F494148

General Info

Members Datasets Scaffolds Average Seq Length
1463 733 1235 234

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0310543|Ga0496102_0310543_638_1453
Length 271
Sequence LLRIFVVRWSASGDPPTFSDNDYPTSPSREEAKMSPSQFSRLSLLAAAIGAVALSALTISYSKAAEEAVIIPPPAMDVQAASGMQTAVLAGGCFWGVQGVFQHTAGVVNAVSGYAGGSKMTADYNMVSTGTTGHAESVEIKYDPKKISYGKILQIFFSVVHDPTQLNRQGPDTGTQYRSAIFTTNDEQKKVAEAYISQLNAAKVYKKPIVTKISALDAFFPAEAYHQDYLTLHPNQPYIAYNDIPKVENLKKIFAENYVEKPTLVSARVTN

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
26 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
32 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
33 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
34 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
35 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
36 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
37 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
38 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
39 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
40 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
41 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
42 2791355199
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
45 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
46 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
47 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
48 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
49 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
50 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
51 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
52 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
53 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
54 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
55 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
56 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
57 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
58 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
59 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
60 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
61 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
62 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
63 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
64 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
75 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
78 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
79 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
80 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
81 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
82 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
83 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
84 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
85 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
92 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
93 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
94 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
95 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
98 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
99 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
100 2904699407
101 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
102 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
103 2906610324
104 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
105 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
106 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
107 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
108 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
109 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
110 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
111 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
112 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
113 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
114 2922368715
115 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
116 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
117 2922425934
118 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
119 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
120 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
121 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
122 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
123 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
124 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
125 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
126 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
127 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
128 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
129 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
130 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
131 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
132 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
133 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
134 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
135 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
136 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
137 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
138 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
139 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
140 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
141 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
142 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
143 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
144 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
145 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
146 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
147 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
148 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
149 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
150 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
151 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
152 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
153 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
154 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
155 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
156 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
157 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
158 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
159 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
160 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
161 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
162 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
163 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
164 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
165 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
166 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
167 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
168 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
169 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
170 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
171 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
172 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
173 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
174 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
175 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
176 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
177 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
178 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
179 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
180 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
181 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
182 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
183 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
184 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
185 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
186 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
187 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
188 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
189 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
190 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
191 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
192 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
193 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
194 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
195 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
196 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
197 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
198 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
199 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
200 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
201 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
203 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
204 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
205 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
206 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
207 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
208 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
209 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
210 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
211 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
213 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
214 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
215 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
216 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
217 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
218 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
219 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
220 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
223 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
224 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
225 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
226 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
227 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
228 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
229 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
230 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
231 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
232 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
233 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
234 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
235 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
236 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
237 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
238 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
239 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
240 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
241 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
242 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
243 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
244 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
245 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
246 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
247 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
248 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
249 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
250 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
251 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
252 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
253 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
254 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
255 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
256 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
257 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
258 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
259 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
260 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
261 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
262 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
263 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
264 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
265 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
266 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
267 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
268 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
269 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
270 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
271 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
272 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
273 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
274 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
275 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
276 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
277 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
278 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
279 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
280 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
281 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
282 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
283 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
284 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
285 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
286 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
287 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
288 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
289 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
290 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
291 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
292 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
293 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
294 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
295 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
296 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
297 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
298 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
299 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
300 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
301 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
302 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
303 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
305 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
306 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
307 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
308 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
309 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
310 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
313 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
314 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
315 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
316 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
317 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
318 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
321 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
322 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
