | 964 |
| 31 | Ga0006781J51513_1004680 | 3300003568 | Bacteria | 1226 |
| 32 | Ga0007410J51695_1023793 | 3300003574 | Bacteria | 830 |
| 33 | Ga0007416J51690_1011819 | 3300003577 | Bacteria | 1234 |
| 34 | Ga0007429J51699_1006648 | 3300003579 | Bacteria | 1228 |
| 35 | JGI25404J52841_10016701 | 3300003659 | Bacteria | 1592 |
| 36 | JGI25404J52841_10027496 | 3300003659 | Bacteria | 1223 |
| 37 | JGI25404J52841_10058120 | 3300003659 | Bacteria | 811 |
| 38 | Ga0032354_1001469 | 3300003693 | Bacteria | 1355 |
| 39 | Ga0006780_1000642 | 3300003735 | Bacteria | 777 |
| 40 | Ga0055539_1013566 | 3300003752 | Bacteria | 998 |
| 41 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 42 | Ga0055524_1029581 | 3300003775 | Bacteria | 1616 |
| 43 | Ga0055528_1008660 | 3300003790 | Bacteria | 4325 |
| 44 | Ga0055531_10006809 | 3300003794 | Bacteria | 6380 |
| 45 | JGI25405J52794_10040334 | 3300003911 | Bacteria | 987 |
| 46 | Ga0055543_1005069 | 3300004625 | Bacteria | 3434 |
| 47 | Ga0058859_11354442 | 3300004798 | Bacteria | 939 |
| 48 | Ga0058861_12010056 | 3300004800 | Bacteria | 1175 |
| 49 | Ga0065165_1001376 | 3300005262 | Bacteria | 26733 |
| 50 | Ga0065165_1003381 | 3300005262 | Bacteria | 11283 |
| 51 | Ga0065165_1006721 | 3300005262 | Bacteria | 5908 |
| 52 | Ga0065165_1042564 | 3300005262 | Bacteria | 1339 |
| 53 | Ga0070683_100353009 | 3300005329 | Bacteria | 1400 |
| 54 | Ga0070670_100166969 | 3300005331 | Bacteria | 1909 |
| 55 | Ga0070677_10027820 | 3300005333 | Bacteria | 2131 |
| 56 | Ga0070666_10091775 | 3300005335 | Bacteria | 2087 |
| 57 | Ga0070666_10546164 | 3300005335 | Bacteria | 843 |
| 58 | Ga0070680_100011514 | 3300005336 | Bacteria | 6846 |
| 59 | Ga0070680_100088017 | 3300005336 | Bacteria | 2568 |
| 60 | Ga0070680_100308636 | 3300005336 | Bacteria | 1342 |
| 61 | Ga0070682_100025295 | 3300005337 | Bacteria | 3541 |
| 62 | Ga0068868_100117433 | 3300005338 | Bacteria | 2167 |
| 63 | Ga0068868_100288646 | 3300005338 | Bacteria | 1390 |
| 64 | Ga0068868_100504877 | 3300005338 | Bacteria | 1060 |
| 65 | Ga0070660_100359116 | 3300005339 | Bacteria | 1200 |
| 66 | Ga0070691_10062835 | 3300005341 | Bacteria | 1789 |
| 67 | Ga0070687_100241257 | 3300005343 | Bacteria | 1118 |
| 68 | Ga0070661_100238131 | 3300005344 | Bacteria | 1400 |
| 69 | Ga0070661_100353940 | 3300005344 | Bacteria | 1153 |
| 70 | Ga0070668_100027694 | 3300005347 | Bacteria | 4302 |
| 71 | Ga0070668_100034676 | 3300005347 | Bacteria | 3846 |
| 72 | Ga0070668_100273988 | 3300005347 | Bacteria | 1407 |
| 73 | Ga0070668_100312648 | 3300005347 | Bacteria | 1320 |
| 74 | Ga0070669_100141703 | 3300005353 | Bacteria | 1854 |
| 75 | Ga0070671_100045130 | 3300005355 | Bacteria | 3663 |
| 76 | Ga0070671_100070957 | 3300005355 | Bacteria | 2907 |
| 77 | Ga0070671_100200942 | 3300005355 | Bacteria | 1690 |
| 78 | Ga0070671_100273068 | 3300005355 | Bacteria | 1437 |
| 79 | Ga0070671_100640921 | 3300005355 | Bacteria | 920 |
| 80 | Ga0070674_100097673 | 3300005356 | Bacteria | 2133 |
| 81 | Ga0070673_100769279 | 3300005364 | Bacteria | 887 |
| 82 | Ga0070688_100013583 | 3300005365 | Bacteria | 4597 |
| 83 | Ga0070688_100154951 | 3300005365 | Bacteria | 1569 |
| 84 | Ga0070659_100052884 | 3300005366 | Bacteria | 3195 |
| 85 | Ga0070659_100214544 | 3300005366 | Bacteria | 1587 |
| 86 | Ga0070659_100330430 | 3300005366 | Bacteria | 1276 |
| 87 | Ga0070659_100519196 | 3300005366 | Bacteria | 1017 |
| 88 | Ga0070659_100691825 | 3300005366 | Bacteria | 881 |
| 89 | Ga0070667_100125652 | 3300005367 | Bacteria | 2235 |
| 90 | Ga0070709_10005526 | 3300005434 | Bacteria | 6844 |
| 91 | Ga0070709_10010952 | 3300005434 | Bacteria | 5037 |
| 92 | Ga0070709_10058749 | 3300005434 | Bacteria | 2440 |
| 93 | Ga0070709_10171116 | 3300005434 | Bacteria | 1518 |
| 94 | Ga0070714_100002233 | 3300005435 | Bacteria | 14249 |
| 95 | Ga0070714_100081991 | 3300005435 | Bacteria | 2809 |
| 96 | Ga0070714_100156494 | 3300005435 | Bacteria | 2058 |
| 97 | Ga0070714_100220629 | 3300005435 | Bacteria | 1742 |
| 98 | Ga0070713_100004820 | 3300005436 | Bacteria | 9135 |
| 99 | Ga0070713_100058748 | 3300005436 | Bacteria | 3209 |
| 100 | Ga0070713_100071226 | 3300005436 | Bacteria | 2937 |
| 101 | Ga0070713_100097470 | 3300005436 | Bacteria | 2541 |
| 102 | Ga0070713_100130356 | 3300005436 | Bacteria | 2216 |
| 103 | Ga0070713_100170583 | 3300005436 | Bacteria | 1949 |
| 104 | Ga0070710_10000549 | 3300005437 | Bacteria | 17726 |
| 105 | Ga0070711_100007048 | 3300005439 | Bacteria | 6817 |
| 106 | Ga0070711_100017942 | 3300005439 | Bacteria | 4511 |
| 107 | Ga0070711_100069372 | 3300005439 | Bacteria | 2480 |
| 108 | Ga0070700_100069003 | 3300005441 | Bacteria | 2249 |
| 109 | Ga0070663_100010930 | 3300005455 | Bacteria | 5673 |
| 110 | Ga0070663_100067660 | 3300005455 | Bacteria | 2592 |
| 111 | Ga0070663_100148879 | 3300005455 | Bacteria | 1793 |
| 112 | Ga0070663_100326240 | 3300005455 | Bacteria | 1236 |
| 113 | Ga0070663_100422958 | 3300005455 | Bacteria | 1093 |
| 114 | Ga0070678_100041320 | 3300005456 | Bacteria | 3268 |
| 115 | Ga0070678_100047311 | 3300005456 | Bacteria | 3090 |
| 116 | Ga0070678_100568549 | 3300005456 | Bacteria | 1008 |
| 117 | Ga0070662_100084819 | 3300005457 | Bacteria | 2367 |
| 118 | Ga0070662_100712441 | 3300005457 | Bacteria | 849 |
| 119 | Ga0070681_10087634 | 3300005458 | Bacteria | 3065 |
| 120 | Ga0070681_10295193 | 3300005458 | Bacteria | 1531 |
| 121 | Ga0068867_100952356 | 3300005459 | Bacteria | 775 |
| 122 | Ga0070685_10168476 | 3300005466 | Bacteria | 1402 |
| 123 | Ga0070685_10336700 | 3300005466 | Bacteria | 1028 |
| 124 | Ga0070706_100158402 | 3300005467 | Bacteria | 2114 |
| 125 | Ga0070707_100033994 | 3300005468 | Bacteria | 4863 |
| 126 | Ga0070707_100581791 | 3300005468 | Bacteria | 1082 |
| 127 | Ga0070699_100149816 | 3300005518 | Bacteria | 2063 |
| 128 | Ga0070684_100010958 | 3300005535 | Bacteria | 7208 |
| 129 | Ga0070697_100320031 | 3300005536 | Bacteria | 1336 |
| 130 | Ga0070697_100729571 | 3300005536 | Bacteria | 875 |
| 131 | Ga0068853_100011007 | 3300005539 | Bacteria | 7336 |
| 132 | Ga0068853_100387662 | 3300005539 | Bacteria | 1306 |
| 133 | Ga0068853_100540120 | 3300005539 | Bacteria | 1103 |
| 134 | Ga0070672_100219817 | 3300005543 | Bacteria | 1593 |
| 135 | Ga0070696_100086014 | 3300005546 | Bacteria | 2232 |
| 136 | Ga0070693_100372648 | 3300005547 | Bacteria | 983 |
| 137 | Ga0070665_100014804 | 3300005548 | Bacteria | 7830 |
| 138 | Ga0070665_100016255 | 3300005548 | Bacteria | 7465 |
| 139 | Ga0070665_100026397 | 3300005548 | Bacteria | 5850 |
| 140 | Ga0070665_100082234 | 3300005548 | Bacteria | 3226 |
| 141 | Ga0070665_100143198 | 3300005548 | Bacteria | 2394 |
| 142 | Ga0070665_100148314 | 3300005548 | Bacteria | 2348 |
| 143 | Ga0070665_100153970 | 3300005548 | Bacteria | 2301 |
| 144 | Ga0070665_100161902 | 3300005548 | Bacteria | 2239 |
| 145 | Ga0070665_100171758 | 3300005548 | Bacteria | 2169 |
| 146 | Ga0070665_100524084 | 3300005548 | Bacteria | 1197 |
| 147 | Ga0068855_100045608 | 3300005563 | Bacteria | 5184 |
| 148 | Ga0068855_100059386 | 3300005563 | Bacteria | 4475 |
| 149 | Ga0068855_100103063 | 3300005563 | Bacteria | 3284 |
| 150 | Ga0068855_100155264 | 3300005563 | Bacteria | 2601 |
| 151 | Ga0068855_100235166 | 3300005563 | Bacteria | 2049 |
| 152 | Ga0068855_100291329 | 3300005563 | Bacteria | 1809 |
| 153 | Ga0070664_100122248 | 3300005564 | Bacteria | 2280 |
| 154 | Ga0070664_100291013 | 3300005564 | Bacteria | 1475 |
| 155 | Ga0068857_100049570 | 3300005577 | Bacteria | 3725 |
| 156 | Ga0068857_100178355 | 3300005577 | Bacteria | 1933 |
| 157 | Ga0068854_100151272 | 3300005578 | Bacteria | 1790 |
| 158 | Ga0068854_100201872 | 3300005578 | Bacteria | 1563 |
| 159 | Ga0068856_100003313 | 3300005614 | Bacteria | 16364 |
| 160 | Ga0068856_100131687 | 3300005614 | Bacteria | 2506 |
| 161 | Ga0068856_100188069 | 3300005614 | Bacteria | 2079 |
| 162 | Ga0068856_100425696 | 3300005614 | Bacteria | 1347 |
| 163 | Ga0068856_100552487 | 3300005614 | Bacteria | 1173 |
| 164 | Ga0068852_100038969 | 3300005616 | Bacteria | 3998 |
| 165 | Ga0068852_100246511 | 3300005616 | Bacteria | 1710 |
| 166 | Ga0068852_100835030 | 3300005616 | Bacteria | 936 |
| 167 | Ga0068864_100069542 | 3300005618 | Bacteria | 3061 |
| 168 | Ga0068866_10111408 | 3300005718 | Bacteria | 1528 |
| 169 | Ga0068861_100168874 | 3300005719 | Bacteria | 1811 |
| 170 | Ga0068851_10011299 | 3300005834 | Bacteria | 4185 |
| 171 | Ga0068851_10244567 | 3300005834 | Bacteria | 1016 |
| 172 | Ga0068863_100267222 | 3300005841 | Bacteria | 1655 |
| 173 | Ga0068863_100301418 | 3300005841 | Bacteria | 1555 |
| 174 | Ga0068863_100390284 | 3300005841 | Bacteria | 1360 |
| 175 | Ga0068858_100073088 | 3300005842 | Bacteria | 3183 |
| 176 | Ga0068858_100094941 | 3300005842 | Bacteria | 2778 |
| 177 | Ga0068858_100476957 | 3300005842 | Bacteria | 1204 |
| 178 | Ga0068860_100000534 | 3300005843 | Bacteria | 46465 |
| 179 | Ga0068860_100153346 | 3300005843 | Bacteria | 2219 |
| 180 | Ga0068860_101072146 | 3300005843 | Bacteria | 825 |
| 181 | Ga0068862_100105017 | 3300005844 | Bacteria | 2476 |
| 182 | Ga0081455_10000815 | 3300005937 | Bacteria | 40097 |
| 183 | Ga0081455_10012165 | 3300005937 | Bacteria | 8597 |
| 184 | Ga0081455_10022180 | 3300005937 | Bacteria | 5941 |
| 185 | Ga0081540_1003580 | 3300005983 | Bacteria | 12204 |
| 186 | Ga0081540_1004327 | 3300005983 | Bacteria | 10875 |
| 187 | Ga0081540_1008358 | 3300005983 | Bacteria | 7233 |
| 188 | Ga0081540_1010413 | 3300005983 | Bacteria | 6302 |
| 189 | Ga0081540_1011157 | 3300005983 | Bacteria | 6030 |
| 190 | Ga0081540_1011347 | 3300005983 | Bacteria | 5960 |
| 191 | Ga0081540_1087692 | 3300005983 | Bacteria | 1378 |
| 192 | Ga0081540_1110169 | 3300005983 | Bacteria | 1166 |
| 193 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 194 | Ga0081539_10000958 | 3300005985 | Bacteria | 54105 |
| 195 | Ga0081539_10030928 | 3300005985 | Bacteria | 3310 |
| 196 | Ga0081539_10128426 | 3300005985 | Bacteria | 1249 |
| 197 | Ga0070717_10000884 | 3300006028 | Bacteria | 19823 |
| 198 | Ga0070717_10003176 | 3300006028 | Bacteria | 11737 |
| 199 | Ga0070717_10063343 | 3300006028 | Bacteria | 3068 |
| 200 | Ga0070717_10791037 | 3300006028 | Bacteria | 863 |
| 201 | Ga0075365_10000529 | 3300006038 | Bacteria | 14696 |
| 202 | Ga0075365_10059515 | 3300006038 | Bacteria | 2546 |
| 203 | Ga0075368_10195728 | 3300006042 | Bacteria | 854 |
| 204 | Ga0075363_100013678 | 3300006048 | Bacteria | 3944 |
| 205 | Ga0075363_100025950 | 3300006048 | Bacteria | 2994 |
| 206 | Ga0075363_100049181 | 3300006048 | Bacteria | 2244 |
| 207 | Ga0075364_10031891 | 3300006051 | Bacteria | 3385 |
| 208 | Ga0075364_10054185 | 3300006051 | Bacteria | 2623 |
| 209 | Ga0075364_10121089 | 3300006051 | Bacteria | 1751 |
| 210 | Ga0070715_10001749 | 3300006163 | Bacteria | 6464 |
| 211 | Ga0070716_100005320 | 3300006173 | Bacteria | 6223 |
| 212 | Ga0070716_100033588 | 3300006173 | Bacteria | 2807 |
| 213 | Ga0070716_100141225 | 3300006173 | Bacteria | 1536 |
| 214 | Ga0070716_100434674 | 3300006173 | Bacteria | 953 |
| 215 | Ga0070712_100024654 | 3300006175 | Bacteria | 3989 |
| 216 | Ga0070712_100857464 | 3300006175 | Bacteria | 782 |
| 217 | Ga0075362_10025311 | 3300006177 | Bacteria | 2525 |
| 218 | Ga0075362_10028330 | 3300006177 | Bacteria | 2405 |
| 219 | Ga0075362_10047595 | 3300006177 | Bacteria | 1910 |
| 220 | Ga0075367_10011261 | 3300006178 | Bacteria | 4725 |
| 221 | Ga0075367_10028491 | 3300006178 | Bacteria | 3186 |
| 222 | Ga0075367_10037617 | 3300006178 | Bacteria | 2813 |
| 223 | Ga0075367_10058666 | 3300006178 | Bacteria | 2290 |
| 224 | Ga0075367_10195637 | 3300006178 | Bacteria | 1262 |
| 225 | Ga0075369_10009378 | 3300006186 | Bacteria | 3801 |
| 226 | Ga0075369_10021528 | 3300006186 | Bacteria | 2651 |
| 227 | Ga0075369_10061887 | 3300006186 | Bacteria | 1634 |
| 228 | Ga0075366_10036160 | 3300006195 | Bacteria | 2911 |
| 229 | Ga0075366_10053729 | 3300006195 | Bacteria | 2393 |
| 230 | Ga0097621_100078434 | 3300006237 | Bacteria | 2744 |
| 231 | Ga0097621_100192342 | 3300006237 | Bacteria | 1767 |
| 232 | Ga0075370_10006177 | 3300006353 | Bacteria | 6008 |
| 233 | Ga0075370_10043189 | 3300006353 | Bacteria | 2547 |
| 234 | Ga0075370_10043400 | 3300006353 | Bacteria | 2541 |
| 235 | Ga0075370_10080200 | 3300006353 | Bacteria | 1875 |
| 236 | Ga0075370_10292859 | 3300006353 | Bacteria | 967 |
| 237 | Ga0068871_100050386 | 3300006358 | Bacteria | 3368 |
| 238 | Ga0068871_100347315 | 3300006358 | Bacteria | 1311 |
| 239 | Ga0075434_100006045 | 3300006871 | Bacteria | 11068 |
| 240 | Ga0099824_1013868 | 3300006942 | Bacteria | 8216 |
| 241 | Ga0099822_1054877 | 3300006943 | Bacteria | 1499 |
| 242 | Ga0099823_1032665 | 3300006944 | Bacteria | 4222 |
| 243 | Ga0099795_10024287 | 3300007788 | Bacteria | 2020 |
| 244 | Ga0099795_10029257 | 3300007788 | Bacteria | 1881 |
| 245 | Ga0105250_10071291 | 3300009092 | Bacteria | 1403 |
| 246 | Ga0105240_10000497 | 3300009093 | Bacteria | 72381 |
| 247 | Ga0105240_10025997 | 3300009093 | Bacteria | 7688 |
| 248 | Ga0105240_10042855 | 3300009093 | Bacteria | 5765 |
| 249 | Ga0105240_10098710 | 3300009093 | Bacteria | 3556 |
| 250 | Ga0105240_10146636 | 3300009093 | Bacteria | 2816 |
| 251 | Ga0105240_10339230 | 3300009093 | Bacteria | 1708 |
| 252 | Ga0105240_10574421 | 3300009093 | Bacteria | 1244 |
| 253 | Ga0105240_10619226 | 3300009093 | Bacteria | 1190 |
| 254 | Ga0111539_10004709 | 3300009094 | Bacteria | 17828 |
| 255 | Ga0111539_10392146 | 3300009094 | Bacteria | 1617 |
| 256 | Ga0105245_10025310 | 3300009098 | Bacteria | 5218 |
| 257 | Ga0105247_10137117 | 3300009101 | Bacteria | 1599 |
| 258 | Ga0105247_10363603 | 3300009101 | Bacteria | 1021 |
| 259 | Ga0105247_10490616 | 3300009101 | Bacteria | 893 |
| 260 | Ga0114129_10419060 | 3300009147 | Bacteria | 1761 |
| 261 | Ga0114129_10431581 | 3300009147 | Bacteria | 1731 |
| 262 | Ga0114129_11129443 | 3300009147 | Bacteria | 980 |
| 263 | Ga0114129_11206551 | 3300009147 | Bacteria | 942 |
| 264 | Ga0105243_10088252 | 3300009148 | Bacteria | 2548 |
| 265 | Ga0105241_10050926 | 3300009174 | Bacteria | 3157 |
| 266 | Ga0105242_10237267 | 3300009176 | Bacteria | 1637 |
| 267 | Ga0105242_10406877 | 3300009176 | Bacteria | 1271 |
| 268 | Ga0105248_10030134 | 3300009177 | Bacteria | 6056 |
| 269 | Ga0105248_10110038 | 3300009177 | Bacteria | 3106 |
| 270 | Ga0105248_10113191 | 3300009177 | Bacteria | 3060 |
| 271 | Ga0105237_10031990 | 3300009545 | Bacteria | 5328 |
| 272 | Ga0105237_10033065 | 3300009545 | Bacteria | 5239 |
| 273 | Ga0105237_10040649 | 3300009545 | Bacteria | 4689 |
| 274 | Ga0105237_10041954 | 3300009545 | Bacteria | 4614 |
| 275 | Ga0105237_10049749 | 3300009545 | Bacteria | 4212 |
| 276 | Ga0105237_10072458 | 3300009545 | Bacteria | 3438 |
| 277 | Ga0105237_10150599 | 3300009545 | Bacteria | 2323 |
| 278 | Ga0105237_10159053 | 3300009545 | Bacteria | 2257 |
| 279 | Ga0105237_10442143 | 3300009545 | Bacteria | 1306 |
| 280 | Ga0105238_10016659 | 3300009551 | Bacteria | 7445 |
| 281 | Ga0105238_10030444 | 3300009551 | Bacteria | 5494 |
| 282 | Ga0105238_10047369 | 3300009551 | Bacteria | 4335 |
| 283 | Ga0105238_10071229 | 3300009551 | Bacteria | 3474 |
| 284 | Ga0105238_10108125 | 3300009551 | Bacteria | 2762 |
| 285 | Ga0105238_10112637 | 3300009551 | Bacteria | 2700 |
| 286 | Ga0105238_10128331 | 3300009551 | Bacteria | 2514 |
| 287 | Ga0105238_10178649 | 3300009551 | Bacteria | 2099 |
| 288 | Ga0105238_10292697 | 3300009551 | Bacteria | 1611 |
| 289 | Ga0105249_10135725 | 3300009553 | Bacteria | 2354 |
| 290 | Ga0105249_10281311 | 3300009553 | Bacteria | 1662 |
| 291 | Ga0105249_11109305 | 3300009553 | Bacteria | 861 |
| 292 | Ga0123342_1013414 | 3300009766 | Bacteria | 8227 |
| 293 | Ga0099796_10008189 | 3300010159 | Bacteria | 2775 |
| 294 | Ga0099796_10047758 | 3300010159 | Bacteria | 1474 |
| 295 | Ga0105239_10144608 | 3300010375 | Bacteria | 2651 |
| 296 | Ga0105239_10567219 | 3300010375 | Bacteria | 1293 |
| 297 | Ga0105246_10062381 | 3300011119 | Bacteria | 2597 |
| 298 | Ga0105246_10280332 | 3300011119 | Bacteria | 1337 |
| 299 | Ga0105246_10297578 | 3300011119 | Bacteria | 1301 |
| 300 | Ga0157371_10024676 | 3300013102 | Bacteria | 4387 |
| 301 | Ga0157371_10100896 | 3300013102 | Bacteria | 2047 |
| 302 | Ga0157370_10017035 | 3300013104 | Bacteria | 7343 |
| 303 | Ga0157370_10029467 | 3300013104 | Bacteria | 5385 |
| 304 | Ga0157370_10230358 | 3300013104 | Bacteria | 1715 |
| 305 | Ga0157369_10013948 | 3300013105 | Bacteria | 9081 |
| 306 | Ga0157369_10014664 | 3300013105 | Bacteria | 8843 |
| 307 | Ga0157369_10026923 | 3300013105 | Bacteria | 6377 |
| 308 | Ga0157374_10007888 | 3300013296 | Bacteria | 9089 |
| 309 | Ga0157374_10022044 | 3300013296 | Bacteria | 5677 |
| 310 | Ga0157374_10047182 | 3300013296 | Bacteria | 3993 |
| 311 | Ga0157374_10347474 | 3300013296 | Bacteria | 1473 |
| 312 | Ga0157374_10752030 | 3300013296 | Bacteria | 989 |
| 313 | Ga0157378_10007047 | 3300013297 | Bacteria | 9813 |
| 314 | Ga0163162_10315157 | 3300013306 | Bacteria | 1697 |
| 315 | Ga0163162_10420843 | 3300013306 | Bacteria | 1468 |
| 316 | Ga0163162_10521253 | 3300013306 | Bacteria | 1318 |
| 317 | Ga0163162_10588232 | 3300013306 | Bacteria | 1240 |
| 318 | Ga0163162_10709274 | 3300013306 | Bacteria | 1127 |
| 319 | Ga0157372_10078452 | 3300013307 | Bacteria | 3731 |
| 320 | Ga0157372_10108336 | 3300013307 | Bacteria | 3179 |
| 321 | Ga0157372_10272871 | 3300013307 | Bacteria | 1966 |
| 322 | Ga0157375_10016901 | 3300013308 | Bacteria | 6572 |
| 323 | Ga0157375_10119355 | 3300013308 | Bacteria | 2745 |
| 324 | Ga0157375_10174904 | 3300013308 | Bacteria | 2296 |
| 325 | Ga0163163_10000003 | 3300014325 | Bacteria | 455102 |
| 326 | Ga0163163_10033749 | 3300014325 | Bacteria | 4953 |
| 327 | Ga0163163_10252399 | 3300014325 | Bacteria | 1814 |
| 328 | Ga0163163_10341237 | 3300014325 | Bacteria | 1553 |
| 329 | Ga0163163_10878467 | 3300014325 | Bacteria | 960 |
| 330 | Ga0157380_10858932 | 3300014326 | Bacteria | 930 |
| 331 | Ga0182008_10001323 | 3300014497 | Bacteria | 16876 |
| 332 | Ga0182008_10061172 | 3300014497 | Bacteria | 1856 |
| 333 | Ga0157379_10789002 | 3300014968 | Bacteria | 896 |
| 334 | Ga0157376_10109424 | 3300014969 | Bacteria | 2429 |
| 335 | Ga0157376_10590605 | 3300014969 | Bacteria | 1104 |
| 336 | Ga0182006_1087717 | 3300015261 | Bacteria | 1124 |
| 337 | Ga0163161_10071147 | 3300017792 | Bacteria | 2545 |
| 338 | Ga0163161_10245265 | 3300017792 | Bacteria | 1395 |
| 339 | Ga0197907_11028214 | 3300020069 | Bacteria | 1562 |
| 340 | Ga0197907_11371172 | 3300020069 | Bacteria | 1108 |
| 341 | Ga0206356_10790464 | 3300020070 | Bacteria | 1424 |
| 342 | Ga0206350_11646629 | 3300020080 | Bacteria | 1677 |
| 343 | Ga0206354_10070692 | 3300020081 | Bacteria | 947 |
| 344 | Ga0206354_10138454 | 3300020081 | Bacteria | 1087 |
| 345 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 346 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 347 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 348 | Ga0214543_1000564 | 3300021327 | Bacteria | 63531 |
| 349 | Ga0213874_10013003 | 3300021377 | Bacteria | 2147 |
| 350 | Ga0213874_10078758 | 3300021377 | Bacteria | 1064 |
| 351 | Ga0213874_10103166 | 3300021377 | Bacteria | 951 |
| 352 | Ga0213876_10046146 | 3300021384 | Bacteria | 2304 |
| 353 | Ga0213876_10086955 | 3300021384 | Bacteria | 1654 |
| 354 | Ga0213875_10097599 | 3300021388 | Bacteria | 1371 |
| 355 | Ga0213871_10016627 | 3300021441 | Bacteria | 1777 |
| 356 | Ga0224712_10030820 | 3300022467 | Bacteria | 1940 |
| 357 | Ga0224712_10064366 | 3300022467 | Bacteria | 1471 |
| 358 | Ga0224712_10070990 | 3300022467 | Bacteria | 1414 |
| 359 | Ga0224712_10139776 | 3300022467 | Bacteria | 1065 |
| 360 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 361 | Ga0209435_100038 | 3300025206 | Bacteria | 120273 |
| 362 | Ga0209435_100096 | 3300025206 | Bacteria | 38561 |
| 363 | Ga0207672_1002024 | 3300025223 | Bacteria | 1297 |
| 364 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 365 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 366 | Ga0209258_100210 | 3300025242 | Bacteria | 117131 |
| 367 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 368 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 369 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 370 | Ga0209677_101880 | 3300025253 | Bacteria | 8513 |
| 371 | Ga0209677_106176 | 3300025253 | Bacteria | 2910 |
| 372 | Ga0209148_1000900 | 3300025254 | Bacteria | 20229 |
| 373 | Ga0209148_1004037 | 3300025254 | Bacteria | 3745 |
| 374 | Ga0209148_1023204 | 3300025254 | Bacteria | 990 |
| 375 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 376 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 377 | Ga0209129_1001529 | 3300025258 | Bacteria | 12772 |
| 378 | Ga0209233_1001052 | 3300025261 | Bacteria | 11545 |
| 379 | Ga0209233_1001098 | 3300025261 | Bacteria | 11109 |
| 380 | Ga0209233_1003397 | 3300025261 | Bacteria | 5614 |
| 381 | Ga0209233_1003422 | 3300025261 | Bacteria | 5592 |
| 382 | Ga0209455_1001412 | 3300025272 | Bacteria | 10889 |
| 383 | Ga0209455_1004740 | 3300025272 | Bacteria | 4367 |
| 384 | Ga0209455_1004957 | 3300025272 | Bacteria | 4224 |
| 385 | Ga0209673_1002499 | 3300025273 | Bacteria | 12641 |
| 386 | Ga0209673_1015590 | 3300025273 | Bacteria | 2877 |
| 387 | Ga0209025_1019148 | 3300025294 | Bacteria | 3824 |
| 388 | Ga0209564_1003825 | 3300025295 | Bacteria | 9742 |
| 389 | Ga0209564_1012222 | 3300025295 | Bacteria | 3761 |
| 390 | Ga0209564_1015496 | 3300025295 | Bacteria | 3094 |
| 391 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 392 | Ga0209758_1001188 | 3300025297 | Bacteria | 32870 |
| 393 | Ga0209758_1001605 | 3300025297 | Bacteria | 25827 |
| 394 | Ga0209758_1002945 | 3300025297 | Bacteria | 16357 |
| 395 | Ga0209758_1004134 | 3300025297 | Bacteria | 12396 |
| 396 | Ga0209758_1006083 | 3300025297 | Bacteria | 8879 |
| 397 | Ga0209758_1012239 | 3300025297 | Bacteria | 4826 |
| 398 | Ga0209256_1003962 | 3300025299 | Bacteria | 9737 |
| 399 | Ga0209256_1013127 | 3300025299 | Bacteria | 3100 |
| 400 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 401 | Ga0207426_1000447 | 3300025302 | Bacteria | 66140 |