323 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
324 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
325 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
326 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
327 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
328 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
329 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
330 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
331 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
332 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
333 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
334 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
335 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
336 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
337 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
338 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
339 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
340 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
341 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
342 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
343 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
344 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
345 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
346 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
347 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
350 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
352 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
353 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
356 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
357 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
358 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
360 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
361 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
362 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
363 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
364 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
365 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
420 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
421 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
422 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
423 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
426 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
427 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
431 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
432 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
433 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
434 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
435 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
436 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
437 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
438 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
439 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
440 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
441 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
442 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
443 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
444 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
445 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
446 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
447 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
448 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
449 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
450 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
451 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
452 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
453 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
454 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
455 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
456 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
457 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
458 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
459 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
460 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
461 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
462 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
463 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
464 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
465 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
466 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
467 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
468 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
469 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
470 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
471 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
472 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
473 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
474 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
475 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
476 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
477 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
478 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
479 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
480 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
481 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
482 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
483 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
484 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
485 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
486 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
487 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
488 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
489 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
490 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
491 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
492 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
493 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
494 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
495 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
496 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
497 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
498 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
499 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
500 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
501 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
502 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
503 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
504 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
505 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
506 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
507 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
508 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
509 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
510 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
511 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
512 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
513 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
514 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
515 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
516 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
517 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
518 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
519 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
520 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
521 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
522 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
523 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
524 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
525 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
526 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
527 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
528 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
529 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
530 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
531 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
532 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
533 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
534 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
535 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
536 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
537 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
538 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
539 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
540 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
541 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
542 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
543 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
544 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
545 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
546 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
547 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
548 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
549 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
550 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
551 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
552 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
553 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
554 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
555 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
556 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
557 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
558 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
559 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
560 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
561 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
562 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
563 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
564 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
565 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
566 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
567 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
568 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
569 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
570 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
571 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
572 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
573 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
574 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
575 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
576 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
577 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
578 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
579 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
580 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
581 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
582 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
583 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
584 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
585 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
586 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
587 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
588 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
589 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
590 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
591 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
592 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
593 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
594 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
595 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
596 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
597 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
598 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
599 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
600 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
601 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
602 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
603 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
610 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
611 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
612 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
619 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
620 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
621 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
622 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
623 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
624 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
625 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
626 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
627 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
628 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
631 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
632 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
633 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
634 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
635 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
636 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
637 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
638 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
639 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
640 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
641 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
642 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
643 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
644 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
645 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
646 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
647 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
648 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
649 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
650 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
651 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
652 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
653 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
654 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
655 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
656 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
657 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
658 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
659 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
660 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
661 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
662 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
663 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
664 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
665 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
666 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
667 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