| 402 | Ga0207426_1003427 | 3300025302 | Bacteria | 8639 |
| 403 | Ga0207426_1004280 | 3300025302 | Bacteria | 7069 |
| 404 | Ga0209257_1001262 | 3300025304 | Bacteria | 31134 |
| 405 | Ga0209257_1064884 | 3300025304 | Bacteria | 980 |
| 406 | Ga0207656_10020378 | 3300025321 | Bacteria | 2636 |
| 407 | Ga0207692_10001489 | 3300025898 | Bacteria | 8788 |
| 408 | Ga0207642_10143416 | 3300025899 | Bacteria | 1262 |
| 409 | Ga0207688_10090991 | 3300025901 | Bacteria | 1752 |
| 410 | Ga0207647_10019007 | 3300025904 | Bacteria | 4629 |
| 411 | Ga0207647_10095057 | 3300025904 | Bacteria | 1774 |
| 412 | Ga0207647_10128573 | 3300025904 | Bacteria | 1490 |
| 413 | Ga0207647_10186038 | 3300025904 | Bacteria | 1205 |
| 414 | Ga0207647_10215618 | 3300025904 | Bacteria | 1107 |
| 415 | Ga0207647_10249166 | 3300025904 | Bacteria | 1019 |
| 416 | Ga0207685_10003252 | 3300025905 | Bacteria | 3918 |
| 417 | Ga0207699_10006246 | 3300025906 | Bacteria | 5754 |
| 418 | Ga0207699_10035636 | 3300025906 | Bacteria | 2832 |
| 419 | Ga0207699_10412455 | 3300025906 | Bacteria | 963 |
| 420 | Ga0207645_10146099 | 3300025907 | Bacteria | 1542 |
| 421 | Ga0207654_10194396 | 3300025911 | Bacteria | 1332 |
| 422 | Ga0207707_10000827 | 3300025912 | Bacteria | 30384 |
| 423 | Ga0207707_10002566 | 3300025912 | Bacteria | 16278 |
| 424 | Ga0207707_10427961 | 3300025912 | Bacteria | 1134 |
| 425 | Ga0207695_10001268 | 3300025913 | Bacteria | 42942 |
| 426 | Ga0207695_10034685 | 3300025913 | Bacteria | 5483 |
| 427 | Ga0207695_10217169 | 3300025913 | Bacteria | 1820 |
| 428 | Ga0207695_10284239 | 3300025913 | Bacteria | 1548 |
| 429 | Ga0207671_10035618 | 3300025914 | Bacteria | 3692 |
| 430 | Ga0207671_10072431 | 3300025914 | Bacteria | 2572 |
| 431 | Ga0207671_10096180 | 3300025914 | Bacteria | 2237 |
| 432 | Ga0207671_10098760 | 3300025914 | Bacteria | 2209 |
| 433 | Ga0207671_10411173 | 3300025914 | Bacteria | 1076 |
| 434 | Ga0207693_10000565 | 3300025915 | Bacteria | 33481 |
| 435 | Ga0207693_10038353 | 3300025915 | Bacteria | 3774 |
| 436 | Ga0207693_10047306 | 3300025915 | Bacteria | 3380 |
| 437 | Ga0207693_10300721 | 3300025915 | Bacteria | 1257 |
| 438 | Ga0207663_10003532 | 3300025916 | Bacteria | 7669 |
| 439 | Ga0207663_10180633 | 3300025916 | Bacteria | 1507 |
| 440 | Ga0207663_10184937 | 3300025916 | Bacteria | 1491 |
| 441 | Ga0207663_10248595 | 3300025916 | Bacteria | 1308 |
| 442 | Ga0207663_10388809 | 3300025916 | Bacteria | 1064 |
| 443 | Ga0207660_10001934 | 3300025917 | Bacteria | 13823 |
| 444 | Ga0207660_10312940 | 3300025917 | Bacteria | 1252 |
| 445 | Ga0207662_10107841 | 3300025918 | Bacteria | 1733 |
| 446 | Ga0207657_10001315 | 3300025919 | Bacteria | 26383 |
| 447 | Ga0207657_10058186 | 3300025919 | Bacteria | 3327 |
| 448 | Ga0207657_10238645 | 3300025919 | Bacteria | 1452 |
| 449 | Ga0207652_10001089 | 3300025921 | Bacteria | 24596 |
| 450 | Ga0207652_10483385 | 3300025921 | Bacteria | 1115 |
| 451 | Ga0207646_10105609 | 3300025922 | Bacteria | 2526 |
| 452 | Ga0207694_10013374 | 3300025924 | Bacteria | 6181 |
| 453 | Ga0207694_10057271 | 3300025924 | Bacteria | 3029 |
| 454 | Ga0207694_10100380 | 3300025924 | Bacteria | 2293 |
| 455 | Ga0207694_10150477 | 3300025924 | Bacteria | 1875 |
| 456 | Ga0207694_10166699 | 3300025924 | Bacteria | 1782 |
| 457 | Ga0207650_10050383 | 3300025925 | Bacteria | 3079 |
| 458 | Ga0207650_10395791 | 3300025925 | Bacteria | 1143 |
| 459 | Ga0207650_10554119 | 3300025925 | Bacteria | 964 |
| 460 | Ga0207687_10216949 | 3300025927 | Bacteria | 1504 |
| 461 | Ga0207687_10261905 | 3300025927 | Bacteria | 1379 |
| 462 | Ga0207700_10001452 | 3300025928 | Bacteria | 13448 |
| 463 | Ga0207700_10003591 | 3300025928 | Bacteria | 9036 |
| 464 | Ga0207700_10074358 | 3300025928 | Bacteria | 2628 |
| 465 | Ga0207664_10027347 | 3300025929 | Bacteria | 4323 |
| 466 | Ga0207664_10076768 | 3300025929 | Bacteria | 2705 |
| 467 | Ga0207664_10372061 | 3300025929 | Bacteria | 1267 |
| 468 | Ga0207644_10098349 | 3300025931 | Bacteria | 2193 |
| 469 | Ga0207644_10195260 | 3300025931 | Bacteria | 1594 |
| 470 | Ga0207644_10300355 | 3300025931 | Bacteria | 1294 |
| 471 | Ga0207644_10360358 | 3300025931 | Bacteria | 1183 |
| 472 | Ga0207690_10047179 | 3300025932 | Bacteria | 2857 |
| 473 | Ga0207686_10423105 | 3300025934 | Bacteria | 1019 |
| 474 | Ga0207709_10127840 | 3300025935 | Bacteria | 1727 |
| 475 | Ga0207670_10133607 | 3300025936 | Bacteria | 1821 |
| 476 | Ga0207670_10314499 | 3300025936 | Bacteria | 1230 |
| 477 | Ga0207669_10259432 | 3300025937 | Bacteria | 1299 |
| 478 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 479 | Ga0207665_10029628 | 3300025939 | Bacteria | 3617 |
| 480 | Ga0207665_10154968 | 3300025939 | Bacteria | 1643 |
| 481 | Ga0207665_10174494 | 3300025939 | Bacteria | 1554 |
| 482 | Ga0207691_10077623 | 3300025940 | Bacteria | 2991 |
| 483 | Ga0207691_10198264 | 3300025940 | Bacteria | 1748 |
| 484 | Ga0207711_10114332 | 3300025941 | Bacteria | 2403 |
| 485 | Ga0207711_10127907 | 3300025941 | Bacteria | 2274 |
| 486 | Ga0207711_10786049 | 3300025941 | Bacteria | 887 |
| 487 | Ga0207689_10070761 | 3300025942 | Bacteria | 2866 |
| 488 | Ga0207661_10001422 | 3300025944 | Bacteria | 16129 |
| 489 | Ga0207661_10122812 | 3300025944 | Bacteria | 2213 |
| 490 | Ga0207661_10235943 | 3300025944 | Bacteria | 1621 |
| 491 | Ga0207679_10589751 | 3300025945 | Bacteria | 1000 |
| 492 | Ga0207667_10012575 | 3300025949 | Bacteria | 9738 |
| 493 | Ga0207667_10072969 | 3300025949 | Bacteria | 3567 |
| 494 | Ga0207667_10147895 | 3300025949 | Bacteria | 2418 |
| 495 | Ga0207667_10166711 | 3300025949 | Bacteria | 2264 |
| 496 | Ga0207667_10679273 | 3300025949 | Bacteria | 1033 |
| 497 | Ga0207712_10057465 | 3300025961 | Bacteria | 2745 |
| 498 | Ga0207712_10093050 | 3300025961 | Bacteria | 2224 |
| 499 | Ga0207712_10177224 | 3300025961 | Bacteria | 1671 |
| 500 | Ga0207668_10117877 | 3300025972 | Bacteria | 2004 |
| 501 | Ga0207668_10186470 | 3300025972 | Bacteria | 1640 |
| 502 | Ga0207640_10334363 | 3300025981 | Bacteria | 1211 |
| 503 | Ga0207658_10044511 | 3300025986 | Bacteria | 3232 |
| 504 | Ga0207658_10093331 | 3300025986 | Bacteria | 2340 |
| 505 | Ga0207677_10038365 | 3300026023 | Bacteria | 3140 |
| 506 | Ga0207677_10369299 | 3300026023 | Bacteria | 1208 |
| 507 | Ga0207703_10104559 | 3300026035 | Bacteria | 2406 |
| 508 | Ga0207639_10038223 | 3300026041 | Bacteria | 3569 |
| 509 | Ga0207639_10169613 | 3300026041 | Bacteria | 1847 |
| 510 | Ga0207639_10631308 | 3300026041 | Bacteria | 990 |
| 511 | Ga0207639_10943170 | 3300026041 | Bacteria | 807 |
| 512 | Ga0207678_10037444 | 3300026067 | Bacteria | 4218 |
| 513 | Ga0207678_10085373 | 3300026067 | Bacteria | 2698 |
| 514 | Ga0207678_10110846 | 3300026067 | Bacteria | 2341 |
| 515 | Ga0207678_10120047 | 3300026067 | Bacteria | 2243 |
| 516 | Ga0207708_10269013 | 3300026075 | Bacteria | 1378 |
| 517 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 518 | Ga0207702_10411177 | 3300026078 | Bacteria | 1306 |
| 519 | Ga0207641_10186155 | 3300026088 | Bacteria | 1905 |
| 520 | Ga0207641_10346921 | 3300026088 | Bacteria | 1414 |
| 521 | Ga0207641_10455359 | 3300026088 | Bacteria | 1237 |
| 522 | Ga0207648_10026143 | 3300026089 | Bacteria | 5191 |
| 523 | Ga0207648_10094964 | 3300026089 | Bacteria | 2607 |
| 524 | Ga0207674_10021123 | 3300026116 | Bacteria | 7018 |
| 525 | Ga0207674_10147250 | 3300026116 | Bacteria | 2313 |
| 526 | Ga0207675_100021098 | 3300026118 | Bacteria | 6070 |
| 527 | Ga0207675_100033884 | 3300026118 | Bacteria | 4759 |
| 528 | Ga0207675_100125057 | 3300026118 | Bacteria | 2436 |
| 529 | Ga0207683_10042552 | 3300026121 | Bacteria | 3967 |
| 530 | Ga0207683_10043308 | 3300026121 | Bacteria | 3934 |
| 531 | Ga0207683_10106205 | 3300026121 | Bacteria | 2511 |
| 532 | Ga0207683_10307777 | 3300026121 | Bacteria | 1450 |
| 533 | Ga0207683_10381410 | 3300026121 | Bacteria | 1296 |
| 534 | Ga0207683_10569160 | 3300026121 | Bacteria | 1048 |
| 535 | Ga0207698_10103666 | 3300026142 | Bacteria | 2365 |
| 536 | Ga0207698_10503482 | 3300026142 | Bacteria | 1179 |
| 537 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 538 | Ga0209389_1000086 | 3300027296 | Bacteria | 84925 |
| 539 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 540 | Ga0209489_100313 | 3300027361 | Bacteria | 85507 |
| 541 | Ga0209489_105143 | 3300027361 | Bacteria | 23183 |
| 542 | Ga0209700_100483 | 3300027363 | Bacteria | 74857 |
| 543 | Ga0209179_1001603 | 3300027512 | Bacteria | 2832 |
| 544 | Ga0209588_1005183 | 3300027671 | Bacteria | 3720 |
| 545 | Ga0209813_10073923 | 3300027866 | Bacteria | 1114 |
| 546 | Ga0207428_10000153 | 3300027907 | Bacteria | 94107 |
| 547 | Ga0207428_10098549 | 3300027907 | Bacteria | 2262 |
| 548 | Ga0268266_10001864 | 3300028379 | Bacteria | 23828 |
| 549 | Ga0268266_10006918 | 3300028379 | Bacteria | 10320 |
| 550 | Ga0268266_10014519 | 3300028379 | Bacteria | 6770 |
| 551 | Ga0268266_10062975 | 3300028379 | Bacteria | 3202 |
| 552 | Ga0268266_10317439 | 3300028379 | Bacteria | 1457 |
| 553 | Ga0268265_10218137 | 3300028380 | Bacteria | 1667 |
| 554 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 555 | Ga0268264_10067965 | 3300028381 | Bacteria | 3009 |
| 556 | Ga0268264_10155104 | 3300028381 | Bacteria | 2057 |
| 557 | Ga0265326_10059103 | 3300028558 | Bacteria | 1084 |
| 558 | Ga0265334_10024228 | 3300028573 | Bacteria | 2464 |
| 559 | Ga0265334_10090418 | 3300028573 | Bacteria | 1117 |
| 560 | Ga0265323_10002822 | 3300028653 | Bacteria | 7819 |
| 561 | Ga0265336_10005738 | 3300028666 | Bacteria | 4542 |
| 562 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 563 | Ga0307515_10009381 | 3300028794 | Bacteria | 18936 |
| 564 | Ga0265338_10001016 | 3300028800 | Bacteria | 47131 |
| 565 | Ga0265339_10001394 | 3300031249 | Bacteria | 17992 |
| 566 | Ga0265339_10054450 | 3300031249 | Bacteria | 2173 |
| 567 | Ga0265331_10102459 | 3300031250 | Bacteria | 1316 |
| 568 | Ga0307513_10153193 | 3300031456 | Bacteria | 2210 |
| 569 | Ga0307513_10648399 | 3300031456 | Bacteria | 763 |
| 570 | Ga0307408_100447596 | 3300031548 | Bacteria | 1120 |
| 571 | Ga0307508_10000063 | 3300031616 | Bacteria | 122536 |
| 572 | Ga0307508_10144279 | 3300031616 | Bacteria | 1985 |
| 573 | Ga0307508_10162486 | 3300031616 | Bacteria | 1837 |
| 574 | Ga0265314_10002593 | 3300031711 | Bacteria | 18286 |
| 575 | Ga0265314_10157186 | 3300031711 | Bacteria | 1387 |
| 576 | Ga0265342_10063479 | 3300031712 | Bacteria | 2171 |
| 577 | Ga0265342_10146097 | 3300031712 | Bacteria | 1316 |
| 578 | Ga0307516_10035746 | 3300031730 | Bacteria | 4980 |
| 579 | Ga0316045_107024 | 3300031815 | Bacteria | 1398 |
| 580 | Ga0307412_10231177 | 3300031911 | Bacteria | 1424 |
| 581 | Ga0307416_100721809 | 3300032002 | Bacteria | 1087 |
| 582 | Ga0307411_10102847 | 3300032005 | Bacteria | 2025 |
| 583 | Ga0307507_10033915 | 3300033179 | Bacteria | 5289 |
| 584 | Ga0307510_10047759 | 3300033180 | Bacteria | 4579 |
| 585 | Ga0307510_10067650 | 3300033180 | Bacteria | 3594 |
| 586 | Ga0307510_10079158 | 3300033180 | Bacteria | 3207 |
| 587 | Ga0307510_10179327 | 3300033180 | Bacteria | 1684 |
| 588 | Ga0315911_1000041 | 3300033442 | Bacteria | 50391 |
| 589 | Ga0373926_0055251 | 3300035083 | Bacteria | 1439 |
| 590 | Ga0373934_0016039 | 3300035086 | Bacteria | 2846 |
| 591 | Ga0373944_0038867 | 3300035089 | Bacteria | 1463 |
| 592 | Ga0373923_0079043 | 3300035111 | Bacteria | 1424 |
| 593 | Ga0373932_0038755 | 3300035112 | Bacteria | 1364 |
| 594 | Ga0373936_0008700 | 3300035113 | Bacteria | 3822 |
| 595 | Ga0373945_0097535 | 3300035116 | Bacteria | 1146 |
| 596 | Ga0373953_0011700 | 3300035117 | Bacteria | 3089 |
| 597 | Ga0373953_0017203 | 3300035117 | Bacteria | 2653 |
| 598 | Ga0373954_0002485 | 3300035118 | Bacteria | 7734 |
| 599 | Ga0373954_0002626 | 3300035118 | Bacteria | 7566 |
| 600 | Ga0373956_0064383 | 3300035119 | Bacteria | 1664 |
| 601 | Ga0373956_0108293 | 3300035119 | Bacteria | 1292 |
| 602 | Ga0373957_0007070 | 3300035120 | Bacteria | 3571 |
| 603 | Ga0373957_0202208 | 3300035120 | Bacteria | 828 |
| 604 | Ga0373960_0132965 | 3300035121 | Bacteria | 836 |
| 605 | Ga0373943_0023109 | 3300035170 | Bacteria | 2888 |
| 606 | Ga0373943_0033966 | 3300035170 | Bacteria | 2432 |
| 607 | Ga0373943_0169966 | 3300035170 | Bacteria | 1192 |
| 608 | Ga0373946_0079414 | 3300035171 | Bacteria | 1433 |
| 609 | Ga0373955_0003095 | 3300035172 | Bacteria | 7279 |
| 610 | Ga0373955_0029659 | 3300035172 | Bacteria | 2847 |
| 611 | Ga0373924_0007214 | 3300035410 | Bacteria | 4006 |
| 612 | Ga0373924_0011253 | 3300035410 | Bacteria | 3319 |
| 613 | Ga0373924_0144945 | 3300035410 | Bacteria | 1037 |
| 614 | Ga0373931_0045065 | 3300035691 | Bacteria | 2328 |
| 615 | Ga0373931_0464179 | 3300035691 | Bacteria | 812 |
| 616 | Ga0373935_0002137 | 3300035692 | Bacteria | 11210 |
| 617 | Ga0373935_0032712 | 3300035692 | Bacteria | 3232 |
| 618 | Ga0373935_0048301 | 3300035692 | Bacteria | 2694 |
| 619 | Ga0373935_0213405 | 3300035692 | Bacteria | 1338 |
| 620 | Ga0373927_0012355 | 3300035695 | Bacteria | 5683 |
| 621 | Ga0373927_0017005 | 3300035695 | Bacteria | 4792 |
| 622 | Ga0373927_0019441 | 3300035695 | Bacteria | 4454 |
| 623 | Ga0373927_0026674 | 3300035695 | Bacteria | 3776 |
| 624 | Ga0373927_0062498 | 3300035695 | Bacteria | 2408 |
| 625 | Ga0373927_0096048 | 3300035695 | Bacteria | 1926 |
| 626 | Ga0373927_0174958 | 3300035695 | Bacteria | 1408 |
| 627 | Ga0373933_0001835 | 3300035724 | Bacteria | 12297 |
| 628 | Ga0373933_0006528 | 3300035724 | Bacteria | 6352 |
| 629 | Ga0373933_0009573 | 3300035724 | Bacteria | 5291 |
| 630 | Ga0373933_0342226 | 3300035724 | Bacteria | 971 |
| 631 | Ga0373947_0033072 | 3300035725 | Bacteria | 3051 |
| 632 | Ga0373947_0054441 | 3300035725 | Bacteria | 2414 |
| 633 | Ga0373947_0066850 | 3300035725 | Bacteria | 2194 |
| 634 | Ga0373947_0159889 | 3300035725 | Bacteria | 1456 |
| 635 | Ga0373947_0275424 | 3300035725 | Bacteria | 1118 |
| 636 | Ga0373937_0089606 | 3300036401 | Bacteria | 2848 |
| 637 | Ga0373937_0232745 | 3300036401 | Bacteria | 1735 |
| 638 | Ga0373937_0798680 | 3300036401 | Bacteria | 891 |
| 639 | Ga0373925_0001877 | 3300037068 | Bacteria | 17454 |
| 640 | Ga0373925_0023145 | 3300037068 | Bacteria | 4533 |
| 641 | Ga0373925_0802946 | 3300037068 | Bacteria | 776 |
| 642 | Ga0395899_0050606 | 3300037312 | Bacteria | 3084 |
| 643 | Ga0395900_0009563 | 3300037418 | Bacteria | 9940 |
| 644 | Ga0395900_0025652 | 3300037418 | Bacteria | 6033 |
| 645 | Ga0395900_0226917 | 3300037418 | Bacteria | 1880 |
| 646 | Ga0395900_0502955 | 3300037418 | Bacteria | 1162 |
| 647 | Ga0395898_0040500 | 3300037466 | Bacteria | 4607 |
| 648 | Ga0395898_0051337 | 3300037466 | Bacteria | 4033 |
| 649 | Ga0395905_0005393 | 3300037471 | Bacteria | 13071 |
| 650 | Ga0436364_0322463 | 3300037853 | Bacteria | 1089 |
| 651 | Ga0436364_0421012 | 3300037853 | Bacteria | 2309 |
| 652 | Ga0395901_0180976 | 3300038443 | Bacteria | 2211 |
| 653 | Ga0395901_0437762 | 3300038443 | Bacteria | 1339 |
| 654 | Ga0436365_0108820 | 3300039437 | Bacteria | 5042 |
| 655 | Ga0436365_1361824 | 3300039437 | Bacteria | 1130 |
| 656 | Ga0436365_1936582 | 3300039437 | Bacteria | 2513 |
| 657 | Ga0436360_0582206 | 3300039438 | Bacteria | 8464 |
| 658 | Ga0436360_0620676 | 3300039438 | Bacteria | 2483 |
| 659 | Ga0436360_0701610 | 3300039438 | Bacteria | 2116 |
| 660 | Ga0436361_0568203 | 3300039447 | Bacteria | 1775 |
| 661 | Ga0436361_0657147 | 3300039447 | Bacteria | 3201 |
| 662 | Ga0436361_0757415 | 3300039447 | Bacteria | 3485 |
| 663 | Ga0436363_0158762 | 3300039450 | Bacteria | 1733 |
| 664 | Ga0436363_0665946 | 3300039450 | Bacteria | 1683 |
| 665 | Ga0436363_0827034 | 3300039450 | Bacteria | 9035 |
| 666 | Ga0436363_1336752 | 3300039450 | Bacteria | 955 |
| 667 | Ga0436363_1697773 | 3300039450 | Bacteria | 3701 |
| 668 | Ga0436362_0336193 | 3300039453 | Bacteria | 1827 |
| 669 | Ga0439465_0072875 | 3300041413 | Bacteria | 1153 |
| 670 | Ga0451802_0169913 | 3300041460 | Bacteria | 1324 |
| 671 | Ga0450918_020862 | 3300042531 | Bacteria | 1145 |
| 672 | Ga0451577_1064199 | 3300042876 | Bacteria | 725 |
| 673 | Ga0466972_0000268 | 3300044658 | Bacteria | 33053 |
| 674 | Ga0466972_0010885 | 3300044658 | Bacteria | 4564 |
| 675 | Ga0466972_0232184 | 3300044658 | Bacteria | 863 |
| 676 | Ga0466966_0052188 | 3300044684 | Bacteria | 2598 |
| 677 | Ga0466961_0000311 | 3300044693 | Bacteria | 32320 |
| 678 | Ga0466961_0042051 | 3300044693 | Bacteria | 2930 |
| 679 | Ga0466963_0454104 | 3300044694 | Bacteria | 904 |
| 680 | Ga0466971_0274903 | 3300044719 | Bacteria | 805 |
| 681 | Ga0466968_0002021 | 3300044735 | Bacteria | 7381 |
| 682 | Ga0466970_0012632 | 3300044765 | Bacteria | 4321 |
| 683 | Ga0466970_0186319 | 3300044765 | Bacteria | 1152 |
| 684 | Ga0466970_0353401 | 3300044765 | Bacteria | 834 |
| 685 | Ga0466960_0010159 | 3300044901 | Bacteria | 3904 |
| 686 | Ga0466959_0045853 | 3300045049 | Bacteria | 3218 |
| 687 | Ga0466959_0052297 | 3300045049 | Bacteria | 2992 |
| 688 | Ga0466959_0126327 | 3300045049 | Bacteria | 1815 |
| 689 | Ga0466959_0450840 | 3300045049 | Bacteria | 872 |
| 690 | Ga0451576_0015673 | 3300045051 | Bacteria | 8391 |
| 691 | Ga0466967_0016558 | 3300045976 | Bacteria | 5819 |
| 692 | Ga0466967_0082354 | 3300045976 | Bacteria | 2908 |
| 693 | Ga0466967_0262376 | 3300045976 | Bacteria | 1653 |
| 694 | Ga0466967_0353595 | 3300045976 | Bacteria | 1422 |
| 695 | Ga0495617_005474 | 3300046452 | Bacteria | 4498 |
| 696 | Ga0495592_0006884 | 3300046454 | Bacteria | 8491 |
| 697 | Ga0495592_0080289 | 3300046454 | Bacteria | 2360 |
| 698 | Ga0495592_0151879 | 3300046454 | Bacteria | 1601 |
| 699 | Ga0495603_0003074 | 3300046455 | Bacteria | 9910 |
| 700 | Ga0495603_0005432 | 3300046455 | Bacteria | 7608 |
| 701 | Ga0495603_0062571 | 3300046455 | Bacteria | 2197 |
| 702 | Ga0495603_0083049 | 3300046455 | Bacteria | 1876 |
| 703 | Ga0495603_0129051 | 3300046455 | Bacteria | 1473 |
| 704 | Ga0495603_0232934 | 3300046455 | Bacteria | 1061 |
| 705 | Ga0495629_0000532 | 3300046459 | Bacteria | 31675 |
| 706 | Ga0495629_0000913 | 3300046459 | Bacteria | 23749 |
| 707 | Ga0495629_0013169 | 3300046459 | Bacteria | 5971 |
| 708 | Ga0495638_0017480 | 3300046460 | Bacteria | 4777 |
| 709 | Ga0495638_0022023 | 3300046460 | Bacteria | 4188 |
| 710 | Ga0495641_0008153 | 3300046461 | Bacteria | 6432 |
| 711 | Ga0495651_0018793 | 3300046462 | Bacteria | 5354 |
| 712 | Ga0495651_0052377 | 3300046462 | Bacteria | 3144 |
| 713 | Ga0495651_0068600 | 3300046462 | Bacteria | 2703 |
| 714 | Ga0495651_0149459 | 3300046462 | Bacteria | 1686 |
| 715 | Ga0495651_0150046 | 3300046462 | Bacteria | 1681 |
| 716 | Ga0495651_0302379 | 3300046462 | Bacteria | 1072 |
| 717 | Ga0495653_0010069 | 3300046463 | Bacteria | 7734 |
| 718 | Ga0495653_0166213 | 3300046463 | Bacteria | 1527 |
| 719 | Ga0495650_0110791 | 3300046471 | Bacteria | 1020 |
| 720 | Ga0495580_0041291 | 3300046472 | Bacteria | 3290 |
| 721 | Ga0495580_0056230 | 3300046472 | Bacteria | 2771 |
| 722 | Ga0495582_0000331 | 3300046473 | Bacteria | 25765 |
| 723 | Ga0495582_0169322 | 3300046473 | Bacteria | 1243 |
| 724 | Ga0495605_0059800 | 3300046474 | Bacteria | 1829 |
| 725 | Ga0495605_0161109 | 3300046474 | Bacteria | 996 |
| 726 | Ga0495605_0216166 | 3300046474 | Bacteria | 830 |
| 727 | Ga0495639_0000147 | 3300046475 | Bacteria | 36171 |
| 728 | Ga0495639_0184197 | 3300046475 | Bacteria | 1017 |
| 729 | Ga0495662_0000716 | 3300046476 | Bacteria | 15801 |
| 730 | Ga0495662_0136179 | 3300046476 | Bacteria | 1208 |
| 731 | Ga0495664_0004013 | 3300046477 | Bacteria | 8034 |
| 732 | Ga0495664_0005574 | 3300046477 | Bacteria | 6920 |
| 733 | Ga0495664_0036527 | 3300046477 | Bacteria | 2896 |
| 734 | Ga0495664_0038112 | 3300046477 | Bacteria | 2837 |
| 735 | Ga0495664_0270126 | 3300046477 | Bacteria | 1028 |
| 736 | Ga0495594_0000113 | 3300046499 | Bacteria | 38231 |
| 737 | Ga0495594_0291170 | 3300046499 | Bacteria | 930 |
| 738 | Ga0495607_0165028 | 3300046501 | Bacteria | 1122 |
| 739 | Ga0495583_0090772 | 3300046506 | Bacteria | 1315 |
| 740 | Ga0495606_0005723 | 3300046507 | Bacteria | 11754 |
| 741 | Ga0495608_0004537 | 3300046511 | Bacteria | 9921 |
| 742 | Ga0495608_0009049 | 3300046511 | Bacteria | 6966 |
| 743 | Ga0495608_0077014 | 3300046511 | Bacteria | 2171 |
| 744 | Ga0495610_0031207 | 3300046512 | Bacteria | 2782 |
| 745 | Ga0495610_0038063 | 3300046512 | Bacteria | 2443 |
| 746 | Ga0495610_0129064 | 3300046512 | Bacteria | 1099 |
| 747 | Ga0495618_0010718 | 3300046514 | Bacteria | 5551 |
| 748 | Ga0495618_0016158 | 3300046514 | Bacteria | 4562 |
| 749 | Ga0495618_0059962 | 3300046514 | Bacteria | 2412 |
| 750 | Ga0495620_0044370 | 3300046515 | Bacteria | 1932 |
| 751 | Ga0495620_0119015 | 3300046515 | Bacteria | 1042 |
| 752 | Ga0495628_0001092 | 3300046516 | Bacteria | 24748 |
| 753 | Ga0495628_0062677 | 3300046516 | Bacteria | 2914 |
| 754 | Ga0495628_0206105 | 3300046516 | Bacteria | 1480 |
| 755 | Ga0495628_0239962 | 3300046516 | Bacteria | 1356 |
| 756 | Ga0495628_0245717 | 3300046516 | Bacteria | 1337 |
| 757 | Ga0495630_0004274 | 3300046517 | Bacteria | 10018 |
| 758 | Ga0495630_0096705 | 3300046517 | Bacteria | 2232 |
| 759 | Ga0495630_0579363 | 3300046517 | Bacteria | 860 |
| 760 | Ga0495631_0025217 | 3300046518 | Bacteria | 2740 |
| 761 | Ga0495632_0096435 | 3300046519 | Bacteria | 1397 |
| 762 | Ga0495632_0111837 | 3300046519 | Bacteria | 1282 |
| 763 | Ga0495637_0031199 | 3300046520 | Bacteria | 2359 |
| 764 | Ga0495643_0036114 | 3300046522 | Bacteria | 2717 |
| 765 | Ga0495643_0191416 | 3300046522 | Bacteria | 987 |
| 766 | Ga0495643_0201458 | 3300046522 | Bacteria | 955 |
| 767 | Ga0495648_0000776 | 3300046524 | Bacteria | 34006 |
| 768 | Ga0495648_0001514 | 3300046524 | Bacteria | 22778 |
| 769 | Ga0495648_0111763 | 3300046524 | Bacteria | 1485 |
| 770 | Ga0495642_0032875 | 3300046528 | Bacteria | 2083 |
| 771 | Ga0495652_0021351 | 3300046529 | Bacteria | 5758 |
| 772 | Ga0495652_0031369 | 3300046529 | Bacteria | 4655 |
| 773 | Ga0495652_0073625 | 3300046529 | Bacteria | 2843 |
| 774 | Ga0495652_0150525 | 3300046529 | Bacteria | 1819 |
| 775 | Ga0495652_0275783 | 3300046529 | Bacteria | 1234 |
| 776 | Ga0495654_0147632 | 3300046530 | Bacteria | 1042 |
| 777 | Ga0495665_0000291 | 3300046531 | Bacteria | 25361 |
| 778 | Ga0495665_0017301 | 3300046531 | Bacteria | 3878 |
| 779 | Ga0495640_0005851 | 3300046533 | Bacteria | 9760 |
| 780 | Ga0495640_0032424 | 3300046533 | Bacteria | 3722 |
| 781 | Ga0495640_0050334 | 3300046533 | Bacteria | 2870 |
| 782 | Ga0495640_0051488 | 3300046533 | Bacteria | 2830 |
| 783 | Ga0495587_0007337 | 3300046536 | Bacteria | 7146 |
| 784 | Ga0495587_0018944 | 3300046536 | Bacteria | 4265 |
| 785 | Ga0495587_0021240 | 3300046536 | Bacteria | 4003 |
| 786 | Ga0495587_0054532 | 3300046536 | Bacteria | 2356 |
| 787 | Ga0495598_0042422 | 3300046537 | Bacteria | 1335 |
| 788 | Ga0495609_0072648 | 3300046538 | Bacteria | 1510 |
| 789 | Ga0495597_0133670 | 3300046542 | Bacteria | 1027 |
| 790 | Ga0495645_0006636 | 3300046543 | Bacteria | 8039 |
| 791 | Ga0495645_0006977 | 3300046543 | Bacteria | 7853 |
| 792 | Ga0495645_0037792 | 3300046543 | Bacteria | 3520 |
| 793 | Ga0495622_0004379 | 3300046557 | Bacteria | 6576 |
| 794 | Ga0495622_0009802 | 3300046557 | Bacteria | 4429 |
| 795 | Ga0495633_0139616 | 3300046558 | Bacteria | 1120 |
| 796 | Ga0495667_0014817 | 3300046559 | Bacteria | 5269 |
| 797 | Ga0495667_0038192 | 3300046559 | Bacteria | 3198 |
| 798 | Ga0495667_0063781 | 3300046559 | Bacteria | 2411 |
| 799 | Ga0495667_0158948 | 3300046559 | Bacteria | 1454 |
| 800 | Ga0495667_0338480 | 3300046559 | Bacteria | 951 |
| 801 | Ga0495668_0053955 | 3300046616 | Bacteria | 2222 |
| 802 | Ga0495668_0216692 | 3300046616 | Bacteria | 1048 |
| 803 | Ga0495634_0003174 | 3300046642 | Bacteria | 13304 |
| 804 | Ga0495634_0011850 | 3300046642 | Bacteria | 6337 |
| 805 | Ga0495634_0226375 | 3300046642 | Bacteria | 1152 |
| 806 | Ga0495611_0017586 | 3300046648 | Bacteria | 3059 |
| 807 | Ga0495625_0000888 | 3300046660 | Bacteria | 40400 |
| 808 | Ga0495625_0077443 | 3300046660 | Bacteria | 2323 |
| 809 | Ga0495625_0357388 | 3300046660 | Bacteria | 921 |
| 810 | Ga0495635_0000491 | 3300046663 | Bacteria | 24925 |
| 811 | Ga0495635_0007428 | 3300046663 | Bacteria | 7647 |
| 812 | Ga0495635_0028493 | 3300046663 | Bacteria | 3882 |
| 813 | Ga0495635_0178771 | 3300046663 | Bacteria | 1442 |
| 814 | Ga0495659_0019004 | 3300046664 | Bacteria | 2296 |
| 815 | Ga0495659_0080509 | 3300046664 | Bacteria | 1235 |
| 816 | Ga0495588_0012745 | 3300046674 | Bacteria | 3984 |
| 817 | Ga0495588_0057864 | 3300046674 | Bacteria | 2003 |
| 818 | Ga0495588_0208071 | 3300046674 | Bacteria | 1033 |
| 819 | Ga0495657_0011578 | 3300046675 | Bacteria | 6590 |
| 820 | Ga0495657_0021093 | 3300046675 | Bacteria | 4678 |
| 821 | Ga0495657_0023411 | 3300046675 | Bacteria | 4414 |
| 822 | Ga0495657_0176096 | 3300046675 | Bacteria | 1315 |
| 823 | Ga0495599_0019185 | 3300046678 | Bacteria | 4263 |
| 824 | Ga0495599_0023100 | 3300046678 | Bacteria | 3886 |
| 825 | Ga0495599_0078126 | 3300046678 | Bacteria | 2066 |
| 826 | Ga0495599_0122084 | 3300046678 | Bacteria | 1619 |
| 827 | Ga0495623_0115298 | 3300046679 | Bacteria | 1624 |
| 828 | Ga0495623_0120508 | 3300046679 | Bacteria | 1579 |
| 829 | Ga0495646_0031381 | 3300046680 | Bacteria | 3311 |
| 830 | Ga0495646_0040428 | 3300046680 | Bacteria | 2872 |
| 831 | Ga0495646_0049680 | 3300046680 | Bacteria | 2545 |
| 832 | Ga0495646_0165379 | 3300046680 | Bacteria | 1222 |
| 833 | Ga0495646_0254712 | 3300046680 | Bacteria | 939 |
| 834 | Ga0495647_0007692 | 3300046681 | Bacteria | 3618 |
| 835 | Ga0495647_0016960 | 3300046681 | Bacteria | 2572 |
| 836 | Ga0495647_0042172 | 3300046681 | Bacteria | 1741 |
| 837 | Ga0495658_0001211 | 3300046683 | Bacteria | 13552 |
| 838 | Ga0495658_0007033 | 3300046683 | Bacteria | 5551 |
| 839 | Ga0495658_0327898 | 3300046683 | Bacteria | 971 |
| 840 | Ga0495613_0002051 | 3300046689 | Bacteria | 15316 |
| 841 | Ga0495613_0104978 | 3300046689 | Bacteria | 2040 |
| 842 | Ga0495613_0109386 | 3300046689 | Bacteria | 1993 |
| 843 | Ga0495613_0249616 | 3300046689 | Bacteria | 1239 |
| 844 | Ga0495624_0008987 | 3300046690 | Bacteria | 6944 |
| 845 | Ga0495624_0053556 | 3300046690 | Bacteria | 2547 |
| 846 | Ga0495624_0242967 | 3300046690 | Bacteria | 1089 |
| 847 | Ga0495624_0304827 | 3300046690 | Bacteria | 960 |
| 848 | Ga0495600_0008599 | 3300046809 | Bacteria | 6279 |
| 849 | Ga0495600_0080311 | 3300046809 | Bacteria | 2129 |
| 850 | Ga0495600_0103729 | 3300046809 | Bacteria | 1853 |
| 851 | Ga0495581_0000620 | 3300047315 | Bacteria | 18623 |
| 852 | Ga0495581_0025894 | 3300047315 | Bacteria | 3402 |
| 853 | Ga0495581_0154759 | 3300047315 | Bacteria | 1340 |
| 854 | Ga0495581_0229963 | 3300047315 | Bacteria | 1085 |
| 855 | Ga0495604_0005882 | 3300047317 | Bacteria | 9725 |
| 856 | Ga0495604_0034678 | 3300047317 | Bacteria | 3992 |
| 857 | Ga0495604_0147868 | 3300047317 | Bacteria | 1673 |
| 858 | Ga0495674_0001226 | 3300047319 | Bacteria | 24884 |
| 859 | Ga0495674_0004909 | 3300047319 | Bacteria | 12856 |
| 860 | Ga0495674_0023635 | 3300047319 | Bacteria | 5661 |
| 861 | Ga0495674_0074047 | 3300047319 | Bacteria | 2934 |
| 862 | Ga0495674_0111936 | 3300047319 | Bacteria | 2313 |
| 863 | Ga0495672_0088113 | 3300047320 | Bacteria | 1712 |
| 864 | Ga0495672_0224730 | 3300047320 | Bacteria | 925 |
| 865 | Ga0495672_0242940 | 3300047320 | Bacteria | 878 |
| 866 | Ga0495676_0044749 | 3300047321 | Bacteria | 3610 |
| 867 | Ga0495676_0111442 | 3300047321 | Bacteria | 2007 |
| 868 | Ga0495676_0145248 | 3300047321 | Bacteria | 1695 |
| 869 | Ga0495676_0216065 | 3300047321 | Bacteria | 1324 |
| 870 | Ga0495676_0417388 | 3300047321 | Bacteria | 888 |
| 871 | Ga0495680_0006961 | 3300047322 | Bacteria | 10433 |
| 872 | Ga0495680_0025019 | 3300047322 | Bacteria | 4944 |
| 873 | Ga0495680_0095272 | 3300047322 | Bacteria | 2225 |
| 874 | Ga0495683_0188214 | 3300047323 | Bacteria | 938 |
| 875 | Ga0495675_0005368 | 3300047444 | Bacteria | 7809 |
| 876 | Ga0495675_0016604 | 3300047444 | Bacteria | 4658 |
| 877 | Ga0495675_0039087 | 3300047444 | Bacteria | 3021 |
| 878 | Ga0495685_152001 | 3300047447 | Bacteria | 752 |
| 879 | Ga0495673_0038526 | 3300047469 | Bacteria | 2174 |
| 880 | Ga0495673_0042363 | 3300047469 | Bacteria | 2044 |
| 881 | Ga0495673_0043580 | 3300047469 | Bacteria | 2007 |
| 882 | Ga0495684_0000897 | 3300047471 | Bacteria | 24092 |
| 883 | Ga0495684_0052148 | 3300047471 | Bacteria | 3121 |
| 884 | Ga0495684_0172219 | 3300047471 | Bacteria | 1609 |
| 885 | Ga0495686_0018504 | 3300047472 | Bacteria | 4672 |
| 886 | Ga0495686_0051010 | 3300047472 | Bacteria | 2598 |
| 887 | Ga0495686_0060450 | 3300047472 | Bacteria | 2355 |
| 888 | Ga0495686_0127067 | 3300047472 | Bacteria | 1515 |
| 889 | Ga0495686_0226041 | 3300047472 | Bacteria | 1062 |
| 890 | Ga0495593_0000389 | 3300047673 | Bacteria | 24349 |
| 891 | Ga0495593_0113880 | 3300047673 | Bacteria | 1380 |
| 892 | Ga0495602_0000296 | 3300048088 | Bacteria | 45726 |
| 893 | Ga0495602_0013144 | 3300048088 | Bacteria | 8469 |
| 894 | Ga0495602_0048749 | 3300048088 | Bacteria | 3802 |
| 895 | Ga0495626_0044330 | 3300048091 | Bacteria | 2082 |
| 896 | Ga0496100_0012832 | 3300048903 | Bacteria | 4817 |
| 897 | Ga0496100_0046173 | 3300048903 | Bacteria | 2799 |
| 898 | Ga0496100_0067873 | 3300048903 | Bacteria | 2370 |
| 899 | Ga0496100_0288218 | 3300048903 | Bacteria | 1226 |
| 900 | Ga0496100_0305044 | 3300048903 | Bacteria | 1192 |
| 901 | Ga0496101_0059039 | 3300048904 | Bacteria | 2780 |
| 902 | Ga0496102_0052153 | 3300048905 | Bacteria | 3726 |
| 903 | Ga0496102_0092413 | 3300048905 | Bacteria | 2802 |
| 904 | Ga0496102_0093921 | 3300048905 | Bacteria | 2779 |
| 905 | Ga0496102_0310543 | 3300048905 | Bacteria | 1486 |
| 906 | Ga0496103_0087932 | 3300048906 | Bacteria | 1959 |
| 907 | Ga0496103_0425452 | 3300048906 | Bacteria | 852 |
| 908 | Ga0496103_0451226 | 3300048906 | Bacteria | 825 |
| 909 | Ga0496104_0009605 | 3300048907 | Bacteria | 8613 |
| 910 | Ga0496104_0011964 | 3300048907 | Bacteria | 7786 |
| 911 | Ga0496104_0031565 | 3300048907 | Bacteria | 4927 |
| 912 | Ga0496104_0057600 | 3300048907 | Bacteria | 3676 |
| 913 | Ga0496104_0115515 | 3300048907 | Bacteria | 2575 |
| 914 | Ga0496104_0158543 | 3300048907 | Bacteria | 2171 |
| 915 | Ga0496105_0023344 | 3300048908 | Bacteria | 5014 |
| 916 | Ga0496105_0036534 | 3300048908 | Bacteria | 4047 |
| 917 | Ga0496105_0054431 | 3300048908 | Bacteria | 3303 |
| 918 | Ga0496105_0069715 | 3300048908 | Bacteria | 2906 |
| 919 | Ga0496105_0110603 | 3300048908 | Bacteria | 2268 |
| 920 | Ga0496105_0157413 | 3300048908 | Bacteria | 1865 |
| 921 | Ga0496106_0006109 | 3300048909 | Bacteria | 8908 |
| 922 | Ga0496106_0011496 | 3300048909 | Bacteria | 6547 |
| 923 | Ga0496106_0011990 | 3300048909 | Bacteria | 6397 |
| 924 | Ga0496106_0135844 | 3300048909 | Bacteria | 1931 |
| 925 | Ga0496107_0018364 | 3300048910 | Bacteria | 4924 |
| 926 | Ga0496107_0028844 | 3300048910 | Bacteria | 3946 |
| 927 | Ga0496107_0033816 | 3300048910 | Bacteria | 3659 |
| 928 | Ga0496107_0083233 | 3300048910 | Bacteria | 2333 |
| 929 | Ga0496107_0089542 | 3300048910 | Bacteria | 2247 |
| 930 | Ga0496107_0265871 | 3300048910 | Bacteria | 1276 |
| 931 | Ga0496107_0296295 | 3300048910 | Bacteria | 1204 |
| 932 | Ga0496108_0000764 | 3300048911 | Bacteria | 25051 |
| 933 | Ga0496108_0009713 | 3300048911 | Bacteria | 7799 |
| 934 | Ga0496108_0028405 | 3300048911 | Bacteria | 4628 |
| 935 | Ga0496108_0270666 | 3300048911 | Bacteria | 1478 |
| 936 | Ga0496108_0743687 | 3300048911 | Bacteria | 849 |
| 937 | Ga0496109_0004357 | 3300048912 | Bacteria | 11828 |
| 938 | Ga0496109_0009522 | 3300048912 | Bacteria | 8280 |
| 939 | Ga0496109_0009612 | 3300048912 | Bacteria | 8246 |
| 940 | Ga0496109_0022973 | 3300048912 | Bacteria | 5530 |
| 941 | Ga0496109_0056204 | 3300048912 | Bacteria | 3591 |
| 942 | Ga0496109_0068250 | 3300048912 | Bacteria | 3259 |
| 943 | Ga0496109_0197123 | 3300048912 | Bacteria | 1893 |
| 944 | Ga0496109_0387945 | 3300048912 | Bacteria | 1319 |
| 945 | Ga0496110_0027878 | 3300048913 | Bacteria | 4846 |
| 946 | Ga0496110_0070020 | 3300048913 | Bacteria | 3107 |
| 947 | Ga0496110_0078286 | 3300048913 | Bacteria | 2943 |
| 948 | Ga0496110_0083574 | 3300048913 | Bacteria | 2848 |
| 949 | Ga0496110_0379849 | 3300048913 | Bacteria | 1287 |
| 950 | Ga0496110_0394115 | 3300048913 | Bacteria | 1262 |
| 951 | Ga0496110_0428776 | 3300048913 | Bacteria | 1205 |
| 952 | Ga0496111_0001105 | 3300048914 | Bacteria | 14931 |
| 953 | Ga0496111_0011921 | 3300048914 | Bacteria | 5874 |
| 954 | Ga0496111_0049580 | 3300048914 | Bacteria | 3028 |
| 955 | Ga0496111_0173121 | 3300048914 | Bacteria | 1604 |
| 956 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 957 | Ga0496112_0004212 | 3300048915 | Bacteria | 12130 |
| 958 | Ga0496112_0004915 | 3300048915 | Bacteria | 11438 |
| 959 | Ga0496112_0013107 | 3300048915 | Bacteria | 7650 |
| 960 | Ga0496112_0023568 | 3300048915 | Bacteria | 5882 |
| 961 | Ga0496112_0025554 | 3300048915 | Bacteria | 5671 |
| 962 | Ga0496112_0026567 | 3300048915 | Bacteria | 5574 |
| 963 | Ga0496112_0038470 | 3300048915 | Bacteria | 4671 |
| 964 | Ga0496112_0125607 | 3300048915 | Bacteria | 2536 |
| 965 | Ga0496113_0002366 | 3300048916 | Bacteria | 10928 |
| 966 | Ga0496113_0045330 | 3300048916 | Bacteria | 3261 |
| 967 | Ga0496113_0159709 | 3300048916 | Bacteria | 1781 |
| 968 | Ga0496113_0490827 | 3300048916 | Bacteria | 986 |
| 969 | Ga0496113_0759438 | 3300048916 | Bacteria | 772 |
| 970 | Ga0496114_0037653 | 3300048917 | Bacteria | 4001 |
| 971 | Ga0496114_0118920 | 3300048917 | Bacteria | 2271 |
| 972 | Ga0496114_0175359 | 3300048917 | Bacteria | 1870 |
| 973 | Ga0496114_0244542 | 3300048917 | Bacteria | 1578 |
| 974 | Ga0496114_0379366 | 3300048917 | Bacteria | 1251 |
| 975 | Ga0496115_0009221 | 3300048918 | Bacteria | 7326 |
| 976 | Ga0496115_0061653 | 3300048918 | Bacteria | 3024 |
| 977 | Ga0496115_0185245 | 3300048918 | Bacteria | 1720 |
| 978 | Ga0496115_0279239 | 3300048918 | Bacteria | 1371 |
| 979 | Ga0496116_0005214 | 3300048919 | Bacteria | 12168 |
| 980 | Ga0496116_0040362 | 3300048919 | Bacteria | 3214 |
| 981 | Ga0496117_0016824 | 3300048920 | Bacteria | 6145 |
| 982 | Ga0496117_0219159 | 3300048920 | Bacteria | 1060 |
| 983 | Ga0496117_0260907 | 3300048920 | Bacteria | 939 |
| 984 | Ga0496118_0019126 | 3300048921 | Bacteria | 6135 |
| 985 | Ga0496118_0072041 | 3300048921 | Bacteria | 2484 |
| 986 | Ga0496118_0197593 | 3300048921 | Bacteria | 1195 |
| 987 | Ga0496118_0263421 | 3300048921 | Bacteria | 971 |
| 988 | Ga0496119_0010049 | 3300048922 | Bacteria | 8006 |
| 989 | Ga0496119_0059543 | 3300048922 | Bacteria | 2293 |
| 990 | Ga0496119_0201349 | 3300048922 | Bacteria | 1030 |
| 991 | Ga0496120_0219816 | 3300048923 | Bacteria | 908 |
| 992 | Ga0496121_0001057 | 3300048924 | Bacteria | 48772 |
| 993 | Ga0496121_0001543 | 3300048924 | Bacteria | 38548 |
| 994 | Ga0496121_0009515 | 3300048924 | Bacteria | 11148 |
| 995 | Ga0496121_0017186 | 3300048924 | Bacteria | 7408 |
| 996 | Ga0496121_0020788 | 3300048924 | Bacteria | 6471 |
| 997 | Ga0496121_0047906 | 3300048924 | Bacteria | 3641 |
| 998 | Ga0496121_0054922 | 3300048924 | Bacteria | 3323 |
| 999 | Ga0496121_0094560 | 3300048924 | Bacteria | 2325 |
| 1000 | Ga0496121_0288475 | 3300048924 | Bacteria | 1119 |
| 1001 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 1002 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 1003 | Ga0496122_0057569 | 3300048925 | Bacteria | 2885 |
| 1004 | Ga0496123_0000117 | 3300048926 | Bacteria | 161679 |
| 1005 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 1006 | Ga0496123_0091273 | 3300048926 | Bacteria | 1807 |
| 1007 | Ga0496124_0127208 | 3300048927 | Bacteria | 2028 |
| 1008 | Ga0496124_0158870 | 3300048927 | Bacteria | 1764 |
| 1009 | Ga0496124_0197816 | 3300048927 | Bacteria | 1531 |
| 1010 | Ga0496124_0299559 | 3300048927 | Bacteria | 1162 |
| 1011 | Ga0496125_0000694 | 3300048928 | Bacteria | 55573 |
| 1012 | Ga0496125_0010987 | 3300048928 | Bacteria | 9087 |
| 1013 | Ga0496125_0015170 | 3300048928 | Bacteria | 7464 |
| 1014 | Ga0496125_0047355 | 3300048928 | Bacteria | 3597 |
| 1015 | Ga0496125_0105823 | 3300048928 | Bacteria | 2055 |
| 1016 | Ga0496125_0151299 | 3300048928 | Bacteria | 1593 |
| 1017 | Ga0496125_0152594 | 3300048928 | Bacteria | 1584 |
| 1018 | Ga0496125_0276335 | 3300048928 | Bacteria | 1043 |
| 1019 | Ga0496126_0005900 | 3300048929 | Bacteria | 13814 |
| 1020 | Ga0496126_0011116 | 3300048929 | Bacteria | 9349 |
| 1021 | Ga0496126_0016331 | 3300048929 | Bacteria | 7427 |
| 1022 | Ga0496126_0018583 | 3300048929 | Bacteria | 6881 |
| 1023 | Ga0496126_0037396 | 3300048929 | Bacteria | 4530 |
| 1024 | Ga0496126_0059599 | 3300048929 | Bacteria | 3437 |
| 1025 | Ga0496126_0077667 | 3300048929 | Bacteria | 2943 |
| 1026 | Ga0496126_0102738 | 3300048929 | Bacteria | 2498 |
| 1027 | Ga0496126_0104250 | 3300048929 | Bacteria | 2477 |
| 1028 | Ga0496126_0105850 | 3300048929 | Bacteria | 2455 |
| 1029 | Ga0496126_0135635 | 3300048929 | Bacteria | 2123 |
| 1030 | Ga0496126_0147005 | 3300048929 | Bacteria | 2023 |
| 1031 | Ga0496126_0312937 | 3300048929 | Bacteria | 1292 |
| 1032 | Ga0496126_0467551 | 3300048929 | Bacteria | 1013 |
| 1033 | Ga0496126_0730971 | 3300048929 | Bacteria | 766 |
| 1034 | Ga0495682_0042087 | 3300049460 | Bacteria | 1674 |
| 1035 | Ga0501031_0000655 | 3300049568 | Bacteria | 20505 |
| 1036 | Ga0501031_0001803 | 3300049568 | Bacteria | 13455 |
| 1037 | Ga0501031_0163876 | 3300049568 | Bacteria | 1453 |
| 1038 | Ga0501031_0428737 | 3300049568 | Bacteria | 855 |
| 1039 | Ga0501032_0000161 | 3300049569 | Bacteria | 54292 |
| 1040 | Ga0501032_0159161 | 3300049569 | Bacteria | 1483 |
| 1041 | Ga0501032_0182983 | 3300049569 | Bacteria | 1371 |
| 1042 | Ga0501033_0000672 | 3300049570 | Bacteria | 31550 |
| 1043 | Ga0501033_0001580 | 3300049570 | Bacteria | 20051 |
| 1044 | Ga0501033_0006379 | 3300049570 | Bacteria | 9241 |
| 1045 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 1046 | Ga0501034_0024633 | 3300049571 | Bacteria | 6120 |
| 1047 | Ga0501036_0000250 | 3300049572 | Bacteria | 36419 |
| 1048 | Ga0501036_0265193 | 3300049572 | Bacteria | 1438 |
| 1049 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 1050 | Ga0501037_0001059 | 3300049573 | Bacteria | 20381 |
| 1051 | Ga0501037_0033396 | 3300049573 | Bacteria | 3800 |
| 1052 | Ga0501037_0116571 | 3300049573 | Bacteria | 1922 |
| 1053 | Ga0501038_0000826 | 3300049574 | Bacteria | 27582 |
| 1054 | Ga0501038_0004208 | 3300049574 | Bacteria | 13371 |
| 1055 | Ga0501038_0057490 | 3300049574 | Bacteria | 3339 |
| 1056 | Ga0501038_0074567 | 3300049574 | Bacteria | 2870 |
| 1057 | Ga0501038_0205716 | 3300049574 | Bacteria | 1577 |
| 1058 | Ga0501039_0012015 | 3300049575 | Bacteria | 6598 |
| 1059 | Ga0501040_0500770 | 3300049576 | Bacteria | 876 |
| 1060 | Ga0501041_0151158 | 3300049577 | Bacteria | 1450 |
| 1061 | Ga0501042_0073646 | 3300049578 | Bacteria | 2443 |
| 1062 | Ga0501043_0000357 | 3300049579 | Bacteria | 41554 |
| 1063 | Ga0501043_0023451 | 3300049579 | Bacteria | 4839 |
| 1064 | Ga0501043_0579497 | 3300049579 | Bacteria | 831 |
| 1065 | Ga0501046_0023974 | 3300049580 | Bacteria | 5010 |
| 1066 | Ga0501046_0091706 | 3300049580 | Bacteria | 2336 |
| 1067 | Ga0501046_0326812 | 3300049580 | Bacteria | 1117 |
| 1068 | Ga0501047_0001531 | 3300049581 | Bacteria | 22591 |
| 1069 | Ga0501047_0013515 | 3300049581 | Bacteria | 7740 |
| 1070 | Ga0501047_0208882 | 3300049581 | Bacteria | 1811 |
| 1071 | Ga0501048_0000477 | 3300049582 | Bacteria | 27978 |
| 1072 | Ga0501067_0000068 | 3300049583 | Bacteria | 59338 |
| 1073 | Ga0501067_0083381 | 3300049583 | Bacteria | 1773 |
| 1074 | Ga0501068_0001116 | 3300049584 | Bacteria | 14202 |
| 1075 | Ga0501070_0002354 | 3300049586 | Bacteria | 16597 |
| 1076 | Ga0501070_0042138 | 3300049586 | Bacteria | 3802 |
| 1077 | Ga0501070_0204948 | 3300049586 | Bacteria | 1620 |
| 1078 | Ga0501072_0000835 | 3300049588 | Bacteria | 22655 |
| 1079 | Ga0501072_0258072 | 3300049588 | Bacteria | 1388 |
| 1080 | Ga0501072_0300148 | 3300049588 | Bacteria | 1277 |
| 1081 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 1082 | Ga0501073_0114093 | 3300049589 | Bacteria | 1873 |
| 1083 | Ga0501073_0222140 | 3300049589 | Bacteria | 1305 |
| 1084 | Ga0501073_0309438 | 3300049589 | Bacteria | 1090 |
| 1085 | Ga0501074_0000716 | 3300049590 | Bacteria | 20790 |
| 1086 | Ga0501079_0000251 | 3300049741 | Bacteria | 32618 |
| 1087 | Ga0501080_0004321 | 3300049742 | Bacteria | 12621 |
| 1088 | Ga0501080_0083252 | 3300049742 | Bacteria | 2972 |
| 1089 | Ga0501080_0311972 | 3300049742 | Bacteria | 1425 |
| 1090 | Ga0501083_0039237 | 3300049744 | Bacteria | 3216 |
| 1091 | Ga0501280_000775 | 3300049776 | Bacteria | 6972 |
| 1092 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 1093 | Ga0501035_0035252 | 3300049822 | Bacteria | 4541 |
| 1094 | Ga0501035_0036075 | 3300049822 | Bacteria | 4483 |
| 1095 | Ga0501035_0122045 | 3300049822 | Bacteria | 2277 |
| 1096 | Ga0501035_0329252 | 3300049822 | Bacteria | 1282 |
| 1097 | Ga0501035_0373790 | 3300049822 | Bacteria | 1189 |
| 1098 | Ga0501044_0002804 | 3300049823 | Bacteria | 19858 |
| 1099 | Ga0501044_0004858 | 3300049823 | Bacteria | 15027 |
| 1100 | Ga0501044_0064150 | 3300049823 | Bacteria | 3751 |
| 1101 | Ga0501044_0142659 | 3300049823 | Bacteria | 2383 |
| 1102 | Ga0501044_0622559 | 3300049823 | Bacteria | 971 |
| 1103 | Ga0501044_0645009 | 3300049823 | Bacteria | 948 |
| 1104 | Ga0501045_0164291 | 3300049824 | Bacteria | 1653 |
| 1105 | nmdc:mga03683_16686_c1 | 3300050489 | Bacteria | 2763 |
| 1106 | nmdc:mga03n38_533_c1 | 3300050490 | Bacteria | 9651 |
| 1107 | nmdc:mga00v17_23676_c1 | 3300050491 | Bacteria | 3554 |
| 1108 | nmdc:mga00v17_26685_c1 | 3300050491 | Bacteria | 3368 |
| 1109 | nmdc:mga00v17_43888_c1 | 3300050491 | Bacteria | 2694 |
| 1110 | nmdc:mga00v17_79611_c1 | 3300050491 | Bacteria | 2044 |
| 1111 | nmdc:mga0yw44_141158_c1 | 3300050492 | Bacteria | 1566 |
| 1112 | nmdc:mga0yw44_4925_c2 | 3300050492 | Bacteria | 3992 |
| 1113 | nmdc:mga0yw44_96245_c1 | 3300050492 | Bacteria | 1879 |
| 1114 | nmdc:mga0k408_120724_c1 | 3300050493 | Bacteria | 1552 |
| 1115 | nmdc:mga0k408_237919_c1 | 3300050493 | Bacteria | 1087 |
| 1116 | nmdc:mga0k408_274974_c1 | 3300050493 | Bacteria | 1005 |
| 1117 | nmdc:mga06z11_100307_c1 | 3300050494 | Bacteria | 1587 |
| 1118 | nmdc:mga06z11_21201_c1 | 3300050494 | Bacteria | 3016 |
| 1119 | nmdc:mga06z11_250804_c1 | 3300050494 | Bacteria | 1042 |
| 1120 | nmdc:mga06z11_345722_c1 | 3300050494 | Bacteria | 890 |
| 1121 | nmdc:mga06z11_35246_c1 | 3300050494 | Bacteria | 2462 |
| 1122 | nmdc:mga07m45_139324_c1 | 3300050496 | Bacteria | 1405 |
| 1123 | nmdc:mga07m45_2114_c1 | 3300050496 | Bacteria | 9242 |
| 1124 | nmdc:mga07m45_241183_c1 | 3300050496 | Bacteria | 1052 |
| 1125 | nmdc:mga07m45_40194_c1 | 3300050496 | Bacteria | 2617 |
| 1126 | nmdc:mga05p37_734481_c1 | 3300050507 | Bacteria | 1091 |
| 1127 | nmdc:mga0qj67_227519_c1 | 3300050509 | Bacteria | 1513 |
| 1128 | nmdc:mga08y16_34_c1 | 3300050511 | Bacteria | 164092 |
| 1129 | nmdc:mga0n895_586141_c1 | 3300050512 | Bacteria | 1118 |
| 1130 | nmdc:mga0n895_8338_c1 | 3300050512 | Bacteria | 8968 |
| 1131 | nmdc:mga08x19_220984_c1 | 3300050514 | Bacteria | 1301 |
| 1132 | nmdc:mga0sz30_10116_c1 | 3300050516 | Bacteria | 3607 |
| 1133 | nmdc:mga0sz30_167649_c1 | 3300050516 | Bacteria | 974 |
| 1134 | Ga0495601_0000749 | 3300053077 | Bacteria | 17465 |
| 1135 | Ga0495601_0015596 | 3300053077 | Bacteria | 4593 |
| 1136 | Ga0495601_0134564 | 3300053077 | Bacteria | 1611 |
| 1137 | Ga0495601_0209693 | 3300053077 | Bacteria | 1273 |
| 1138 | Ga0495601_0374656 | 3300053077 | Bacteria | 924 |
| 1139 | Ga0495612_0000707 | 3300053078 | Bacteria | 13532 |
| 1140 | Ga0495612_0040544 | 3300053078 | Bacteria | 1897 |
| 1141 | Ga0495612_0061626 | 3300053078 | Bacteria | 1554 |
| 1142 | Ga0495612_0076464 | 3300053078 | Bacteria | 1402 |
| 1143 | Ga0495612_0241613 | 3300053078 | Bacteria | 802 |
| 1144 | Ga0500635_0007052 | 3300053080 | Bacteria | 3032 |
| 1145 | Ga0495595_0019377 | 3300053084 | Bacteria | 2951 |
| 1146 | Ga0495595_0020690 | 3300053084 | Bacteria | 2866 |
| 1147 | Ga0495595_0025669 | 3300053084 | Bacteria | 2613 |
| 1148 | Ga0495595_0029233 | 3300053084 | Bacteria | 2465 |
| 1149 | Ga0495595_0241509 | 3300053084 | Bacteria | 904 |