668 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
669 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
670 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
671 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
672 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
673 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
674 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
675 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
676 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
677 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
678 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
679 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
680 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
681 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
682 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
683 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
684 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
685 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
686 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
687 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
688 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
689 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
690 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
691 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
692 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
693 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
694 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
695 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
696 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
697 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
698 8005258706 Rhizobium sp. R693 Isolate Nodule
699 8005321885 Rhizobium sp. R72 Isolate Nodule
700 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
701 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
702 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
703 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
704 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
705 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
706 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
707 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
708 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
709 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
710 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
711 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
712 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
713 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
714 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
715 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
716 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
717 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
718 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
719 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
720 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
721 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
722 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
723 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
724 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
725 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
726 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
727 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
728 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
729 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
730 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
731 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
732 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
733 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.26
Metatranscriptomes 1.51
Isolates 15.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.92
Nodule 11.21
Rhizoplane 6.02
Rhizosphere 58.17
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006154 3300000549 Bacteria 1502
2 JGI24740J21852_10000767 3300001979 Bacteria 14071
3 JGI25155J39150_1000198 3300002704 Bacteria 25200
4 JGI25155J39150_1000408 3300002704 Bacteria 11785
5 JGI25156J39149_1000057 3300002705 Bacteria 86392
6 JGI25156J39149_1002321 3300002705 Bacteria 6937
7 JGI25162J39368_1000277 3300002737 Bacteria 48696
8 JGI25162J39368_1003686 3300002737 Bacteria 4182
9 JGI25154J39366_1000087 3300002738 Bacteria 86392
10 JGI25154J39366_1000925 3300002738 Bacteria 12344
11 JGI25157J39369_1000336 3300002741 Bacteria 33359
12 JGI25152J39213_1002781 3300002773 Bacteria 6332
13 JGI25159J45721_1001498 3300002987 Bacteria 9580
14 Ga0006778J45830_1005206 3300003162 Bacteria 1262
15 Ga0006778J45830_1037934 3300003162 Bacteria 857
16 JGI25406J46586_10000042 3300003203 Bacteria 56211
17 JGI25406J46586_10001462 3300003203 Bacteria 11132
18 JGI25406J46586_10029632 3300003203 Bacteria 2068
19 JGI25165J46597_1003489 3300003214 Bacteria 3875
20 JGI25165J46597_1004533 3300003214 Bacteria 2945
21 JGI25153J46596_10001736 3300003215 Bacteria 12940
22 JGI25153J46596_10003826 3300003215 Bacteria 8296
23 JGI25153J46596_10004140 3300003215 Bacteria 7883
24 JGI25153J46596_10005975 3300003215 Bacteria 6266
25 JGI25153J46596_10011700 3300003215 Bacteria 3855
26 JGI25153J46596_10038013 3300003215 Bacteria 1523
27 JGI25160J50197_1002670 3300003354 Bacteria 8209
28 JGI25160J50197_1009335 3300003354 Bacteria 3650
29 JGI25160J50197_1029710 3300003354 Bacteria 1439
30 Ga0007417J51691_1021109 3300003544 Bacteria 964
31 Ga0006781J51513_1004680 3300003568 Bacteria 1226
32 Ga0007410J51695_1023793 3300003574 Bacteria 830
33 Ga0007416J51690_1011819 3300003577 Bacteria 1234
34 Ga0007429J51699_1006648 3300003579 Bacteria 1228
35 JGI25404J52841_10016701 3300003659 Bacteria 1592
36 JGI25404J52841_10027496 3300003659 Bacteria 1223
37 JGI25404J52841_10058120 3300003659 Bacteria 811
38 Ga0032354_1001469 3300003693 Bacteria 1355
39 Ga0006780_1000642 3300003735 Bacteria 777
40 Ga0055539_1013566 3300003752 Bacteria 998
41 Ga0055532_1000016 3300003758 Bacteria 327509
42 Ga0055524_1029581 3300003775 Bacteria 1616
43 Ga0055528_1008660 3300003790 Bacteria 4325
44 Ga0055531_10006809 3300003794 Bacteria 6380
45 JGI25405J52794_10040334 3300003911 Bacteria 987
46 Ga0055543_1005069 3300004625 Bacteria 3434
47 Ga0058859_11354442 3300004798 Bacteria 939
48 Ga0058861_12010056 3300004800 Bacteria 1175
49 Ga0065165_1001376 3300005262 Bacteria 26733
50 Ga0065165_1003381 3300005262 Bacteria 11283
51 Ga0065165_1006721 3300005262 Bacteria 5908
52 Ga0065165_1042564 3300005262 Bacteria 1339
53 Ga0070683_100353009 3300005329 Bacteria 1400
54 Ga0070670_100166969 3300005331 Bacteria 1909
55 Ga0070677_10027820 3300005333 Bacteria 2131
56 Ga0070666_10091775 3300005335 Bacteria 2087
57 Ga0070666_10546164 3300005335 Bacteria 843
58 Ga0070680_100011514 3300005336 Bacteria 6846
59 Ga0070680_100088017 3300005336 Bacteria 2568
60 Ga0070680_100308636 3300005336 Bacteria 1342
61 Ga0070682_100025295 3300005337 Bacteria 3541
62 Ga0068868_100117433 3300005338 Bacteria 2167
63 Ga0068868_100288646 3300005338 Bacteria 1390
64 Ga0068868_100504877 3300005338 Bacteria 1060
65 Ga0070660_100359116 3300005339 Bacteria 1200
66 Ga0070691_10062835 3300005341 Bacteria 1789
67 Ga0070687_100241257 3300005343 Bacteria 1118
68 Ga0070661_100238131 3300005344 Bacteria 1400
69 Ga0070661_100353940 3300005344 Bacteria 1153
70 Ga0070668_100027694 3300005347 Bacteria 4302
71 Ga0070668_100034676 3300005347 Bacteria 3846
72 Ga0070668_100273988 3300005347 Bacteria 1407
73 Ga0070668_100312648 3300005347 Bacteria 1320
74 Ga0070669_100141703 3300005353 Bacteria 1854
75 Ga0070671_100045130 3300005355 Bacteria 3663
76 Ga0070671_100070957 3300005355 Bacteria 2907
77 Ga0070671_100200942 3300005355 Bacteria 1690
78 Ga0070671_100273068 3300005355 Bacteria 1437
79 Ga0070671_100640921 3300005355 Bacteria 920
80 Ga0070674_100097673 3300005356 Bacteria 2133
81 Ga0070673_100769279 3300005364 Bacteria 887
82 Ga0070688_100013583 3300005365 Bacteria 4597
83 Ga0070688_100154951 3300005365 Bacteria 1569
84 Ga0070659_100052884 3300005366 Bacteria 3195
85 Ga0070659_100214544 3300005366 Bacteria 1587
86 Ga0070659_100330430 3300005366 Bacteria 1276
87 Ga0070659_100519196 3300005366 Bacteria 1017
88 Ga0070659_100691825 3300005366 Bacteria 881
89 Ga0070667_100125652 3300005367 Bacteria 2235
90 Ga0070709_10005526 3300005434 Bacteria 6844
91 Ga0070709_10010952 3300005434 Bacteria 5037
92 Ga0070709_10058749 3300005434 Bacteria 2440
93 Ga0070709_10171116 3300005434 Bacteria 1518
94 Ga0070714_100002233 3300005435 Bacteria 14249
95 Ga0070714_100081991 3300005435 Bacteria 2809
96 Ga0070714_100156494 3300005435 Bacteria 2058
97 Ga0070714_100220629 3300005435 Bacteria 1742
98 Ga0070713_100004820 3300005436 Bacteria 9135
99 Ga0070713_100058748 3300005436 Bacteria 3209
100 Ga0070713_100071226 3300005436 Bacteria 2937
101 Ga0070713_100097470 3300005436 Bacteria 2541
102 Ga0070713_100130356 3300005436 Bacteria 2216
103 Ga0070713_100170583 3300005436 Bacteria 1949
104 Ga0070710_10000549 3300005437 Bacteria 17726
105 Ga0070711_100007048 3300005439 Bacteria 6817
106 Ga0070711_100017942 3300005439 Bacteria 4511
107 Ga0070711_100069372 3300005439 Bacteria 2480
108 Ga0070700_100069003 3300005441 Bacteria 2249
109 Ga0070663_100010930 3300005455 Bacteria 5673
110 Ga0070663_100067660 3300005455 Bacteria 2592
111 Ga0070663_100148879 3300005455 Bacteria 1793
112 Ga0070663_100326240 3300005455 Bacteria 1236
113 Ga0070663_100422958 3300005455 Bacteria 1093
114 Ga0070678_100041320 3300005456 Bacteria 3268
115 Ga0070678_100047311 3300005456 Bacteria 3090
116 Ga0070678_100568549 3300005456 Bacteria 1008
117 Ga0070662_100084819 3300005457 Bacteria 2367
118 Ga0070662_100712441 3300005457 Bacteria 849
119 Ga0070681_10087634 3300005458 Bacteria 3065
120 Ga0070681_10295193 3300005458 Bacteria 1531
121 Ga0068867_100952356 3300005459 Bacteria 775
122 Ga0070685_10168476 3300005466 Bacteria 1402
123 Ga0070685_10336700 3300005466 Bacteria 1028
124 Ga0070706_100158402 3300005467 Bacteria 2114
125 Ga0070707_100033994 3300005468 Bacteria 4863
126 Ga0070707_100581791 3300005468 Bacteria 1082
127 Ga0070699_100149816 3300005518 Bacteria 2063
128 Ga0070684_100010958 3300005535 Bacteria 7208
129 Ga0070697_100320031 3300005536 Bacteria 1336
130 Ga0070697_100729571 3300005536 Bacteria 875
131 Ga0068853_100011007 3300005539 Bacteria 7336
132 Ga0068853_100387662 3300005539 Bacteria 1306
133 Ga0068853_100540120 3300005539 Bacteria 1103
134 Ga0070672_100219817 3300005543 Bacteria 1593
135 Ga0070696_100086014 3300005546 Bacteria 2232
136 Ga0070693_100372648 3300005547 Bacteria 983
137 Ga0070665_100014804 3300005548 Bacteria 7830
138 Ga0070665_100016255 3300005548 Bacteria 7465
139 Ga0070665_100026397 3300005548 Bacteria 5850
140 Ga0070665_100082234 3300005548 Bacteria 3226
141 Ga0070665_100143198 3300005548 Bacteria 2394
142 Ga0070665_100148314 3300005548 Bacteria 2348
143 Ga0070665_100153970 3300005548 Bacteria 2301
144 Ga0070665_100161902 3300005548 Bacteria 2239
145 Ga0070665_100171758 3300005548 Bacteria 2169
146 Ga0070665_100524084 3300005548 Bacteria 1197
147 Ga0068855_100045608 3300005563 Bacteria 5184
148 Ga0068855_100059386 3300005563 Bacteria 4475
149 Ga0068855_100103063 3300005563 Bacteria 3284
150 Ga0068855_100155264 3300005563 Bacteria 2601
151 Ga0068855_100235166 3300005563 Bacteria 2049
152 Ga0068855_100291329 3300005563 Bacteria 1809
153 Ga0070664_100122248 3300005564 Bacteria 2280
154 Ga0070664_100291013 3300005564 Bacteria 1475
155 Ga0068857_100049570 3300005577 Bacteria 3725
156 Ga0068857_100178355 3300005577 Bacteria 1933
157 Ga0068854_100151272 3300005578 Bacteria 1790
158 Ga0068854_100201872 3300005578 Bacteria 1563
159 Ga0068856_100003313 3300005614 Bacteria 16364
160 Ga0068856_100131687 3300005614 Bacteria 2506
161 Ga0068856_100188069 3300005614 Bacteria 2079
162 Ga0068856_100425696 3300005614 Bacteria 1347
163 Ga0068856_100552487 3300005614 Bacteria 1173
164 Ga0068852_100038969 3300005616 Bacteria 3998
165 Ga0068852_100246511 3300005616 Bacteria 1710
166 Ga0068852_100835030 3300005616 Bacteria 936
167 Ga0068864_100069542 3300005618 Bacteria 3061
168 Ga0068866_10111408 3300005718 Bacteria 1528
169 Ga0068861_100168874 3300005719 Bacteria 1811
170 Ga0068851_10011299 3300005834 Bacteria 4185
171 Ga0068851_10244567 3300005834 Bacteria 1016
172 Ga0068863_100267222 3300005841 Bacteria 1655
173 Ga0068863_100301418 3300005841 Bacteria 1555
174 Ga0068863_100390284 3300005841 Bacteria 1360
175 Ga0068858_100073088 3300005842 Bacteria 3183
176 Ga0068858_100094941 3300005842 Bacteria 2778
177 Ga0068858_100476957 3300005842 Bacteria 1204
178 Ga0068860_100000534 3300005843 Bacteria 46465
179 Ga0068860_100153346 3300005843 Bacteria 2219
180 Ga0068860_101072146 3300005843 Bacteria 825
181 Ga0068862_100105017 3300005844 Bacteria 2476
182 Ga0081455_10000815 3300005937 Bacteria 40097
183 Ga0081455_10012165 3300005937 Bacteria 8597
184 Ga0081455_10022180 3300005937 Bacteria 5941
185 Ga0081540_1003580 3300005983 Bacteria 12204
186 Ga0081540_1004327 3300005983 Bacteria 10875
187 Ga0081540_1008358 3300005983 Bacteria 7233
188 Ga0081540_1010413 3300005983 Bacteria 6302
189 Ga0081540_1011157 3300005983 Bacteria 6030
190 Ga0081540_1011347 3300005983 Bacteria 5960
191 Ga0081540_1087692 3300005983 Bacteria 1378
192 Ga0081540_1110169 3300005983 Bacteria 1166
193 Ga0081539_10000099 3300005985 Bacteria 201018
194 Ga0081539_10000958 3300005985 Bacteria 54105
195 Ga0081539_10030928 3300005985 Bacteria 3310
196 Ga0081539_10128426 3300005985 Bacteria 1249
197 Ga0070717_10000884 3300006028 Bacteria 19823
198 Ga0070717_10003176 3300006028 Bacteria 11737
199 Ga0070717_10063343 3300006028 Bacteria 3068
200 Ga0070717_10791037 3300006028 Bacteria 863
201 Ga0075365_10000529 3300006038 Bacteria 14696
202 Ga0075365_10059515 3300006038 Bacteria 2546
203 Ga0075368_10195728 3300006042 Bacteria 854
204 Ga0075363_100013678 3300006048 Bacteria 3944
205 Ga0075363_100025950 3300006048 Bacteria 2994
206 Ga0075363_100049181 3300006048 Bacteria 2244
207 Ga0075364_10031891 3300006051 Bacteria 3385
208 Ga0075364_10054185 3300006051 Bacteria 2623
209 Ga0075364_10121089 3300006051 Bacteria 1751
210 Ga0070715_10001749 3300006163 Bacteria 6464
211 Ga0070716_100005320 3300006173 Bacteria 6223
212 Ga0070716_100033588 3300006173 Bacteria 2807
213 Ga0070716_100141225 3300006173 Bacteria 1536
214 Ga0070716_100434674 3300006173 Bacteria 953
215 Ga0070712_100024654 3300006175 Bacteria 3989
216 Ga0070712_100857464 3300006175 Bacteria 782
217 Ga0075362_10025311 3300006177 Bacteria 2525
218 Ga0075362_10028330 3300006177 Bacteria 2405
219 Ga0075362_10047595 3300006177 Bacteria 1910
220 Ga0075367_10011261 3300006178 Bacteria 4725
221 Ga0075367_10028491 3300006178 Bacteria 3186
222 Ga0075367_10037617 3300006178 Bacteria 2813
223 Ga0075367_10058666 3300006178 Bacteria 2290
224 Ga0075367_10195637 3300006178 Bacteria 1262
225 Ga0075369_10009378 3300006186 Bacteria 3801
226 Ga0075369_10021528 3300006186 Bacteria 2651
227 Ga0075369_10061887 3300006186 Bacteria 1634
228 Ga0075366_10036160 3300006195 Bacteria 2911
229 Ga0075366_10053729 3300006195 Bacteria 2393
230 Ga0097621_100078434 3300006237 Bacteria 2744
231 Ga0097621_100192342 3300006237 Bacteria 1767
232 Ga0075370_10006177 3300006353 Bacteria 6008
233 Ga0075370_10043189 3300006353 Bacteria 2547
234 Ga0075370_10043400 3300006353 Bacteria 2541
235 Ga0075370_10080200 3300006353 Bacteria 1875
236 Ga0075370_10292859 3300006353 Bacteria 967
237 Ga0068871_100050386 3300006358 Bacteria 3368
238 Ga0068871_100347315 3300006358 Bacteria 1311
239 Ga0075434_100006045 3300006871 Bacteria 11068
240 Ga0099824_1013868 3300006942 Bacteria 8216
241 Ga0099822_1054877 3300006943 Bacteria 1499
242 Ga0099823_1032665 3300006944 Bacteria 4222
243 Ga0099795_10024287 3300007788 Bacteria 2020
244 Ga0099795_10029257 3300007788 Bacteria 1881
245 Ga0105250_10071291 3300009092 Bacteria 1403
246 Ga0105240_10000497 3300009093 Bacteria 72381
247 Ga0105240_10025997 3300009093 Bacteria 7688
248 Ga0105240_10042855 3300009093 Bacteria 5765
249 Ga0105240_10098710 3300009093 Bacteria 3556
250 Ga0105240_10146636 3300009093 Bacteria 2816
251 Ga0105240_10339230 3300009093 Bacteria 1708
252 Ga0105240_10574421 3300009093 Bacteria 1244
253 Ga0105240_10619226 3300009093 Bacteria 1190
254 Ga0111539_10004709 3300009094 Bacteria 17828
255 Ga0111539_10392146 3300009094 Bacteria 1617
256 Ga0105245_10025310 3300009098 Bacteria 5218
257 Ga0105247_10137117 3300009101 Bacteria 1599
258 Ga0105247_10363603 3300009101 Bacteria 1021
259 Ga0105247_10490616 3300009101 Bacteria 893
260 Ga0114129_10419060 3300009147 Bacteria 1761
261 Ga0114129_10431581 3300009147 Bacteria 1731
262 Ga0114129_11129443 3300009147 Bacteria 980
263 Ga0114129_11206551 3300009147 Bacteria 942
264 Ga0105243_10088252 3300009148 Bacteria 2548
265 Ga0105241_10050926 3300009174 Bacteria 3157
266 Ga0105242_10237267 3300009176 Bacteria 1637
267 Ga0105242_10406877 3300009176 Bacteria 1271
268 Ga0105248_10030134 3300009177 Bacteria 6056
269 Ga0105248_10110038 3300009177 Bacteria 3106
270 Ga0105248_10113191 3300009177 Bacteria 3060
271 Ga0105237_10031990 3300009545 Bacteria 5328
272 Ga0105237_10033065 3300009545 Bacteria 5239
273 Ga0105237_10040649 3300009545 Bacteria 4689
274 Ga0105237_10041954 3300009545 Bacteria 4614
275 Ga0105237_10049749 3300009545 Bacteria 4212
276 Ga0105237_10072458 3300009545 Bacteria 3438
277 Ga0105237_10150599 3300009545 Bacteria 2323
278 Ga0105237_10159053 3300009545 Bacteria 2257
279 Ga0105237_10442143 3300009545 Bacteria 1306
280 Ga0105238_10016659 3300009551 Bacteria 7445
281 Ga0105238_10030444 3300009551 Bacteria 5494
282 Ga0105238_10047369 3300009551 Bacteria 4335
283 Ga0105238_10071229 3300009551 Bacteria 3474
284 Ga0105238_10108125 3300009551 Bacteria 2762
285 Ga0105238_10112637 3300009551 Bacteria 2700
286 Ga0105238_10128331 3300009551 Bacteria 2514
287 Ga0105238_10178649 3300009551 Bacteria 2099
288 Ga0105238_10292697 3300009551 Bacteria 1611
289 Ga0105249_10135725 3300009553 Bacteria 2354
290 Ga0105249_10281311 3300009553 Bacteria 1662
291 Ga0105249_11109305 3300009553 Bacteria 861
292 Ga0123342_1013414 3300009766 Bacteria 8227
293 Ga0099796_10008189 3300010159 Bacteria 2775
294 Ga0099796_10047758 3300010159 Bacteria 1474
295 Ga0105239_10144608 3300010375 Bacteria 2651
296 Ga0105239_10567219 3300010375 Bacteria 1293
297 Ga0105246_10062381 3300011119 Bacteria 2597
298 Ga0105246_10280332 3300011119 Bacteria 1337
299 Ga0105246_10297578 3300011119 Bacteria 1301
300 Ga0157371_10024676 3300013102 Bacteria 4387
301 Ga0157371_10100896 3300013102 Bacteria 2047
302 Ga0157370_10017035 3300013104 Bacteria 7343
303 Ga0157370_10029467 3300013104 Bacteria 5385
304 Ga0157370_10230358 3300013104 Bacteria 1715
305 Ga0157369_10013948 3300013105 Bacteria 9081
306 Ga0157369_10014664 3300013105 Bacteria 8843
307 Ga0157369_10026923 3300013105 Bacteria 6377
308 Ga0157374_10007888 3300013296 Bacteria 9089
309 Ga0157374_10022044 3300013296 Bacteria 5677
310 Ga0157374_10047182 3300013296 Bacteria 3993
311 Ga0157374_10347474 3300013296 Bacteria 1473
312 Ga0157374_10752030 3300013296 Bacteria 989
313 Ga0157378_10007047 3300013297 Bacteria 9813
314 Ga0163162_10315157 3300013306 Bacteria 1697
315 Ga0163162_10420843 3300013306 Bacteria 1468
316 Ga0163162_10521253 3300013306 Bacteria 1318
317 Ga0163162_10588232 3300013306 Bacteria 1240
318 Ga0163162_10709274 3300013306 Bacteria 1127
319 Ga0157372_10078452 3300013307 Bacteria 3731
320 Ga0157372_10108336 3300013307 Bacteria 3179
321 Ga0157372_10272871 3300013307 Bacteria 1966
322 Ga0157375_10016901 3300013308 Bacteria 6572
323 Ga0157375_10119355 3300013308 Bacteria 2745
324 Ga0157375_10174904 3300013308 Bacteria 2296
325 Ga0163163_10000003 3300014325 Bacteria 455102
326 Ga0163163_10033749 3300014325 Bacteria 4953
327 Ga0163163_10252399 3300014325 Bacteria 1814
328 Ga0163163_10341237 3300014325 Bacteria 1553
329 Ga0163163_10878467 3300014325 Bacteria 960
330 Ga0157380_10858932 3300014326 Bacteria 930
331 Ga0182008_10001323 3300014497 Bacteria 16876
332 Ga0182008_10061172 3300014497 Bacteria 1856
333 Ga0157379_10789002 3300014968 Bacteria 896
334 Ga0157376_10109424 3300014969 Bacteria 2429
335 Ga0157376_10590605 3300014969 Bacteria 1104
336 Ga0182006_1087717 3300015261 Bacteria 1124
337 Ga0163161_10071147 3300017792 Bacteria 2545
338 Ga0163161_10245265 3300017792 Bacteria 1395
339 Ga0197907_11028214 3300020069 Bacteria 1562
340 Ga0197907_11371172 3300020069 Bacteria 1108
341 Ga0206356_10790464 3300020070 Bacteria 1424
342 Ga0206350_11646629 3300020080 Bacteria 1677
343 Ga0206354_10070692 3300020081 Bacteria 947
344 Ga0206354_10138454 3300020081 Bacteria 1087
345 Ga0214544_1000005 3300021320 Bacteria 387675
346 Ga0214542_1000004 3300021321 Bacteria 415597
347 Ga0214545_1000005 3300021324 Bacteria 415590
348 Ga0214543_1000564 3300021327 Bacteria 63531
349 Ga0213874_10013003 3300021377 Bacteria 2147
350 Ga0213874_10078758 3300021377 Bacteria 1064
351 Ga0213874_10103166 3300021377 Bacteria 951
352 Ga0213876_10046146 3300021384 Bacteria 2304
353 Ga0213876_10086955 3300021384 Bacteria 1654
354 Ga0213875_10097599 3300021388 Bacteria 1371
355 Ga0213871_10016627 3300021441 Bacteria 1777
356 Ga0224712_10030820 3300022467 Bacteria 1940
357 Ga0224712_10064366 3300022467 Bacteria 1471
358 Ga0224712_10070990 3300022467 Bacteria 1414
359 Ga0224712_10139776 3300022467 Bacteria 1065
360 Ga0209435_100016 3300025206 Bacteria 305566
361 Ga0209435_100038 3300025206 Bacteria 120273
362 Ga0209435_100096 3300025206 Bacteria 38561
363 Ga0207672_1002024 3300025223 Bacteria 1297
364 Ga0209147_100023 3300025229 Bacteria 437803
365 Ga0209437_100080 3300025233 Bacteria 275402
366 Ga0209258_100210 3300025242 Bacteria 117131
367 Ga0209646_1000033 3300025246 Bacteria 369507
368 Ga0209646_1000093 3300025246 Bacteria 183840
369 Ga0209026_1000031 3300025250 Bacteria 325747
370 Ga0209677_101880 3300025253 Bacteria 8513
371 Ga0209677_106176 3300025253 Bacteria 2910
372 Ga0209148_1000900 3300025254 Bacteria 20229
373 Ga0209148_1004037 3300025254 Bacteria 3745
374 Ga0209148_1023204 3300025254 Bacteria 990
375 Ga0209759_1000045 3300025256 Bacteria 235654
376 Ga0209759_1000248 3300025256 Bacteria 80537
377 Ga0209129_1001529 3300025258 Bacteria 12772
378 Ga0209233_1001052 3300025261 Bacteria 11545
379 Ga0209233_1001098 3300025261 Bacteria 11109
380 Ga0209233_1003397 3300025261 Bacteria 5614
381 Ga0209233_1003422 3300025261 Bacteria 5592
382 Ga0209455_1001412 3300025272 Bacteria 10889
383 Ga0209455_1004740 3300025272 Bacteria 4367
384 Ga0209455_1004957 3300025272 Bacteria 4224
385 Ga0209673_1002499 3300025273 Bacteria 12641
386 Ga0209673_1015590 3300025273 Bacteria 2877
387 Ga0209025_1019148 3300025294 Bacteria 3824
388 Ga0209564_1003825 3300025295 Bacteria 9742
389 Ga0209564_1012222 3300025295 Bacteria 3761
390 Ga0209564_1015496 3300025295 Bacteria 3094
391 Ga0209758_1000102 3300025297 Bacteria 224851
392 Ga0209758_1001188 3300025297 Bacteria 32870
393 Ga0209758_1001605 3300025297 Bacteria 25827
394 Ga0209758_1002945 3300025297 Bacteria 16357
395 Ga0209758_1004134 3300025297 Bacteria 12396
396 Ga0209758_1006083 3300025297 Bacteria 8879
397 Ga0209758_1012239 3300025297 Bacteria 4826
398 Ga0209256_1003962 3300025299 Bacteria 9737
399 Ga0209256_1013127 3300025299 Bacteria 3100
400 Ga0207426_1000354 3300025302 Bacteria 83734
401 Ga0207426_1000447 3300025302 Bacteria 66140
402 Ga0207426_1003427 3300025302 Bacteria 8639
403 Ga0207426_1004280 3300025302 Bacteria 7069
404 Ga0209257_1001262 3300025304 Bacteria 31134
405 Ga0209257_1064884 3300025304 Bacteria 980
406 Ga0207656_10020378 3300025321 Bacteria 2636
407 Ga0207692_10001489 3300025898 Bacteria 8788
408 Ga0207642_10143416 3300025899 Bacteria 1262
409 Ga0207688_10090991 3300025901 Bacteria 1752
410 Ga0207647_10019007 3300025904 Bacteria 4629
411 Ga0207647_10095057 3300025904 Bacteria 1774
412 Ga0207647_10128573 3300025904 Bacteria 1490
413 Ga0207647_10186038 3300025904 Bacteria 1205
414 Ga0207647_10215618 3300025904 Bacteria 1107
415 Ga0207647_10249166 3300025904 Bacteria 1019
416 Ga0207685_10003252 3300025905 Bacteria 3918
417 Ga0207699_10006246 3300025906 Bacteria 5754
418 Ga0207699_10035636 3300025906 Bacteria 2832
419 Ga0207699_10412455 3300025906 Bacteria 963
420 Ga0207645_10146099 3300025907 Bacteria 1542
421 Ga0207654_10194396 3300025911 Bacteria 1332
422 Ga0207707_10000827 3300025912 Bacteria 30384
423 Ga0207707_10002566 3300025912 Bacteria 16278
424 Ga0207707_10427961 3300025912 Bacteria 1134
425 Ga0207695_10001268 3300025913 Bacteria 42942
426 Ga0207695_10034685 3300025913 Bacteria 5483
427 Ga0207695_10217169 3300025913 Bacteria 1820
428 Ga0207695_10284239 3300025913 Bacteria 1548
429 Ga0207671_10035618 3300025914 Bacteria 3692
430 Ga0207671_10072431 3300025914 Bacteria 2572
431 Ga0207671_10096180 3300025914 Bacteria 2237
432 Ga0207671_10098760 3300025914 Bacteria 2209
433 Ga0207671_10411173 3300025914 Bacteria 1076
434 Ga0207693_10000565 3300025915 Bacteria 33481
435 Ga0207693_10038353 3300025915 Bacteria 3774
436 Ga0207693_10047306 3300025915 Bacteria 3380
437 Ga0207693_10300721 3300025915 Bacteria 1257
438 Ga0207663_10003532 3300025916 Bacteria 7669
439 Ga0207663_10180633 3300025916 Bacteria 1507
440 Ga0207663_10184937 3300025916 Bacteria 1491
441 Ga0207663_10248595 3300025916 Bacteria 1308
442 Ga0207663_10388809 3300025916 Bacteria 1064
443 Ga0207660_10001934 3300025917 Bacteria 13823
444 Ga0207660_10312940 3300025917 Bacteria 1252
445 Ga0207662_10107841 3300025918 Bacteria 1733
446 Ga0207657_10001315 3300025919 Bacteria 26383
447 Ga0207657_10058186 3300025919 Bacteria 3327
448 Ga0207657_10238645 3300025919 Bacteria 1452
449 Ga0207652_10001089 3300025921 Bacteria 24596
450 Ga0207652_10483385 3300025921 Bacteria 1115
451 Ga0207646_10105609 3300025922 Bacteria 2526
452 Ga0207694_10013374 3300025924 Bacteria 6181
453 Ga0207694_10057271 3300025924 Bacteria 3029
454 Ga0207694_10100380 3300025924 Bacteria 2293
455 Ga0207694_10150477 3300025924 Bacteria 1875
456 Ga0207694_10166699 3300025924 Bacteria 1782
457 Ga0207650_10050383 3300025925 Bacteria 3079
458 Ga0207650_10395791 3300025925 Bacteria 1143
459 Ga0207650_10554119 3300025925 Bacteria 964
460 Ga0207687_10216949 3300025927 Bacteria 1504
461 Ga0207687_10261905 3300025927 Bacteria 1379
462 Ga0207700_10001452 3300025928 Bacteria 13448
463 Ga0207700_10003591 3300025928 Bacteria 9036
464 Ga0207700_10074358 3300025928 Bacteria 2628
465 Ga0207664_10027347 3300025929 Bacteria 4323
466 Ga0207664_10076768 3300025929 Bacteria 2705
467 Ga0207664_10372061 3300025929 Bacteria 1267
468 Ga0207644_10098349 3300025931 Bacteria 2193
469 Ga0207644_10195260 3300025931 Bacteria 1594
470 Ga0207644_10300355 3300025931 Bacteria 1294
471 Ga0207644_10360358 3300025931 Bacteria 1183
472 Ga0207690_10047179 3300025932 Bacteria 2857
473 Ga0207686_10423105 3300025934 Bacteria 1019
474 Ga0207709_10127840 3300025935 Bacteria 1727
475 Ga0207670_10133607 3300025936 Bacteria 1821
476 Ga0207670_10314499 3300025936 Bacteria 1230
477 Ga0207669_10259432 3300025937 Bacteria 1299
478 Ga0207665_10000127 3300025939 Bacteria 50413
479 Ga0207665_10029628 3300025939 Bacteria 3617
480 Ga0207665_10154968 3300025939 Bacteria 1643
481 Ga0207665_10174494 3300025939 Bacteria 1554
482 Ga0207691_10077623 3300025940 Bacteria 2991
483 Ga0207691_10198264 3300025940 Bacteria 1748
484 Ga0207711_10114332 3300025941 Bacteria 2403
485 Ga0207711_10127907 3300025941 Bacteria 2274
486 Ga0207711_10786049 3300025941 Bacteria 887
487 Ga0207689_10070761 3300025942 Bacteria 2866
488 Ga0207661_10001422 3300025944 Bacteria 16129
489 Ga0207661_10122812 3300025944 Bacteria 2213
490 Ga0207661_10235943 3300025944 Bacteria 1621
491 Ga0207679_10589751 3300025945 Bacteria 1000
492 Ga0207667_10012575 3300025949 Bacteria 9738
493 Ga0207667_10072969 3300025949 Bacteria 3567
494 Ga0207667_10147895 3300025949 Bacteria 2418
495 Ga0207667_10166711 3300025949 Bacteria 2264
496 Ga0207667_10679273 3300025949 Bacteria 1033
497 Ga0207712_10057465 3300025961 Bacteria 2745
498 Ga0207712_10093050 3300025961 Bacteria 2224
499 Ga0207712_10177224 3300025961 Bacteria 1671
500 Ga0207668_10117877 3300025972 Bacteria 2004
501 Ga0207668_10186470 3300025972 Bacteria 1640
502 Ga0207640_10334363 3300025981 Bacteria 1211
503 Ga0207658_10044511 3300025986 Bacteria 3232
504 Ga0207658_10093331 3300025986 Bacteria 2340
505 Ga0207677_10038365 3300026023 Bacteria 3140
506 Ga0207677_10369299 3300026023 Bacteria 1208
507 Ga0207703_10104559 3300026035 Bacteria 2406
508 Ga0207639_10038223 3300026041 Bacteria 3569
509 Ga0207639_10169613 3300026041 Bacteria 1847
510 Ga0207639_10631308 3300026041 Bacteria 990
511 Ga0207639_10943170 3300026041 Bacteria 807
512 Ga0207678_10037444 3300026067 Bacteria 4218
513 Ga0207678_10085373 3300026067 Bacteria 2698
514 Ga0207678_10110846 3300026067 Bacteria 2341
515 Ga0207678_10120047 3300026067 Bacteria 2243
516 Ga0207708_10269013 3300026075 Bacteria 1378
517 Ga0207702_10000325 3300026078 Bacteria 54690
518 Ga0207702_10411177 3300026078 Bacteria 1306
519 Ga0207641_10186155 3300026088 Bacteria 1905
520 Ga0207641_10346921 3300026088 Bacteria 1414
521 Ga0207641_10455359 3300026088 Bacteria 1237
522 Ga0207648_10026143 3300026089 Bacteria 5191
523 Ga0207648_10094964 3300026089 Bacteria 2607
524 Ga0207674_10021123 3300026116 Bacteria 7018
525 Ga0207674_10147250 3300026116 Bacteria 2313
526 Ga0207675_100021098 3300026118 Bacteria 6070
527 Ga0207675_100033884 3300026118 Bacteria 4759
528 Ga0207675_100125057 3300026118 Bacteria 2436
529 Ga0207683_10042552 3300026121 Bacteria 3967
530 Ga0207683_10043308 3300026121 Bacteria 3934
531 Ga0207683_10106205 3300026121 Bacteria 2511
532 Ga0207683_10307777 3300026121 Bacteria 1450
533 Ga0207683_10381410 3300026121 Bacteria 1296
534 Ga0207683_10569160 3300026121 Bacteria 1048
535 Ga0207698_10103666 3300026142 Bacteria 2365
536 Ga0207698_10503482 3300026142 Bacteria 1179
537 Ga0209389_1000021 3300027296 Bacteria 169506
538 Ga0209389_1000086 3300027296 Bacteria 84925
539 Ga0209589_1000027 3300027357 Bacteria 155295
540 Ga0209489_100313 3300027361 Bacteria 85507
541 Ga0209489_105143 3300027361 Bacteria 23183
542 Ga0209700_100483 3300027363 Bacteria 74857
543 Ga0209179_1001603 3300027512 Bacteria 2832
544 Ga0209588_1005183 3300027671 Bacteria 3720
545 Ga0209813_10073923 3300027866 Bacteria 1114
546 Ga0207428_10000153 3300027907 Bacteria 94107
547 Ga0207428_10098549 3300027907 Bacteria 2262
548 Ga0268266_10001864 3300028379 Bacteria 23828
549 Ga0268266_10006918 3300028379 Bacteria 10320
550 Ga0268266_10014519 3300028379 Bacteria 6770
551 Ga0268266_10062975 3300028379 Bacteria 3202
552 Ga0268266_10317439 3300028379 Bacteria 1457
553 Ga0268265_10218137 3300028380 Bacteria 1667
554 Ga0268264_10000174 3300028381 Bacteria 137254
555 Ga0268264_10067965 3300028381 Bacteria 3009
556 Ga0268264_10155104 3300028381 Bacteria 2057