| 1150 | Ga0495619_0010830 | 3300053085 | Bacteria | 5738 |
| 1151 | Ga0495619_0039935 | 3300053085 | Bacteria | 3065 |
| 1152 | Ga0495619_0063210 | 3300053085 | Bacteria | 2466 |
| 1153 | Ga0495619_0117863 | 3300053085 | Bacteria | 1818 |
| 1154 | Ga0495619_0133930 | 3300053085 | Bacteria | 1704 |
| 1155 | Ga0495619_0447829 | 3300053085 | Bacteria | 890 |
| 1156 | Ga0500578_0155667 | 3300053086 | Bacteria | 1421 |
| 1157 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1158 | Ga0500643_079769 | 3300053087 | Bacteria | 900 |
| 1159 | Ga0500644_0008381 | 3300053088 | Bacteria | 2728 |
| 1160 | Ga0500646_0041940 | 3300053090 | Bacteria | 1291 |
| 1161 | Ga0500651_0071542 | 3300053093 | Bacteria | 2158 |
| 1162 | Ga0500566_0000751 | 3300053094 | Bacteria | 18265 |
| 1163 | Ga0500566_0003091 | 3300053094 | Bacteria | 9947 |
| 1164 | Ga0500566_0105695 | 3300053094 | Bacteria | 1537 |
| 1165 | Ga0500566_0123505 | 3300053094 | Bacteria | 1393 |
| 1166 | Ga0500641_0001845 | 3300053096 | Bacteria | 7514 |
| 1167 | Ga0500641_0008013 | 3300053096 | Bacteria | 3765 |
| 1168 | Ga0500641_0067011 | 3300053096 | Bacteria | 1504 |
| 1169 | Ga0500641_0097233 | 3300053096 | Bacteria | 1261 |
| 1170 | Ga0500648_094847 | 3300053097 | Bacteria | 1666 |
| 1171 | Ga0500650_0004589 | 3300053098 | Bacteria | 5014 |
| 1172 | Ga0500555_008692 | 3300053103 | Bacteria | 2898 |
| 1173 | Ga0500556_0000238 | 3300053104 | Bacteria | 44627 |
| 1174 | Ga0500556_0064238 | 3300053104 | Bacteria | 1358 |
| 1175 | Ga0500557_003716 | 3300053105 | Bacteria | 3083 |
| 1176 | Ga0500562_038244 | 3300053108 | Bacteria | 1274 |
| 1177 | Ga0500569_006994 | 3300053109 | Bacteria | 2509 |
| 1178 | Ga0500569_014547 | 3300053109 | Bacteria | 1950 |
| 1179 | Ga0500572_000585 | 3300053111 | Bacteria | 12313 |
| 1180 | Ga0500592_000799 | 3300053116 | Bacteria | 5164 |
| 1181 | Ga0500592_024540 | 3300053116 | Bacteria | 972 |
| 1182 | Ga0500595_002375 | 3300053119 | Bacteria | 9407 |
| 1183 | Ga0500595_003407 | 3300053119 | Bacteria | 7437 |
| 1184 | Ga0500595_007814 | 3300053119 | Bacteria | 4408 |
| 1185 | Ga0500595_019669 | 3300053119 | Bacteria | 2445 |
| 1186 | Ga0500608_004588 | 3300053122 | Bacteria | 5377 |
| 1187 | Ga0500617_148009 | 3300053124 | Bacteria | 933 |
| 1188 | Ga0500618_032582 | 3300053125 | Bacteria | 1218 |
| 1189 | Ga0500626_067116 | 3300053128 | Bacteria | 1599 |
| 1190 | Ga0500642_0000092 | 3300053130 | Bacteria | 45651 |
| 1191 | Ga0500642_0000109 | 3300053130 | Bacteria | 40031 |
| 1192 | Ga0500652_001613 | 3300053131 | Bacteria | 6864 |
| 1193 | Ga0500559_0000492 | 3300053136 | Bacteria | 27669 |
| 1194 | Ga0500559_0029582 | 3300053136 | Bacteria | 2346 |
| 1195 | Ga0500559_0062637 | 3300053136 | Bacteria | 1661 |
| 1196 | Ga0500568_0002222 | 3300053139 | Bacteria | 11652 |
| 1197 | Ga0500568_0045737 | 3300053139 | Bacteria | 1741 |
| 1198 | Ga0500568_0079638 | 3300053139 | Bacteria | 1245 |
| 1199 | Ga0500573_0006467 | 3300053140 | Bacteria | 6347 |
| 1200 | Ga0500577_0000135 | 3300053142 | Bacteria | 17919 |
| 1201 | Ga0500579_114888 | 3300053143 | Bacteria | 1335 |
| 1202 | Ga0500586_001127 | 3300053145 | Bacteria | 5524 |
| 1203 | Ga0500590_021786 | 3300053148 | Bacteria | 3325 |
| 1204 | Ga0500590_040995 | 3300053148 | Bacteria | 2383 |
| 1205 | Ga0500590_091519 | 3300053148 | Bacteria | 1476 |
| 1206 | Ga0500604_0062277 | 3300053151 | Bacteria | 1174 |
| 1207 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 1208 | Ga0500616_0260809 | 3300053153 | Bacteria | 736 |
| 1209 | Ga0500622_0000966 | 3300053156 | Bacteria | 24386 |
| 1210 | Ga0500622_0025854 | 3300053156 | Bacteria | 3099 |
| 1211 | Ga0500627_0030431 | 3300053158 | Bacteria | 2260 |
| 1212 | Ga0500633_0022583 | 3300053160 | Bacteria | 1929 |
| 1213 | Ga0500634_0012476 | 3300053161 | Bacteria | 4426 |
| 1214 | Ga0500634_0019449 | 3300053161 | Bacteria | 3659 |
| 1215 | Ga0500638_004107 | 3300053162 | Bacteria | 5536 |
| 1216 | Ga0500636_0003333 | 3300053177 | Bacteria | 9023 |
| 1217 | Ga0500636_0026379 | 3300053177 | Bacteria | 3432 |
| 1218 | Ga0500636_0036683 | 3300053177 | Bacteria | 2900 |
| 1219 | Ga0500636_0077322 | 3300053177 | Bacteria | 1922 |
| 1220 | Ga0500637_0000090 | 3300053178 | Bacteria | 32448 |
| 1221 | Ga0500637_0094288 | 3300053178 | Bacteria | 1734 |
| 1222 | Ga0500637_0282160 | 3300053178 | Bacteria | 913 |
| 1223 | Ga0500625_022262 | 3300053729 | Bacteria | 2992 |
| 1224 | Ga0500645_026052 | 3300053730 | Bacteria | 1780 |
| 1225 | Ga0500645_062200 | 3300053730 | Bacteria | 1078 |
| 1226 | Ga0500609_004261 | 3300053731 | Bacteria | 1984 |
| 1227 | Ga0500609_018634 | 3300053731 | Bacteria | 945 |
| 1228 | Ga0500596_000284 | 3300053735 | Bacteria | 9009 |
| 1229 | Ga0500599_002093 | 3300053736 | Bacteria | 2370 |
| 1230 | Ga0500601_000997 | 3300053737 | Bacteria | 3280 |
| 1231 | Ga0501084_0012720 | 3300054114 | Bacteria | 6970 |
| 1232 | Ga0590077_025092 | 3300059426 | Bacteria | 1283 |
| 1233 | Ga0501082_0008921 | 3300060353 | Bacteria | 8653 |
| 1234 | Ga0466962_0067990 | 3300061719 | Bacteria | 1701 |
| 1235 | Ga0466962_0186089 | 3300061719 | Bacteria | 1013 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006048 | Ga0075363_100025950 | Ga0075363_1000259502 | 196 |
| 2 | 3300006353 | Ga0075370_10080200 | Ga0075370_100802001 | 196 |
| 3 | 3300048925 | Ga0496122_0000063 | Ga0496122_0000063_240390_241124 | 202 |
| 4 | 3300048926 | Ga0496123_0000117 | Ga0496123_0000117_119298_120032 | 202 |
| 5 | 3300046559 | Ga0495667_0158948 | Ga0495667_0158948_310_1008 | 209 |
| 6 | 3300048920 | Ga0496117_0219159 | Ga0496117_0219159_21_755 | 209 |
| 7 | 3300053077 | Ga0495601_0374656 | Ga0495601_0374656_61_759 | 209 |
| 8 | 3300053085 | Ga0495619_0117863 | Ga0495619_0117863_245_943 | 209 |
| 9 | 3300025273 | Ga0209673_1002499 | Ga0209673_10024992 | 210 |
| 10 | 3300002773 | JGI25152J39213_1002781 | JGI25152J39213_10027815 | 212 |
| 11 | 3300003354 | JGI25160J50197_1029710 | JGI25160J50197_10297103 | 212 |
| 12 | 3300003790 | Ga0055528_1008660 | Ga0055528_10086601 | 212 |
| 13 | 3300005335 | Ga0070666_10091775 | Ga0070666_100917752 | 212 |
| 14 | 3300005355 | Ga0070671_100070957 | Ga0070671_1000709572 | 212 |
| 15 | 3300006178 | Ga0075367_10195637 | Ga0075367_101956372 | 212 |
| 16 | 3300009177 | Ga0105248_10110038 | Ga0105248_101100382 | 212 |
| 17 | 3300017792 | Ga0163161_10245265 | Ga0163161_102452652 | 212 |
| 18 | 3300025258 | Ga0209129_1001529 | Ga0209129_10015293 | 212 |
| 19 | 3300025294 | Ga0209025_1019148 | Ga0209025_10191482 | 212 |
| 20 | 3300025295 | Ga0209564_1015496 | Ga0209564_10154962 | 212 |
| 21 | 3300025299 | Ga0209256_1003962 | Ga0209256_10039625 | 212 |
| 22 | 3300025302 | Ga0207426_1000447 | Ga0207426_100044755 | 212 |
| 23 | 3300025925 | Ga0207650_10395791 | Ga0207650_103957912 | 212 |
| 24 | 3300025931 | Ga0207644_10098349 | Ga0207644_100983492 | 212 |
| 25 | 3300025961 | Ga0207712_10177224 | Ga0207712_101772242 | 212 |
| 26 | 3300025986 | Ga0207658_10044511 | Ga0207658_100445112 | 212 |
| 27 | 3300026067 | Ga0207678_10120047 | Ga0207678_101200472 | 212 |
| 28 | 3300048904 | Ga0496101_0059039 | Ga0496101_0059039_250_990 | 212 |
| 29 | 3300048907 | Ga0496104_0115515 | Ga0496104_0115515_913_1653 | 212 |
| 30 | 3300048908 | Ga0496105_0054431 | Ga0496105_0054431_731_1471 | 212 |
| 31 | 3300048914 | Ga0496111_0173121 | Ga0496111_0173121_333_1073 | 212 |
| 32 | 3300048926 | Ga0496123_0091273 | Ga0496123_0091273_362_1102 | 212 |
| 33 | 3300048927 | Ga0496124_0197816 | Ga0496124_0197816_557_1297 | 212 |
| 34 | iso_pu_bacteria | 2534681796 | 2535518040 | 212 |
| 35 | 3300014497 | Ga0182008_10001323 | Ga0182008_100013232 | 213 |
| 36 | 3300006038 | Ga0075365_10000529 | Ga0075365_100005292 | 214 |
| 37 | 3300006177 | Ga0075362_10025311 | Ga0075362_100253111 | 214 |
| 38 | 3300006186 | Ga0075369_10009378 | Ga0075369_100093783 | 214 |
| 39 | 3300009766 | Ga0123342_1013414 | Ga0123342_10134149 | 214 |
| 40 | 3300025915 | Ga0207693_10047306 | Ga0207693_100473062 | 214 |
| 41 | 3300042876 | Ga0451577_1064199 | Ga0451577_1064199_13_681 | 214 |
| 42 | 3300005331 | Ga0070670_100166969 | Ga0070670_1001669693 | 215 |
| 43 | 3300005347 | Ga0070668_100273988 | Ga0070668_1002739882 | 215 |
| 44 | 3300005353 | Ga0070669_100141703 | Ga0070669_1001417033 | 215 |
| 45 | 3300005355 | Ga0070671_100200942 | Ga0070671_1002009422 | 215 |
| 46 | 3300005365 | Ga0070688_100013583 | Ga0070688_1000135834 | 215 |
| 47 | 3300005543 | Ga0070672_100219817 | Ga0070672_1002198172 | 215 |
| 48 | 3300006028 | Ga0070717_10791037 | Ga0070717_107910371 | 215 |
| 49 | 3300025925 | Ga0207650_10050383 | Ga0207650_100503836 | 215 |
| 50 | 3300025931 | Ga0207644_10300355 | Ga0207644_103003552 | 215 |
| 51 | 3300025936 | Ga0207670_10133607 | Ga0207670_101336073 | 215 |
| 52 | 3300025940 | Ga0207691_10198264 | Ga0207691_101982642 | 215 |
| 53 | 3300025945 | Ga0207679_10589751 | Ga0207679_105897512 | 215 |
| 54 | 3300005468 | Ga0070707_100033994 | Ga0070707_1000339944 | 216 |
| 55 | 3300005468 | Ga0070707_100581791 | Ga0070707_1005817912 | 216 |
| 56 | 3300005841 | Ga0068863_100390284 | Ga0068863_1003902842 | 216 |
| 57 | 3300006237 | Ga0097621_100078434 | Ga0097621_1000784342 | 216 |
| 58 | 3300014325 | Ga0163163_10000003 | Ga0163163_10000003231 | 216 |
| 59 | 3300025913 | Ga0207695_10034685 | Ga0207695_100346855 | 216 |
| 60 | 3300045051 | Ga0451576_0015673 | Ga0451576_0015673_1696_2394 | 216 |
| 61 | 3300010159 | Ga0099796_10047758 | Ga0099796_100477582 | 218 |
| 62 | 3300027512 | Ga0209179_1001603 | Ga0209179_10016032 | 218 |
| 63 | 3300028558 | Ga0265326_10059103 | Ga0265326_100591032 | 218 |
| 64 | 3300028573 | Ga0265334_10090418 | Ga0265334_100904182 | 218 |
| 65 | 3300028653 | Ga0265323_10002822 | Ga0265323_100028225 | 218 |
| 66 | 3300028666 | Ga0265336_10005738 | Ga0265336_100057382 | 218 |
| 67 | 3300028800 | Ga0265338_10001016 | Ga0265338_1000101643 | 218 |
| 68 | 3300031456 | Ga0307513_10648399 | Ga0307513_106483991 | 218 |
| 69 | 3300037068 | Ga0373925_0802946 | Ga0373925_0802946_90_758 | 218 |
| 70 | 3300048905 | Ga0496102_0093921 | Ga0496102_0093921_1680_2399 | 218 |
| 71 | 3300005436 | Ga0070713_100097470 | Ga0070713_1000974702 | 219 |
| 72 | 3300005536 | Ga0070697_100320031 | Ga0070697_1003200311 | 219 |
| 73 | 3300007788 | Ga0099795_10029257 | Ga0099795_100292572 | 219 |
| 74 | 3300014325 | Ga0163163_10252399 | Ga0163163_102523992 | 219 |
| 75 | 3300044765 | Ga0466970_0186319 | Ga0466970_0186319_466_1125 | 219 |
| 76 | 3300047320 | Ga0495672_0088113 | Ga0495672_0088113_862_1611 | 219 |
| 77 | 3300048907 | Ga0496104_0009605 | Ga0496104_0009605_3353_4027 | 219 |
| 78 | 3300048908 | Ga0496105_0023344 | Ga0496105_0023344_3137_3811 | 219 |
| 79 | 3300048911 | Ga0496108_0009713 | Ga0496108_0009713_3331_4005 | 219 |
| 80 | 3300048912 | Ga0496109_0009522 | Ga0496109_0009522_749_1423 | 219 |
| 81 | 3300048913 | Ga0496110_0027878 | Ga0496110_0027878_3337_4011 | 219 |
| 82 | 3300048914 | Ga0496111_0011921 | Ga0496111_0011921_2070_2744 | 219 |
| 83 | 3300048915 | Ga0496112_0026567 | Ga0496112_0026567_3333_4007 | 219 |
| 84 | 3300053119 | Ga0500595_007814 | Ga0500595_007814_2404_3123 | 219 |
| 85 | 3300053145 | Ga0500586_001127 | Ga0500586_001127_705_1421 | 219 |
| 86 | iso_pu_bacteria | 2765235802 | 2765464362 | 219 |
| 87 | iso_pu_bacteria | 2767802442 | 2770194713 | 219 |
| 88 | iso_pu_bacteria | 2775506902 | 2776272502 | 219 |
| 89 | iso_pu_bacteria | 2775506904 | 2776284442 | 219 |
| 90 | iso_pu_bacteria | 2839993093 | 2839994278 | 219 |
| 91 | iso_pu_bacteria | 2840764183 | 2840769320 | 219 |
| 92 | iso_pu_bacteria | 2904578770 | 2904579048 | 219 |
| 93 | iso_pu_bacteria | 2919119836 | 2919122124 | 219 |
| 94 | iso_pu_bacteria | 2928521798 | 2928521936 | 219 |
| 95 | iso_pu_bacteria | 2954011201 | 2954014707 | 219 |
| 96 | iso_pu_bacteria | 3002141150 | 3002142675 | 219 |
| 97 | 3300003215 | JGI25153J46596_10005975 | JGI25153J46596_100059752 | 220 |
| 98 | 3300005536 | Ga0070697_100729571 | Ga0070697_1007295711 | 220 |
| 99 | 3300005843 | Ga0068860_100000534 | Ga0068860_10000053426 | 220 |
| 100 | 3300005843 | Ga0068860_101072146 | Ga0068860_1010721461 | 220 |
| 101 | 3300009545 | Ga0105237_10040649 | Ga0105237_100406492 | 220 |
| 102 | 3300013306 | Ga0163162_10709274 | Ga0163162_107092741 | 220 |
| 103 | 3300028381 | Ga0268264_10000174 | Ga0268264_1000017448 | 220 |
| 104 | 3300033179 | Ga0307507_10033915 | Ga0307507_100339159 | 220 |
| 105 | 3300033180 | Ga0307510_10179327 | Ga0307510_101793272 | 220 |
| 106 | 3300035692 | Ga0373935_0032712 | Ga0373935_0032712_1618_2337 | 220 |
| 107 | 3300035695 | Ga0373927_0026674 | Ga0373927_0026674_2062_2781 | 220 |
| 108 | 3300035725 | Ga0373947_0033072 | Ga0373947_0033072_875_1594 | 220 |
| 109 | 3300048921 | Ga0496118_0019126 | Ga0496118_0019126_1431_2150 | 220 |
| 110 | 3300053080 | Ga0500635_0007052 | Ga0500635_0007052_2142_2861 | 220 |
| 111 | 3300053094 | Ga0500566_0123505 | Ga0500566_0123505_347_1066 | 220 |
| 112 | 3300053097 | Ga0500648_094847 | Ga0500648_094847_150_869 | 220 |
| 113 | 3300053140 | Ga0500573_0006467 | Ga0500573_0006467_1130_1849 | 220 |
| 114 | 3300053177 | Ga0500636_0077322 | Ga0500636_0077322_924_1643 | 220 |
| 115 | 3300053178 | Ga0500637_0282160 | Ga0500637_0282160_45_764 | 220 |
| 116 | 3300053735 | Ga0500596_000284 | Ga0500596_000284_5073_5792 | 220 |
| 117 | 3300005458 | Ga0070681_10087634 | Ga0070681_100876345 | 221 |
| 118 | 3300005985 | Ga0081539_10030928 | Ga0081539_100309284 | 221 |
| 119 | 3300013104 | Ga0157370_10017035 | Ga0157370_100170358 | 221 |
| 120 | 3300025917 | Ga0207660_10312940 | Ga0207660_103129402 | 221 |
| 121 | 3300031249 | Ga0265339_10054450 | Ga0265339_100544503 | 221 |
| 122 | 3300033180 | Ga0307510_10067650 | Ga0307510_100676503 | 221 |
| 123 | 3300048929 | Ga0496126_0102738 | Ga0496126_0102738_1607_2326 | 221 |
| 124 | 3300050489 | nmdc:mga03683_16686_c1 | nmdc:mga03683_16686_c1_775_1494 | 221 |
| 125 | 3300053119 | Ga0500595_002375 | Ga0500595_002375_1025_1744 | 221 |
| 126 | 3300053162 | Ga0500638_004107 | Ga0500638_004107_1911_2630 | 221 |
| 127 | 3300053178 | Ga0500637_0000090 | Ga0500637_0000090_4545_5264 | 221 |
| 128 | 3300003574 | Ga0007410J51695_1023793 | Ga0007410J51695_10237931 | 222 |
| 129 | 3300005518 | Ga0070699_100149816 | Ga0070699_1001498163 | 222 |
| 130 | 3300005548 | Ga0070665_100014804 | Ga0070665_1000148046 | 222 |
| 131 | 3300006195 | Ga0075366_10053729 | Ga0075366_100537293 | 222 |
| 132 | 3300009147 | Ga0114129_11129443 | Ga0114129_111294431 | 222 |
| 133 | 3300011119 | Ga0105246_10280332 | Ga0105246_102803322 | 222 |
| 134 | 3300025924 | Ga0207694_10166699 | Ga0207694_101666992 | 222 |
| 135 | 3300025937 | Ga0207669_10259432 | Ga0207669_102594321 | 222 |
| 136 | 3300025941 | Ga0207711_10127907 | Ga0207711_101279074 | 222 |
| 137 | 3300035112 | Ga0373932_0038755 | Ga0373932_0038755_153_995 | 222 |
| 138 | 3300037418 | Ga0395900_0226917 | Ga0395900_0226917_78_791 | 222 |
| 139 | 3300041413 | Ga0439465_0072875 | Ga0439465_0072875_143_832 | 222 |
| 140 | 3300045976 | Ga0466967_0016558 | Ga0466967_0016558_1737_2450 | 222 |
| 141 | 3300046477 | Ga0495664_0270126 | Ga0495664_0270126_252_974 | 222 |
| 142 | 3300048913 | Ga0496110_0078286 | Ga0496110_0078286_656_1498 | 222 |
| 143 | 3300048914 | Ga0496111_0049580 | Ga0496111_0049580_212_931 | 222 |
| 144 | 3300048917 | Ga0496114_0037653 | Ga0496114_0037653_665_1507 | 222 |
| 145 | 3300048929 | Ga0496126_0730971 | Ga0496126_0730971_34_747 | 222 |
| 146 | 3300049568 | Ga0501031_0428737 | Ga0501031_0428737_81_800 | 222 |
| 147 | 3300049588 | Ga0501072_0258072 | Ga0501072_0258072_639_1358 | 222 |
| 148 | 3300049589 | Ga0501073_0309438 | Ga0501073_0309438_186_905 | 222 |
| 149 | 3300050493 | nmdc:mga0k408_120724_c1 | nmdc:mga0k408_120724_c1_811_1530 | 222 |
| 150 | iso_pu_bacteria | 2548876994 | 2550697216 | 222 |
| 151 | 3300005335 | Ga0070666_10546164 | Ga0070666_105461641 | 223 |
| 152 | 3300005344 | Ga0070661_100238131 | Ga0070661_1002381312 | 223 |
| 153 | 3300005434 | Ga0070709_10058749 | Ga0070709_100587492 | 223 |
| 154 | 3300005436 | Ga0070713_100170583 | Ga0070713_1001705832 | 223 |
| 155 | 3300005455 | Ga0070663_100010930 | Ga0070663_1000109302 | 223 |
| 156 | 3300005466 | Ga0070685_10336700 | Ga0070685_103367001 | 223 |
| 157 | 3300005548 | Ga0070665_100016255 | Ga0070665_1000162553 | 223 |
| 158 | 3300006048 | Ga0075363_100013678 | Ga0075363_1000136785 | 223 |
| 159 | 3300006051 | Ga0075364_10054185 | Ga0075364_100541852 | 223 |
| 160 | 3300006178 | Ga0075367_10037617 | Ga0075367_100376172 | 223 |
| 161 | 3300006353 | Ga0075370_10006177 | Ga0075370_100061774 | 223 |
| 162 | 3300009092 | Ga0105250_10071291 | Ga0105250_100712912 | 223 |
| 163 | 3300013306 | Ga0163162_10521253 | Ga0163162_105212532 | 223 |
| 164 | 3300013307 | Ga0157372_10272871 | Ga0157372_102728711 | 223 |
| 165 | 3300025929 | Ga0207664_10372061 | Ga0207664_103720612 | 223 |
| 166 | 3300026067 | Ga0207678_10037444 | Ga0207678_100374443 | 223 |
| 167 | 3300026121 | Ga0207683_10569160 | Ga0207683_105691601 | 223 |
| 168 | 3300028379 | Ga0268266_10001864 | Ga0268266_100018644 | 223 |
| 169 | 3300031911 | Ga0307412_10231177 | Ga0307412_102311772 | 223 |
| 170 | 3300039450 | Ga0436363_0665946 | Ga0436363_0665946_448_1212 | 223 |
| 171 | 3300047320 | Ga0495672_0224730 | Ga0495672_0224730_59_778 | 223 |
| 172 | 3300048908 | Ga0496105_0069715 | Ga0496105_0069715_1985_2704 | 223 |
| 173 | 3300048909 | Ga0496106_0011496 | Ga0496106_0011496_3969_4673 | 223 |
| 174 | 3300048910 | Ga0496107_0089542 | Ga0496107_0089542_1323_2042 | 223 |
| 175 | 3300048918 | Ga0496115_0061653 | Ga0496115_0061653_2272_2991 | 223 |
| 176 | 3300050490 | nmdc:mga03n38_533_c1 | nmdc:mga03n38_533_c1_5573_6292 | 223 |
| 177 | 3300050491 | nmdc:mga00v17_43888_c1 | nmdc:mga00v17_43888_c1_236_955 | 223 |
| 178 | 3300050492 | nmdc:mga0yw44_4925_c2 | nmdc:mga0yw44_4925_c2_860_1579 | 223 |
| 179 | 3300050494 | nmdc:mga06z11_35246_c1 | nmdc:mga06z11_35246_c1_1384_2103 | 223 |
| 180 | 3300050496 | nmdc:mga07m45_2114_c1 | nmdc:mga07m45_2114_c1_1968_2687 | 223 |
| 181 | 3300050512 | nmdc:mga0n895_586141_c1 | nmdc:mga0n895_586141_c1_307_1026 | 223 |
| 182 | 3300053109 | Ga0500569_014547 | Ga0500569_014547_134_850 | 223 |
| 183 | 3300053731 | Ga0500609_018634 | Ga0500609_018634_39_755 | 223 |
| 184 | iso_pu_bacteria | 2896154374 | 2896155420 | 223 |
| 185 | iso_pu_bacteria | 8005258706 | 8005264703 | 223 |
| 186 | iso_pu_bacteria | 8005321885 | 8005327197 | 223 |
| 187 | 3300005338 | Ga0068868_100117433 | Ga0068868_1001174332 | 224 |
| 188 | 3300005459 | Ga0068867_100952356 | Ga0068867_1009523561 | 224 |
| 189 | 3300005564 | Ga0070664_100122248 | Ga0070664_1001222482 | 224 |
| 190 | 3300005841 | Ga0068863_100301418 | Ga0068863_1003014182 | 224 |
| 191 | 3300005937 | Ga0081455_10022180 | Ga0081455_100221807 | 224 |
| 192 | 3300006042 | Ga0075368_10195728 | Ga0075368_101957282 | 224 |
| 193 | 3300009098 | Ga0105245_10025310 | Ga0105245_100253101 | 224 |
| 194 | 3300011119 | Ga0105246_10297578 | Ga0105246_102975782 | 224 |
| 195 | 3300013306 | Ga0163162_10420843 | Ga0163162_104208432 | 224 |
| 196 | 3300013308 | Ga0157375_10016901 | Ga0157375_100169012 | 224 |
| 197 | 3300014325 | Ga0163163_10341237 | Ga0163163_103412372 | 224 |
| 198 | 3300014969 | Ga0157376_10109424 | Ga0157376_101094243 | 224 |
| 199 | 3300021384 | Ga0213876_10086955 | Ga0213876_100869552 | 224 |
| 200 | 3300025919 | Ga0207657_10058186 | Ga0207657_100581861 | 224 |
| 201 | 3300025925 | Ga0207650_10554119 | Ga0207650_105541192 | 224 |
| 202 | 3300025934 | Ga0207686_10423105 | Ga0207686_104231052 | 224 |
| 203 | 3300025981 | Ga0207640_10334363 | Ga0207640_103343632 | 224 |
| 204 | 3300026023 | Ga0207677_10038365 | Ga0207677_100383652 | 224 |
| 205 | 3300026088 | Ga0207641_10455359 | Ga0207641_104553591 | 224 |
| 206 | 3300026121 | Ga0207683_10043308 | Ga0207683_100433082 | 224 |
| 207 | 3300039450 | Ga0436363_0158762 | Ga0436363_0158762_626_1342 | 224 |
| 208 | 3300039453 | Ga0436362_0336193 | Ga0436362_0336193_745_1461 | 224 |
| 209 | 3300048903 | Ga0496100_0046173 | Ga0496100_0046173_1145_1864 | 224 |
| 210 | 3300048908 | Ga0496105_0157413 | Ga0496105_0157413_701_1420 | 224 |
| 211 | 3300048909 | Ga0496106_0011990 | Ga0496106_0011990_963_1682 | 224 |
| 212 | 3300048910 | Ga0496107_0028844 | Ga0496107_0028844_2765_3484 | 224 |
| 213 | 3300048912 | Ga0496109_0068250 | Ga0496109_0068250_1592_2311 | 224 |
| 214 | 3300048913 | Ga0496110_0428776 | Ga0496110_0428776_349_1068 | 224 |
| 215 | 3300048915 | Ga0496112_0025554 | Ga0496112_0025554_1257_1976 | 224 |
| 216 | 3300048916 | Ga0496113_0045330 | Ga0496113_0045330_1526_2245 | 224 |
| 217 | 3300048917 | Ga0496114_0379366 | Ga0496114_0379366_136_855 | 224 |
| 218 | 3300049589 | Ga0501073_0222140 | Ga0501073_0222140_338_1120 | 224 |
| 219 | 3300050491 | nmdc:mga00v17_79611_c1 | nmdc:mga00v17_79611_c1_1050_1748 | 224 |
| 220 | 3300050492 | nmdc:mga0yw44_141158_c1 | nmdc:mga0yw44_141158_c1_298_996 | 224 |
| 221 | 3300050494 | nmdc:mga06z11_345722_c1 | nmdc:mga06z11_345722_c1_177_875 | 224 |
| 222 | 3300050496 | nmdc:mga07m45_241183_c1 | nmdc:mga07m45_241183_c1_166_864 | 224 |
| 223 | 3300050496 | nmdc:mga07m45_40194_c1 | nmdc:mga07m45_40194_c1_1746_2444 | 224 |
| 224 | 3300050516 | nmdc:mga0sz30_167649_c1 | nmdc:mga0sz30_167649_c1_28_726 | 224 |
| 225 | iso_pu_bacteria | 2818991445 | 2819591372 | 224 |
| 226 | iso_pu_bacteria | 2884811622 | 2884815253 | 224 |
| 227 | iso_pu_bacteria | 2884811622 | 2884815264 | 224 |
| 228 | iso_pu_bacteria | 2884836552 | 2884837171 | 224 |
| 229 | iso_pu_bacteria | 2884852848 | 2884853463 | 224 |
| 230 | 3300003659 | JGI25404J52841_10027496 | JGI25404J52841_100274961 | 225 |
| 231 | 3300005614 | Ga0068856_100003313 | Ga0068856_1000033138 | 225 |
| 232 | 3300005983 | Ga0081540_1004327 | Ga0081540_100432717 | 225 |
| 233 | 3300005983 | Ga0081540_1008358 | Ga0081540_10083582 | 225 |
| 234 | 3300009101 | Ga0105247_10490616 | Ga0105247_104906162 | 225 |
| 235 | 3300026078 | Ga0207702_10000325 | Ga0207702_1000032539 | 225 |
| 236 | 3300027671 | Ga0209588_1005183 | Ga0209588_10051833 | 225 |
| 237 | 3300048924 | Ga0496121_0020788 | Ga0496121_0020788_4288_5007 | 225 |
| 238 | 3300053087 | Ga0500643_079769 | Ga0500643_079769_38_739 | 225 |
| 239 | iso_pu_bacteria | 2511231003 | 2511248911 | 225 |