557 Ga0265326_10059103 3300028558 Bacteria 1084
558 Ga0265334_10024228 3300028573 Bacteria 2464
559 Ga0265334_10090418 3300028573 Bacteria 1117
560 Ga0265323_10002822 3300028653 Bacteria 7819
561 Ga0265336_10005738 3300028666 Bacteria 4542
562 Ga0307517_10000124 3300028786 Bacteria 115570
563 Ga0307515_10009381 3300028794 Bacteria 18936
564 Ga0265338_10001016 3300028800 Bacteria 47131
565 Ga0265339_10001394 3300031249 Bacteria 17992
566 Ga0265339_10054450 3300031249 Bacteria 2173
567 Ga0265331_10102459 3300031250 Bacteria 1316
568 Ga0307513_10153193 3300031456 Bacteria 2210
569 Ga0307513_10648399 3300031456 Bacteria 763
570 Ga0307408_100447596 3300031548 Bacteria 1120
571 Ga0307508_10000063 3300031616 Bacteria 122536
572 Ga0307508_10144279 3300031616 Bacteria 1985
573 Ga0307508_10162486 3300031616 Bacteria 1837
574 Ga0265314_10002593 3300031711 Bacteria 18286
575 Ga0265314_10157186 3300031711 Bacteria 1387
576 Ga0265342_10063479 3300031712 Bacteria 2171
577 Ga0265342_10146097 3300031712 Bacteria 1316
578 Ga0307516_10035746 3300031730 Bacteria 4980
579 Ga0316045_107024 3300031815 Bacteria 1398
580 Ga0307412_10231177 3300031911 Bacteria 1424
581 Ga0307416_100721809 3300032002 Bacteria 1087
582 Ga0307411_10102847 3300032005 Bacteria 2025
583 Ga0307507_10033915 3300033179 Bacteria 5289
584 Ga0307510_10047759 3300033180 Bacteria 4579
585 Ga0307510_10067650 3300033180 Bacteria 3594
586 Ga0307510_10079158 3300033180 Bacteria 3207
587 Ga0307510_10179327 3300033180 Bacteria 1684
588 Ga0315911_1000041 3300033442 Bacteria 50391
589 Ga0373926_0055251 3300035083 Bacteria 1439
590 Ga0373934_0016039 3300035086 Bacteria 2846
591 Ga0373944_0038867 3300035089 Bacteria 1463
592 Ga0373923_0079043 3300035111 Bacteria 1424
593 Ga0373932_0038755 3300035112 Bacteria 1364
594 Ga0373936_0008700 3300035113 Bacteria 3822
595 Ga0373945_0097535 3300035116 Bacteria 1146
596 Ga0373953_0011700 3300035117 Bacteria 3089
597 Ga0373953_0017203 3300035117 Bacteria 2653
598 Ga0373954_0002485 3300035118 Bacteria 7734
599 Ga0373954_0002626 3300035118 Bacteria 7566
600 Ga0373956_0064383 3300035119 Bacteria 1664
601 Ga0373956_0108293 3300035119 Bacteria 1292
602 Ga0373957_0007070 3300035120 Bacteria 3571
603 Ga0373957_0202208 3300035120 Bacteria 828
604 Ga0373960_0132965 3300035121 Bacteria 836
605 Ga0373943_0023109 3300035170 Bacteria 2888
606 Ga0373943_0033966 3300035170 Bacteria 2432
607 Ga0373943_0169966 3300035170 Bacteria 1192
608 Ga0373946_0079414 3300035171 Bacteria 1433
609 Ga0373955_0003095 3300035172 Bacteria 7279
610 Ga0373955_0029659 3300035172 Bacteria 2847
611 Ga0373924_0007214 3300035410 Bacteria 4006
612 Ga0373924_0011253 3300035410 Bacteria 3319
613 Ga0373924_0144945 3300035410 Bacteria 1037
614 Ga0373931_0045065 3300035691 Bacteria 2328
615 Ga0373931_0464179 3300035691 Bacteria 812
616 Ga0373935_0002137 3300035692 Bacteria 11210
617 Ga0373935_0032712 3300035692 Bacteria 3232
618 Ga0373935_0048301 3300035692 Bacteria 2694
619 Ga0373935_0213405 3300035692 Bacteria 1338
620 Ga0373927_0012355 3300035695 Bacteria 5683
621 Ga0373927_0017005 3300035695 Bacteria 4792
622 Ga0373927_0019441 3300035695 Bacteria 4454
623 Ga0373927_0026674 3300035695 Bacteria 3776
624 Ga0373927_0062498 3300035695 Bacteria 2408
625 Ga0373927_0096048 3300035695 Bacteria 1926
626 Ga0373927_0174958 3300035695 Bacteria 1408
627 Ga0373933_0001835 3300035724 Bacteria 12297
628 Ga0373933_0006528 3300035724 Bacteria 6352
629 Ga0373933_0009573 3300035724 Bacteria 5291
630 Ga0373933_0342226 3300035724 Bacteria 971
631 Ga0373947_0033072 3300035725 Bacteria 3051
632 Ga0373947_0054441 3300035725 Bacteria 2414
633 Ga0373947_0066850 3300035725 Bacteria 2194
634 Ga0373947_0159889 3300035725 Bacteria 1456
635 Ga0373947_0275424 3300035725 Bacteria 1118
636 Ga0373937_0089606 3300036401 Bacteria 2848
637 Ga0373937_0232745 3300036401 Bacteria 1735
638 Ga0373937_0798680 3300036401 Bacteria 891
639 Ga0373925_0001877 3300037068 Bacteria 17454
640 Ga0373925_0023145 3300037068 Bacteria 4533
641 Ga0373925_0802946 3300037068 Bacteria 776
642 Ga0395899_0050606 3300037312 Bacteria 3084
643 Ga0395900_0009563 3300037418 Bacteria 9940
644 Ga0395900_0025652 3300037418 Bacteria 6033
645 Ga0395900_0226917 3300037418 Bacteria 1880
646 Ga0395900_0502955 3300037418 Bacteria 1162
647 Ga0395898_0040500 3300037466 Bacteria 4607
648 Ga0395898_0051337 3300037466 Bacteria 4033
649 Ga0395905_0005393 3300037471 Bacteria 13071
650 Ga0436364_0322463 3300037853 Bacteria 1089
651 Ga0436364_0421012 3300037853 Bacteria 2309
652 Ga0395901_0180976 3300038443 Bacteria 2211
653 Ga0395901_0437762 3300038443 Bacteria 1339
654 Ga0436365_0108820 3300039437 Bacteria 5042
655 Ga0436365_1361824 3300039437 Bacteria 1130
656 Ga0436365_1936582 3300039437 Bacteria 2513
657 Ga0436360_0582206 3300039438 Bacteria 8464
658 Ga0436360_0620676 3300039438 Bacteria 2483
659 Ga0436360_0701610 3300039438 Bacteria 2116
660 Ga0436361_0568203 3300039447 Bacteria 1775
661 Ga0436361_0657147 3300039447 Bacteria 3201
662 Ga0436361_0757415 3300039447 Bacteria 3485
663 Ga0436363_0158762 3300039450 Bacteria 1733
664 Ga0436363_0665946 3300039450 Bacteria 1683
665 Ga0436363_0827034 3300039450 Bacteria 9035
666 Ga0436363_1336752 3300039450 Bacteria 955
667 Ga0436363_1697773 3300039450 Bacteria 3701
668 Ga0436362_0336193 3300039453 Bacteria 1827
669 Ga0439465_0072875 3300041413 Bacteria 1153
670 Ga0451802_0169913 3300041460 Bacteria 1324
671 Ga0450918_020862 3300042531 Bacteria 1145
672 Ga0451577_1064199 3300042876 Bacteria 725
673 Ga0466972_0000268 3300044658 Bacteria 33053
674 Ga0466972_0010885 3300044658 Bacteria 4564
675 Ga0466972_0232184 3300044658 Bacteria 863
676 Ga0466966_0052188 3300044684 Bacteria 2598
677 Ga0466961_0000311 3300044693 Bacteria 32320
678 Ga0466961_0042051 3300044693 Bacteria 2930
679 Ga0466963_0454104 3300044694 Bacteria 904
680 Ga0466971_0274903 3300044719 Bacteria 805
681 Ga0466968_0002021 3300044735 Bacteria 7381
682 Ga0466970_0012632 3300044765 Bacteria 4321
683 Ga0466970_0186319 3300044765 Bacteria 1152
684 Ga0466970_0353401 3300044765 Bacteria 834
685 Ga0466960_0010159 3300044901 Bacteria 3904
686 Ga0466959_0045853 3300045049 Bacteria 3218
687 Ga0466959_0052297 3300045049 Bacteria 2992
688 Ga0466959_0126327 3300045049 Bacteria 1815
689 Ga0466959_0450840 3300045049 Bacteria 872
690 Ga0451576_0015673 3300045051 Bacteria 8391
691 Ga0466967_0016558 3300045976 Bacteria 5819
692 Ga0466967_0082354 3300045976 Bacteria 2908
693 Ga0466967_0262376 3300045976 Bacteria 1653
694 Ga0466967_0353595 3300045976 Bacteria 1422
695 Ga0495617_005474 3300046452 Bacteria 4498
696 Ga0495592_0006884 3300046454 Bacteria 8491
697 Ga0495592_0080289 3300046454 Bacteria 2360
698 Ga0495592_0151879 3300046454 Bacteria 1601
699 Ga0495603_0003074 3300046455 Bacteria 9910
700 Ga0495603_0005432 3300046455 Bacteria 7608
701 Ga0495603_0062571 3300046455 Bacteria 2197
702 Ga0495603_0083049 3300046455 Bacteria 1876
703 Ga0495603_0129051 3300046455 Bacteria 1473
704 Ga0495603_0232934 3300046455 Bacteria 1061
705 Ga0495629_0000532 3300046459 Bacteria 31675
706 Ga0495629_0000913 3300046459 Bacteria 23749
707 Ga0495629_0013169 3300046459 Bacteria 5971
708 Ga0495638_0017480 3300046460 Bacteria 4777
709 Ga0495638_0022023 3300046460 Bacteria 4188
710 Ga0495641_0008153 3300046461 Bacteria 6432
711 Ga0495651_0018793 3300046462 Bacteria 5354
712 Ga0495651_0052377 3300046462 Bacteria 3144
713 Ga0495651_0068600 3300046462 Bacteria 2703
714 Ga0495651_0149459 3300046462 Bacteria 1686
715 Ga0495651_0150046 3300046462 Bacteria 1681
716 Ga0495651_0302379 3300046462 Bacteria 1072
717 Ga0495653_0010069 3300046463 Bacteria 7734
718 Ga0495653_0166213 3300046463 Bacteria 1527
719 Ga0495650_0110791 3300046471 Bacteria 1020
720 Ga0495580_0041291 3300046472 Bacteria 3290
721 Ga0495580_0056230 3300046472 Bacteria 2771
722 Ga0495582_0000331 3300046473 Bacteria 25765
723 Ga0495582_0169322 3300046473 Bacteria 1243
724 Ga0495605_0059800 3300046474 Bacteria 1829
725 Ga0495605_0161109 3300046474 Bacteria 996
726 Ga0495605_0216166 3300046474 Bacteria 830
727 Ga0495639_0000147 3300046475 Bacteria 36171
728 Ga0495639_0184197 3300046475 Bacteria 1017
729 Ga0495662_0000716 3300046476 Bacteria 15801
730 Ga0495662_0136179 3300046476 Bacteria 1208
731 Ga0495664_0004013 3300046477 Bacteria 8034
732 Ga0495664_0005574 3300046477 Bacteria 6920
733 Ga0495664_0036527 3300046477 Bacteria 2896
734 Ga0495664_0038112 3300046477 Bacteria 2837
735 Ga0495664_0270126 3300046477 Bacteria 1028
736 Ga0495594_0000113 3300046499 Bacteria 38231
737 Ga0495594_0291170 3300046499 Bacteria 930
738 Ga0495607_0165028 3300046501 Bacteria 1122
739 Ga0495583_0090772 3300046506 Bacteria 1315
740 Ga0495606_0005723 3300046507 Bacteria 11754
741 Ga0495608_0004537 3300046511 Bacteria 9921
742 Ga0495608_0009049 3300046511 Bacteria 6966
743 Ga0495608_0077014 3300046511 Bacteria 2171
744 Ga0495610_0031207 3300046512 Bacteria 2782
745 Ga0495610_0038063 3300046512 Bacteria 2443
746 Ga0495610_0129064 3300046512 Bacteria 1099
747 Ga0495618_0010718 3300046514 Bacteria 5551
748 Ga0495618_0016158 3300046514 Bacteria 4562
749 Ga0495618_0059962 3300046514 Bacteria 2412
750 Ga0495620_0044370 3300046515 Bacteria 1932
751 Ga0495620_0119015 3300046515 Bacteria 1042
752 Ga0495628_0001092 3300046516 Bacteria 24748
753 Ga0495628_0062677 3300046516 Bacteria 2914
754 Ga0495628_0206105 3300046516 Bacteria 1480
755 Ga0495628_0239962 3300046516 Bacteria 1356
756 Ga0495628_0245717 3300046516 Bacteria 1337
757 Ga0495630_0004274 3300046517 Bacteria 10018
758 Ga0495630_0096705 3300046517 Bacteria 2232
759 Ga0495630_0579363 3300046517 Bacteria 860
760 Ga0495631_0025217 3300046518 Bacteria 2740
761 Ga0495632_0096435 3300046519 Bacteria 1397
762 Ga0495632_0111837 3300046519 Bacteria 1282
763 Ga0495637_0031199 3300046520 Bacteria 2359
764 Ga0495643_0036114 3300046522 Bacteria 2717
765 Ga0495643_0191416 3300046522 Bacteria 987
766 Ga0495643_0201458 3300046522 Bacteria 955
767 Ga0495648_0000776 3300046524 Bacteria 34006
768 Ga0495648_0001514 3300046524 Bacteria 22778
769 Ga0495648_0111763 3300046524 Bacteria 1485
770 Ga0495642_0032875 3300046528 Bacteria 2083
771 Ga0495652_0021351 3300046529 Bacteria 5758
772 Ga0495652_0031369 3300046529 Bacteria 4655
773 Ga0495652_0073625 3300046529 Bacteria 2843
774 Ga0495652_0150525 3300046529 Bacteria 1819
775 Ga0495652_0275783 3300046529 Bacteria 1234
776 Ga0495654_0147632 3300046530 Bacteria 1042
777 Ga0495665_0000291 3300046531 Bacteria 25361
778 Ga0495665_0017301 3300046531 Bacteria 3878
779 Ga0495640_0005851 3300046533 Bacteria 9760
780 Ga0495640_0032424 3300046533 Bacteria 3722
781 Ga0495640_0050334 3300046533 Bacteria 2870
782 Ga0495640_0051488 3300046533 Bacteria 2830
783 Ga0495587_0007337 3300046536 Bacteria 7146
784 Ga0495587_0018944 3300046536 Bacteria 4265
785 Ga0495587_0021240 3300046536 Bacteria 4003
786 Ga0495587_0054532 3300046536 Bacteria 2356
787 Ga0495598_0042422 3300046537 Bacteria 1335
788 Ga0495609_0072648 3300046538 Bacteria 1510
789 Ga0495597_0133670 3300046542 Bacteria 1027
790 Ga0495645_0006636 3300046543 Bacteria 8039
791 Ga0495645_0006977 3300046543 Bacteria 7853
792 Ga0495645_0037792 3300046543 Bacteria 3520
793 Ga0495622_0004379 3300046557 Bacteria 6576
794 Ga0495622_0009802 3300046557 Bacteria 4429
795 Ga0495633_0139616 3300046558 Bacteria 1120
796 Ga0495667_0014817 3300046559 Bacteria 5269
797 Ga0495667_0038192 3300046559 Bacteria 3198
798 Ga0495667_0063781 3300046559 Bacteria 2411
799 Ga0495667_0158948 3300046559 Bacteria 1454
800 Ga0495667_0338480 3300046559 Bacteria 951
801 Ga0495668_0053955 3300046616 Bacteria 2222
802 Ga0495668_0216692 3300046616 Bacteria 1048
803 Ga0495634_0003174 3300046642 Bacteria 13304
804 Ga0495634_0011850 3300046642 Bacteria 6337
805 Ga0495634_0226375 3300046642 Bacteria 1152
806 Ga0495611_0017586 3300046648 Bacteria 3059
807 Ga0495625_0000888 3300046660 Bacteria 40400
808 Ga0495625_0077443 3300046660 Bacteria 2323
809 Ga0495625_0357388 3300046660 Bacteria 921
810 Ga0495635_0000491 3300046663 Bacteria 24925
811 Ga0495635_0007428 3300046663 Bacteria 7647
812 Ga0495635_0028493 3300046663 Bacteria 3882
813 Ga0495635_0178771 3300046663 Bacteria 1442
814 Ga0495659_0019004 3300046664 Bacteria 2296
815 Ga0495659_0080509 3300046664 Bacteria 1235
816 Ga0495588_0012745 3300046674 Bacteria 3984
817 Ga0495588_0057864 3300046674 Bacteria 2003
818 Ga0495588_0208071 3300046674 Bacteria 1033
819 Ga0495657_0011578 3300046675 Bacteria 6590
820 Ga0495657_0021093 3300046675 Bacteria 4678
821 Ga0495657_0023411 3300046675 Bacteria 4414
822 Ga0495657_0176096 3300046675 Bacteria 1315
823 Ga0495599_0019185 3300046678 Bacteria 4263
824 Ga0495599_0023100 3300046678 Bacteria 3886
825 Ga0495599_0078126 3300046678 Bacteria 2066
826 Ga0495599_0122084 3300046678 Bacteria 1619
827 Ga0495623_0115298 3300046679 Bacteria 1624
828 Ga0495623_0120508 3300046679 Bacteria 1579
829 Ga0495646_0031381 3300046680 Bacteria 3311
830 Ga0495646_0040428 3300046680 Bacteria 2872
831 Ga0495646_0049680 3300046680 Bacteria 2545
832 Ga0495646_0165379 3300046680 Bacteria 1222
833 Ga0495646_0254712 3300046680 Bacteria 939
834 Ga0495647_0007692 3300046681 Bacteria 3618
835 Ga0495647_0016960 3300046681 Bacteria 2572
836 Ga0495647_0042172 3300046681 Bacteria 1741
837 Ga0495658_0001211 3300046683 Bacteria 13552
838 Ga0495658_0007033 3300046683 Bacteria 5551
839 Ga0495658_0327898 3300046683 Bacteria 971
840 Ga0495613_0002051 3300046689 Bacteria 15316
841 Ga0495613_0104978 3300046689 Bacteria 2040
842 Ga0495613_0109386 3300046689 Bacteria 1993
843 Ga0495613_0249616 3300046689 Bacteria 1239
844 Ga0495624_0008987 3300046690 Bacteria 6944
845 Ga0495624_0053556 3300046690 Bacteria 2547
846 Ga0495624_0242967 3300046690 Bacteria 1089
847 Ga0495624_0304827 3300046690 Bacteria 960
848 Ga0495600_0008599 3300046809 Bacteria 6279
849 Ga0495600_0080311 3300046809 Bacteria 2129
850 Ga0495600_0103729 3300046809 Bacteria 1853
851 Ga0495581_0000620 3300047315 Bacteria 18623
852 Ga0495581_0025894 3300047315 Bacteria 3402
853 Ga0495581_0154759 3300047315 Bacteria 1340
854 Ga0495581_0229963 3300047315 Bacteria 1085
855 Ga0495604_0005882 3300047317 Bacteria 9725
856 Ga0495604_0034678 3300047317 Bacteria 3992
857 Ga0495604_0147868 3300047317 Bacteria 1673
858 Ga0495674_0001226 3300047319 Bacteria 24884
859 Ga0495674_0004909 3300047319 Bacteria 12856
860 Ga0495674_0023635 3300047319 Bacteria 5661
861 Ga0495674_0074047 3300047319 Bacteria 2934
862 Ga0495674_0111936 3300047319 Bacteria 2313
863 Ga0495672_0088113 3300047320 Bacteria 1712
864 Ga0495672_0224730 3300047320 Bacteria 925
865 Ga0495672_0242940 3300047320 Bacteria 878
866 Ga0495676_0044749 3300047321 Bacteria 3610
867 Ga0495676_0111442 3300047321 Bacteria 2007
868 Ga0495676_0145248 3300047321 Bacteria 1695
869 Ga0495676_0216065 3300047321 Bacteria 1324
870 Ga0495676_0417388 3300047321 Bacteria 888
871 Ga0495680_0006961 3300047322 Bacteria 10433
872 Ga0495680_0025019 3300047322 Bacteria 4944
873 Ga0495680_0095272 3300047322 Bacteria 2225
874 Ga0495683_0188214 3300047323 Bacteria 938
875 Ga0495675_0005368 3300047444 Bacteria 7809
876 Ga0495675_0016604 3300047444 Bacteria 4658
877 Ga0495675_0039087 3300047444 Bacteria 3021
878 Ga0495685_152001 3300047447 Bacteria 752
879 Ga0495673_0038526 3300047469 Bacteria 2174
880 Ga0495673_0042363 3300047469 Bacteria 2044
881 Ga0495673_0043580 3300047469 Bacteria 2007
882 Ga0495684_0000897 3300047471 Bacteria 24092
883 Ga0495684_0052148 3300047471 Bacteria 3121
884 Ga0495684_0172219 3300047471 Bacteria 1609