| 240 | 3300002737 | JGI25162J39368_1003686 | JGI25162J39368_10036864 | 226 |
| 241 | 3300005343 | Ga0070687_100241257 | Ga0070687_1002412572 | 226 |
| 242 | 3300005366 | Ga0070659_100052884 | Ga0070659_1000528841 | 226 |
| 243 | 3300005455 | Ga0070663_100148879 | Ga0070663_1001488791 | 226 |
| 244 | 3300005457 | Ga0070662_100084819 | Ga0070662_1000848193 | 226 |
| 245 | 3300005548 | Ga0070665_100161902 | Ga0070665_1001619023 | 226 |
| 246 | 3300005563 | Ga0068855_100045608 | Ga0068855_1000456082 | 226 |
| 247 | 3300005563 | Ga0068855_100103063 | Ga0068855_1001030633 | 226 |
| 248 | 3300005618 | Ga0068864_100069542 | Ga0068864_1000695426 | 226 |
| 249 | 3300005841 | Ga0068863_100267222 | Ga0068863_1002672222 | 226 |
| 250 | 3300005842 | Ga0068858_100073088 | Ga0068858_1000730881 | 226 |
| 251 | 3300005983 | Ga0081540_1003580 | Ga0081540_100358010 | 226 |
| 252 | 3300006175 | Ga0070712_100024654 | Ga0070712_1000246545 | 226 |
| 253 | 3300006237 | Ga0097621_100192342 | Ga0097621_1001923422 | 226 |
| 254 | 3300006358 | Ga0068871_100050386 | Ga0068871_1000503862 | 226 |
| 255 | 3300006358 | Ga0068871_100347315 | Ga0068871_1003473151 | 226 |
| 256 | 3300007788 | Ga0099795_10024287 | Ga0099795_100242872 | 226 |
| 257 | 3300009093 | Ga0105240_10619226 | Ga0105240_106192261 | 226 |
| 258 | 3300010159 | Ga0099796_10008189 | Ga0099796_100081892 | 226 |
| 259 | 3300010375 | Ga0105239_10144608 | Ga0105239_101446085 | 226 |
| 260 | 3300011119 | Ga0105246_10062381 | Ga0105246_100623812 | 226 |
| 261 | 3300013102 | Ga0157371_10100896 | Ga0157371_101008962 | 226 |
| 262 | 3300014969 | Ga0157376_10590605 | Ga0157376_105906052 | 226 |
| 263 | 3300021384 | Ga0213876_10046146 | Ga0213876_100461462 | 226 |
| 264 | 3300025223 | Ga0207672_1002024 | Ga0207672_10020242 | 226 |
| 265 | 3300025233 | Ga0209437_100080 | Ga0209437_1000807 | 226 |
| 266 | 3300025253 | Ga0209677_101880 | Ga0209677_1018805 | 226 |
| 267 | 3300025254 | Ga0209148_1004037 | Ga0209148_10040372 | 226 |
| 268 | 3300025261 | Ga0209233_1001098 | Ga0209233_10010983 | 226 |
| 269 | 3300025915 | Ga0207693_10038353 | Ga0207693_100383533 | 226 |
| 270 | 3300025916 | Ga0207663_10388809 | Ga0207663_103888092 | 226 |
| 271 | 3300025918 | Ga0207662_10107841 | Ga0207662_101078411 | 226 |
| 272 | 3300025927 | Ga0207687_10216949 | Ga0207687_102169492 | 226 |
| 273 | 3300025927 | Ga0207687_10261905 | Ga0207687_102619052 | 226 |
| 274 | 3300025941 | Ga0207711_10114332 | Ga0207711_101143322 | 226 |
| 275 | 3300026088 | Ga0207641_10346921 | Ga0207641_103469212 | 226 |
| 276 | 3300027866 | Ga0209813_10073923 | Ga0209813_100739231 | 226 |
| 277 | 3300028379 | Ga0268266_10006918 | Ga0268266_100069181 | 226 |
| 278 | 3300037853 | Ga0436364_0421012 | Ga0436364_0421012_184_906 | 226 |
| 279 | 3300039437 | Ga0436365_1936582 | Ga0436365_1936582_798_1520 | 226 |
| 280 | 3300039447 | Ga0436361_0657147 | Ga0436361_0657147_156_866 | 226 |
| 281 | 3300039447 | Ga0436361_0757415 | Ga0436361_0757415_970_1671 | 226 |
| 282 | 3300042531 | Ga0450918_020862 | Ga0450918_020862_55_762 | 226 |
| 283 | 3300046537 | Ga0495598_0042422 | Ga0495598_0042422_18_737 | 226 |
| 284 | 3300048910 | Ga0496107_0296295 | Ga0496107_0296295_192_911 | 226 |
| 285 | 3300048921 | Ga0496118_0197593 | Ga0496118_0197593_192_914 | 226 |
| 286 | 3300048924 | Ga0496121_0054922 | Ga0496121_0054922_1070_1792 | 226 |
| 287 | 3300049583 | Ga0501067_0083381 | Ga0501067_0083381_783_1502 | 226 |
| 288 | 3300053111 | Ga0500572_000585 | Ga0500572_000585_9669_10388 | 226 |
| 289 | 3300005616 | Ga0068852_100246511 | Ga0068852_1002465112 | 227 |
| 290 | 3300009101 | Ga0105247_10137117 | Ga0105247_101371172 | 227 |
| 291 | 3300013297 | Ga0157378_10007047 | Ga0157378_100070474 | 227 |
| 292 | 3300014497 | Ga0182008_10061172 | Ga0182008_100611723 | 227 |
| 293 | 3300025913 | Ga0207695_10001268 | Ga0207695_1000126826 | 227 |
| 294 | 3300025924 | Ga0207694_10013374 | Ga0207694_100133747 | 227 |
| 295 | 3300045049 | Ga0466959_0126327 | Ga0466959_0126327_1042_1758 | 227 |
| 296 | 3300046455 | Ga0495603_0003074 | Ga0495603_0003074_2820_3536 | 227 |
| 297 | 3300046499 | Ga0495594_0291170 | Ga0495594_0291170_113_829 | 227 |
| 298 | 3300046690 | Ga0495624_0304827 | Ga0495624_0304827_198_914 | 227 |
| 299 | 3300047673 | Ga0495593_0113880 | Ga0495593_0113880_301_1020 | 227 |
| 300 | 3300053078 | Ga0495612_0241613 | Ga0495612_0241613_73_792 | 227 |
| 301 | 3300053084 | Ga0495595_0241509 | Ga0495595_0241509_114_833 | 227 |
| 302 | 3300002704 | JGI25155J39150_1000408 | JGI25155J39150_10004084 | 228 |
| 303 | 3300002705 | JGI25156J39149_1000057 | JGI25156J39149_100005712 | 228 |
| 304 | 3300002738 | JGI25154J39366_1000087 | JGI25154J39366_100008778 | 228 |
| 305 | 3300002741 | JGI25157J39369_1000336 | JGI25157J39369_100033611 | 228 |
| 306 | 3300005333 | Ga0070677_10027820 | Ga0070677_100278203 | 228 |
| 307 | 3300005355 | Ga0070671_100640921 | Ga0070671_1006409211 | 228 |
| 308 | 3300005364 | Ga0070673_100769279 | Ga0070673_1007692792 | 228 |
| 309 | 3300005456 | Ga0070678_100568549 | Ga0070678_1005685492 | 228 |
| 310 | 3300005985 | Ga0081539_10128426 | Ga0081539_101284262 | 228 |
| 311 | 3300006353 | Ga0075370_10292859 | Ga0075370_102928592 | 228 |
| 312 | 3300009093 | Ga0105240_10000497 | Ga0105240_1000049749 | 228 |
| 313 | 3300009147 | Ga0114129_10431581 | Ga0114129_104315813 | 228 |
| 314 | 3300009177 | Ga0105248_10030134 | Ga0105248_100301343 | 228 |
| 315 | 3300009551 | Ga0105238_10047369 | Ga0105238_100473694 | 228 |
| 316 | 3300013306 | Ga0163162_10588232 | Ga0163162_105882322 | 228 |
| 317 | 3300025206 | Ga0209435_100016 | Ga0209435_100016139 | 228 |
| 318 | 3300025206 | Ga0209435_100038 | Ga0209435_10003821 | 228 |
| 319 | 3300025229 | Ga0209147_100023 | Ga0209147_100023190 | 228 |
| 320 | 3300025242 | Ga0209258_100210 | Ga0209258_100210109 | 228 |
| 321 | 3300025246 | Ga0209646_1000033 | Ga0209646_1000033171 | 228 |
| 322 | 3300025250 | Ga0209026_1000031 | Ga0209026_1000031190 | 228 |
| 323 | 3300025256 | Ga0209759_1000045 | Ga0209759_100004596 | 228 |
| 324 | 3300025272 | Ga0209455_1001412 | Ga0209455_100141210 | 228 |
| 325 | 3300025297 | Ga0209758_1012239 | Ga0209758_10122393 | 228 |
| 326 | 3300025911 | Ga0207654_10194396 | Ga0207654_101943961 | 228 |
| 327 | 3300025931 | Ga0207644_10195260 | Ga0207644_101952601 | 228 |
| 328 | 3300025936 | Ga0207670_10314499 | Ga0207670_103144991 | 228 |
| 329 | 3300025972 | Ga0207668_10117877 | Ga0207668_101178773 | 228 |
| 330 | 3300026089 | Ga0207648_10094964 | Ga0207648_100949642 | 228 |
| 331 | 3300026121 | Ga0207683_10381410 | Ga0207683_103814101 | 228 |
| 332 | 3300028379 | Ga0268266_10014519 | Ga0268266_100145194 | 228 |
| 333 | 3300031548 | Ga0307408_100447596 | Ga0307408_1004475962 | 228 |
| 334 | 3300033180 | Ga0307510_10047759 | Ga0307510_100477592 | 228 |
| 335 | 3300035695 | Ga0373927_0062498 | Ga0373927_0062498_824_1543 | 228 |
| 336 | 3300035695 | Ga0373927_0096048 | Ga0373927_0096048_195_914 | 228 |
| 337 | 3300036401 | Ga0373937_0089606 | Ga0373937_0089606_1327_2046 | 228 |
| 338 | 3300046454 | Ga0495592_0151879 | Ga0495592_0151879_477_1196 | 228 |
| 339 | 3300046455 | Ga0495603_0232934 | Ga0495603_0232934_329_1048 | 228 |
| 340 | 3300046462 | Ga0495651_0150046 | Ga0495651_0150046_209_928 | 228 |
| 341 | 3300046477 | Ga0495664_0004013 | Ga0495664_0004013_465_1184 | 228 |
| 342 | 3300046512 | Ga0495610_0038063 | Ga0495610_0038063_1187_1906 | 228 |
| 343 | 3300046514 | Ga0495618_0059962 | Ga0495618_0059962_681_1400 | 228 |
| 344 | 3300046515 | Ga0495620_0044370 | Ga0495620_0044370_1162_1881 | 228 |
| 345 | 3300046516 | Ga0495628_0206105 | Ga0495628_0206105_341_1060 | 228 |
| 346 | 3300046529 | Ga0495652_0150525 | Ga0495652_0150525_180_899 | 228 |
| 347 | 3300046536 | Ga0495587_0007337 | Ga0495587_0007337_582_1301 | 228 |
| 348 | 3300046536 | Ga0495587_0054532 | Ga0495587_0054532_890_1603 | 228 |
| 349 | 3300046543 | Ga0495645_0006977 | Ga0495645_0006977_1292_2011 | 228 |
| 350 | 3300046559 | Ga0495667_0063781 | Ga0495667_0063781_726_1445 | 228 |
| 351 | 3300046660 | Ga0495625_0000888 | Ga0495625_0000888_23797_24504 | 228 |
| 352 | 3300046678 | Ga0495599_0078126 | Ga0495599_0078126_111_830 | 228 |
| 353 | 3300046680 | Ga0495646_0165379 | Ga0495646_0165379_437_1150 | 228 |
| 354 | 3300046681 | Ga0495647_0042172 | Ga0495647_0042172_337_1056 | 228 |
| 355 | 3300046809 | Ga0495600_0080311 | Ga0495600_0080311_1367_2086 | 228 |
| 356 | 3300047317 | Ga0495604_0034678 | Ga0495604_0034678_2944_3663 | 228 |
| 357 | 3300047319 | Ga0495674_0004909 | Ga0495674_0004909_10135_10854 | 228 |
| 358 | 3300047321 | Ga0495676_0216065 | Ga0495676_0216065_44_763 | 228 |
| 359 | 3300047322 | Ga0495680_0025019 | Ga0495680_0025019_4163_4882 | 228 |
| 360 | 3300047444 | Ga0495675_0039087 | Ga0495675_0039087_459_1178 | 228 |
| 361 | 3300048088 | Ga0495602_0000296 | Ga0495602_0000296_38174_38893 | 228 |
| 362 | 3300048919 | Ga0496116_0040362 | Ga0496116_0040362_989_1705 | 228 |
| 363 | 3300048925 | Ga0496122_0000375 | Ga0496122_0000375_28902_29618 | 228 |
| 364 | 3300048926 | Ga0496123_0000267 | Ga0496123_0000267_73440_74156 | 228 |
| 365 | 3300048927 | Ga0496124_0299559 | Ga0496124_0299559_20_739 | 228 |
| 366 | 3300048928 | Ga0496125_0000694 | Ga0496125_0000694_33694_34401 | 228 |
| 367 | 3300048928 | Ga0496125_0010987 | Ga0496125_0010987_7467_8183 | 228 |
| 368 | 3300048929 | Ga0496126_0011116 | Ga0496126_0011116_3869_4591 | 228 |
| 369 | 3300050493 | nmdc:mga0k408_274974_c1 | nmdc:mga0k408_274974_c1_30_749 | 228 |
| 370 | 3300050496 | nmdc:mga07m45_139324_c1 | nmdc:mga07m45_139324_c1_294_1013 | 228 |
| 371 | 3300050514 | nmdc:mga08x19_220984_c1 | nmdc:mga08x19_220984_c1_558_1277 | 228 |
| 372 | 3300053077 | Ga0495601_0000749 | Ga0495601_0000749_13328_14047 | 228 |
| 373 | 3300053078 | Ga0495612_0000707 | Ga0495612_0000707_10627_11346 | 228 |
| 374 | 3300053084 | Ga0495595_0025669 | Ga0495595_0025669_506_1225 | 228 |
| 375 | 3300053085 | Ga0495619_0039935 | Ga0495619_0039935_1047_1766 | 228 |
| 376 | 3300053109 | Ga0500569_006994 | Ga0500569_006994_1166_1885 | 228 |
| 377 | 3300053730 | Ga0500645_062200 | Ga0500645_062200_341_1060 | 228 |
| 378 | 3300002704 | JGI25155J39150_1000198 | JGI25155J39150_10001984 | 229 |
| 379 | 3300002705 | JGI25156J39149_1002321 | JGI25156J39149_10023215 | 229 |
| 380 | 3300002738 | JGI25154J39366_1000925 | JGI25154J39366_10009252 | 229 |
| 381 | 3300003758 | Ga0055532_1000016 | Ga0055532_1000016254 | 229 |
| 382 | 3300005338 | Ga0068868_100504877 | Ga0068868_1005048772 | 229 |
| 383 | 3300005548 | Ga0070665_100524084 | Ga0070665_1005240841 | 229 |
| 384 | 3300005937 | Ga0081455_10000815 | Ga0081455_1000081526 | 229 |
| 385 | 3300005983 | Ga0081540_1011347 | Ga0081540_10113478 | 229 |
| 386 | 3300005983 | Ga0081540_1087692 | Ga0081540_10876922 | 229 |
| 387 | 3300009093 | Ga0105240_10042855 | Ga0105240_100428553 | 229 |
| 388 | 3300009553 | Ga0105249_10135725 | Ga0105249_101357254 | 229 |
| 389 | 3300013296 | Ga0157374_10752030 | Ga0157374_107520301 | 229 |
| 390 | 3300025206 | Ga0209435_100096 | Ga0209435_10009619 | 229 |
| 391 | 3300025246 | Ga0209646_1000093 | Ga0209646_100009328 | 229 |
| 392 | 3300025256 | Ga0209759_1000248 | Ga0209759_100024834 | 229 |
| 393 | 3300025261 | Ga0209233_1003422 | Ga0209233_10034228 | 229 |
| 394 | 3300025961 | Ga0207712_10057465 | Ga0207712_100574654 | 229 |
| 395 | 3300046452 | Ga0495617_005474 | Ga0495617_005474_2507_3226 | 229 |
| 396 | 3300046522 | Ga0495643_0201458 | Ga0495643_0201458_129_848 | 229 |
| 397 | 3300046530 | Ga0495654_0147632 | Ga0495654_0147632_94_813 | 229 |
| 398 | 3300046660 | Ga0495625_0357388 | Ga0495625_0357388_117_836 | 229 |
| 399 | 3300047472 | Ga0495686_0127067 | Ga0495686_0127067_616_1335 | 229 |
| 400 | 3300048912 | Ga0496109_0197123 | Ga0496109_0197123_838_1554 | 229 |
| 401 | 3300048921 | Ga0496118_0263421 | Ga0496118_0263421_71_781 | 229 |
| 402 | 3300048924 | Ga0496121_0094560 | Ga0496121_0094560_1128_1838 | 229 |
| 403 | 3300048929 | Ga0496126_0135635 | Ga0496126_0135635_196_915 | 229 |
| 404 | 3300049776 | Ga0501280_000775 | Ga0501280_000775_3891_4607 | 229 |
| 405 | iso_pu_bacteria | 2513237094 | 2513641110 | 229 |
| 406 | iso_pu_bacteria | 2844315083 | 2844316540 | 229 |
| 407 | iso_pu_bacteria | 2903727486 | 2903731402 | 229 |
| 408 | iso_pu_bacteria | 2906602504 | 2906603776 | 229 |
| 409 | iso_pu_bacteria | 2932794094 | 2932795744 | 229 |
| 410 | iso_pu_bacteria | 2932801729 | 2932801982 | 229 |
| 411 | iso_pu_bacteria | 2935883170 | 2935886170 | 229 |
| 412 | iso_pu_bacteria | 2941531003 | 2941537005 | 229 |
| 413 | iso_pu_bacteria | 3005594810 | 3005596170 | 229 |
| 414 | iso_pu_bacteria | 3005718088 | 3005719350 | 229 |
| 415 | iso_pu_bacteria | 8019648815 | 8019650393 | 229 |
| 416 | iso_pu_bacteria | 8056967851 | 8056973848 | 229 |
| 417 | 3300005435 | Ga0070714_100156494 | Ga0070714_1001564942 | 230 |
| 418 | 3300005436 | Ga0070713_100071226 | Ga0070713_1000712262 | 230 |
| 419 | 3300005983 | Ga0081540_1110169 | Ga0081540_11101692 | 230 |
| 420 | 3300009545 | Ga0105237_10159053 | Ga0105237_101590532 | 230 |
| 421 | 3300009553 | Ga0105249_10281311 | Ga0105249_102813112 | 230 |
| 422 | 3300009553 | Ga0105249_11109305 | Ga0105249_111093051 | 230 |
| 423 | 3300013105 | Ga0157369_10026923 | Ga0157369_1002692310 | 230 |
| 424 | 3300020069 | Ga0197907_11028214 | Ga0197907_110282143 | 230 |
| 425 | 3300022467 | Ga0224712_10030820 | Ga0224712_100308201 | 230 |
| 426 | 3300025904 | Ga0207647_10095057 | Ga0207647_100950573 | 230 |
| 427 | 3300025904 | Ga0207647_10186038 | Ga0207647_101860382 | 230 |
| 428 | 3300025904 | Ga0207647_10249166 | Ga0207647_102491662 | 230 |
| 429 | 3300025907 | Ga0207645_10146099 | Ga0207645_101460992 | 230 |
| 430 | 3300025913 | Ga0207695_10217169 | Ga0207695_102171693 | 230 |
| 431 | 3300025928 | Ga0207700_10074358 | Ga0207700_100743582 | 230 |
| 432 | 3300025929 | Ga0207664_10076768 | Ga0207664_100767683 | 230 |
| 433 | 3300025961 | Ga0207712_10093050 | Ga0207712_100930503 | 230 |
| 434 | 3300026118 | Ga0207675_100021098 | Ga0207675_1000210984 | 230 |
| 435 | 3300028381 | Ga0268264_10155104 | Ga0268264_101551043 | 230 |
| 436 | 3300033442 | Ga0315911_1000041 | Ga0315911_100004118 | 230 |
| 437 | 3300048913 | Ga0496110_0070020 | Ga0496110_0070020_1766_2485 | 230 |
| 438 | 3300048924 | Ga0496121_0047906 | Ga0496121_0047906_1860_2579 | 230 |
| 439 | 3300048929 | Ga0496126_0037396 | Ga0496126_0037396_1472_2191 | 230 |
| 440 | 3300049588 | Ga0501072_0300148 | Ga0501072_0300148_267_1004 | 230 |
| 441 | iso_pu_bacteria | 2507262055 | 2507511372 | 230 |
| 442 | iso_pu_bacteria | 2508501009 | 2508545166 | 230 |
| 443 | iso_pu_bacteria | 2508501042 | 2508694009 | 230 |
| 444 | iso_pu_bacteria | 2508501114 | 2509074743 | 230 |
| 445 | iso_pu_bacteria | 2511231028 | 2511394253 | 230 |
| 446 | iso_pu_bacteria | 2513237092 | 2513624147 | 230 |
| 447 | iso_pu_bacteria | 2513237095 | 2513648539 | 230 |
| 448 | iso_pu_bacteria | 2513237102 | 2513702622 | 230 |
| 449 | iso_pu_bacteria | 2517093001 | 2517101114 | 230 |
| 450 | iso_pu_bacteria | 2524023205 | 2524439944 | 230 |
| 451 | iso_pu_bacteria | 2528768022 | 2528853992 | 230 |
| 452 | iso_pu_bacteria | 2617270735 | 2617348475 | 230 |
| 453 | iso_pu_bacteria | 2617270741 | 2617375020 | 230 |
| 454 | iso_pu_bacteria | 2744054633 | 2745075775 | 230 |
| 455 | iso_pu_bacteria | 2791355196 | 2793061666 | 230 |
| 456 | iso_pu_bacteria | 2816332527 | 2818243421 | 230 |
| 457 | iso_pu_bacteria | 2824600985 | 2824609163 | 230 |
| 458 | iso_pu_bacteria | 2824609381 | 2824616848 | 230 |
| 459 | iso_pu_bacteria | 2824617872 | 2824624998 | 230 |
| 460 | iso_pu_bacteria | 2824626560 | 2824633865 | 230 |
| 461 | iso_pu_bacteria | 2824635225 | 2824641021 | 230 |
| 462 | iso_pu_bacteria | 2824644064 | 2824651537 | 230 |
| 463 | iso_pu_bacteria | 2824653114 | 2824661142 | 230 |
| 464 | iso_pu_bacteria | 2824661429 | 2824668414 | 230 |
| 465 | iso_pu_bacteria | 2824679649 | 2824683647 | 230 |
| 466 | iso_pu_bacteria | 2824704595 | 2824711470 | 230 |
| 467 | iso_pu_bacteria | 2824714736 | 2824721520 | 230 |
| 468 | iso_pu_bacteria | 2824723954 | 2824728288 | 230 |
| 469 | iso_pu_bacteria | 2824732956 | 2824739573 | 230 |
| 470 | iso_pu_bacteria | 2824746037 | 2824751854 | 230 |
| 471 | iso_pu_bacteria | 2824753945 | 2824754185 | 230 |
| 472 | iso_pu_bacteria | 2824763712 | 2824773242 | 230 |
| 473 | iso_pu_bacteria | 2824773399 | 2824780583 | 230 |
| 474 | iso_pu_bacteria | 2841957949 | 2841961530 | 230 |
| 475 | iso_pu_bacteria | 2842038055 | 2842042336 | 230 |
| 476 | iso_pu_bacteria | 2842045827 | 2842050379 | 230 |
| 477 | iso_pu_bacteria | 2847930680 | 2847939150 | 230 |
| 478 | iso_pu_bacteria | 2849076700 | 2849081872 | 230 |
| 479 | iso_pu_bacteria | 2857509624 | 2857512631 | 230 |
| 480 | iso_pu_bacteria | 2874612657 | 2874613957 | 230 |
| 481 | iso_pu_bacteria | 2874620515 | 2874625617 | 230 |
| 482 | iso_pu_bacteria | 2874628541 | 2874633719 | 230 |
| 483 | iso_pu_bacteria | 2876761206 | 2876766327 | 230 |
| 484 | iso_pu_bacteria | 2879083081 | 2879084622 | 230 |
| 485 | iso_pu_bacteria | 2879099564 | 2879100819 | 230 |
| 486 | iso_pu_bacteria | 2881364244 | 2881367322 | 230 |
| 487 | iso_pu_bacteria | 2881665667 | 2881668712 | 230 |
| 488 | iso_pu_bacteria | 2885366525 | 2885373763 | 230 |
| 489 | iso_pu_bacteria | 2888378607 | 2888386926 | 230 |
| 490 | iso_pu_bacteria | 2888388044 | 2888389621 | 230 |
| 491 | iso_pu_bacteria | 2888419890 | 2888421467 | 230 |
| 492 | iso_pu_bacteria | 2904666416 | 2904673563 | 230 |
| 493 | iso_pu_bacteria | 2904711408 | 2904719516 | 230 |
| 494 | iso_pu_bacteria | 2906626472 | 2906626723 | 230 |
| 495 | iso_pu_bacteria | 2906643746 | 2906646122 | 230 |
| 496 | iso_pu_bacteria | 2908775508 | 2908777504 | 230 |
| 497 | iso_pu_bacteria | 2922368715 | 2922377058 | 230 |
| 498 | iso_pu_bacteria | 2922393267 | 2922398212 | 230 |
| 499 | iso_pu_bacteria | 2929615660 | 2929619109 | 230 |
| 500 | iso_pu_bacteria | 2929624759 | 2929628396 | 230 |
| 501 | iso_pu_bacteria | 2932784394 | 2932791316 | 230 |
| 502 | iso_pu_bacteria | 2932809354 | 2932817658 | 230 |
| 503 | iso_pu_bacteria | 2932818245 | 2932826944 | 230 |
| 504 | iso_pu_bacteria | 2932828146 | 2932833115 | 230 |
| 505 | iso_pu_bacteria | 2933577622 | 2933581031 | 230 |
| 506 | iso_pu_bacteria | 2935608549 | 2935612301 | 230 |
| 507 | iso_pu_bacteria | 2935616580 | 2935623844 | 230 |
| 508 | iso_pu_bacteria | 2935638405 | 2935639619 | 230 |
| 509 | iso_pu_bacteria | 2935648319 | 2935650141 | 230 |
| 510 | iso_pu_bacteria | 2935656913 | 2935658288 | 230 |
| 511 | iso_pu_bacteria | 2935665750 | 2935667542 | 230 |
| 512 | iso_pu_bacteria | 2935675223 | 2935682895 | 230 |
| 513 | iso_pu_bacteria | 2935684952 | 2935687558 | 230 |
| 514 | iso_pu_bacteria | 2935694250 | 2935696470 | 230 |
| 515 | iso_pu_bacteria | 2935703347 | 2935705283 | 230 |
| 516 | iso_pu_bacteria | 2935713505 | 2935719018 | 230 |
| 517 | iso_pu_bacteria | 2935722832 | 2935728670 | 230 |
| 518 | iso_pu_bacteria | 2935732158 | 2935736734 | 230 |
| 519 | iso_pu_bacteria | 2935741537 | 2935746264 | 230 |
| 520 | iso_pu_bacteria | 2935750917 | 2935753524 | 230 |
| 521 | iso_pu_bacteria | 2935760218 | 2935767721 | 230 |
| 522 | iso_pu_bacteria | 2935769743 | 2935770483 | 230 |
| 523 | iso_pu_bacteria | 2935777560 | 2935782490 | 230 |
| 524 | iso_pu_bacteria | 2935785616 | 2935786464 | 230 |
| 525 | iso_pu_bacteria | 2935793552 | 2935794519 | 230 |
| 526 | iso_pu_bacteria | 2935801545 | 2935807028 | 230 |
| 527 | iso_pu_bacteria | 2935810662 | 2935814057 | 230 |
| 528 | iso_pu_bacteria | 2935819856 | 2935823789 | 230 |
| 529 | iso_pu_bacteria | 2935827899 | 2935829101 | 230 |
| 530 | iso_pu_bacteria | 2935837841 | 2935845364 | 230 |
| 531 | iso_pu_bacteria | 2935847175 | 2935854427 | 230 |
| 532 | iso_pu_bacteria | 2935855204 | 2935861931 | 230 |
| 533 | iso_pu_bacteria | 2935864058 | 2935872819 | 230 |
| 534 | iso_pu_bacteria | 2935873716 | 2935880394 | 230 |
| 535 | iso_pu_bacteria | 2935908558 | 2935913479 | 230 |
| 536 | iso_pu_bacteria | 2935916978 | 2935923376 | 230 |
| 537 | iso_pu_bacteria | 2935926038 | 2935931204 | 230 |
| 538 | iso_pu_bacteria | 2935934488 | 2935935486 | 230 |
| 539 | iso_pu_bacteria | 2935942939 | 2935947052 | 230 |
| 540 | iso_pu_bacteria | 2935951376 | 2935953853 | 230 |
| 541 | iso_pu_bacteria | 2935959822 | 2935961510 | 230 |
| 542 | iso_pu_bacteria | 2935967501 | 2935968879 | 230 |
| 543 | iso_pu_bacteria | 2935984226 | 2935985920 | 230 |
| 544 | iso_pu_bacteria | 2935992306 | 2935995004 | 230 |
| 545 | iso_pu_bacteria | 2936002035 | 2936006097 | 230 |
| 546 | iso_pu_bacteria | 2936011229 | 2936013300 | 230 |
| 547 | iso_pu_bacteria | 2936019824 | 2936021613 | 230 |
| 548 | iso_pu_bacteria | 2936028420 | 2936030593 | 230 |
| 549 | iso_pu_bacteria | 2936037263 | 2936039612 | 230 |
| 550 | iso_pu_bacteria | 2936046547 | 2936047807 | 230 |
| 551 | iso_pu_bacteria | 2936055302 | 2936057809 | 230 |
| 552 | iso_pu_bacteria | 2940556831 | 2940559437 | 230 |
| 553 | iso_pu_bacteria | 2941538514 | 2941545665 | 230 |
| 554 | iso_pu_bacteria | 3005483717 | 3005489140 | 230 |
| 555 | iso_pu_bacteria | 3005506211 | 3005511194 | 230 |
| 556 | iso_pu_bacteria | 3005587118 | 3005592045 | 230 |
| 557 | iso_pu_bacteria | 3005710791 | 3005712109 | 230 |
| 558 | iso_pu_bacteria | 8016511872 | 8016516924 | 230 |
| 559 | iso_pu_bacteria | 8016522445 | 8016524504 | 230 |
| 560 | iso_pu_bacteria | 8016530956 | 8016538064 | 230 |
| 561 | iso_pu_bacteria | 8016539877 | 8016542340 | 230 |
| 562 | iso_pu_bacteria | 8016548790 | 8016550937 | 230 |
| 563 | iso_pu_bacteria | 8016557553 | 8016559350 | 230 |
| 564 | iso_pu_bacteria | 8016566248 | 8016567727 | 230 |
| 565 | iso_pu_bacteria | 8016575299 | 8016580421 | 230 |
| 566 | iso_pu_bacteria | 8016583857 | 8016588631 | 230 |
| 567 | iso_pu_bacteria | 8016595262 | 8016597291 | 230 |
| 568 | iso_pu_bacteria | 8016603502 | 8016604968 | 230 |
| 569 | iso_pu_bacteria | 8016613128 | 8016620043 | 230 |
| 570 | iso_pu_bacteria | 8016622563 | 8016624262 | 230 |
| 571 | iso_pu_bacteria | 8016630954 | 8016637671 | 230 |
| 572 | iso_pu_bacteria | 8017057580 | 8017059646 | 230 |
| 573 | iso_pu_bacteria | 8019530166 | 8019537732 | 230 |
| 574 | iso_pu_bacteria | 8019538911 | 8019539362 | 230 |