885 Ga0495686_0018504 3300047472 Bacteria 4672
886 Ga0495686_0051010 3300047472 Bacteria 2598
887 Ga0495686_0060450 3300047472 Bacteria 2355
888 Ga0495686_0127067 3300047472 Bacteria 1515
889 Ga0495686_0226041 3300047472 Bacteria 1062
890 Ga0495593_0000389 3300047673 Bacteria 24349
891 Ga0495593_0113880 3300047673 Bacteria 1380
892 Ga0495602_0000296 3300048088 Bacteria 45726
893 Ga0495602_0013144 3300048088 Bacteria 8469
894 Ga0495602_0048749 3300048088 Bacteria 3802
895 Ga0495626_0044330 3300048091 Bacteria 2082
896 Ga0496100_0012832 3300048903 Bacteria 4817
897 Ga0496100_0046173 3300048903 Bacteria 2799
898 Ga0496100_0067873 3300048903 Bacteria 2370
899 Ga0496100_0288218 3300048903 Bacteria 1226
900 Ga0496100_0305044 3300048903 Bacteria 1192
901 Ga0496101_0059039 3300048904 Bacteria 2780
902 Ga0496102_0052153 3300048905 Bacteria 3726
903 Ga0496102_0092413 3300048905 Bacteria 2802
904 Ga0496102_0093921 3300048905 Bacteria 2779
905 Ga0496102_0310543 3300048905 Bacteria 1486
906 Ga0496103_0087932 3300048906 Bacteria 1959
907 Ga0496103_0425452 3300048906 Bacteria 852
908 Ga0496103_0451226 3300048906 Bacteria 825
909 Ga0496104_0009605 3300048907 Bacteria 8613
910 Ga0496104_0011964 3300048907 Bacteria 7786
911 Ga0496104_0031565 3300048907 Bacteria 4927
912 Ga0496104_0057600 3300048907 Bacteria 3676
913 Ga0496104_0115515 3300048907 Bacteria 2575
914 Ga0496104_0158543 3300048907 Bacteria 2171
915 Ga0496105_0023344 3300048908 Bacteria 5014
916 Ga0496105_0036534 3300048908 Bacteria 4047
917 Ga0496105_0054431 3300048908 Bacteria 3303
918 Ga0496105_0069715 3300048908 Bacteria 2906
919 Ga0496105_0110603 3300048908 Bacteria 2268
920 Ga0496105_0157413 3300048908 Bacteria 1865
921 Ga0496106_0006109 3300048909 Bacteria 8908
922 Ga0496106_0011496 3300048909 Bacteria 6547
923 Ga0496106_0011990 3300048909 Bacteria 6397
924 Ga0496106_0135844 3300048909 Bacteria 1931
925 Ga0496107_0018364 3300048910 Bacteria 4924
926 Ga0496107_0028844 3300048910 Bacteria 3946
927 Ga0496107_0033816 3300048910 Bacteria 3659
928 Ga0496107_0083233 3300048910 Bacteria 2333
929 Ga0496107_0089542 3300048910 Bacteria 2247
930 Ga0496107_0265871 3300048910 Bacteria 1276
931 Ga0496107_0296295 3300048910 Bacteria 1204
932 Ga0496108_0000764 3300048911 Bacteria 25051
933 Ga0496108_0009713 3300048911 Bacteria 7799
934 Ga0496108_0028405 3300048911 Bacteria 4628
935 Ga0496108_0270666 3300048911 Bacteria 1478
936 Ga0496108_0743687 3300048911 Bacteria 849
937 Ga0496109_0004357 3300048912 Bacteria 11828
938 Ga0496109_0009522 3300048912 Bacteria 8280
939 Ga0496109_0009612 3300048912 Bacteria 8246
940 Ga0496109_0022973 3300048912 Bacteria 5530
941 Ga0496109_0056204 3300048912 Bacteria 3591
942 Ga0496109_0068250 3300048912 Bacteria 3259
943 Ga0496109_0197123 3300048912 Bacteria 1893
944 Ga0496109_0387945 3300048912 Bacteria 1319
945 Ga0496110_0027878 3300048913 Bacteria 4846
946 Ga0496110_0070020 3300048913 Bacteria 3107
947 Ga0496110_0078286 3300048913 Bacteria 2943
948 Ga0496110_0083574 3300048913 Bacteria 2848
949 Ga0496110_0379849 3300048913 Bacteria 1287
950 Ga0496110_0394115 3300048913 Bacteria 1262
951 Ga0496110_0428776 3300048913 Bacteria 1205
952 Ga0496111_0001105 3300048914 Bacteria 14931
953 Ga0496111_0011921 3300048914 Bacteria 5874
954 Ga0496111_0049580 3300048914 Bacteria 3028
955 Ga0496111_0173121 3300048914 Bacteria 1604
956 Ga0496112_0000052 3300048915 Bacteria 81285
957 Ga0496112_0004212 3300048915 Bacteria 12130
958 Ga0496112_0004915 3300048915 Bacteria 11438
959 Ga0496112_0013107 3300048915 Bacteria 7650
960 Ga0496112_0023568 3300048915 Bacteria 5882
961 Ga0496112_0025554 3300048915 Bacteria 5671
962 Ga0496112_0026567 3300048915 Bacteria 5574
963 Ga0496112_0038470 3300048915 Bacteria 4671
964 Ga0496112_0125607 3300048915 Bacteria 2536
965 Ga0496113_0002366 3300048916 Bacteria 10928
966 Ga0496113_0045330 3300048916 Bacteria 3261
967 Ga0496113_0159709 3300048916 Bacteria 1781
968 Ga0496113_0490827 3300048916 Bacteria 986
969 Ga0496113_0759438 3300048916 Bacteria 772
970 Ga0496114_0037653 3300048917 Bacteria 4001
971 Ga0496114_0118920 3300048917 Bacteria 2271
972 Ga0496114_0175359 3300048917 Bacteria 1870
973 Ga0496114_0244542 3300048917 Bacteria 1578
974 Ga0496114_0379366 3300048917 Bacteria 1251
975 Ga0496115_0009221 3300048918 Bacteria 7326
976 Ga0496115_0061653 3300048918 Bacteria 3024
977 Ga0496115_0185245 3300048918 Bacteria 1720
978 Ga0496115_0279239 3300048918 Bacteria 1371
979 Ga0496116_0005214 3300048919 Bacteria 12168
980 Ga0496116_0040362 3300048919 Bacteria 3214
981 Ga0496117_0016824 3300048920 Bacteria 6145
982 Ga0496117_0219159 3300048920 Bacteria 1060
983 Ga0496117_0260907 3300048920 Bacteria 939
984 Ga0496118_0019126 3300048921 Bacteria 6135
985 Ga0496118_0072041 3300048921 Bacteria 2484
986 Ga0496118_0197593 3300048921 Bacteria 1195
987 Ga0496118_0263421 3300048921 Bacteria 971
988 Ga0496119_0010049 3300048922 Bacteria 8006
989 Ga0496119_0059543 3300048922 Bacteria 2293
990 Ga0496119_0201349 3300048922 Bacteria 1030
991 Ga0496120_0219816 3300048923 Bacteria 908
992 Ga0496121_0001057 3300048924 Bacteria 48772
993 Ga0496121_0001543 3300048924 Bacteria 38548
994 Ga0496121_0009515 3300048924 Bacteria 11148
995 Ga0496121_0017186 3300048924 Bacteria 7408
996 Ga0496121_0020788 3300048924 Bacteria 6471
997 Ga0496121_0047906 3300048924 Bacteria 3641
998 Ga0496121_0054922 3300048924 Bacteria 3323
999 Ga0496121_0094560 3300048924 Bacteria 2325
1000 Ga0496121_0288475 3300048924 Bacteria 1119
1001 Ga0496122_0000063 3300048925 Bacteria 241378
1002 Ga0496122_0000375 3300048925 Bacteria 95681
1003 Ga0496122_0057569 3300048925 Bacteria 2885
1004 Ga0496123_0000117 3300048926 Bacteria 161679
1005 Ga0496123_0000267 3300048926 Bacteria 104282
1006 Ga0496123_0091273 3300048926 Bacteria 1807
1007 Ga0496124_0127208 3300048927 Bacteria 2028
1008 Ga0496124_0158870 3300048927 Bacteria 1764
1009 Ga0496124_0197816 3300048927 Bacteria 1531
1010 Ga0496124_0299559 3300048927 Bacteria 1162
1011 Ga0496125_0000694 3300048928 Bacteria 55573
1012 Ga0496125_0010987 3300048928 Bacteria 9087
1013 Ga0496125_0015170 3300048928 Bacteria 7464
1014 Ga0496125_0047355 3300048928 Bacteria 3597
1015 Ga0496125_0105823 3300048928 Bacteria 2055
1016 Ga0496125_0151299 3300048928 Bacteria 1593
1017 Ga0496125_0152594 3300048928 Bacteria 1584
1018 Ga0496125_0276335 3300048928 Bacteria 1043
1019 Ga0496126_0005900 3300048929 Bacteria 13814
1020 Ga0496126_0011116 3300048929 Bacteria 9349
1021 Ga0496126_0016331 3300048929 Bacteria 7427
1022 Ga0496126_0018583 3300048929 Bacteria 6881
1023 Ga0496126_0037396 3300048929 Bacteria 4530
1024 Ga0496126_0059599 3300048929 Bacteria 3437
1025 Ga0496126_0077667 3300048929 Bacteria 2943
1026 Ga0496126_0102738 3300048929 Bacteria 2498
1027 Ga0496126_0104250 3300048929 Bacteria 2477
1028 Ga0496126_0105850 3300048929 Bacteria 2455
1029 Ga0496126_0135635 3300048929 Bacteria 2123
1030 Ga0496126_0147005 3300048929 Bacteria 2023
1031 Ga0496126_0312937 3300048929 Bacteria 1292
1032 Ga0496126_0467551 3300048929 Bacteria 1013
1033 Ga0496126_0730971 3300048929 Bacteria 766
1034 Ga0495682_0042087 3300049460 Bacteria 1674
1035 Ga0501031_0000655 3300049568 Bacteria 20505
1036 Ga0501031_0001803 3300049568 Bacteria 13455
1037 Ga0501031_0163876 3300049568 Bacteria 1453
1038 Ga0501031_0428737 3300049568 Bacteria 855
1039 Ga0501032_0000161 3300049569 Bacteria 54292
1040 Ga0501032_0159161 3300049569 Bacteria 1483
1041 Ga0501032_0182983 3300049569 Bacteria 1371
1042 Ga0501033_0000672 3300049570 Bacteria 31550
1043 Ga0501033_0001580 3300049570 Bacteria 20051
1044 Ga0501033_0006379 3300049570 Bacteria 9241
1045 Ga0501034_0000072 3300049571 Bacteria 179824
1046 Ga0501034_0024633 3300049571 Bacteria 6120
1047 Ga0501036_0000250 3300049572 Bacteria 36419
1048 Ga0501036_0265193 3300049572 Bacteria 1438
1049 Ga0501037_0000030 3300049573 Bacteria 136148
1050 Ga0501037_0001059 3300049573 Bacteria 20381
1051 Ga0501037_0033396 3300049573 Bacteria 3800
1052 Ga0501037_0116571 3300049573 Bacteria 1922
1053 Ga0501038_0000826 3300049574 Bacteria 27582
1054 Ga0501038_0004208 3300049574 Bacteria 13371
1055 Ga0501038_0057490 3300049574 Bacteria 3339
1056 Ga0501038_0074567 3300049574 Bacteria 2870
1057 Ga0501038_0205716 3300049574 Bacteria 1577
1058 Ga0501039_0012015 3300049575 Bacteria 6598
1059 Ga0501040_0500770 3300049576 Bacteria 876
1060 Ga0501041_0151158 3300049577 Bacteria 1450
1061 Ga0501042_0073646 3300049578 Bacteria 2443
1062 Ga0501043_0000357 3300049579 Bacteria 41554
1063 Ga0501043_0023451 3300049579 Bacteria 4839
1064 Ga0501043_0579497 3300049579 Bacteria 831
1065 Ga0501046_0023974 3300049580 Bacteria 5010
1066 Ga0501046_0091706 3300049580 Bacteria 2336
1067 Ga0501046_0326812 3300049580 Bacteria 1117
1068 Ga0501047_0001531 3300049581 Bacteria 22591
1069 Ga0501047_0013515 3300049581 Bacteria 7740
1070 Ga0501047_0208882 3300049581 Bacteria 1811
1071 Ga0501048_0000477 3300049582 Bacteria 27978
1072 Ga0501067_0000068 3300049583 Bacteria 59338
1073 Ga0501067_0083381 3300049583 Bacteria 1773
1074 Ga0501068_0001116 3300049584 Bacteria 14202
1075 Ga0501070_0002354 3300049586 Bacteria 16597
1076 Ga0501070_0042138 3300049586 Bacteria 3802
1077 Ga0501070_0204948 3300049586 Bacteria 1620
1078 Ga0501072_0000835 3300049588 Bacteria 22655
1079 Ga0501072_0258072 3300049588 Bacteria 1388
1080 Ga0501072_0300148 3300049588 Bacteria 1277
1081 Ga0501073_0000009 3300049589 Bacteria 195649
1082 Ga0501073_0114093 3300049589 Bacteria 1873
1083 Ga0501073_0222140 3300049589 Bacteria 1305
1084 Ga0501073_0309438 3300049589 Bacteria 1090
1085 Ga0501074_0000716 3300049590 Bacteria 20790
1086 Ga0501079_0000251 3300049741 Bacteria 32618
1087 Ga0501080_0004321 3300049742 Bacteria 12621
1088 Ga0501080_0083252 3300049742 Bacteria 2972
1089 Ga0501080_0311972 3300049742 Bacteria 1425
1090 Ga0501083_0039237 3300049744 Bacteria 3216
1091 Ga0501280_000775 3300049776 Bacteria 6972
1092 Ga0501035_0000067 3300049822 Bacteria 129204
1093 Ga0501035_0035252 3300049822 Bacteria 4541
1094 Ga0501035_0036075 3300049822 Bacteria 4483
1095 Ga0501035_0122045 3300049822 Bacteria 2277
1096 Ga0501035_0329252 3300049822 Bacteria 1282
1097 Ga0501035_0373790 3300049822 Bacteria 1189
1098 Ga0501044_0002804 3300049823 Bacteria 19858
1099 Ga0501044_0004858 3300049823 Bacteria 15027
1100 Ga0501044_0064150 3300049823 Bacteria 3751
1101 Ga0501044_0142659 3300049823 Bacteria 2383
1102 Ga0501044_0622559 3300049823 Bacteria 971
1103 Ga0501044_0645009 3300049823 Bacteria 948
1104 Ga0501045_0164291 3300049824 Bacteria 1653
1105 nmdc:mga03683_16686_c1 3300050489 Bacteria 2763
1106 nmdc:mga03n38_533_c1 3300050490 Bacteria 9651
1107 nmdc:mga00v17_23676_c1 3300050491 Bacteria 3554
1108 nmdc:mga00v17_26685_c1 3300050491 Bacteria 3368
1109 nmdc:mga00v17_43888_c1 3300050491 Bacteria 2694
1110 nmdc:mga00v17_79611_c1 3300050491 Bacteria 2044
1111 nmdc:mga0yw44_141158_c1 3300050492 Bacteria 1566
1112 nmdc:mga0yw44_4925_c2 3300050492 Bacteria 3992
1113 nmdc:mga0yw44_96245_c1 3300050492 Bacteria 1879
1114 nmdc:mga0k408_120724_c1 3300050493 Bacteria 1552
1115 nmdc:mga0k408_237919_c1 3300050493 Bacteria 1087
1116 nmdc:mga0k408_274974_c1 3300050493 Bacteria 1005
1117 nmdc:mga06z11_100307_c1 3300050494 Bacteria 1587
1118 nmdc:mga06z11_21201_c1 3300050494 Bacteria 3016
1119 nmdc:mga06z11_250804_c1 3300050494 Bacteria 1042
1120 nmdc:mga06z11_345722_c1 3300050494 Bacteria 890
1121 nmdc:mga06z11_35246_c1 3300050494 Bacteria 2462
1122 nmdc:mga07m45_139324_c1 3300050496 Bacteria 1405
1123 nmdc:mga07m45_2114_c1 3300050496 Bacteria 9242
1124 nmdc:mga07m45_241183_c1 3300050496 Bacteria 1052
1125 nmdc:mga07m45_40194_c1 3300050496 Bacteria 2617
1126 nmdc:mga05p37_734481_c1 3300050507 Bacteria 1091
1127 nmdc:mga0qj67_227519_c1 3300050509 Bacteria 1513
1128 nmdc:mga08y16_34_c1 3300050511 Bacteria 164092
1129 nmdc:mga0n895_586141_c1 3300050512 Bacteria 1118
1130 nmdc:mga0n895_8338_c1 3300050512 Bacteria 8968
1131 nmdc:mga08x19_220984_c1 3300050514 Bacteria 1301
1132 nmdc:mga0sz30_10116_c1 3300050516 Bacteria 3607
1133 nmdc:mga0sz30_167649_c1 3300050516 Bacteria 974
1134 Ga0495601_0000749 3300053077 Bacteria 17465
1135 Ga0495601_0015596 3300053077 Bacteria 4593
1136 Ga0495601_0134564 3300053077 Bacteria 1611
1137 Ga0495601_0209693 3300053077 Bacteria 1273
1138 Ga0495601_0374656 3300053077 Bacteria 924
1139 Ga0495612_0000707 3300053078 Bacteria 13532
1140 Ga0495612_0040544 3300053078 Bacteria 1897
1141 Ga0495612_0061626 3300053078 Bacteria 1554
1142 Ga0495612_0076464 3300053078 Bacteria 1402
1143 Ga0495612_0241613 3300053078 Bacteria 802
1144 Ga0500635_0007052 3300053080 Bacteria 3032
1145 Ga0495595_0019377 3300053084 Bacteria 2951
1146 Ga0495595_0020690 3300053084 Bacteria 2866
1147 Ga0495595_0025669 3300053084 Bacteria 2613
1148 Ga0495595_0029233 3300053084 Bacteria 2465
1149 Ga0495595_0241509 3300053084 Bacteria 904
1150 Ga0495619_0010830 3300053085 Bacteria 5738
1151 Ga0495619_0039935 3300053085 Bacteria 3065
1152 Ga0495619_0063210 3300053085 Bacteria 2466
1153 Ga0495619_0117863 3300053085 Bacteria 1818
1154 Ga0495619_0133930 3300053085 Bacteria 1704
1155 Ga0495619_0447829 3300053085 Bacteria 890
1156 Ga0500578_0155667 3300053086 Bacteria 1421
1157 Ga0500643_000016 3300053087 Bacteria 309502
1158 Ga0500643_079769 3300053087 Bacteria 900
1159 Ga0500644_0008381 3300053088 Bacteria 2728
1160 Ga0500646_0041940 3300053090 Bacteria 1291
1161 Ga0500651_0071542 3300053093 Bacteria 2158
1162 Ga0500566_0000751 3300053094 Bacteria 18265
1163 Ga0500566_0003091 3300053094 Bacteria 9947
1164 Ga0500566_0105695 3300053094 Bacteria 1537
1165 Ga0500566_0123505 3300053094 Bacteria 1393
1166 Ga0500641_0001845 3300053096 Bacteria 7514
1167 Ga0500641_0008013 3300053096 Bacteria 3765
1168 Ga0500641_0067011 3300053096 Bacteria 1504
1169 Ga0500641_0097233 3300053096 Bacteria 1261
1170 Ga0500648_094847 3300053097 Bacteria 1666
1171 Ga0500650_0004589 3300053098 Bacteria 5014
1172 Ga0500555_008692 3300053103 Bacteria 2898
1173 Ga0500556_0000238 3300053104 Bacteria 44627
1174 Ga0500556_0064238 3300053104 Bacteria 1358
1175 Ga0500557_003716 3300053105 Bacteria 3083
1176 Ga0500562_038244 3300053108 Bacteria 1274
1177 Ga0500569_006994 3300053109 Bacteria 2509
1178 Ga0500569_014547 3300053109 Bacteria 1950
1179 Ga0500572_000585 3300053111 Bacteria 12313
1180 Ga0500592_000799 3300053116 Bacteria 5164
1181 Ga0500592_024540 3300053116 Bacteria 972
1182 Ga0500595_002375 3300053119 Bacteria 9407
1183 Ga0500595_003407 3300053119 Bacteria 7437
1184 Ga0500595_007814 3300053119 Bacteria 4408
1185 Ga0500595_019669 3300053119 Bacteria 2445
1186 Ga0500608_004588 3300053122 Bacteria 5377
1187 Ga0500617_148009 3300053124 Bacteria 933
1188 Ga0500618_032582 3300053125 Bacteria 1218
1189 Ga0500626_067116 3300053128 Bacteria 1599
1190 Ga0500642_0000092 3300053130 Bacteria 45651
1191 Ga0500642_0000109 3300053130 Bacteria 40031
1192 Ga0500652_001613 3300053131 Bacteria 6864
1193 Ga0500559_0000492 3300053136 Bacteria 27669
1194 Ga0500559_0029582 3300053136 Bacteria 2346
1195 Ga0500559_0062637 3300053136 Bacteria 1661
1196 Ga0500568_0002222 3300053139 Bacteria 11652
1197 Ga0500568_0045737 3300053139 Bacteria 1741
1198 Ga0500568_0079638 3300053139 Bacteria 1245
1199 Ga0500573_0006467 3300053140 Bacteria 6347
1200 Ga0500577_0000135 3300053142 Bacteria 17919
1201 Ga0500579_114888 3300053143 Bacteria 1335
1202 Ga0500586_001127 3300053145 Bacteria 5524
1203 Ga0500590_021786 3300053148 Bacteria 3325
1204 Ga0500590_040995 3300053148 Bacteria 2383