| 575 | iso_pu_bacteria | 8019576017 | 8019579120 | 230 |
| 576 | iso_pu_bacteria | 8019586578 | 8019597174 | 230 |
| 577 | iso_pu_bacteria | 8019597564 | 8019604517 | 230 |
| 578 | iso_pu_bacteria | 8019687851 | 8019694562 | 230 |
| 579 | iso_pu_bacteria | 8055742211 | 8055749633 | 230 |
| 580 | 3300003203 | JGI25406J46586_10029632 | JGI25406J46586_100296322 | 231 |
| 581 | 3300005985 | Ga0081539_10000958 | Ga0081539_100009587 | 231 |
| 582 | 3300006871 | Ga0075434_100006045 | Ga0075434_1000060455 | 231 |
| 583 | 3300013296 | Ga0157374_10022044 | Ga0157374_100220449 | 231 |
| 584 | 3300025915 | Ga0207693_10300721 | Ga0207693_103007212 | 231 |
| 585 | 3300031616 | Ga0307508_10144279 | Ga0307508_101442792 | 231 |
| 586 | 3300032005 | Ga0307411_10102847 | Ga0307411_101028472 | 231 |
| 587 | 3300035121 | Ga0373960_0132965 | Ga0373960_0132965_96_812 | 231 |
| 588 | 3300046528 | Ga0495642_0032875 | Ga0495642_0032875_966_1685 | 231 |
| 589 | 3300046648 | Ga0495611_0017586 | Ga0495611_0017586_449_1168 | 231 |
| 590 | 3300047469 | Ga0495673_0042363 | Ga0495673_0042363_25_744 | 231 |
| 591 | 3300047469 | Ga0495673_0043580 | Ga0495673_0043580_474_1193 | 231 |
| 592 | 3300048929 | Ga0496126_0467551 | Ga0496126_0467551_263_982 | 231 |
| 593 | 3300050512 | nmdc:mga0n895_8338_c1 | nmdc:mga0n895_8338_c1_3749_4456 | 231 |
| 594 | 3300053096 | Ga0500641_0097233 | Ga0500641_0097233_472_1191 | 231 |
| 595 | 3300053116 | Ga0500592_024540 | Ga0500592_024540_236_955 | 231 |
| 596 | 3300053124 | Ga0500617_148009 | Ga0500617_148009_138_857 | 231 |
| 597 | 3300053143 | Ga0500579_114888 | Ga0500579_114888_297_1016 | 231 |
| 598 | 3300053148 | Ga0500590_040995 | Ga0500590_040995_148_867 | 231 |
| 599 | 3300053158 | Ga0500627_0030431 | Ga0500627_0030431_1165_1884 | 231 |
| 600 | 3300053160 | Ga0500633_0022583 | Ga0500633_0022583_765_1484 | 231 |
| 601 | 3300053731 | Ga0500609_004261 | Ga0500609_004261_385_1104 | 231 |
| 602 | iso_pu_bacteria | 2508501128 | 2509146650 | 231 |
| 603 | 3300005355 | Ga0070671_100273068 | Ga0070671_1002730682 | 232 |
| 604 | 3300005367 | Ga0070667_100125652 | Ga0070667_1001256522 | 232 |
| 605 | 3300005577 | Ga0068857_100178355 | Ga0068857_1001783551 | 232 |
| 606 | 3300005614 | Ga0068856_100131687 | Ga0068856_1001316873 | 232 |
| 607 | 3300006177 | Ga0075362_10028330 | Ga0075362_100283301 | 232 |
| 608 | 3300009093 | Ga0105240_10339230 | Ga0105240_103392302 | 232 |
| 609 | 3300009147 | Ga0114129_10419060 | Ga0114129_104190602 | 232 |
| 610 | 3300013104 | Ga0157370_10230358 | Ga0157370_102303582 | 232 |
| 611 | 3300013105 | Ga0157369_10013948 | Ga0157369_100139481 | 232 |
| 612 | 3300013307 | Ga0157372_10078452 | Ga0157372_100784523 | 232 |
| 613 | 3300020080 | Ga0206350_11646629 | Ga0206350_116466293 | 232 |
| 614 | 3300020081 | Ga0206354_10138454 | Ga0206354_101384541 | 232 |
| 615 | 3300025931 | Ga0207644_10360358 | Ga0207644_103603582 | 232 |
| 616 | 3300026116 | Ga0207674_10147250 | Ga0207674_101472501 | 232 |
| 617 | 3300031616 | Ga0307508_10000063 | Ga0307508_100000632 | 232 |
| 618 | 3300031616 | Ga0307508_10162486 | Ga0307508_101624861 | 232 |
| 619 | 3300032002 | Ga0307416_100721809 | Ga0307416_1007218091 | 232 |
| 620 | 3300035089 | Ga0373944_0038867 | Ga0373944_0038867_649_1368 | 232 |
| 621 | 3300035725 | Ga0373947_0275424 | Ga0373947_0275424_113_832 | 232 |
| 622 | 3300046455 | Ga0495603_0062571 | Ga0495603_0062571_765_1484 | 232 |
| 623 | 3300046501 | Ga0495607_0165028 | Ga0495607_0165028_337_1053 | 232 |
| 624 | 3300046558 | Ga0495633_0139616 | Ga0495633_0139616_44_763 | 232 |
| 625 | 3300046664 | Ga0495659_0080509 | Ga0495659_0080509_168_887 | 232 |
| 626 | 3300048912 | Ga0496109_0009612 | Ga0496109_0009612_6821_7540 | 232 |
| 627 | 3300048913 | Ga0496110_0083574 | Ga0496110_0083574_1294_2013 | 232 |
| 628 | 3300048914 | Ga0496111_0001105 | Ga0496111_0001105_7009_7728 | 232 |
| 629 | 3300048915 | Ga0496112_0013107 | Ga0496112_0013107_3707_4426 | 232 |
| 630 | 3300048916 | Ga0496113_0002366 | Ga0496113_0002366_3249_3968 | 232 |
| 631 | 3300048918 | Ga0496115_0009221 | Ga0496115_0009221_3112_3831 | 232 |
| 632 | 3300050507 | nmdc:mga05p37_734481_c1 | nmdc:mga05p37_734481_c1_195_914 | 232 |
| 633 | 3300059426 | Ga0590077_025092 | Ga0590077_025092_417_1148 | 232 |
| 634 | iso_pu_bacteria | 2513237104 | 2513717832 | 232 |
| 635 | iso_pu_bacteria | 2513237141 | 2513887693 | 232 |
| 636 | iso_pu_bacteria | 8006933436 | 8006934816 | 232 |
| 637 | iso_pu_bacteria | 8006973647 | 8006974784 | 232 |
| 638 | 3300003215 | JGI25153J46596_10038013 | JGI25153J46596_100380131 | 233 |
| 639 | 3300005435 | Ga0070714_100220629 | Ga0070714_1002206292 | 233 |
| 640 | 3300005546 | Ga0070696_100086014 | Ga0070696_1000860142 | 233 |
| 641 | 3300009094 | Ga0111539_10004709 | Ga0111539_100047098 | 233 |
| 642 | 3300009147 | Ga0114129_11206551 | Ga0114129_112065511 | 233 |
| 643 | 3300009551 | Ga0105238_10292697 | Ga0105238_102926973 | 233 |
| 644 | 3300025254 | Ga0209148_1000900 | Ga0209148_10009007 | 233 |
| 645 | 3300025261 | Ga0209233_1003397 | Ga0209233_10033972 | 233 |
| 646 | 3300025272 | Ga0209455_1004957 | Ga0209455_10049576 | 233 |
| 647 | 3300025297 | Ga0209758_1006083 | Ga0209758_10060838 | 233 |
| 648 | 3300025922 | Ga0207646_10105609 | Ga0207646_101056092 | 233 |
| 649 | 3300025924 | Ga0207694_10100380 | Ga0207694_101003802 | 233 |
| 650 | 3300025929 | Ga0207664_10027347 | Ga0207664_100273475 | 233 |
| 651 | 3300027907 | Ga0207428_10000153 | Ga0207428_1000015370 | 233 |
| 652 | 3300037853 | Ga0436364_0322463 | Ga0436364_0322463_209_910 | 233 |
| 653 | 3300044658 | Ga0466972_0010885 | Ga0466972_0010885_1069_1782 | 233 |
| 654 | 3300044684 | Ga0466966_0052188 | Ga0466966_0052188_465_1166 | 233 |
| 655 | 3300044693 | Ga0466961_0000311 | Ga0466961_0000311_505_1206 | 233 |
| 656 | 3300044735 | Ga0466968_0002021 | Ga0466968_0002021_4733_5446 | 233 |
| 657 | 3300044901 | Ga0466960_0010159 | Ga0466960_0010159_592_1305 | 233 |
| 658 | 3300045049 | Ga0466959_0052297 | Ga0466959_0052297_2016_2717 | 233 |
| 659 | 3300046459 | Ga0495629_0000913 | Ga0495629_0000913_15782_16483 | 233 |
| 660 | 3300046462 | Ga0495651_0052377 | Ga0495651_0052377_2224_2925 | 233 |
| 661 | 3300046474 | Ga0495605_0216166 | Ga0495605_0216166_14_715 | 233 |
| 662 | 3300046476 | Ga0495662_0136179 | Ga0495662_0136179_402_1103 | 233 |
| 663 | 3300046507 | Ga0495606_0005723 | Ga0495606_0005723_1109_1813 | 233 |
| 664 | 3300046511 | Ga0495608_0077014 | Ga0495608_0077014_227_928 | 233 |
| 665 | 3300046515 | Ga0495620_0119015 | Ga0495620_0119015_107_808 | 233 |
| 666 | 3300046517 | Ga0495630_0579363 | Ga0495630_0579363_103_804 | 233 |
| 667 | 3300046524 | Ga0495648_0111763 | Ga0495648_0111763_260_961 | 233 |
| 668 | 3300046533 | Ga0495640_0050334 | Ga0495640_0050334_220_921 | 233 |
| 669 | 3300046538 | Ga0495609_0072648 | Ga0495609_0072648_255_956 | 233 |
| 670 | 3300046660 | Ga0495625_0077443 | Ga0495625_0077443_367_1068 | 233 |
| 671 | 3300046683 | Ga0495658_0327898 | Ga0495658_0327898_110_811 | 233 |
| 672 | 3300046690 | Ga0495624_0242967 | Ga0495624_0242967_82_783 | 233 |
| 673 | 3300047321 | Ga0495676_0145248 | Ga0495676_0145248_168_869 | 233 |
| 674 | 3300048907 | Ga0496104_0031565 | Ga0496104_0031565_3921_4622 | 233 |
| 675 | 3300048922 | Ga0496119_0010049 | Ga0496119_0010049_1946_2647 | 233 |
| 676 | 3300048929 | Ga0496126_0016331 | Ga0496126_0016331_2871_3572 | 233 |
| 677 | 3300050511 | nmdc:mga08y16_34_c1 | nmdc:mga08y16_34_c1_55839_56573 | 233 |
| 678 | 3300053085 | Ga0495619_0133930 | Ga0495619_0133930_769_1470 | 233 |
| 679 | 3300053119 | Ga0500595_019669 | Ga0500595_019669_1267_1968 | 233 |
| 680 | 3300053136 | Ga0500559_0062637 | Ga0500559_0062637_787_1488 | 233 |
| 681 | 3300061719 | Ga0466962_0186089 | Ga0466962_0186089_248_949 | 233 |
| 682 | iso_pu_bacteria | 2513237096 | 2513656083 | 233 |
| 683 | iso_pu_bacteria | 2513237137 | 2513862889 | 233 |
| 684 | iso_pu_bacteria | 2513237145 | 2513920908 | 233 |
| 685 | iso_pu_bacteria | 2517572143 | 2517895904 | 233 |
| 686 | iso_pu_bacteria | 2524023228 | 2524534772 | 233 |
| 687 | iso_pu_bacteria | 2602042107 | 2603857526 | 233 |
| 688 | iso_pu_bacteria | 2667528175 | 2671122695 | 233 |
| 689 | iso_pu_bacteria | 2671180139 | 2671693394 | 233 |
| 690 | iso_pu_bacteria | 2728368998 | 2728754209 | 233 |
| 691 | iso_pu_bacteria | 2791355197 | 2793069670 | 233 |
| 692 | iso_pu_bacteria | 2857524615 | 2857526913 | 233 |
| 693 | iso_pu_bacteria | 2876808645 | 2876809978 | 233 |
| 694 | iso_pu_bacteria | 2879110137 | 2879113715 | 233 |
| 695 | iso_pu_bacteria | 2885374607 | 2885377854 | 233 |
| 696 | iso_pu_bacteria | 2893066018 | 2893070070 | 233 |
| 697 | iso_pu_bacteria | 2903748898 | 2903756009 | 233 |
| 698 | iso_pu_bacteria | 2904690495 | 2904693383 | 233 |
| 699 | iso_pu_bacteria | 2904699407 | 2904707037 | 233 |
| 700 | iso_pu_bacteria | 2906610324 | 2906615631 | 233 |
| 701 | iso_pu_bacteria | 2906635258 | 2906635584 | 233 |
| 702 | iso_pu_bacteria | 2906660503 | 2906665064 | 233 |
| 703 | iso_pu_bacteria | 2908739725 | 2908745548 | 233 |
| 704 | iso_pu_bacteria | 2908756301 | 2908763537 | 233 |
| 705 | iso_pu_bacteria | 2919073203 | 2919078030 | 233 |
| 706 | iso_pu_bacteria | 2922425934 | 2922432375 | 233 |
| 707 | iso_pu_bacteria | 2935630451 | 2935630797 | 233 |
| 708 | iso_pu_bacteria | 2941507105 | 2941507449 | 233 |
| 709 | iso_pu_bacteria | 2941515067 | 2941515876 | 233 |
| 710 | iso_pu_bacteria | 2941523033 | 2941523416 | 233 |
| 711 | iso_pu_bacteria | 3005474847 | 3005476663 | 233 |
| 712 | iso_pu_bacteria | 8019555841 | 8019563838 | 233 |
| 713 | iso_pu_bacteria | 8019565922 | 8019573907 | 233 |
| 714 | 3300003162 | Ga0006778J45830_1005206 | Ga0006778J45830_10052061 | 234 |
| 715 | 3300003214 | JGI25165J46597_1004533 | JGI25165J46597_10045332 | 234 |
| 716 | 3300003215 | JGI25153J46596_10001736 | JGI25153J46596_1000173615 | 234 |
| 717 | 3300003215 | JGI25153J46596_10003826 | JGI25153J46596_1000382610 | 234 |
| 718 | 3300003215 | JGI25153J46596_10004140 | JGI25153J46596_100041403 | 234 |
| 719 | 3300003215 | JGI25153J46596_10011700 | JGI25153J46596_100117004 | 234 |
| 720 | 3300003354 | JGI25160J50197_1002670 | JGI25160J50197_10026702 | 234 |
| 721 | 3300003354 | JGI25160J50197_1009335 | JGI25160J50197_10093352 | 234 |
| 722 | 3300003544 | Ga0007417J51691_1021109 | Ga0007417J51691_10211091 | 234 |
| 723 | 3300003568 | Ga0006781J51513_1004680 | Ga0006781J51513_10046801 | 234 |
| 724 | 3300003577 | Ga0007416J51690_1011819 | Ga0007416J51690_10118191 | 234 |
| 725 | 3300003579 | Ga0007429J51699_1006648 | Ga0007429J51699_10066481 | 234 |
| 726 | 3300003693 | Ga0032354_1001469 | Ga0032354_10014691 | 234 |
| 727 | 3300003735 | Ga0006780_1000642 | Ga0006780_10006421 | 234 |
| 728 | 3300003752 | Ga0055539_1013566 | Ga0055539_10135661 | 234 |
| 729 | 3300003775 | Ga0055524_1029581 | Ga0055524_10295812 | 234 |
| 730 | 3300003794 | Ga0055531_10006809 | Ga0055531_100068094 | 234 |
| 731 | 3300003911 | JGI25405J52794_10040334 | JGI25405J52794_100403342 | 234 |
| 732 | 3300004625 | Ga0055543_1005069 | Ga0055543_10050693 | 234 |
| 733 | 3300005262 | Ga0065165_1001376 | Ga0065165_100137621 | 234 |
| 734 | 3300005262 | Ga0065165_1003381 | Ga0065165_10033816 | 234 |
| 735 | 3300005262 | Ga0065165_1006721 | Ga0065165_10067214 | 234 |
| 736 | 3300005262 | Ga0065165_1042564 | Ga0065165_10425642 | 234 |
| 737 | 3300005347 | Ga0070668_100027694 | Ga0070668_1000276946 | 234 |
| 738 | 3300005355 | Ga0070671_100045130 | Ga0070671_1000451304 | 234 |
| 739 | 3300005366 | Ga0070659_100519196 | Ga0070659_1005191962 | 234 |
| 740 | 3300005455 | Ga0070663_100067660 | Ga0070663_1000676602 | 234 |
| 741 | 3300005548 | Ga0070665_100082234 | Ga0070665_1000822342 | 234 |
| 742 | 3300005564 | Ga0070664_100291013 | Ga0070664_1002910133 | 234 |
| 743 | 3300005578 | Ga0068854_100201872 | Ga0068854_1002018722 | 234 |
| 744 | 3300005614 | Ga0068856_100425696 | Ga0068856_1004256962 | 234 |
| 745 | 3300005614 | Ga0068856_100552487 | Ga0068856_1005524872 | 234 |
| 746 | 3300005616 | Ga0068852_100835030 | Ga0068852_1008350301 | 234 |
| 747 | 3300005842 | Ga0068858_100094941 | Ga0068858_1000949414 | 234 |
| 748 | 3300005983 | Ga0081540_1010413 | Ga0081540_10104131 | 234 |
| 749 | 3300006051 | Ga0075364_10031891 | Ga0075364_100318913 | 234 |
| 750 | 3300006178 | Ga0075367_10058666 | Ga0075367_100586663 | 234 |
| 751 | 3300006186 | Ga0075369_10021528 | Ga0075369_100215282 | 234 |
| 752 | 3300006195 | Ga0075366_10036160 | Ga0075366_100361602 | 234 |
| 753 | 3300006353 | Ga0075370_10043400 | Ga0075370_100434003 | 234 |
| 754 | 3300006942 | Ga0099824_1013868 | Ga0099824_101386810 | 234 |
| 755 | 3300006942 | Ga0099824_1013868 | Ga0099824_10138689 | 234 |
| 756 | 3300006943 | Ga0099822_1054877 | Ga0099822_10548772 | 234 |
| 757 | 3300006944 | Ga0099823_1032665 | Ga0099823_10326658 | 234 |
| 758 | 3300009148 | Ga0105243_10088252 | Ga0105243_100882522 | 234 |
| 759 | 3300009177 | Ga0105248_10113191 | Ga0105248_101131914 | 234 |
| 760 | 3300009545 | Ga0105237_10033065 | Ga0105237_100330654 | 234 |
| 761 | 3300009545 | Ga0105237_10072458 | Ga0105237_100724582 | 234 |
| 762 | 3300013308 | Ga0157375_10174904 | Ga0157375_101749044 | 234 |
| 763 | 3300015261 | Ga0182006_1087717 | Ga0182006_10877172 | 234 |
| 764 | 3300020081 | Ga0206354_10070692 | Ga0206354_100706921 | 234 |
| 765 | 3300021320 | Ga0214544_1000005 | Ga0214544_1000005170 | 234 |
| 766 | 3300021321 | Ga0214542_1000004 | Ga0214542_1000004174 | 234 |
| 767 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005223 | 234 |
| 768 | 3300021327 | Ga0214543_1000564 | Ga0214543_100056459 | 234 |
| 769 | 3300022467 | Ga0224712_10139776 | Ga0224712_101397761 | 234 |
| 770 | 3300025253 | Ga0209677_106176 | Ga0209677_1061764 | 234 |
| 771 | 3300025261 | Ga0209233_1001052 | Ga0209233_10010524 | 234 |
| 772 | 3300025273 | Ga0209673_1015590 | Ga0209673_10155904 | 234 |
| 773 | 3300025295 | Ga0209564_1003825 | Ga0209564_100382510 | 234 |
| 774 | 3300025295 | Ga0209564_1012222 | Ga0209564_10122223 | 234 |
| 775 | 3300025297 | Ga0209758_1000102 | Ga0209758_100010249 | 234 |
| 776 | 3300025297 | Ga0209758_1001188 | Ga0209758_100118811 | 234 |
| 777 | 3300025297 | Ga0209758_1001605 | Ga0209758_100160513 | 234 |
| 778 | 3300025297 | Ga0209758_1004134 | Ga0209758_10041344 | 234 |
| 779 | 3300025299 | Ga0209256_1013127 | Ga0209256_10131274 | 234 |
| 780 | 3300025302 | Ga0207426_1000354 | Ga0207426_100035437 | 234 |
| 781 | 3300025302 | Ga0207426_1003427 | Ga0207426_10034273 | 234 |
| 782 | 3300025302 | Ga0207426_1004280 | Ga0207426_10042802 | 234 |
| 783 | 3300025304 | Ga0209257_1001262 | Ga0209257_10012624 | 234 |
| 784 | 3300025304 | Ga0209257_1064884 | Ga0209257_10648841 | 234 |
| 785 | 3300025901 | Ga0207688_10090991 | Ga0207688_100909913 | 234 |
| 786 | 3300025904 | Ga0207647_10019007 | Ga0207647_100190073 | 234 |
| 787 | 3300025914 | Ga0207671_10098760 | Ga0207671_100987601 | 234 |
| 788 | 3300025914 | Ga0207671_10411173 | Ga0207671_104111731 | 234 |
| 789 | 3300025941 | Ga0207711_10786049 | Ga0207711_107860491 | 234 |
| 790 | 3300025949 | Ga0207667_10166711 | Ga0207667_101667112 | 234 |
| 791 | 3300025949 | Ga0207667_10679273 | Ga0207667_106792731 | 234 |
| 792 | 3300025986 | Ga0207658_10093331 | Ga0207658_100933314 | 234 |
| 793 | 3300026023 | Ga0207677_10369299 | Ga0207677_103692992 | 234 |
| 794 | 3300026041 | Ga0207639_10169613 | Ga0207639_101696134 | 234 |
| 795 | 3300026088 | Ga0207641_10186155 | Ga0207641_101861553 | 234 |
| 796 | 3300026118 | Ga0207675_100125057 | Ga0207675_1001250572 | 234 |
| 797 | 3300027296 | Ga0209389_1000021 | Ga0209389_100002115 | 234 |
| 798 | 3300027296 | Ga0209389_1000086 | Ga0209389_100008673 | 234 |
| 799 | 3300027357 | Ga0209589_1000027 | Ga0209589_100002712 | 234 |
| 800 | 3300027361 | Ga0209489_100313 | Ga0209489_10031373 | 234 |
| 801 | 3300027361 | Ga0209489_105143 | Ga0209489_10514324 | 234 |
| 802 | 3300027363 | Ga0209700_100483 | Ga0209700_10048325 | 234 |
| 803 | 3300033180 | Ga0307510_10079158 | Ga0307510_100791585 | 234 |
| 804 | 3300037418 | Ga0395900_0025652 | Ga0395900_0025652_2977_3681 | 234 |
| 805 | 3300037418 | Ga0395900_0502955 | Ga0395900_0502955_316_1020 | 234 |
| 806 | 3300037471 | Ga0395905_0005393 | Ga0395905_0005393_8015_8731 | 234 |
| 807 | 3300038443 | Ga0395901_0180976 | Ga0395901_0180976_1179_1895 | 234 |
| 808 | 3300044658 | Ga0466972_0000268 | Ga0466972_0000268_4756_5460 | 234 |
| 809 | 3300044658 | Ga0466972_0232184 | Ga0466972_0232184_102_806 | 234 |
| 810 | 3300045976 | Ga0466967_0262376 | Ga0466967_0262376_683_1387 | 234 |
| 811 | 3300046460 | Ga0495638_0017480 | Ga0495638_0017480_2803_3507 | 234 |
| 812 | 3300046462 | Ga0495651_0018793 | Ga0495651_0018793_2032_2736 | 234 |
| 813 | 3300046471 | Ga0495650_0110791 | Ga0495650_0110791_172_876 | 234 |
| 814 | 3300046474 | Ga0495605_0059800 | Ga0495605_0059800_929_1633 | 234 |
| 815 | 3300046477 | Ga0495664_0036527 | Ga0495664_0036527_2121_2825 | 234 |
| 816 | 3300046506 | Ga0495583_0090772 | Ga0495583_0090772_318_1022 | 234 |
| 817 | 3300046522 | Ga0495643_0191416 | Ga0495643_0191416_133_837 | 234 |
| 818 | 3300046529 | Ga0495652_0021351 | Ga0495652_0021351_2997_3701 | 234 |
| 819 | 3300046542 | Ga0495597_0133670 | Ga0495597_0133670_37_741 | 234 |
| 820 | 3300046543 | Ga0495645_0006636 | Ga0495645_0006636_6900_7604 | 234 |
| 821 | 3300046559 | Ga0495667_0338480 | Ga0495667_0338480_125_829 | 234 |
| 822 | 3300046616 | Ga0495668_0053955 | Ga0495668_0053955_913_1617 | 234 |
| 823 | 3300046642 | Ga0495634_0226375 | Ga0495634_0226375_252_956 | 234 |
| 824 | 3300046674 | Ga0495588_0012745 | Ga0495588_0012745_1736_2440 | 234 |
| 825 | 3300046675 | Ga0495657_0023411 | Ga0495657_0023411_750_1454 | 234 |
| 826 | 3300046678 | Ga0495599_0023100 | Ga0495599_0023100_2055_2759 | 234 |
| 827 | 3300046679 | Ga0495623_0115298 | Ga0495623_0115298_53_757 | 234 |
| 828 | 3300046680 | Ga0495646_0254712 | Ga0495646_0254712_78_782 | 234 |
| 829 | 3300047319 | Ga0495674_0023635 | Ga0495674_0023635_1945_2649 | 234 |
| 830 | 3300047320 | Ga0495672_0242940 | Ga0495672_0242940_29_733 | 234 |
| 831 | 3300047321 | Ga0495676_0417388 | Ga0495676_0417388_49_753 | 234 |
| 832 | 3300047322 | Ga0495680_0006961 | Ga0495680_0006961_2873_3577 | 234 |
| 833 | 3300047323 | Ga0495683_0188214 | Ga0495683_0188214_112_816 | 234 |
| 834 | 3300047444 | Ga0495675_0016604 | Ga0495675_0016604_1665_2369 | 234 |
| 835 | 3300047447 | Ga0495685_152001 | Ga0495685_152001_30_734 | 234 |
| 836 | 3300047469 | Ga0495673_0038526 | Ga0495673_0038526_1404_2108 | 234 |
| 837 | 3300047472 | Ga0495686_0051010 | Ga0495686_0051010_1417_2121 | 234 |
| 838 | 3300048088 | Ga0495602_0048749 | Ga0495602_0048749_2681_3385 | 234 |
| 839 | 3300048091 | Ga0495626_0044330 | Ga0495626_0044330_956_1660 | 234 |
| 840 | 3300048903 | Ga0496100_0067873 | Ga0496100_0067873_886_1590 | 234 |
| 841 | 3300048905 | Ga0496102_0092413 | Ga0496102_0092413_637_1341 | 234 |
| 842 | 3300048906 | Ga0496103_0087932 | Ga0496103_0087932_135_839 | 234 |
| 843 | 3300048907 | Ga0496104_0057600 | Ga0496104_0057600_1801_2505 | 234 |
| 844 | 3300048908 | Ga0496105_0036534 | Ga0496105_0036534_1723_2427 | 234 |
| 845 | 3300048909 | Ga0496106_0135844 | Ga0496106_0135844_1019_1723 | 234 |
| 846 | 3300048910 | Ga0496107_0265871 | Ga0496107_0265871_397_1101 | 234 |
| 847 | 3300048911 | Ga0496108_0028405 | Ga0496108_0028405_848_1552 | 234 |
| 848 | 3300048912 | Ga0496109_0056204 | Ga0496109_0056204_983_1687 | 234 |
| 849 | 3300048913 | Ga0496110_0394115 | Ga0496110_0394115_504_1208 | 234 |
| 850 | 3300048915 | Ga0496112_0004212 | Ga0496112_0004212_6656_7360 | 234 |
| 851 | 3300048917 | Ga0496114_0175359 | Ga0496114_0175359_754_1458 | 234 |
| 852 | 3300048920 | Ga0496117_0260907 | Ga0496117_0260907_132_836 | 234 |
| 853 | 3300048921 | Ga0496118_0072041 | Ga0496118_0072041_1270_1974 | 234 |
| 854 | 3300048922 | Ga0496119_0059543 | Ga0496119_0059543_1406_2110 | 234 |
| 855 | 3300048923 | Ga0496120_0219816 | Ga0496120_0219816_154_858 | 234 |
| 856 | 3300048924 | Ga0496121_0009515 | Ga0496121_0009515_7060_7764 | 234 |
| 857 | 3300048924 | Ga0496121_0288475 | Ga0496121_0288475_324_1028 | 234 |
| 858 | 3300048927 | Ga0496124_0158870 | Ga0496124_0158870_519_1223 | 234 |
| 859 | 3300048928 | Ga0496125_0105823 | Ga0496125_0105823_132_836 | 234 |
| 860 | 3300048928 | Ga0496125_0151299 | Ga0496125_0151299_373_1077 | 234 |
| 861 | 3300048929 | Ga0496126_0059599 | Ga0496126_0059599_2307_3011 | 234 |
| 862 | 3300049460 | Ga0495682_0042087 | Ga0495682_0042087_695_1399 | 234 |
| 863 | 3300049573 | Ga0501037_0116571 | Ga0501037_0116571_922_1632 | 234 |
| 864 | 3300049822 | Ga0501035_0036075 | Ga0501035_0036075_733_1443 | 234 |
| 865 | 3300050491 | nmdc:mga00v17_23676_c1 | nmdc:mga00v17_23676_c1_1658_2362 | 234 |
| 866 | 3300050492 | nmdc:mga0yw44_96245_c1 | nmdc:mga0yw44_96245_c1_490_1194 | 234 |
| 867 | 3300050493 | nmdc:mga0k408_237919_c1 | nmdc:mga0k408_237919_c1_107_811 | 234 |
| 868 | 3300053084 | Ga0495595_0020690 | Ga0495595_0020690_1531_2235 | 234 |
| 869 | 3300053086 | Ga0500578_0155667 | Ga0500578_0155667_394_1098 | 234 |
| 870 | 3300053087 | Ga0500643_000016 | Ga0500643_000016_163962_164666 | 234 |
| 871 | 3300053090 | Ga0500646_0041940 | Ga0500646_0041940_484_1188 | 234 |
| 872 | 3300053094 | Ga0500566_0003091 | Ga0500566_0003091_7742_8446 | 234 |
| 873 | 3300053094 | Ga0500566_0105695 | Ga0500566_0105695_214_918 | 234 |
| 874 | 3300053096 | Ga0500641_0067011 | Ga0500641_0067011_414_1118 | 234 |
| 875 | 3300053103 | Ga0500555_008692 | Ga0500555_008692_2002_2706 | 234 |
| 876 | 3300053104 | Ga0500556_0064238 | Ga0500556_0064238_640_1344 | 234 |
| 877 | 3300053105 | Ga0500557_003716 | Ga0500557_003716_403_1107 | 234 |
| 878 | 3300053128 | Ga0500626_067116 | Ga0500626_067116_395_1099 | 234 |
| 879 | 3300053130 | Ga0500642_0000109 | Ga0500642_0000109_25871_26575 | 234 |
| 880 | 3300053136 | Ga0500559_0029582 | Ga0500559_0029582_265_969 | 234 |
| 881 | 3300053139 | Ga0500568_0045737 | Ga0500568_0045737_349_1053 | 234 |
| 882 | 3300053148 | Ga0500590_021786 | Ga0500590_021786_788_1492 | 234 |
| 883 | 3300053151 | Ga0500604_0062277 | Ga0500604_0062277_84_788 | 234 |
| 884 | 3300053153 | Ga0500616_0260809 | Ga0500616_0260809_22_726 | 234 |
| 885 | 3300053156 | Ga0500622_0025854 | Ga0500622_0025854_1191_1895 | 234 |