1205 Ga0500590_091519 3300053148 Bacteria 1476
1206 Ga0500604_0062277 3300053151 Bacteria 1174
1207 Ga0500616_0000197 3300053153 Bacteria 98372
1208 Ga0500616_0260809 3300053153 Bacteria 736
1209 Ga0500622_0000966 3300053156 Bacteria 24386
1210 Ga0500622_0025854 3300053156 Bacteria 3099
1211 Ga0500627_0030431 3300053158 Bacteria 2260
1212 Ga0500633_0022583 3300053160 Bacteria 1929
1213 Ga0500634_0012476 3300053161 Bacteria 4426
1214 Ga0500634_0019449 3300053161 Bacteria 3659
1215 Ga0500638_004107 3300053162 Bacteria 5536
1216 Ga0500636_0003333 3300053177 Bacteria 9023
1217 Ga0500636_0026379 3300053177 Bacteria 3432
1218 Ga0500636_0036683 3300053177 Bacteria 2900
1219 Ga0500636_0077322 3300053177 Bacteria 1922
1220 Ga0500637_0000090 3300053178 Bacteria 32448
1221 Ga0500637_0094288 3300053178 Bacteria 1734
1222 Ga0500637_0282160 3300053178 Bacteria 913
1223 Ga0500625_022262 3300053729 Bacteria 2992
1224 Ga0500645_026052 3300053730 Bacteria 1780
1225 Ga0500645_062200 3300053730 Bacteria 1078
1226 Ga0500609_004261 3300053731 Bacteria 1984
1227 Ga0500609_018634 3300053731 Bacteria 945
1228 Ga0500596_000284 3300053735 Bacteria 9009
1229 Ga0500599_002093 3300053736 Bacteria 2370
1230 Ga0500601_000997 3300053737 Bacteria 3280
1231 Ga0501084_0012720 3300054114 Bacteria 6970
1232 Ga0590077_025092 3300059426 Bacteria 1283
1233 Ga0501082_0008921 3300060353 Bacteria 8653
1234 Ga0466962_0067990 3300061719 Bacteria 1701
1235 Ga0466962_0186089 3300061719 Bacteria 1013

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100025950 Ga0075363_1000259502 196
2 3300006353 Ga0075370_10080200 Ga0075370_100802001 196
3 3300048925 Ga0496122_0000063 Ga0496122_0000063_240390_241124 202
4 3300048926 Ga0496123_0000117 Ga0496123_0000117_119298_120032 202
5 3300046559 Ga0495667_0158948 Ga0495667_0158948_310_1008 209
6 3300048920 Ga0496117_0219159 Ga0496117_0219159_21_755 209
7 3300053077 Ga0495601_0374656 Ga0495601_0374656_61_759 209
8 3300053085 Ga0495619_0117863 Ga0495619_0117863_245_943 209
9 3300025273 Ga0209673_1002499 Ga0209673_10024992 210
10 3300002773 JGI25152J39213_1002781 JGI25152J39213_10027815 212
11 3300003354 JGI25160J50197_1029710 JGI25160J50197_10297103 212
12 3300003790 Ga0055528_1008660 Ga0055528_10086601 212
13 3300005335 Ga0070666_10091775 Ga0070666_100917752 212
14 3300005355 Ga0070671_100070957 Ga0070671_1000709572 212
15 3300006178 Ga0075367_10195637 Ga0075367_101956372 212
16 3300009177 Ga0105248_10110038 Ga0105248_101100382 212
17 3300017792 Ga0163161_10245265 Ga0163161_102452652 212
18 3300025258 Ga0209129_1001529 Ga0209129_10015293 212
19 3300025294 Ga0209025_1019148 Ga0209025_10191482 212
20 3300025295 Ga0209564_1015496 Ga0209564_10154962 212
21 3300025299 Ga0209256_1003962 Ga0209256_10039625 212
22 3300025302 Ga0207426_1000447 Ga0207426_100044755 212
23 3300025925 Ga0207650_10395791 Ga0207650_103957912 212
24 3300025931 Ga0207644_10098349 Ga0207644_100983492 212
25 3300025961 Ga0207712_10177224 Ga0207712_101772242 212
26 3300025986 Ga0207658_10044511 Ga0207658_100445112 212
27 3300026067 Ga0207678_10120047 Ga0207678_101200472 212
28 3300048904 Ga0496101_0059039 Ga0496101_0059039_250_990 212
29 3300048907 Ga0496104_0115515 Ga0496104_0115515_913_1653 212
30 3300048908 Ga0496105_0054431 Ga0496105_0054431_731_1471 212
31 3300048914 Ga0496111_0173121 Ga0496111_0173121_333_1073 212
32 3300048926 Ga0496123_0091273 Ga0496123_0091273_362_1102 212
33 3300048927 Ga0496124_0197816 Ga0496124_0197816_557_1297 212
34 iso_pu_bacteria 2534681796 2535518040 212
35 3300014497 Ga0182008_10001323 Ga0182008_100013232 213
36 3300006038 Ga0075365_10000529 Ga0075365_100005292 214
37 3300006177 Ga0075362_10025311 Ga0075362_100253111 214
38 3300006186 Ga0075369_10009378 Ga0075369_100093783 214
39 3300009766 Ga0123342_1013414 Ga0123342_10134149 214
40 3300025915 Ga0207693_10047306 Ga0207693_100473062 214
41 3300042876 Ga0451577_1064199 Ga0451577_1064199_13_681 214
42 3300005331 Ga0070670_100166969 Ga0070670_1001669693 215
43 3300005347 Ga0070668_100273988 Ga0070668_1002739882 215
44 3300005353 Ga0070669_100141703 Ga0070669_1001417033 215
45 3300005355 Ga0070671_100200942 Ga0070671_1002009422 215
46 3300005365 Ga0070688_100013583 Ga0070688_1000135834 215
47 3300005543 Ga0070672_100219817 Ga0070672_1002198172 215
48 3300006028 Ga0070717_10791037 Ga0070717_107910371 215
49 3300025925 Ga0207650_10050383 Ga0207650_100503836 215
50 3300025931 Ga0207644_10300355 Ga0207644_103003552 215
51 3300025936 Ga0207670_10133607 Ga0207670_101336073 215
52 3300025940 Ga0207691_10198264 Ga0207691_101982642 215
53 3300025945 Ga0207679_10589751 Ga0207679_105897512 215
54 3300005468 Ga0070707_100033994 Ga0070707_1000339944 216
55 3300005468 Ga0070707_100581791 Ga0070707_1005817912 216
56 3300005841 Ga0068863_100390284 Ga0068863_1003902842 216
57 3300006237 Ga0097621_100078434 Ga0097621_1000784342 216
58 3300014325 Ga0163163_10000003 Ga0163163_10000003231 216
59 3300025913 Ga0207695_10034685 Ga0207695_100346855 216
60 3300045051 Ga0451576_0015673 Ga0451576_0015673_1696_2394 216
61 3300010159 Ga0099796_10047758 Ga0099796_100477582 218
62 3300027512 Ga0209179_1001603 Ga0209179_10016032 218
63 3300028558 Ga0265326_10059103 Ga0265326_100591032 218
64 3300028573 Ga0265334_10090418 Ga0265334_100904182 218
65 3300028653 Ga0265323_10002822 Ga0265323_100028225 218
66 3300028666 Ga0265336_10005738 Ga0265336_100057382 218
67 3300028800 Ga0265338_10001016 Ga0265338_1000101643 218
68 3300031456 Ga0307513_10648399 Ga0307513_106483991 218
69 3300037068 Ga0373925_0802946 Ga0373925_0802946_90_758 218
70 3300048905 Ga0496102_0093921 Ga0496102_0093921_1680_2399 218
71 3300005436 Ga0070713_100097470 Ga0070713_1000974702 219
72 3300005536 Ga0070697_100320031 Ga0070697_1003200311 219
73 3300007788 Ga0099795_10029257 Ga0099795_100292572 219
74 3300014325 Ga0163163_10252399 Ga0163163_102523992 219
75 3300044765 Ga0466970_0186319 Ga0466970_0186319_466_1125 219
76 3300047320 Ga0495672_0088113 Ga0495672_0088113_862_1611 219
77 3300048907 Ga0496104_0009605 Ga0496104_0009605_3353_4027 219
78 3300048908 Ga0496105_0023344 Ga0496105_0023344_3137_3811 219
79 3300048911 Ga0496108_0009713 Ga0496108_0009713_3331_4005 219
80 3300048912 Ga0496109_0009522 Ga0496109_0009522_749_1423 219
81 3300048913 Ga0496110_0027878 Ga0496110_0027878_3337_4011 219
82 3300048914 Ga0496111_0011921 Ga0496111_0011921_2070_2744 219
83 3300048915 Ga0496112_0026567 Ga0496112_0026567_3333_4007 219
84 3300053119 Ga0500595_007814 Ga0500595_007814_2404_3123 219
85 3300053145 Ga0500586_001127 Ga0500586_001127_705_1421 219
86 iso_pu_bacteria 2765235802 2765464362 219
87 iso_pu_bacteria 2767802442 2770194713 219
88 iso_pu_bacteria 2775506902 2776272502 219
89 iso_pu_bacteria 2775506904 2776284442 219
90 iso_pu_bacteria 2839993093 2839994278 219
91 iso_pu_bacteria 2840764183 2840769320 219
92 iso_pu_bacteria 2904578770 2904579048 219
93 iso_pu_bacteria 2919119836 2919122124 219
94 iso_pu_bacteria 2928521798 2928521936 219
95 iso_pu_bacteria 2954011201 2954014707 219
96 iso_pu_bacteria 3002141150 3002142675 219
97 3300003215 JGI25153J46596_10005975 JGI25153J46596_100059752 220
98 3300005536 Ga0070697_100729571 Ga0070697_1007295711 220
99 3300005843 Ga0068860_100000534 Ga0068860_10000053426 220
100 3300005843 Ga0068860_101072146 Ga0068860_1010721461 220
101 3300009545 Ga0105237_10040649 Ga0105237_100406492 220
102 3300013306 Ga0163162_10709274 Ga0163162_107092741 220
103 3300028381 Ga0268264_10000174 Ga0268264_1000017448 220
104 3300033179 Ga0307507_10033915 Ga0307507_100339159 220
105 3300033180 Ga0307510_10179327 Ga0307510_101793272 220
106 3300035692 Ga0373935_0032712 Ga0373935_0032712_1618_2337 220
107 3300035695 Ga0373927_0026674 Ga0373927_0026674_2062_2781 220
108 3300035725 Ga0373947_0033072 Ga0373947_0033072_875_1594 220
109 3300048921 Ga0496118_0019126 Ga0496118_0019126_1431_2150 220
110 3300053080 Ga0500635_0007052 Ga0500635_0007052_2142_2861 220
111 3300053094 Ga0500566_0123505 Ga0500566_0123505_347_1066 220
112 3300053097 Ga0500648_094847 Ga0500648_094847_150_869 220
113 3300053140 Ga0500573_0006467 Ga0500573_0006467_1130_1849 220
114 3300053177 Ga0500636_0077322 Ga0500636_0077322_924_1643 220
115 3300053178 Ga0500637_0282160 Ga0500637_0282160_45_764 220
116 3300053735 Ga0500596_000284 Ga0500596_000284_5073_5792 220
117 3300005458 Ga0070681_10087634 Ga0070681_100876345 221
118 3300005985 Ga0081539_10030928 Ga0081539_100309284 221
119 3300013104 Ga0157370_10017035 Ga0157370_100170358 221
120 3300025917 Ga0207660_10312940 Ga0207660_103129402 221
121 3300031249 Ga0265339_10054450 Ga0265339_100544503 221
122 3300033180 Ga0307510_10067650 Ga0307510_100676503 221
123 3300048929 Ga0496126_0102738 Ga0496126_0102738_1607_2326 221
124 3300050489 nmdc:mga03683_16686_c1 nmdc:mga03683_16686_c1_775_1494 221
125 3300053119 Ga0500595_002375 Ga0500595_002375_1025_1744 221
126 3300053162 Ga0500638_004107 Ga0500638_004107_1911_2630 221
127 3300053178 Ga0500637_0000090 Ga0500637_0000090_4545_5264 221
128 3300003574 Ga0007410J51695_1023793 Ga0007410J51695_10237931 222
129 3300005518 Ga0070699_100149816 Ga0070699_1001498163 222
130 3300005548 Ga0070665_100014804 Ga0070665_1000148046 222
131 3300006195 Ga0075366_10053729 Ga0075366_100537293 222
132 3300009147 Ga0114129_11129443 Ga0114129_111294431 222
133 3300011119 Ga0105246_10280332 Ga0105246_102803322 222
134 3300025924 Ga0207694_10166699 Ga0207694_101666992 222
135 3300025937 Ga0207669_10259432 Ga0207669_102594321 222
136 3300025941 Ga0207711_10127907 Ga0207711_101279074 222
137 3300035112 Ga0373932_0038755 Ga0373932_0038755_153_995 222
138 3300037418 Ga0395900_0226917 Ga0395900_0226917_78_791 222
139 3300041413 Ga0439465_0072875 Ga0439465_0072875_143_832 222
140 3300045976 Ga0466967_0016558 Ga0466967_0016558_1737_2450 222
141 3300046477 Ga0495664_0270126 Ga0495664_0270126_252_974 222
142 3300048913 Ga0496110_0078286 Ga0496110_0078286_656_1498 222
143 3300048914 Ga0496111_0049580 Ga0496111_0049580_212_931 222
144 3300048917 Ga0496114_0037653 Ga0496114_0037653_665_1507 222
145 3300048929 Ga0496126_0730971 Ga0496126_0730971_34_747 222
146 3300049568 Ga0501031_0428737 Ga0501031_0428737_81_800 222
147 3300049588 Ga0501072_0258072 Ga0501072_0258072_639_1358 222
148 3300049589 Ga0501073_0309438 Ga0501073_0309438_186_905 222
149 3300050493 nmdc:mga0k408_120724_c1 nmdc:mga0k408_120724_c1_811_1530 222
150 iso_pu_bacteria 2548876994 2550697216 222
151 3300005335 Ga0070666_10546164 Ga0070666_105461641 223
152 3300005344 Ga0070661_100238131 Ga0070661_1002381312 223
153 3300005434 Ga0070709_10058749 Ga0070709_100587492 223
154 3300005436 Ga0070713_100170583 Ga0070713_1001705832 223
155 3300005455 Ga0070663_100010930 Ga0070663_1000109302 223
156 3300005466 Ga0070685_10336700 Ga0070685_103367001 223
157 3300005548 Ga0070665_100016255 Ga0070665_1000162553 223
158 3300006048 Ga0075363_100013678 Ga0075363_1000136785 223
159 3300006051 Ga0075364_10054185 Ga0075364_100541852 223
160 3300006178 Ga0075367_10037617 Ga0075367_100376172 223
161 3300006353 Ga0075370_10006177 Ga0075370_100061774 223
162 3300009092 Ga0105250_10071291 Ga0105250_100712912 223
163 3300013306 Ga0163162_10521253 Ga0163162_105212532 223
164 3300013307 Ga0157372_10272871 Ga0157372_102728711 223
165 3300025929 Ga0207664_10372061 Ga0207664_103720612 223
166 3300026067 Ga0207678_10037444 Ga0207678_100374443 223
167 3300026121 Ga0207683_10569160 Ga0207683_105691601 223
168 3300028379 Ga0268266_10001864 Ga0268266_100018644 223
169 3300031911 Ga0307412_10231177 Ga0307412_102311772 223
170 3300039450 Ga0436363_0665946 Ga0436363_0665946_448_1212 223
171 3300047320 Ga0495672_0224730 Ga0495672_0224730_59_778 223
172 3300048908 Ga0496105_0069715 Ga0496105_0069715_1985_2704 223
173 3300048909 Ga0496106_0011496 Ga0496106_0011496_3969_4673 223
174 3300048910 Ga0496107_0089542 Ga0496107_0089542_1323_2042 223
175 3300048918 Ga0496115_0061653 Ga0496115_0061653_2272_2991 223
176 3300050490 nmdc:mga03n38_533_c1 nmdc:mga03n38_533_c1_5573_6292 223
177 3300050491 nmdc:mga00v17_43888_c1 nmdc:mga00v17_43888_c1_236_955 223
178 3300050492 nmdc:mga0yw44_4925_c2 nmdc:mga0yw44_4925_c2_860_1579 223
179 3300050494 nmdc:mga06z11_35246_c1 nmdc:mga06z11_35246_c1_1384_2103 223
180 3300050496 nmdc:mga07m45_2114_c1 nmdc:mga07m45_2114_c1_1968_2687 223
181 3300050512 nmdc:mga0n895_586141_c1 nmdc:mga0n895_586141_c1_307_1026 223
182 3300053109 Ga0500569_014547 Ga0500569_014547_134_850 223
183 3300053731 Ga0500609_018634 Ga0500609_018634_39_755 223
184 iso_pu_bacteria 2896154374 2896155420 223
185 iso_pu_bacteria 8005258706 8005264703 223
186 iso_pu_bacteria 8005321885 8005327197 223
187 3300005338 Ga0068868_100117433 Ga0068868_1001174332 224
188 3300005459 Ga0068867_100952356 Ga0068867_1009523561 224
189 3300005564 Ga0070664_100122248 Ga0070664_1001222482 224
190 3300005841 Ga0068863_100301418 Ga0068863_1003014182 224
191 3300005937 Ga0081455_10022180 Ga0081455_100221807 224
192 3300006042 Ga0075368_10195728 Ga0075368_101957282 224
193 3300009098 Ga0105245_10025310 Ga0105245_100253101 224
194 3300011119 Ga0105246_10297578 Ga0105246_102975782 224
195 3300013306 Ga0163162_10420843 Ga0163162_104208432 224
196 3300013308 Ga0157375_10016901 Ga0157375_100169012 224
197 3300014325 Ga0163163_10341237 Ga0163163_103412372 224
198 3300014969 Ga0157376_10109424 Ga0157376_101094243 224
199 3300021384 Ga0213876_10086955 Ga0213876_100869552 224
200 3300025919 Ga0207657_10058186 Ga0207657_100581861 224
201 3300025925 Ga0207650_10554119 Ga0207650_105541192 224
202 3300025934 Ga0207686_10423105 Ga0207686_104231052 224
203 3300025981 Ga0207640_10334363 Ga0207640_103343632 224
204 3300026023 Ga0207677_10038365 Ga0207677_100383652 224
205 3300026088 Ga0207641_10455359 Ga0207641_104553591 224
206 3300026121 Ga0207683_10043308 Ga0207683_100433082 224
207 3300039450 Ga0436363_0158762 Ga0436363_0158762_626_1342 224
208 3300039453 Ga0436362_0336193 Ga0436362_0336193_745_1461 224
209 3300048903 Ga0496100_0046173 Ga0496100_0046173_1145_1864 224
210 3300048908 Ga0496105_0157413 Ga0496105_0157413_701_1420 224
211 3300048909 Ga0496106_0011990 Ga0496106_0011990_963_1682 224
212 3300048910 Ga0496107_0028844 Ga0496107_0028844_2765_3484 224
213 3300048912 Ga0496109_0068250 Ga0496109_0068250_1592_2311 224
214 3300048913 Ga0496110_0428776 Ga0496110_0428776_349_1068 224
215 3300048915 Ga0496112_0025554 Ga0496112_0025554_1257_1976 224
216 3300048916 Ga0496113_0045330 Ga0496113_0045330_1526_2245 224
217 3300048917 Ga0496114_0379366 Ga0496114_0379366_136_855 224
218 3300049589 Ga0501073_0222140 Ga0501073_0222140_338_1120 224
219 3300050491 nmdc:mga00v17_79611_c1 nmdc:mga00v17_79611_c1_1050_1748 224
220 3300050492 nmdc:mga0yw44_141158_c1 nmdc:mga0yw44_141158_c1_298_996 224
221 3300050494 nmdc:mga06z11_345722_c1 nmdc:mga06z11_345722_c1_177_875 224
222 3300050496 nmdc:mga07m45_241183_c1 nmdc:mga07m45_241183_c1_166_864 224
223 3300050496 nmdc:mga07m45_40194_c1 nmdc:mga07m45_40194_c1_1746_2444 224
224 3300050516 nmdc:mga0sz30_167649_c1 nmdc:mga0sz30_167649_c1_28_726 224
225 iso_pu_bacteria 2818991445 2819591372 224
226 iso_pu_bacteria 2884811622 2884815253 224
227 iso_pu_bacteria 2884811622 2884815264 224
228 iso_pu_bacteria 2884836552 2884837171 224
229 iso_pu_bacteria 2884852848 2884853463 224
230 3300003659 JGI25404J52841_10027496 JGI25404J52841_100274961 225
231 3300005614 Ga0068856_100003313 Ga0068856_1000033138 225
232 3300005983 Ga0081540_1004327 Ga0081540_100432717 225
233 3300005983 Ga0081540_1008358 Ga0081540_10083582 225