| 886 | 3300053161 | Ga0500634_0019449 | Ga0500634_0019449_1756_2460 | 234 |
| 887 | 3300053177 | Ga0500636_0036683 | Ga0500636_0036683_512_1216 | 234 |
| 888 | 3300053729 | Ga0500625_022262 | Ga0500625_022262_1789_2493 | 234 |
| 889 | 3300053730 | Ga0500645_026052 | Ga0500645_026052_591_1295 | 234 |
| 890 | 3300053736 | Ga0500599_002093 | Ga0500599_002093_482_1186 | 234 |
| 891 | 3300053737 | Ga0500601_000997 | Ga0500601_000997_2062_2766 | 234 |
| 892 | iso_pu_bacteria | 2513237098 | 2513675266 | 234 |
| 893 | iso_pu_bacteria | 2513237101 | 2513696383 | 234 |
| 894 | iso_pu_bacteria | 2524023210 | 2524469134 | 234 |
| 895 | iso_pu_bacteria | 2643221651 | 2644287239 | 234 |
| 896 | iso_pu_bacteria | 2721755755 | 2723842889 | 234 |
| 897 | iso_pu_bacteria | 2791355199 | 2793080229 | 234 |
| 898 | iso_pu_bacteria | 2874604998 | 2874606449 | 234 |
| 899 | iso_pu_bacteria | 2889033259 | 2889033803 | 234 |
| 900 | iso_pu_bacteria | 2903768456 | 2903771445 | 234 |
| 901 | iso_pu_bacteria | 2922361189 | 2922367203 | 234 |
| 902 | iso_pu_bacteria | 2922386360 | 2922390070 | 234 |
| 903 | iso_pu_bacteria | 8006964411 | 8006966721 | 234 |
| 904 | iso_pu_bacteria | 8006984368 | 8006989640 | 234 |
| 905 | iso_pu_bacteria | 8006994254 | 8006998023 | 234 |
| 906 | iso_pu_bacteria | 8056673599 | 8056675058 | 234 |
| 907 | iso_pu_bacteria | 8056681323 | 8056681855 | 234 |
| 908 | iso_pu_bacteria | 8056689827 | 8056696253 | 234 |
| 909 | 3300005336 | Ga0070680_100308636 | Ga0070680_1003086361 | 235 |
| 910 | 3300005458 | Ga0070681_10295193 | Ga0070681_102951932 | 235 |
| 911 | 3300005547 | Ga0070693_100372648 | Ga0070693_1003726481 | 235 |
| 912 | 3300005842 | Ga0068858_100476957 | Ga0068858_1004769572 | 235 |
| 913 | 3300009545 | Ga0105237_10031990 | Ga0105237_1003199010 | 235 |
| 914 | 3300009551 | Ga0105238_10071229 | Ga0105238_100712294 | 235 |
| 915 | 3300009551 | Ga0105238_10112637 | Ga0105238_101126371 | 235 |
| 916 | 3300025904 | Ga0207647_10128573 | Ga0207647_101285732 | 235 |
| 917 | 3300025912 | Ga0207707_10427961 | Ga0207707_104279612 | 235 |
| 918 | 3300026035 | Ga0207703_10104559 | Ga0207703_101045592 | 235 |
| 919 | 3300037312 | Ga0395899_0050606 | Ga0395899_0050606_97_810 | 235 |
| 920 | 3300039437 | Ga0436365_0108820 | Ga0436365_0108820_2873_3583 | 235 |
| 921 | 3300039437 | Ga0436365_1361824 | Ga0436365_1361824_255_965 | 235 |
| 922 | 3300048910 | Ga0496107_0033816 | Ga0496107_0033816_1385_2101 | 235 |
| 923 | 3300048924 | Ga0496121_0001057 | Ga0496121_0001057_410_1414 | 235 |
| 924 | 3300048929 | Ga0496126_0018583 | Ga0496126_0018583_4203_4919 | 235 |
| 925 | 3300049580 | Ga0501046_0326812 | Ga0501046_0326812_283_1041 | 235 |
| 926 | 3300005329 | Ga0070683_100353009 | Ga0070683_1003530092 | 236 |
| 927 | 3300005336 | Ga0070680_100088017 | Ga0070680_1000880174 | 236 |
| 928 | 3300005337 | Ga0070682_100025295 | Ga0070682_1000252952 | 236 |
| 929 | 3300005344 | Ga0070661_100353940 | Ga0070661_1003539402 | 236 |
| 930 | 3300005434 | Ga0070709_10005526 | Ga0070709_100055261 | 236 |
| 931 | 3300005434 | Ga0070709_10171116 | Ga0070709_101711162 | 236 |
| 932 | 3300005435 | Ga0070714_100081991 | Ga0070714_1000819913 | 236 |
| 933 | 3300005436 | Ga0070713_100130356 | Ga0070713_1001303562 | 236 |
| 934 | 3300005439 | Ga0070711_100007048 | Ga0070711_1000070485 | 236 |
| 935 | 3300005455 | Ga0070663_100422958 | Ga0070663_1004229582 | 236 |
| 936 | 3300005539 | Ga0068853_100387662 | Ga0068853_1003876621 | 236 |
| 937 | 3300005539 | Ga0068853_100540120 | Ga0068853_1005401202 | 236 |
| 938 | 3300005548 | Ga0070665_100148314 | Ga0070665_1001483143 | 236 |
| 939 | 3300005548 | Ga0070665_100171758 | Ga0070665_1001717582 | 236 |
| 940 | 3300005563 | Ga0068855_100059386 | Ga0068855_1000593862 | 236 |
| 941 | 3300005578 | Ga0068854_100151272 | Ga0068854_1001512721 | 236 |
| 942 | 3300005834 | Ga0068851_10244567 | Ga0068851_102445672 | 236 |
| 943 | 3300006173 | Ga0070716_100141225 | Ga0070716_1001412252 | 236 |
| 944 | 3300006175 | Ga0070712_100857464 | Ga0070712_1008574641 | 236 |
| 945 | 3300009093 | Ga0105240_10098710 | Ga0105240_100987102 | 236 |
| 946 | 3300009093 | Ga0105240_10574421 | Ga0105240_105744211 | 236 |
| 947 | 3300009174 | Ga0105241_10050926 | Ga0105241_100509263 | 236 |
| 948 | 3300009545 | Ga0105237_10041954 | Ga0105237_100419545 | 236 |
| 949 | 3300009545 | Ga0105237_10150599 | Ga0105237_101505992 | 236 |
| 950 | 3300009551 | Ga0105238_10030444 | Ga0105238_100304448 | 236 |
| 951 | 3300009551 | Ga0105238_10108125 | Ga0105238_101081252 | 236 |
| 952 | 3300013296 | Ga0157374_10047182 | Ga0157374_100471825 | 236 |
| 953 | 3300021377 | Ga0213874_10013003 | Ga0213874_100130033 | 236 |
| 954 | 3300021377 | Ga0213874_10103166 | Ga0213874_101031661 | 236 |
| 955 | 3300021388 | Ga0213875_10097599 | Ga0213875_100975991 | 236 |
| 956 | 3300021441 | Ga0213871_10016627 | Ga0213871_100166273 | 236 |
| 957 | 3300022467 | Ga0224712_10064366 | Ga0224712_100643661 | 236 |
| 958 | 3300022467 | Ga0224712_10070990 | Ga0224712_100709901 | 236 |
| 959 | 3300025906 | Ga0207699_10035636 | Ga0207699_100356365 | 236 |
| 960 | 3300025906 | Ga0207699_10412455 | Ga0207699_104124552 | 236 |
| 961 | 3300025912 | Ga0207707_10000827 | Ga0207707_1000082716 | 236 |
| 962 | 3300025914 | Ga0207671_10072431 | Ga0207671_100724312 | 236 |
| 963 | 3300025914 | Ga0207671_10096180 | Ga0207671_100961804 | 236 |
| 964 | 3300025916 | Ga0207663_10184937 | Ga0207663_101849372 | 236 |
| 965 | 3300025921 | Ga0207652_10483385 | Ga0207652_104833851 | 236 |
| 966 | 3300025924 | Ga0207694_10057271 | Ga0207694_100572713 | 236 |
| 967 | 3300025924 | Ga0207694_10150477 | Ga0207694_101504772 | 236 |
| 968 | 3300025939 | Ga0207665_10174494 | Ga0207665_101744942 | 236 |
| 969 | 3300025944 | Ga0207661_10001422 | Ga0207661_100014222 | 236 |
| 970 | 3300025944 | Ga0207661_10122812 | Ga0207661_101228124 | 236 |
| 971 | 3300026041 | Ga0207639_10631308 | Ga0207639_106313081 | 236 |
| 972 | 3300026041 | Ga0207639_10943170 | Ga0207639_109431701 | 236 |
| 973 | 3300028379 | Ga0268266_10317439 | Ga0268266_103174391 | 236 |
| 974 | 3300031249 | Ga0265339_10001394 | Ga0265339_1000139411 | 236 |
| 975 | 3300031711 | Ga0265314_10157186 | Ga0265314_101571862 | 236 |
| 976 | 3300035083 | Ga0373926_0055251 | Ga0373926_0055251_669_1382 | 236 |
| 977 | 3300035111 | Ga0373923_0079043 | Ga0373923_0079043_530_1243 | 236 |
| 978 | 3300035113 | Ga0373936_0008700 | Ga0373936_0008700_137_850 | 236 |
| 979 | 3300035116 | Ga0373945_0097535 | Ga0373945_0097535_399_1112 | 236 |
| 980 | 3300035117 | Ga0373953_0011700 | Ga0373953_0011700_686_1399 | 236 |
| 981 | 3300035119 | Ga0373956_0108293 | Ga0373956_0108293_480_1193 | 236 |
| 982 | 3300035120 | Ga0373957_0202208 | Ga0373957_0202208_27_740 | 236 |
| 983 | 3300035170 | Ga0373943_0169966 | Ga0373943_0169966_50_763 | 236 |
| 984 | 3300035171 | Ga0373946_0079414 | Ga0373946_0079414_407_1120 | 236 |
| 985 | 3300035692 | Ga0373935_0048301 | Ga0373935_0048301_1734_2447 | 236 |
| 986 | 3300035695 | Ga0373927_0174958 | Ga0373927_0174958_124_837 | 236 |
| 987 | 3300035724 | Ga0373933_0342226 | Ga0373933_0342226_161_874 | 236 |
| 988 | 3300035725 | Ga0373947_0066850 | Ga0373947_0066850_804_1517 | 236 |
| 989 | 3300036401 | Ga0373937_0232745 | Ga0373937_0232745_337_1050 | 236 |
| 990 | 3300036401 | Ga0373937_0798680 | Ga0373937_0798680_102_815 | 236 |
| 991 | 3300037418 | Ga0395900_0009563 | Ga0395900_0009563_5859_6572 | 236 |
| 992 | 3300037466 | Ga0395898_0051337 | Ga0395898_0051337_2913_3626 | 236 |
| 993 | 3300039438 | Ga0436360_0582206 | Ga0436360_0582206_1241_1954 | 236 |
| 994 | 3300039438 | Ga0436360_0620676 | Ga0436360_0620676_110_823 | 236 |
| 995 | 3300039447 | Ga0436361_0568203 | Ga0436361_0568203_156_869 | 236 |
| 996 | 3300039450 | Ga0436363_0827034 | Ga0436363_0827034_3169_3882 | 236 |
| 997 | 3300039450 | Ga0436363_1336752 | Ga0436363_1336752_90_803 | 236 |
| 998 | 3300044693 | Ga0466961_0042051 | Ga0466961_0042051_768_1481 | 236 |
| 999 | 3300044694 | Ga0466963_0454104 | Ga0466963_0454104_83_796 | 236 |
| 1000 | 3300044765 | Ga0466970_0353401 | Ga0466970_0353401_25_738 | 236 |
| 1001 | 3300045049 | Ga0466959_0045853 | Ga0466959_0045853_1244_1957 | 236 |
| 1002 | 3300045976 | Ga0466967_0353595 | Ga0466967_0353595_274_990 | 236 |
| 1003 | 3300046455 | Ga0495603_0129051 | Ga0495603_0129051_622_1335 | 236 |
| 1004 | 3300046463 | Ga0495653_0166213 | Ga0495653_0166213_558_1271 | 236 |
| 1005 | 3300046472 | Ga0495580_0041291 | Ga0495580_0041291_654_1367 | 236 |
| 1006 | 3300046473 | Ga0495582_0169322 | Ga0495582_0169322_420_1133 | 236 |
| 1007 | 3300046475 | Ga0495639_0184197 | Ga0495639_0184197_233_946 | 236 |
| 1008 | 3300046477 | Ga0495664_0038112 | Ga0495664_0038112_1858_2571 | 236 |
| 1009 | 3300046512 | Ga0495610_0129064 | Ga0495610_0129064_224_937 | 236 |
| 1010 | 3300046516 | Ga0495628_0239962 | Ga0495628_0239962_177_890 | 236 |
| 1011 | 3300046517 | Ga0495630_0096705 | Ga0495630_0096705_959_1672 | 236 |
| 1012 | 3300046529 | Ga0495652_0031369 | Ga0495652_0031369_311_1024 | 236 |
| 1013 | 3300046529 | Ga0495652_0275783 | Ga0495652_0275783_277_990 | 236 |
| 1014 | 3300046531 | Ga0495665_0017301 | Ga0495665_0017301_1245_1958 | 236 |
| 1015 | 3300046559 | Ga0495667_0038192 | Ga0495667_0038192_258_971 | 236 |
| 1016 | 3300046663 | Ga0495635_0178771 | Ga0495635_0178771_573_1286 | 236 |
| 1017 | 3300046680 | Ga0495646_0049680 | Ga0495646_0049680_363_1076 | 236 |
| 1018 | 3300046681 | Ga0495647_0016960 | Ga0495647_0016960_1842_2555 | 236 |
| 1019 | 3300046683 | Ga0495658_0007033 | Ga0495658_0007033_4498_5211 | 236 |
| 1020 | 3300046690 | Ga0495624_0053556 | Ga0495624_0053556_985_1698 | 236 |
| 1021 | 3300047315 | Ga0495581_0025894 | Ga0495581_0025894_2338_3051 | 236 |
| 1022 | 3300047317 | Ga0495604_0147868 | Ga0495604_0147868_427_1140 | 236 |
| 1023 | 3300047319 | Ga0495674_0074047 | Ga0495674_0074047_199_912 | 236 |
| 1024 | 3300047321 | Ga0495676_0111442 | Ga0495676_0111442_849_1562 | 236 |
| 1025 | 3300048917 | Ga0496114_0118920 | Ga0496114_0118920_1023_1736 | 236 |
| 1026 | 3300048925 | Ga0496122_0057569 | Ga0496122_0057569_1459_2172 | 236 |
| 1027 | 3300048929 | Ga0496126_0312937 | Ga0496126_0312937_28_741 | 236 |
| 1028 | 3300049571 | Ga0501034_0024633 | Ga0501034_0024633_2885_3610 | 236 |
| 1029 | 3300049574 | Ga0501038_0074567 | Ga0501038_0074567_548_1273 | 236 |
| 1030 | 3300049586 | Ga0501070_0042138 | Ga0501070_0042138_2582_3295 | 236 |
| 1031 | 3300049742 | Ga0501080_0083252 | Ga0501080_0083252_1542_2255 | 236 |
| 1032 | 3300049822 | Ga0501035_0373790 | Ga0501035_0373790_424_1149 | 236 |
| 1033 | 3300053077 | Ga0495601_0134564 | Ga0495601_0134564_883_1596 | 236 |
| 1034 | 3300053077 | Ga0495601_0209693 | Ga0495601_0209693_97_810 | 236 |
| 1035 | 3300053078 | Ga0495612_0040544 | Ga0495612_0040544_270_983 | 236 |
| 1036 | 3300053078 | Ga0495612_0076464 | Ga0495612_0076464_263_976 | 236 |
| 1037 | 3300053085 | Ga0495619_0063210 | Ga0495619_0063210_285_998 | 236 |
| 1038 | 3300061719 | Ga0466962_0067990 | Ga0466962_0067990_259_972 | 236 |
| 1039 | 3300001979 | JGI24740J21852_10000767 | JGI24740J21852_1000076713 | 237 |
| 1040 | 3300002737 | JGI25162J39368_1000277 | JGI25162J39368_100027745 | 237 |
| 1041 | 3300002987 | JGI25159J45721_1001498 | JGI25159J45721_10014987 | 237 |
| 1042 | 3300003162 | Ga0006778J45830_1037934 | Ga0006778J45830_10379341 | 237 |
| 1043 | 3300003203 | JGI25406J46586_10000042 | JGI25406J46586_100000423 | 237 |
| 1044 | 3300003203 | JGI25406J46586_10001462 | JGI25406J46586_1000146211 | 237 |
| 1045 | 3300003214 | JGI25165J46597_1003489 | JGI25165J46597_10034892 | 237 |
| 1046 | 3300003659 | JGI25404J52841_10058120 | JGI25404J52841_100581201 | 237 |
| 1047 | 3300004798 | Ga0058859_11354442 | Ga0058859_113544422 | 237 |
| 1048 | 3300005365 | Ga0070688_100154951 | Ga0070688_1001549512 | 237 |
| 1049 | 3300005366 | Ga0070659_100330430 | Ga0070659_1003304302 | 237 |
| 1050 | 3300005366 | Ga0070659_100691825 | Ga0070659_1006918251 | 237 |
| 1051 | 3300005434 | Ga0070709_10010952 | Ga0070709_100109523 | 237 |
| 1052 | 3300005435 | Ga0070714_100002233 | Ga0070714_10000223312 | 237 |
| 1053 | 3300005437 | Ga0070710_10000549 | Ga0070710_1000054917 | 237 |
| 1054 | 3300005439 | Ga0070711_100017942 | Ga0070711_1000179423 | 237 |
| 1055 | 3300005439 | Ga0070711_100069372 | Ga0070711_1000693722 | 237 |
| 1056 | 3300005456 | Ga0070678_100047311 | Ga0070678_1000473112 | 237 |
| 1057 | 3300005466 | Ga0070685_10168476 | Ga0070685_101684761 | 237 |
| 1058 | 3300005467 | Ga0070706_100158402 | Ga0070706_1001584023 | 237 |
| 1059 | 3300005548 | Ga0070665_100026397 | Ga0070665_1000263975 | 237 |
| 1060 | 3300005548 | Ga0070665_100153970 | Ga0070665_1001539704 | 237 |
| 1061 | 3300005985 | Ga0081539_10000099 | Ga0081539_10000099139 | 237 |
| 1062 | 3300006028 | Ga0070717_10063343 | Ga0070717_100633432 | 237 |
| 1063 | 3300006038 | Ga0075365_10059515 | Ga0075365_100595153 | 237 |
| 1064 | 3300006048 | Ga0075363_100049181 | Ga0075363_1000491815 | 237 |
| 1065 | 3300006051 | Ga0075364_10121089 | Ga0075364_101210892 | 237 |
| 1066 | 3300006163 | Ga0070715_10001749 | Ga0070715_100017492 | 237 |
| 1067 | 3300006173 | Ga0070716_100005320 | Ga0070716_1000053202 | 237 |
| 1068 | 3300006173 | Ga0070716_100033588 | Ga0070716_1000335883 | 237 |
| 1069 | 3300006178 | Ga0075367_10011261 | Ga0075367_100112613 | 237 |
| 1070 | 3300006186 | Ga0075369_10061887 | Ga0075369_100618871 | 237 |
| 1071 | 3300006353 | Ga0075370_10043189 | Ga0075370_100431892 | 237 |
| 1072 | 3300009093 | Ga0105240_10146636 | Ga0105240_101466362 | 237 |
| 1073 | 3300009101 | Ga0105247_10363603 | Ga0105247_103636031 | 237 |
| 1074 | 3300009545 | Ga0105237_10442143 | Ga0105237_104421432 | 237 |
| 1075 | 3300009551 | Ga0105238_10128331 | Ga0105238_101283312 | 237 |
| 1076 | 3300010375 | Ga0105239_10567219 | Ga0105239_105672191 | 237 |
| 1077 | 3300013102 | Ga0157371_10024676 | Ga0157371_100246762 | 237 |
| 1078 | 3300013104 | Ga0157370_10029467 | Ga0157370_100294673 | 237 |
| 1079 | 3300013296 | Ga0157374_10347474 | Ga0157374_103474742 | 237 |
| 1080 | 3300013307 | Ga0157372_10108336 | Ga0157372_101083363 | 237 |
| 1081 | 3300014325 | Ga0163163_10033749 | Ga0163163_100337496 | 237 |
| 1082 | 3300014325 | Ga0163163_10878467 | Ga0163163_108784671 | 237 |
| 1083 | 3300025898 | Ga0207692_10001489 | Ga0207692_100014898 | 237 |
| 1084 | 3300025905 | Ga0207685_10003252 | Ga0207685_100032522 | 237 |
| 1085 | 3300025906 | Ga0207699_10006246 | Ga0207699_100062466 | 237 |
| 1086 | 3300025915 | Ga0207693_10000565 | Ga0207693_1000056527 | 237 |
| 1087 | 3300025916 | Ga0207663_10003532 | Ga0207663_100035328 | 237 |
| 1088 | 3300025916 | Ga0207663_10248595 | Ga0207663_102485951 | 237 |
| 1089 | 3300025928 | Ga0207700_10003591 | Ga0207700_100035913 | 237 |
| 1090 | 3300025939 | Ga0207665_10000127 | Ga0207665_1000012726 | 237 |
| 1091 | 3300025939 | Ga0207665_10029628 | Ga0207665_100296283 | 237 |
| 1092 | 3300026121 | Ga0207683_10307777 | Ga0207683_103077773 | 237 |
| 1093 | 3300026142 | Ga0207698_10103666 | Ga0207698_101036662 | 237 |
| 1094 | 3300031730 | Ga0307516_10035746 | Ga0307516_100357463 | 237 |
| 1095 | 3300035170 | Ga0373943_0033966 | Ga0373943_0033966_593_1309 | 237 |
| 1096 | 3300035691 | Ga0373931_0045065 | Ga0373931_0045065_1411_2127 | 237 |
| 1097 | 3300035691 | Ga0373931_0464179 | Ga0373931_0464179_84_800 | 237 |
| 1098 | 3300035695 | Ga0373927_0017005 | Ga0373927_0017005_3794_4510 | 237 |
| 1099 | 3300035725 | Ga0373947_0159889 | Ga0373947_0159889_304_1020 | 237 |
| 1100 | 3300037068 | Ga0373925_0023145 | Ga0373925_0023145_2988_3704 | 237 |
| 1101 | 3300037466 | Ga0395898_0040500 | Ga0395898_0040500_1602_2339 | 237 |
| 1102 | 3300038443 | Ga0395901_0437762 | Ga0395901_0437762_52_768 | 237 |
| 1103 | 3300044765 | Ga0466970_0012632 | Ga0466970_0012632_1527_2279 | 237 |
| 1104 | 3300046455 | Ga0495603_0083049 | Ga0495603_0083049_152_868 | 237 |
| 1105 | 3300046460 | Ga0495638_0022023 | Ga0495638_0022023_185_901 | 237 |
| 1106 | 3300046512 | Ga0495610_0031207 | Ga0495610_0031207_1417_2133 | 237 |
| 1107 | 3300046518 | Ga0495631_0025217 | Ga0495631_0025217_585_1301 | 237 |
| 1108 | 3300046519 | Ga0495632_0111837 | Ga0495632_0111837_540_1256 | 237 |
| 1109 | 3300046520 | Ga0495637_0031199 | Ga0495637_0031199_255_971 | 237 |
| 1110 | 3300046522 | Ga0495643_0036114 | Ga0495643_0036114_961_1677 | 237 |
| 1111 | 3300046557 | Ga0495622_0009802 | Ga0495622_0009802_2194_2910 | 237 |
| 1112 | 3300046674 | Ga0495588_0208071 | Ga0495588_0208071_169_885 | 237 |
| 1113 | 3300047472 | Ga0495686_0018504 | Ga0495686_0018504_3013_3729 | 237 |
| 1114 | 3300047472 | Ga0495686_0060450 | Ga0495686_0060450_1028_1744 | 237 |
| 1115 | 3300048905 | Ga0496102_0052153 | Ga0496102_0052153_376_1092 | 237 |
| 1116 | 3300048905 | Ga0496102_0310543 | Ga0496102_0310543_638_1453 | 237 |
| 1117 | 3300048906 | Ga0496103_0451226 | Ga0496103_0451226_92_808 | 237 |
| 1118 | 3300048907 | Ga0496104_0011964 | Ga0496104_0011964_4618_5334 | 237 |
| 1119 | 3300048908 | Ga0496105_0110603 | Ga0496105_0110603_456_1172 | 237 |
| 1120 | 3300048910 | Ga0496107_0083233 | Ga0496107_0083233_1135_1851 | 237 |
| 1121 | 3300048911 | Ga0496108_0270666 | Ga0496108_0270666_428_1144 | 237 |
| 1122 | 3300048911 | Ga0496108_0743687 | Ga0496108_0743687_62_778 | 237 |
| 1123 | 3300048912 | Ga0496109_0022973 | Ga0496109_0022973_2724_3440 | 237 |
| 1124 | 3300048912 | Ga0496109_0387945 | Ga0496109_0387945_414_1130 | 237 |
| 1125 | 3300048913 | Ga0496110_0379849 | Ga0496110_0379849_447_1163 | 237 |
| 1126 | 3300048915 | Ga0496112_0000052 | Ga0496112_0000052_10872_11588 | 237 |
| 1127 | 3300048915 | Ga0496112_0038470 | Ga0496112_0038470_1196_1912 | 237 |
| 1128 | 3300048915 | Ga0496112_0125607 | Ga0496112_0125607_479_1195 | 237 |
| 1129 | 3300048916 | Ga0496113_0159709 | Ga0496113_0159709_463_1179 | 237 |
| 1130 | 3300048916 | Ga0496113_0490827 | Ga0496113_0490827_223_939 | 237 |
| 1131 | 3300048916 | Ga0496113_0759438 | Ga0496113_0759438_41_757 | 237 |
| 1132 | 3300048918 | Ga0496115_0185245 | Ga0496115_0185245_304_1020 | 237 |
| 1133 | 3300048919 | Ga0496116_0005214 | Ga0496116_0005214_2155_2871 | 237 |
| 1134 | 3300048920 | Ga0496117_0016824 | Ga0496117_0016824_20_736 | 237 |
| 1135 | 3300048922 | Ga0496119_0201349 | Ga0496119_0201349_167_883 | 237 |
| 1136 | 3300048924 | Ga0496121_0017186 | Ga0496121_0017186_6310_7026 | 237 |
| 1137 | 3300048927 | Ga0496124_0127208 | Ga0496124_0127208_660_1379 | 237 |
| 1138 | 3300048928 | Ga0496125_0015170 | Ga0496125_0015170_1337_2053 | 237 |
| 1139 | 3300048928 | Ga0496125_0276335 | Ga0496125_0276335_103_822 | 237 |
| 1140 | 3300049568 | Ga0501031_0000655 | Ga0501031_0000655_6233_6952 | 237 |
| 1141 | 3300049568 | Ga0501031_0001803 | Ga0501031_0001803_9591_10310 | 237 |
| 1142 | 3300049569 | Ga0501032_0000161 | Ga0501032_0000161_47777_48496 | 237 |
| 1143 | 3300049570 | Ga0501033_0000672 | Ga0501033_0000672_23258_23977 | 237 |
| 1144 | 3300049570 | Ga0501033_0001580 | Ga0501033_0001580_15584_16303 | 237 |
| 1145 | 3300049571 | Ga0501034_0000072 | Ga0501034_0000072_87581_88300 | 237 |
| 1146 | 3300049572 | Ga0501036_0000250 | Ga0501036_0000250_28839_29558 | 237 |
| 1147 | 3300049573 | Ga0501037_0000030 | Ga0501037_0000030_93064_93783 | 237 |
| 1148 | 3300049573 | Ga0501037_0001059 | Ga0501037_0001059_5271_5990 | 237 |
| 1149 | 3300049574 | Ga0501038_0000826 | Ga0501038_0000826_21835_22554 | 237 |
| 1150 | 3300049574 | Ga0501038_0057490 | Ga0501038_0057490_2077_2796 | 237 |
| 1151 | 3300049575 | Ga0501039_0012015 | Ga0501039_0012015_4740_5459 | 237 |
| 1152 | 3300049577 | Ga0501041_0151158 | Ga0501041_0151158_375_1094 | 237 |
| 1153 | 3300049578 | Ga0501042_0073646 | Ga0501042_0073646_1617_2336 | 237 |
| 1154 | 3300049579 | Ga0501043_0000357 | Ga0501043_0000357_8198_8917 | 237 |
| 1155 | 3300049579 | Ga0501043_0023451 | Ga0501043_0023451_1267_1986 | 237 |
| 1156 | 3300049580 | Ga0501046_0023974 | Ga0501046_0023974_1957_2676 | 237 |
| 1157 | 3300049580 | Ga0501046_0091706 | Ga0501046_0091706_1268_1987 | 237 |
| 1158 | 3300049581 | Ga0501047_0001531 | Ga0501047_0001531_20491_21210 | 237 |
| 1159 | 3300049581 | Ga0501047_0208882 | Ga0501047_0208882_478_1197 | 237 |
| 1160 | 3300049582 | Ga0501048_0000477 | Ga0501048_0000477_7469_8188 | 237 |
| 1161 | 3300049583 | Ga0501067_0000068 | Ga0501067_0000068_15277_15996 | 237 |
| 1162 | 3300049584 | Ga0501068_0001116 | Ga0501068_0001116_13343_14062 | 237 |
| 1163 | 3300049586 | Ga0501070_0002354 | Ga0501070_0002354_9236_9955 | 237 |
| 1164 | 3300049588 | Ga0501072_0000835 | Ga0501072_0000835_8672_9391 | 237 |
| 1165 | 3300049589 | Ga0501073_0000009 | Ga0501073_0000009_103406_104125 | 237 |
| 1166 | 3300049590 | Ga0501074_0000716 | Ga0501074_0000716_2908_3627 | 237 |
| 1167 | 3300049741 | Ga0501079_0000251 | Ga0501079_0000251_27357_28076 | 237 |
| 1168 | 3300049742 | Ga0501080_0004321 | Ga0501080_0004321_5581_6300 | 237 |
| 1169 | 3300049744 | Ga0501083_0039237 | Ga0501083_0039237_151_870 | 237 |
| 1170 | 3300049822 | Ga0501035_0000067 | Ga0501035_0000067_25023_25742 | 237 |
| 1171 | 3300049822 | Ga0501035_0035252 | Ga0501035_0035252_1746_2465 | 237 |
| 1172 | 3300049822 | Ga0501035_0329252 | Ga0501035_0329252_66_785 | 237 |
| 1173 | 3300049823 | Ga0501044_0002804 | Ga0501044_0002804_4041_4760 | 237 |
| 1174 | 3300049823 | Ga0501044_0064150 | Ga0501044_0064150_2302_3021 | 237 |
| 1175 | 3300049823 | Ga0501044_0142659 | Ga0501044_0142659_621_1340 | 237 |
| 1176 | 3300049824 | Ga0501045_0164291 | Ga0501045_0164291_234_953 | 237 |
| 1177 | 3300050491 | nmdc:mga00v17_26685_c1 | nmdc:mga00v17_26685_c1_2004_2720 | 237 |
| 1178 | 3300050494 | nmdc:mga06z11_100307_c1 | nmdc:mga06z11_100307_c1_110_826 | 237 |
| 1179 | 3300050494 | nmdc:mga06z11_21201_c1 | nmdc:mga06z11_21201_c1_1345_2061 | 237 |
| 1180 | 3300050516 | nmdc:mga0sz30_10116_c1 | nmdc:mga0sz30_10116_c1_1492_2208 | 237 |
| 1181 | 3300053088 | Ga0500644_0008381 | Ga0500644_0008381_913_1629 | 237 |
| 1182 | 3300053093 | Ga0500651_0071542 | Ga0500651_0071542_939_1655 | 237 |
| 1183 | 3300053094 | Ga0500566_0000751 | Ga0500566_0000751_14902_15618 | 237 |
| 1184 | 3300053096 | Ga0500641_0001845 | Ga0500641_0001845_994_1710 | 237 |
| 1185 | 3300053098 | Ga0500650_0004589 | Ga0500650_0004589_3866_4582 | 237 |
| 1186 | 3300053104 | Ga0500556_0000238 | Ga0500556_0000238_14095_14811 | 237 |