234 3300009101 Ga0105247_10490616 Ga0105247_104906162 225
235 3300026078 Ga0207702_10000325 Ga0207702_1000032539 225
236 3300027671 Ga0209588_1005183 Ga0209588_10051833 225
237 3300048924 Ga0496121_0020788 Ga0496121_0020788_4288_5007 225
238 3300053087 Ga0500643_079769 Ga0500643_079769_38_739 225
239 iso_pu_bacteria 2511231003 2511248911 225
240 3300002737 JGI25162J39368_1003686 JGI25162J39368_10036864 226
241 3300005343 Ga0070687_100241257 Ga0070687_1002412572 226
242 3300005366 Ga0070659_100052884 Ga0070659_1000528841 226
243 3300005455 Ga0070663_100148879 Ga0070663_1001488791 226
244 3300005457 Ga0070662_100084819 Ga0070662_1000848193 226
245 3300005548 Ga0070665_100161902 Ga0070665_1001619023 226
246 3300005563 Ga0068855_100045608 Ga0068855_1000456082 226
247 3300005563 Ga0068855_100103063 Ga0068855_1001030633 226
248 3300005618 Ga0068864_100069542 Ga0068864_1000695426 226
249 3300005841 Ga0068863_100267222 Ga0068863_1002672222 226
250 3300005842 Ga0068858_100073088 Ga0068858_1000730881 226
251 3300005983 Ga0081540_1003580 Ga0081540_100358010 226
252 3300006175 Ga0070712_100024654 Ga0070712_1000246545 226
253 3300006237 Ga0097621_100192342 Ga0097621_1001923422 226
254 3300006358 Ga0068871_100050386 Ga0068871_1000503862 226
255 3300006358 Ga0068871_100347315 Ga0068871_1003473151 226
256 3300007788 Ga0099795_10024287 Ga0099795_100242872 226
257 3300009093 Ga0105240_10619226 Ga0105240_106192261 226
258 3300010159 Ga0099796_10008189 Ga0099796_100081892 226
259 3300010375 Ga0105239_10144608 Ga0105239_101446085 226
260 3300011119 Ga0105246_10062381 Ga0105246_100623812 226
261 3300013102 Ga0157371_10100896 Ga0157371_101008962 226
262 3300014969 Ga0157376_10590605 Ga0157376_105906052 226
263 3300021384 Ga0213876_10046146 Ga0213876_100461462 226
264 3300025223 Ga0207672_1002024 Ga0207672_10020242 226
265 3300025233 Ga0209437_100080 Ga0209437_1000807 226
266 3300025253 Ga0209677_101880 Ga0209677_1018805 226
267 3300025254 Ga0209148_1004037 Ga0209148_10040372 226
268 3300025261 Ga0209233_1001098 Ga0209233_10010983 226
269 3300025915 Ga0207693_10038353 Ga0207693_100383533 226
270 3300025916 Ga0207663_10388809 Ga0207663_103888092 226
271 3300025918 Ga0207662_10107841 Ga0207662_101078411 226
272 3300025927 Ga0207687_10216949 Ga0207687_102169492 226
273 3300025927 Ga0207687_10261905 Ga0207687_102619052 226
274 3300025941 Ga0207711_10114332 Ga0207711_101143322 226
275 3300026088 Ga0207641_10346921 Ga0207641_103469212 226
276 3300027866 Ga0209813_10073923 Ga0209813_100739231 226
277 3300028379 Ga0268266_10006918 Ga0268266_100069181 226
278 3300037853 Ga0436364_0421012 Ga0436364_0421012_184_906 226
279 3300039437 Ga0436365_1936582 Ga0436365_1936582_798_1520 226
280 3300039447 Ga0436361_0657147 Ga0436361_0657147_156_866 226
281 3300039447 Ga0436361_0757415 Ga0436361_0757415_970_1671 226
282 3300042531 Ga0450918_020862 Ga0450918_020862_55_762 226
283 3300046537 Ga0495598_0042422 Ga0495598_0042422_18_737 226
284 3300048910 Ga0496107_0296295 Ga0496107_0296295_192_911 226
285 3300048921 Ga0496118_0197593 Ga0496118_0197593_192_914 226
286 3300048924 Ga0496121_0054922 Ga0496121_0054922_1070_1792 226
287 3300049583 Ga0501067_0083381 Ga0501067_0083381_783_1502 226
288 3300053111 Ga0500572_000585 Ga0500572_000585_9669_10388 226
289 3300005616 Ga0068852_100246511 Ga0068852_1002465112 227
290 3300009101 Ga0105247_10137117 Ga0105247_101371172 227
291 3300013297 Ga0157378_10007047 Ga0157378_100070474 227
292 3300014497 Ga0182008_10061172 Ga0182008_100611723 227
293 3300025913 Ga0207695_10001268 Ga0207695_1000126826 227
294 3300025924 Ga0207694_10013374 Ga0207694_100133747 227
295 3300045049 Ga0466959_0126327 Ga0466959_0126327_1042_1758 227
296 3300046455 Ga0495603_0003074 Ga0495603_0003074_2820_3536 227
297 3300046499 Ga0495594_0291170 Ga0495594_0291170_113_829 227
298 3300046690 Ga0495624_0304827 Ga0495624_0304827_198_914 227
299 3300047673 Ga0495593_0113880 Ga0495593_0113880_301_1020 227
300 3300053078 Ga0495612_0241613 Ga0495612_0241613_73_792 227
301 3300053084 Ga0495595_0241509 Ga0495595_0241509_114_833 227
302 3300002704 JGI25155J39150_1000408 JGI25155J39150_10004084 228
303 3300002705 JGI25156J39149_1000057 JGI25156J39149_100005712 228
304 3300002738 JGI25154J39366_1000087 JGI25154J39366_100008778 228
305 3300002741 JGI25157J39369_1000336 JGI25157J39369_100033611 228
306 3300005333 Ga0070677_10027820 Ga0070677_100278203 228
307 3300005355 Ga0070671_100640921 Ga0070671_1006409211 228
308 3300005364 Ga0070673_100769279 Ga0070673_1007692792 228
309 3300005456 Ga0070678_100568549 Ga0070678_1005685492 228
310 3300005985 Ga0081539_10128426 Ga0081539_101284262 228
311 3300006353 Ga0075370_10292859 Ga0075370_102928592 228
312 3300009093 Ga0105240_10000497 Ga0105240_1000049749 228
313 3300009147 Ga0114129_10431581 Ga0114129_104315813 228
314 3300009177 Ga0105248_10030134 Ga0105248_100301343 228
315 3300009551 Ga0105238_10047369 Ga0105238_100473694 228
316 3300013306 Ga0163162_10588232 Ga0163162_105882322 228
317 3300025206 Ga0209435_100016 Ga0209435_100016139 228
318 3300025206 Ga0209435_100038 Ga0209435_10003821 228
319 3300025229 Ga0209147_100023 Ga0209147_100023190 228
320 3300025242 Ga0209258_100210 Ga0209258_100210109 228
321 3300025246 Ga0209646_1000033 Ga0209646_1000033171 228
322 3300025250 Ga0209026_1000031 Ga0209026_1000031190 228
323 3300025256 Ga0209759_1000045 Ga0209759_100004596 228
324 3300025272 Ga0209455_1001412 Ga0209455_100141210 228
325 3300025297 Ga0209758_1012239 Ga0209758_10122393 228
326 3300025911 Ga0207654_10194396 Ga0207654_101943961 228
327 3300025931 Ga0207644_10195260 Ga0207644_101952601 228
328 3300025936 Ga0207670_10314499 Ga0207670_103144991 228
329 3300025972 Ga0207668_10117877 Ga0207668_101178773 228
330 3300026089 Ga0207648_10094964 Ga0207648_100949642 228
331 3300026121 Ga0207683_10381410 Ga0207683_103814101 228
332 3300028379 Ga0268266_10014519 Ga0268266_100145194 228
333 3300031548 Ga0307408_100447596 Ga0307408_1004475962 228
334 3300033180 Ga0307510_10047759 Ga0307510_100477592 228
335 3300035695 Ga0373927_0062498 Ga0373927_0062498_824_1543 228
336 3300035695 Ga0373927_0096048 Ga0373927_0096048_195_914 228
337 3300036401 Ga0373937_0089606 Ga0373937_0089606_1327_2046 228
338 3300046454 Ga0495592_0151879 Ga0495592_0151879_477_1196 228
339 3300046455 Ga0495603_0232934 Ga0495603_0232934_329_1048 228
340 3300046462 Ga0495651_0150046 Ga0495651_0150046_209_928 228
341 3300046477 Ga0495664_0004013 Ga0495664_0004013_465_1184 228
342 3300046512 Ga0495610_0038063 Ga0495610_0038063_1187_1906 228
343 3300046514 Ga0495618_0059962 Ga0495618_0059962_681_1400 228
344 3300046515 Ga0495620_0044370 Ga0495620_0044370_1162_1881 228
345 3300046516 Ga0495628_0206105 Ga0495628_0206105_341_1060 228
346 3300046529 Ga0495652_0150525 Ga0495652_0150525_180_899 228
347 3300046536 Ga0495587_0007337 Ga0495587_0007337_582_1301 228
348 3300046536 Ga0495587_0054532 Ga0495587_0054532_890_1603 228
349 3300046543 Ga0495645_0006977 Ga0495645_0006977_1292_2011 228
350 3300046559 Ga0495667_0063781 Ga0495667_0063781_726_1445 228
351 3300046660 Ga0495625_0000888 Ga0495625_0000888_23797_24504 228
352 3300046678 Ga0495599_0078126 Ga0495599_0078126_111_830 228
353 3300046680 Ga0495646_0165379 Ga0495646_0165379_437_1150 228
354 3300046681 Ga0495647_0042172 Ga0495647_0042172_337_1056 228
355 3300046809 Ga0495600_0080311 Ga0495600_0080311_1367_2086 228
356 3300047317 Ga0495604_0034678 Ga0495604_0034678_2944_3663 228
357 3300047319 Ga0495674_0004909 Ga0495674_0004909_10135_10854 228
358 3300047321 Ga0495676_0216065 Ga0495676_0216065_44_763 228
359 3300047322 Ga0495680_0025019 Ga0495680_0025019_4163_4882 228
360 3300047444 Ga0495675_0039087 Ga0495675_0039087_459_1178 228
361 3300048088 Ga0495602_0000296 Ga0495602_0000296_38174_38893 228
362 3300048919 Ga0496116_0040362 Ga0496116_0040362_989_1705 228
363 3300048925 Ga0496122_0000375 Ga0496122_0000375_28902_29618 228
364 3300048926 Ga0496123_0000267 Ga0496123_0000267_73440_74156 228
365 3300048927 Ga0496124_0299559 Ga0496124_0299559_20_739 228
366 3300048928 Ga0496125_0000694 Ga0496125_0000694_33694_34401 228
367 3300048928 Ga0496125_0010987 Ga0496125_0010987_7467_8183 228
368 3300048929 Ga0496126_0011116 Ga0496126_0011116_3869_4591 228
369 3300050493 nmdc:mga0k408_274974_c1 nmdc:mga0k408_274974_c1_30_749 228
370 3300050496 nmdc:mga07m45_139324_c1 nmdc:mga07m45_139324_c1_294_1013 228
371 3300050514 nmdc:mga08x19_220984_c1 nmdc:mga08x19_220984_c1_558_1277 228
372 3300053077 Ga0495601_0000749 Ga0495601_0000749_13328_14047 228
373 3300053078 Ga0495612_0000707 Ga0495612_0000707_10627_11346 228
374 3300053084 Ga0495595_0025669 Ga0495595_0025669_506_1225 228
375 3300053085 Ga0495619_0039935 Ga0495619_0039935_1047_1766 228
376 3300053109 Ga0500569_006994 Ga0500569_006994_1166_1885 228
377 3300053730 Ga0500645_062200 Ga0500645_062200_341_1060 228
378 3300002704 JGI25155J39150_1000198 JGI25155J39150_10001984 229
379 3300002705 JGI25156J39149_1002321 JGI25156J39149_10023215 229
380 3300002738 JGI25154J39366_1000925 JGI25154J39366_10009252 229
381 3300003758 Ga0055532_1000016 Ga0055532_1000016254 229
382 3300005338 Ga0068868_100504877 Ga0068868_1005048772 229
383 3300005548 Ga0070665_100524084 Ga0070665_1005240841 229
384 3300005937 Ga0081455_10000815 Ga0081455_1000081526 229
385 3300005983 Ga0081540_1011347 Ga0081540_10113478 229
386 3300005983 Ga0081540_1087692 Ga0081540_10876922 229
387 3300009093 Ga0105240_10042855 Ga0105240_100428553 229
388 3300009553 Ga0105249_10135725 Ga0105249_101357254 229
389 3300013296 Ga0157374_10752030 Ga0157374_107520301 229
390 3300025206 Ga0209435_100096 Ga0209435_10009619 229
391 3300025246 Ga0209646_1000093 Ga0209646_100009328 229
392 3300025256 Ga0209759_1000248 Ga0209759_100024834 229
393 3300025261 Ga0209233_1003422 Ga0209233_10034228 229
394 3300025961 Ga0207712_10057465 Ga0207712_100574654 229
395 3300046452 Ga0495617_005474 Ga0495617_005474_2507_3226 229
396 3300046522 Ga0495643_0201458 Ga0495643_0201458_129_848 229
397 3300046530 Ga0495654_0147632 Ga0495654_0147632_94_813 229
398 3300046660 Ga0495625_0357388 Ga0495625_0357388_117_836 229
399 3300047472 Ga0495686_0127067 Ga0495686_0127067_616_1335 229
400 3300048912 Ga0496109_0197123 Ga0496109_0197123_838_1554 229
401 3300048921 Ga0496118_0263421 Ga0496118_0263421_71_781 229
402 3300048924 Ga0496121_0094560 Ga0496121_0094560_1128_1838 229
403 3300048929 Ga0496126_0135635 Ga0496126_0135635_196_915 229
404 3300049776 Ga0501280_000775 Ga0501280_000775_3891_4607 229
405 iso_pu_bacteria 2513237094 2513641110 229
406 iso_pu_bacteria 2844315083 2844316540 229
407 iso_pu_bacteria 2903727486 2903731402 229
408 iso_pu_bacteria 2906602504 2906603776 229
409 iso_pu_bacteria 2932794094 2932795744 229
410 iso_pu_bacteria 2932801729 2932801982 229
411 iso_pu_bacteria 2935883170 2935886170 229
412 iso_pu_bacteria 2941531003 2941537005 229
413 iso_pu_bacteria 3005594810 3005596170 229
414 iso_pu_bacteria 3005718088 3005719350 229
415 iso_pu_bacteria 8019648815 8019650393 229
416 iso_pu_bacteria 8056967851 8056973848 229
417 3300005435 Ga0070714_100156494 Ga0070714_1001564942 230
418 3300005436 Ga0070713_100071226 Ga0070713_1000712262 230
419 3300005983 Ga0081540_1110169 Ga0081540_11101692 230
420 3300009545 Ga0105237_10159053 Ga0105237_101590532 230
421 3300009553 Ga0105249_10281311 Ga0105249_102813112 230
422 3300009553 Ga0105249_11109305 Ga0105249_111093051 230
423 3300013105 Ga0157369_10026923 Ga0157369_1002692310 230
424 3300020069 Ga0197907_11028214 Ga0197907_110282143 230
425 3300022467 Ga0224712_10030820 Ga0224712_100308201 230
426 3300025904 Ga0207647_10095057 Ga0207647_100950573 230
427 3300025904 Ga0207647_10186038 Ga0207647_101860382 230
428 3300025904 Ga0207647_10249166 Ga0207647_102491662 230
429 3300025907 Ga0207645_10146099 Ga0207645_101460992 230
430 3300025913 Ga0207695_10217169 Ga0207695_102171693 230
431 3300025928 Ga0207700_10074358 Ga0207700_100743582 230
432 3300025929 Ga0207664_10076768 Ga0207664_100767683 230
433 3300025961 Ga0207712_10093050 Ga0207712_100930503 230
434 3300026118 Ga0207675_100021098 Ga0207675_1000210984 230
435 3300028381 Ga0268264_10155104 Ga0268264_101551043 230
436 3300033442 Ga0315911_1000041 Ga0315911_100004118 230
437 3300048913 Ga0496110_0070020 Ga0496110_0070020_1766_2485 230
438 3300048924 Ga0496121_0047906 Ga0496121_0047906_1860_2579 230
439 3300048929 Ga0496126_0037396 Ga0496126_0037396_1472_2191 230
440 3300049588 Ga0501072_0300148 Ga0501072_0300148_267_1004 230
441 iso_pu_bacteria 2507262055 2507511372 230
442 iso_pu_bacteria 2508501009 2508545166 230
443 iso_pu_bacteria 2508501042 2508694009 230
444 iso_pu_bacteria 2508501114 2509074743 230
445 iso_pu_bacteria 2511231028 2511394253 230
446 iso_pu_bacteria 2513237092 2513624147 230
447 iso_pu_bacteria 2513237095 2513648539 230
448 iso_pu_bacteria 2513237102 2513702622 230
449 iso_pu_bacteria 2517093001 2517101114 230
450 iso_pu_bacteria 2524023205 2524439944 230
451 iso_pu_bacteria 2528768022 2528853992 230
452 iso_pu_bacteria 2617270735 2617348475 230
453 iso_pu_bacteria 2617270741 2617375020 230
454 iso_pu_bacteria 2744054633 2745075775 230
455 iso_pu_bacteria 2791355196 2793061666 230
456 iso_pu_bacteria 2816332527 2818243421 230
457 iso_pu_bacteria 2824600985 2824609163 230
458 iso_pu_bacteria 2824609381 2824616848 230
459 iso_pu_bacteria 2824617872 2824624998 230
460 iso_pu_bacteria 2824626560 2824633865 230
461 iso_pu_bacteria 2824635225 2824641021 230
462 iso_pu_bacteria 2824644064 2824651537 230
463 iso_pu_bacteria 2824653114 2824661142 230
464 iso_pu_bacteria 2824661429 2824668414 230
465 iso_pu_bacteria 2824679649 2824683647 230
466 iso_pu_bacteria 2824704595 2824711470 230
467 iso_pu_bacteria 2824714736 2824721520 230
468 iso_pu_bacteria 2824723954 2824728288 230
469 iso_pu_bacteria 2824732956 2824739573 230
470 iso_pu_bacteria 2824746037 2824751854 230
471 iso_pu_bacteria 2824753945 2824754185 230
472 iso_pu_bacteria 2824763712 2824773242 230
473 iso_pu_bacteria 2824773399 2824780583 230
474 iso_pu_bacteria 2841957949 2841961530 230
475 iso_pu_bacteria 2842038055 2842042336 230
476 iso_pu_bacteria 2842045827 2842050379 230
477 iso_pu_bacteria 2847930680 2847939150 230
478 iso_pu_bacteria 2849076700 2849081872 230
479 iso_pu_bacteria 2857509624 2857512631 230
480 iso_pu_bacteria 2874612657 2874613957 230
481 iso_pu_bacteria 2874620515 2874625617 230
482 iso_pu_bacteria 2874628541 2874633719 230
483 iso_pu_bacteria 2876761206 2876766327 230
484 iso_pu_bacteria 2879083081 2879084622 230
485 iso_pu_bacteria 2879099564 2879100819 230
486 iso_pu_bacteria 2881364244 2881367322 230
487 iso_pu_bacteria 2881665667 2881668712 230
488 iso_pu_bacteria 2885366525 2885373763 230
489 iso_pu_bacteria 2888378607 2888386926 230
490 iso_pu_bacteria 2888388044 2888389621 230
491 iso_pu_bacteria 2888419890 2888421467 230
492 iso_pu_bacteria 2904666416 2904673563 230
493 iso_pu_bacteria 2904711408 2904719516 230
494 iso_pu_bacteria 2906626472 2906626723 230
495 iso_pu_bacteria 2906643746 2906646122 230
496 iso_pu_bacteria 2908775508 2908777504 230
497 iso_pu_bacteria 2922368715 2922377058 230
498 iso_pu_bacteria 2922393267 2922398212 230
499 iso_pu_bacteria 2929615660 2929619109 230
500 iso_pu_bacteria 2929624759 2929628396 230
501 iso_pu_bacteria 2932784394 2932791316 230
502 iso_pu_bacteria 2932809354 2932817658 230
503 iso_pu_bacteria 2932818245 2932826944 230
504 iso_pu_bacteria 2932828146 2932833115 230
505 iso_pu_bacteria 2933577622 2933581031 230
506 iso_pu_bacteria 2935608549 