| 1187 | 3300053108 | Ga0500562_038244 | Ga0500562_038244_223_939 | 237 |
| 1188 | 3300053116 | Ga0500592_000799 | Ga0500592_000799_1218_1934 | 237 |
| 1189 | 3300053122 | Ga0500608_004588 | Ga0500608_004588_4140_4856 | 237 |
| 1190 | 3300053125 | Ga0500618_032582 | Ga0500618_032582_112_828 | 237 |
| 1191 | 3300053130 | Ga0500642_0000092 | Ga0500642_0000092_5621_6337 | 237 |
| 1192 | 3300053131 | Ga0500652_001613 | Ga0500652_001613_2738_3454 | 237 |
| 1193 | 3300053136 | Ga0500559_0000492 | Ga0500559_0000492_21477_22193 | 237 |
| 1194 | 3300053139 | Ga0500568_0002222 | Ga0500568_0002222_5885_6601 | 237 |
| 1195 | 3300053142 | Ga0500577_0000135 | Ga0500577_0000135_6476_7192 | 237 |
| 1196 | 3300053148 | Ga0500590_091519 | Ga0500590_091519_525_1241 | 237 |
| 1197 | 3300053153 | Ga0500616_0000197 | Ga0500616_0000197_42565_43281 | 237 |
| 1198 | 3300053156 | Ga0500622_0000966 | Ga0500622_0000966_19526_20242 | 237 |
| 1199 | 3300053161 | Ga0500634_0012476 | Ga0500634_0012476_383_1099 | 237 |
| 1200 | 3300053177 | Ga0500636_0026379 | Ga0500636_0026379_1989_2705 | 237 |
| 1201 | 3300053178 | Ga0500637_0094288 | Ga0500637_0094288_603_1319 | 237 |
| 1202 | 3300054114 | Ga0501084_0012720 | Ga0501084_0012720_1671_2390 | 237 |
| 1203 | 3300060353 | Ga0501082_0008921 | Ga0501082_0008921_1675_2394 | 237 |
| 1204 | 3300000549 | LJQas_1006154 | LJQas_10061541 | 238 |
| 1205 | 3300003659 | JGI25404J52841_10016701 | JGI25404J52841_100167011 | 238 |
| 1206 | 3300004800 | Ga0058861_12010056 | Ga0058861_120100561 | 238 |
| 1207 | 3300005336 | Ga0070680_100011514 | Ga0070680_1000115145 | 238 |
| 1208 | 3300005338 | Ga0068868_100288646 | Ga0068868_1002886462 | 238 |
| 1209 | 3300005339 | Ga0070660_100359116 | Ga0070660_1003591162 | 238 |
| 1210 | 3300005341 | Ga0070691_10062835 | Ga0070691_100628352 | 238 |
| 1211 | 3300005347 | Ga0070668_100034676 | Ga0070668_1000346762 | 238 |
| 1212 | 3300005347 | Ga0070668_100312648 | Ga0070668_1003126481 | 238 |
| 1213 | 3300005356 | Ga0070674_100097673 | Ga0070674_1000976732 | 238 |
| 1214 | 3300005366 | Ga0070659_100214544 | Ga0070659_1002145443 | 238 |
| 1215 | 3300005436 | Ga0070713_100004820 | Ga0070713_1000048209 | 238 |
| 1216 | 3300005436 | Ga0070713_100058748 | Ga0070713_1000587485 | 238 |
| 1217 | 3300005441 | Ga0070700_100069003 | Ga0070700_1000690032 | 238 |
| 1218 | 3300005455 | Ga0070663_100326240 | Ga0070663_1003262402 | 238 |
| 1219 | 3300005456 | Ga0070678_100041320 | Ga0070678_1000413203 | 238 |
| 1220 | 3300005457 | Ga0070662_100712441 | Ga0070662_1007124411 | 238 |
| 1221 | 3300005535 | Ga0070684_100010958 | Ga0070684_1000109583 | 238 |
| 1222 | 3300005539 | Ga0068853_100011007 | Ga0068853_1000110071 | 238 |
| 1223 | 3300005548 | Ga0070665_100143198 | Ga0070665_1001431983 | 238 |
| 1224 | 3300005563 | Ga0068855_100155264 | Ga0068855_1001552642 | 238 |
| 1225 | 3300005563 | Ga0068855_100235166 | Ga0068855_1002351661 | 238 |
| 1226 | 3300005563 | Ga0068855_100291329 | Ga0068855_1002913293 | 238 |
| 1227 | 3300005577 | Ga0068857_100049570 | Ga0068857_1000495707 | 238 |
| 1228 | 3300005614 | Ga0068856_100188069 | Ga0068856_1001880693 | 238 |
| 1229 | 3300005616 | Ga0068852_100038969 | Ga0068852_1000389693 | 238 |
| 1230 | 3300005718 | Ga0068866_10111408 | Ga0068866_101114082 | 238 |
| 1231 | 3300005719 | Ga0068861_100168874 | Ga0068861_1001688742 | 238 |
| 1232 | 3300005834 | Ga0068851_10011299 | Ga0068851_100112992 | 238 |
| 1233 | 3300005843 | Ga0068860_100153346 | Ga0068860_1001533463 | 238 |
| 1234 | 3300005844 | Ga0068862_100105017 | Ga0068862_1001050172 | 238 |
| 1235 | 3300005937 | Ga0081455_10012165 | Ga0081455_100121656 | 238 |
| 1236 | 3300005983 | Ga0081540_1011157 | Ga0081540_10111576 | 238 |
| 1237 | 3300006028 | Ga0070717_10000884 | Ga0070717_1000088419 | 238 |
| 1238 | 3300006028 | Ga0070717_10003176 | Ga0070717_1000317610 | 238 |
| 1239 | 3300006173 | Ga0070716_100434674 | Ga0070716_1004346742 | 238 |
| 1240 | 3300006177 | Ga0075362_10047595 | Ga0075362_100475952 | 238 |
| 1241 | 3300006178 | Ga0075367_10028491 | Ga0075367_100284912 | 238 |
| 1242 | 3300009093 | Ga0105240_10025997 | Ga0105240_1002599710 | 238 |
| 1243 | 3300009094 | Ga0111539_10392146 | Ga0111539_103921462 | 238 |
| 1244 | 3300009176 | Ga0105242_10237267 | Ga0105242_102372672 | 238 |
| 1245 | 3300009176 | Ga0105242_10406877 | Ga0105242_104068771 | 238 |
| 1246 | 3300009545 | Ga0105237_10049749 | Ga0105237_100497493 | 238 |
| 1247 | 3300009551 | Ga0105238_10016659 | Ga0105238_100166593 | 238 |
| 1248 | 3300009551 | Ga0105238_10178649 | Ga0105238_101786492 | 238 |
| 1249 | 3300013105 | Ga0157369_10014664 | Ga0157369_1001466411 | 238 |
| 1250 | 3300013296 | Ga0157374_10007888 | Ga0157374_100078889 | 238 |
| 1251 | 3300013306 | Ga0163162_10315157 | Ga0163162_103151572 | 238 |
| 1252 | 3300013308 | Ga0157375_10119355 | Ga0157375_101193552 | 238 |
| 1253 | 3300014326 | Ga0157380_10858932 | Ga0157380_108589322 | 238 |
| 1254 | 3300014968 | Ga0157379_10789002 | Ga0157379_107890021 | 238 |
| 1255 | 3300017792 | Ga0163161_10071147 | Ga0163161_100711472 | 238 |
| 1256 | 3300020069 | Ga0197907_11371172 | Ga0197907_113711722 | 238 |
| 1257 | 3300020070 | Ga0206356_10790464 | Ga0206356_107904643 | 238 |
| 1258 | 3300021377 | Ga0213874_10078758 | Ga0213874_100787582 | 238 |
| 1259 | 3300025254 | Ga0209148_1023204 | Ga0209148_10232041 | 238 |
| 1260 | 3300025272 | Ga0209455_1004740 | Ga0209455_10047403 | 238 |
| 1261 | 3300025297 | Ga0209758_1002945 | Ga0209758_100294512 | 238 |
| 1262 | 3300025321 | Ga0207656_10020378 | Ga0207656_100203783 | 238 |
| 1263 | 3300025899 | Ga0207642_10143416 | Ga0207642_101434161 | 238 |
| 1264 | 3300025904 | Ga0207647_10215618 | Ga0207647_102156182 | 238 |
| 1265 | 3300025912 | Ga0207707_10002566 | Ga0207707_100025668 | 238 |
| 1266 | 3300025913 | Ga0207695_10284239 | Ga0207695_102842392 | 238 |
| 1267 | 3300025914 | Ga0207671_10035618 | Ga0207671_100356186 | 238 |
| 1268 | 3300025916 | Ga0207663_10180633 | Ga0207663_101806332 | 238 |
| 1269 | 3300025917 | Ga0207660_10001934 | Ga0207660_1000193411 | 238 |
| 1270 | 3300025919 | Ga0207657_10001315 | Ga0207657_1000131515 | 238 |
| 1271 | 3300025919 | Ga0207657_10238645 | Ga0207657_102386452 | 238 |
| 1272 | 3300025921 | Ga0207652_10001089 | Ga0207652_100010895 | 238 |
| 1273 | 3300025928 | Ga0207700_10001452 | Ga0207700_1000145211 | 238 |
| 1274 | 3300025932 | Ga0207690_10047179 | Ga0207690_100471791 | 238 |
| 1275 | 3300025935 | Ga0207709_10127840 | Ga0207709_101278401 | 238 |
| 1276 | 3300025939 | Ga0207665_10154968 | Ga0207665_101549682 | 238 |
| 1277 | 3300025940 | Ga0207691_10077623 | Ga0207691_100776234 | 238 |
| 1278 | 3300025942 | Ga0207689_10070761 | Ga0207689_100707614 | 238 |
| 1279 | 3300025944 | Ga0207661_10235943 | Ga0207661_102359433 | 238 |
| 1280 | 3300025949 | Ga0207667_10012575 | Ga0207667_100125759 | 238 |
| 1281 | 3300025949 | Ga0207667_10072969 | Ga0207667_100729696 | 238 |
| 1282 | 3300025949 | Ga0207667_10147895 | Ga0207667_101478953 | 238 |
| 1283 | 3300025972 | Ga0207668_10186470 | Ga0207668_101864702 | 238 |
| 1284 | 3300026041 | Ga0207639_10038223 | Ga0207639_100382232 | 238 |
| 1285 | 3300026067 | Ga0207678_10085373 | Ga0207678_100853732 | 238 |
| 1286 | 3300026067 | Ga0207678_10110846 | Ga0207678_101108462 | 238 |
| 1287 | 3300026075 | Ga0207708_10269013 | Ga0207708_102690131 | 238 |
| 1288 | 3300026078 | Ga0207702_10411177 | Ga0207702_104111771 | 238 |
| 1289 | 3300026089 | Ga0207648_10026143 | Ga0207648_100261434 | 238 |
| 1290 | 3300026116 | Ga0207674_10021123 | Ga0207674_100211239 | 238 |
| 1291 | 3300026118 | Ga0207675_100033884 | Ga0207675_1000338843 | 238 |
| 1292 | 3300026121 | Ga0207683_10042552 | Ga0207683_100425522 | 238 |
| 1293 | 3300026121 | Ga0207683_10106205 | Ga0207683_101062053 | 238 |
| 1294 | 3300026142 | Ga0207698_10503482 | Ga0207698_105034822 | 238 |
| 1295 | 3300027907 | Ga0207428_10098549 | Ga0207428_100985492 | 238 |
| 1296 | 3300028379 | Ga0268266_10062975 | Ga0268266_100629753 | 238 |
| 1297 | 3300028380 | Ga0268265_10218137 | Ga0268265_102181371 | 238 |
| 1298 | 3300028381 | Ga0268264_10067965 | Ga0268264_100679653 | 238 |
| 1299 | 3300028573 | Ga0265334_10024228 | Ga0265334_100242283 | 238 |
| 1300 | 3300028786 | Ga0307517_10000124 | Ga0307517_1000012491 | 238 |
| 1301 | 3300028794 | Ga0307515_10009381 | Ga0307515_1000938112 | 238 |
| 1302 | 3300031250 | Ga0265331_10102459 | Ga0265331_101024592 | 238 |
| 1303 | 3300031456 | Ga0307513_10153193 | Ga0307513_101531932 | 238 |
| 1304 | 3300031711 | Ga0265314_10002593 | Ga0265314_100025935 | 238 |
| 1305 | 3300031712 | Ga0265342_10063479 | Ga0265342_100634792 | 238 |
| 1306 | 3300031712 | Ga0265342_10146097 | Ga0265342_101460971 | 238 |
| 1307 | 3300031815 | Ga0316045_107024 | Ga0316045_1070243 | 238 |
| 1308 | 3300035086 | Ga0373934_0016039 | Ga0373934_0016039_295_1014 | 238 |
| 1309 | 3300035117 | Ga0373953_0017203 | Ga0373953_0017203_257_976 | 238 |
| 1310 | 3300035118 | Ga0373954_0002485 | Ga0373954_0002485_1318_2037 | 238 |
| 1311 | 3300035118 | Ga0373954_0002626 | Ga0373954_0002626_3410_4129 | 238 |
| 1312 | 3300035119 | Ga0373956_0064383 | Ga0373956_0064383_373_1092 | 238 |
| 1313 | 3300035120 | Ga0373957_0007070 | Ga0373957_0007070_173_892 | 238 |
| 1314 | 3300035170 | Ga0373943_0023109 | Ga0373943_0023109_385_1104 | 238 |
| 1315 | 3300035172 | Ga0373955_0003095 | Ga0373955_0003095_4014_4733 | 238 |
| 1316 | 3300035172 | Ga0373955_0029659 | Ga0373955_0029659_1569_2288 | 238 |
| 1317 | 3300035410 | Ga0373924_0007214 | Ga0373924_0007214_1655_2374 | 238 |
| 1318 | 3300035410 | Ga0373924_0011253 | Ga0373924_0011253_1067_1786 | 238 |
| 1319 | 3300035410 | Ga0373924_0144945 | Ga0373924_0144945_38_757 | 238 |
| 1320 | 3300035692 | Ga0373935_0002137 | Ga0373935_0002137_10147_10866 | 238 |
| 1321 | 3300035692 | Ga0373935_0213405 | Ga0373935_0213405_322_1041 | 238 |
| 1322 | 3300035695 | Ga0373927_0012355 | Ga0373927_0012355_1155_1874 | 238 |
| 1323 | 3300035695 | Ga0373927_0019441 | Ga0373927_0019441_2119_2838 | 238 |
| 1324 | 3300035724 | Ga0373933_0001835 | Ga0373933_0001835_1067_1786 | 238 |
| 1325 | 3300035724 | Ga0373933_0006528 | Ga0373933_0006528_2048_2767 | 238 |
| 1326 | 3300035724 | Ga0373933_0009573 | Ga0373933_0009573_1807_2526 | 238 |
| 1327 | 3300035725 | Ga0373947_0054441 | Ga0373947_0054441_1617_2336 | 238 |
| 1328 | 3300037068 | Ga0373925_0001877 | Ga0373925_0001877_13275_13994 | 238 |
| 1329 | 3300039438 | Ga0436360_0701610 | Ga0436360_0701610_1033_1752 | 238 |
| 1330 | 3300039450 | Ga0436363_1697773 | Ga0436363_1697773_2609_3328 | 238 |
| 1331 | 3300041460 | Ga0451802_0169913 | Ga0451802_0169913_219_938 | 238 |
| 1332 | 3300044719 | Ga0466971_0274903 | Ga0466971_0274903_32_754 | 238 |
| 1333 | 3300045049 | Ga0466959_0450840 | Ga0466959_0450840_28_750 | 238 |
| 1334 | 3300045976 | Ga0466967_0082354 | Ga0466967_0082354_516_1235 | 238 |
| 1335 | 3300046454 | Ga0495592_0006884 | Ga0495592_0006884_2168_2887 | 238 |
| 1336 | 3300046454 | Ga0495592_0080289 | Ga0495592_0080289_82_801 | 238 |
| 1337 | 3300046455 | Ga0495603_0005432 | Ga0495603_0005432_2287_3006 | 238 |
| 1338 | 3300046459 | Ga0495629_0000532 | Ga0495629_0000532_8525_9244 | 238 |
| 1339 | 3300046459 | Ga0495629_0013169 | Ga0495629_0013169_1262_1981 | 238 |
| 1340 | 3300046461 | Ga0495641_0008153 | Ga0495641_0008153_5368_6087 | 238 |
| 1341 | 3300046462 | Ga0495651_0068600 | Ga0495651_0068600_367_1086 | 238 |
| 1342 | 3300046462 | Ga0495651_0149459 | Ga0495651_0149459_588_1307 | 238 |
| 1343 | 3300046462 | Ga0495651_0302379 | Ga0495651_0302379_22_741 | 238 |
| 1344 | 3300046463 | Ga0495653_0010069 | Ga0495653_0010069_1318_2037 | 238 |
| 1345 | 3300046472 | Ga0495580_0056230 | Ga0495580_0056230_1470_2189 | 238 |
| 1346 | 3300046473 | Ga0495582_0000331 | Ga0495582_0000331_23891_24610 | 238 |
| 1347 | 3300046474 | Ga0495605_0161109 | Ga0495605_0161109_82_801 | 238 |
| 1348 | 3300046475 | Ga0495639_0000147 | Ga0495639_0000147_11591_12310 | 238 |
| 1349 | 3300046476 | Ga0495662_0000716 | Ga0495662_0000716_13348_14067 | 238 |
| 1350 | 3300046477 | Ga0495664_0005574 | Ga0495664_0005574_4435_5154 | 238 |
| 1351 | 3300046499 | Ga0495594_0000113 | Ga0495594_0000113_23846_24565 | 238 |
| 1352 | 3300046511 | Ga0495608_0004537 | Ga0495608_0004537_71_790 | 238 |
| 1353 | 3300046511 | Ga0495608_0009049 | Ga0495608_0009049_3743_4462 | 238 |
| 1354 | 3300046514 | Ga0495618_0010718 | Ga0495618_0010718_3936_4655 | 238 |
| 1355 | 3300046514 | Ga0495618_0016158 | Ga0495618_0016158_3794_4513 | 238 |
| 1356 | 3300046516 | Ga0495628_0001092 | Ga0495628_0001092_21680_22399 | 238 |
| 1357 | 3300046516 | Ga0495628_0062677 | Ga0495628_0062677_387_1106 | 238 |
| 1358 | 3300046516 | Ga0495628_0245717 | Ga0495628_0245717_61_780 | 238 |
| 1359 | 3300046517 | Ga0495630_0004274 | Ga0495630_0004274_5544_6263 | 238 |
| 1360 | 3300046519 | Ga0495632_0096435 | Ga0495632_0096435_168_887 | 238 |
| 1361 | 3300046524 | Ga0495648_0000776 | Ga0495648_0000776_11272_11991 | 238 |
| 1362 | 3300046524 | Ga0495648_0001514 | Ga0495648_0001514_1521_2240 | 238 |
| 1363 | 3300046529 | Ga0495652_0073625 | Ga0495652_0073625_1339_2058 | 238 |
| 1364 | 3300046531 | Ga0495665_0000291 | Ga0495665_0000291_10089_10808 | 238 |
| 1365 | 3300046533 | Ga0495640_0005851 | Ga0495640_0005851_5730_6449 | 238 |
| 1366 | 3300046533 | Ga0495640_0032424 | Ga0495640_0032424_2431_3150 | 238 |
| 1367 | 3300046533 | Ga0495640_0051488 | Ga0495640_0051488_695_1414 | 238 |
| 1368 | 3300046536 | Ga0495587_0018944 | Ga0495587_0018944_1934_2653 | 238 |
| 1369 | 3300046536 | Ga0495587_0021240 | Ga0495587_0021240_1096_1815 | 238 |
| 1370 | 3300046543 | Ga0495645_0037792 | Ga0495645_0037792_2608_3327 | 238 |
| 1371 | 3300046557 | Ga0495622_0004379 | Ga0495622_0004379_976_1695 | 238 |
| 1372 | 3300046559 | Ga0495667_0014817 | Ga0495667_0014817_2503_3222 | 238 |
| 1373 | 3300046616 | Ga0495668_0216692 | Ga0495668_0216692_291_1010 | 238 |
| 1374 | 3300046642 | Ga0495634_0003174 | Ga0495634_0003174_11851_12570 | 238 |
| 1375 | 3300046642 | Ga0495634_0011850 | Ga0495634_0011850_2446_3165 | 238 |
| 1376 | 3300046663 | Ga0495635_0000491 | Ga0495635_0000491_20089_20808 | 238 |
| 1377 | 3300046663 | Ga0495635_0007428 | Ga0495635_0007428_953_1672 | 238 |
| 1378 | 3300046663 | Ga0495635_0028493 | Ga0495635_0028493_2431_3150 | 238 |
| 1379 | 3300046664 | Ga0495659_0019004 | Ga0495659_0019004_1126_1845 | 238 |
| 1380 | 3300046674 | Ga0495588_0057864 | Ga0495588_0057864_652_1371 | 238 |
| 1381 | 3300046675 | Ga0495657_0011578 | Ga0495657_0011578_2048_2767 | 238 |
| 1382 | 3300046675 | Ga0495657_0021093 | Ga0495657_0021093_2362_3081 | 238 |
| 1383 | 3300046675 | Ga0495657_0176096 | Ga0495657_0176096_253_972 | 238 |
| 1384 | 3300046678 | Ga0495599_0019185 | Ga0495599_0019185_3075_3794 | 238 |
| 1385 | 3300046678 | Ga0495599_0122084 | Ga0495599_0122084_721_1440 | 238 |
| 1386 | 3300046679 | Ga0495623_0120508 | Ga0495623_0120508_565_1284 | 238 |
| 1387 | 3300046680 | Ga0495646_0031381 | Ga0495646_0031381_1407_2126 | 238 |
| 1388 | 3300046680 | Ga0495646_0040428 | Ga0495646_0040428_1328_2047 | 238 |
| 1389 | 3300046681 | Ga0495647_0007692 | Ga0495647_0007692_743_1462 | 238 |
| 1390 | 3300046683 | Ga0495658_0001211 | Ga0495658_0001211_1117_1836 | 238 |
| 1391 | 3300046689 | Ga0495613_0002051 | Ga0495613_0002051_495_1214 | 238 |
| 1392 | 3300046689 | Ga0495613_0104978 | Ga0495613_0104978_219_938 | 238 |
| 1393 | 3300046689 | Ga0495613_0109386 | Ga0495613_0109386_49_768 | 238 |
| 1394 | 3300046689 | Ga0495613_0249616 | Ga0495613_0249616_168_887 | 238 |
| 1395 | 3300046690 | Ga0495624_0008987 | Ga0495624_0008987_3464_4183 | 238 |
| 1396 | 3300046809 | Ga0495600_0008599 | Ga0495600_0008599_3079_3798 | 238 |
| 1397 | 3300046809 | Ga0495600_0103729 | Ga0495600_0103729_796_1515 | 238 |
| 1398 | 3300047315 | Ga0495581_0000620 | Ga0495581_0000620_4275_4994 | 238 |
| 1399 | 3300047315 | Ga0495581_0154759 | Ga0495581_0154759_338_1057 | 238 |
| 1400 | 3300047315 | Ga0495581_0229963 | Ga0495581_0229963_149_868 | 238 |
| 1401 | 3300047317 | Ga0495604_0005882 | Ga0495604_0005882_6291_7010 | 238 |
| 1402 | 3300047319 | Ga0495674_0001226 | Ga0495674_0001226_4307_5026 | 238 |
| 1403 | 3300047319 | Ga0495674_0111936 | Ga0495674_0111936_217_936 | 238 |
| 1404 | 3300047321 | Ga0495676_0044749 | Ga0495676_0044749_1019_1738 | 238 |
| 1405 | 3300047322 | Ga0495680_0095272 | Ga0495680_0095272_168_887 | 238 |
| 1406 | 3300047444 | Ga0495675_0005368 | Ga0495675_0005368_1190_1909 | 238 |
| 1407 | 3300047471 | Ga0495684_0000897 | Ga0495684_0000897_19360_20079 | 238 |
| 1408 | 3300047471 | Ga0495684_0052148 | Ga0495684_0052148_1735_2454 | 238 |
| 1409 | 3300047471 | Ga0495684_0172219 | Ga0495684_0172219_585_1304 | 238 |
| 1410 | 3300047472 | Ga0495686_0226041 | Ga0495686_0226041_184_903 | 238 |
| 1411 | 3300047673 | Ga0495593_0000389 | Ga0495593_0000389_10704_11423 | 238 |
| 1412 | 3300048088 | Ga0495602_0013144 | Ga0495602_0013144_6561_7280 | 238 |
| 1413 | 3300048903 | Ga0496100_0012832 | Ga0496100_0012832_3687_4406 | 238 |
| 1414 | 3300048903 | Ga0496100_0288218 | Ga0496100_0288218_346_1065 | 238 |
| 1415 | 3300048903 | Ga0496100_0305044 | Ga0496100_0305044_31_750 | 238 |
| 1416 | 3300048906 | Ga0496103_0425452 | Ga0496103_0425452_14_733 | 238 |
| 1417 | 3300048907 | Ga0496104_0158543 | Ga0496104_0158543_902_1621 | 238 |
| 1418 | 3300048909 | Ga0496106_0006109 | Ga0496106_0006109_7020_7739 | 238 |
| 1419 | 3300048910 | Ga0496107_0018364 | Ga0496107_0018364_3946_4665 | 238 |
| 1420 | 3300048911 | Ga0496108_0000764 | Ga0496108_0000764_16519_17238 | 238 |
| 1421 | 3300048912 | Ga0496109_0004357 | Ga0496109_0004357_7444_8163 | 238 |
| 1422 | 3300048915 | Ga0496112_0004915 | Ga0496112_0004915_3706_4425 | 238 |
| 1423 | 3300048915 | Ga0496112_0023568 | Ga0496112_0023568_90_809 | 238 |
| 1424 | 3300048917 | Ga0496114_0244542 | Ga0496114_0244542_391_1110 | 238 |
| 1425 | 3300048918 | Ga0496115_0279239 | Ga0496115_0279239_175_894 | 238 |
| 1426 | 3300048924 | Ga0496121_0001543 | Ga0496121_0001543_24682_25401 | 238 |
| 1427 | 3300048928 | Ga0496125_0047355 | Ga0496125_0047355_1677_2396 | 238 |
| 1428 | 3300048928 | Ga0496125_0152594 | Ga0496125_0152594_712_1434 | 238 |
| 1429 | 3300048929 | Ga0496126_0005900 | Ga0496126_0005900_2531_3250 | 238 |
| 1430 | 3300048929 | Ga0496126_0077667 | Ga0496126_0077667_1127_1849 | 238 |
| 1431 | 3300048929 | Ga0496126_0104250 | Ga0496126_0104250_108_827 | 238 |
| 1432 | 3300048929 | Ga0496126_0105850 | Ga0496126_0105850_1325_2044 | 238 |
| 1433 | 3300048929 | Ga0496126_0147005 | Ga0496126_0147005_356_1075 | 238 |
| 1434 | 3300049568 | Ga0501031_0163876 | Ga0501031_0163876_583_1308 | 238 |
| 1435 | 3300049569 | Ga0501032_0159161 | Ga0501032_0159161_270_992 | 238 |
| 1436 | 3300049569 | Ga0501032_0182983 | Ga0501032_0182983_547_1272 | 238 |
| 1437 | 3300049570 | Ga0501033_0006379 | Ga0501033_0006379_1156_1878 | 238 |
| 1438 | 3300049572 | Ga0501036_0265193 | Ga0501036_0265193_63_785 | 238 |
| 1439 | 3300049573 | Ga0501037_0033396 | Ga0501037_0033396_588_1310 | 238 |
| 1440 | 3300049574 | Ga0501038_0004208 | Ga0501038_0004208_5211_5933 | 238 |
| 1441 | 3300049574 | Ga0501038_0205716 | Ga0501038_0205716_262_987 | 238 |
| 1442 | 3300049576 | Ga0501040_0500770 | Ga0501040_0500770_35_754 | 238 |
| 1443 | 3300049579 | Ga0501043_0579497 | Ga0501043_0579497_11_733 | 238 |
| 1444 | 3300049581 | Ga0501047_0013515 | Ga0501047_0013515_673_1395 | 238 |
| 1445 | 3300049586 | Ga0501070_0204948 | Ga0501070_0204948_754_1476 | 238 |
| 1446 | 3300049589 | Ga0501073_0114093 | Ga0501073_0114093_1030_1752 | 238 |
| 1447 | 3300049742 | Ga0501080_0311972 | Ga0501080_0311972_226_948 | 238 |
| 1448 | 3300049822 | Ga0501035_0122045 | Ga0501035_0122045_1097_1819 | 238 |
| 1449 | 3300049823 | Ga0501044_0004858 | Ga0501044_0004858_12266_12988 | 238 |
| 1450 | 3300049823 | Ga0501044_0622559 | Ga0501044_0622559_112_834 | 238 |
| 1451 | 3300049823 | Ga0501044_0645009 | Ga0501044_0645009_154_876 | 238 |
| 1452 | 3300050494 | nmdc:mga06z11_250804_c1 | nmdc:mga06z11_250804_c1_161_880 | 238 |
| 1453 | 3300050509 | nmdc:mga0qj67_227519_c1 | nmdc:mga0qj67_227519_c1_547_1266 | 238 |
| 1454 | 3300053077 | Ga0495601_0015596 | Ga0495601_0015596_1788_2507 | 238 |
| 1455 | 3300053078 | Ga0495612_0061626 | Ga0495612_0061626_51_770 | 238 |
| 1456 | 3300053084 | Ga0495595_0019377 | Ga0495595_0019377_63_782 | 238 |
| 1457 | 3300053084 | Ga0495595_0029233 | Ga0495595_0029233_949_1668 | 238 |
| 1458 | 3300053085 | Ga0495619_0010830 | Ga0495619_0010830_2853_3572 | 238 |
| 1459 | 3300053085 | Ga0495619_0447829 | Ga0495619_0447829_56_775 | 238 |
| 1460 | 3300053096 | Ga0500641_0008013 | Ga0500641_0008013_2228_2947 | 238 |
| 1461 | 3300053119 | Ga0500595_003407 | Ga0500595_003407_1449_2168 | 238 |
| 1462 | 3300053139 | Ga0500568_0079638 | Ga0500568_0079638_128_847 | 238 |
| 1463 | 3300053177 | Ga0500636_0003333 | Ga0500636_0003333_4059_4778 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gwb-assembly1.cif.gz_A-2 | crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 | 0.9656 | 51 | 201 |
| 3bqg-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) | 0.9524 | 49 | 201 |
| 3bqe-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) | 0.9496 | 49 | 201 |
| 1nwa-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine | 0.9493 | 49 | 201 |
| 7e43-assembly2.cif.gz_A | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9473 | 49 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9599 | 51 | 198 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.941 | 51 | 198 | 3.30.1060.10 |
| af_P9WJM5_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9361 | 47 | 205 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9112 | 43 | 202 | 3.30.1060.10 |
| af_Q09859_1_167_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9069 | 51 | 208 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5W4M2-F1-model_v4 | deleted | 0.9965 | 53 | 231 |
|
| AF-A0A2L1CRP3-F1-model_v4 | deleted | 0.9963 | 30 | 233 |
|
| AF-A0A2V7ITR3-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9937 | 53 | 225 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A7Z1N7L7-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9934 | 77 | 225 |
GO:0008113
|
| AF-A0A522GLU1-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9929 | 40 | 231 |
GO:0008113
GO:0033744 GO:0036211 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar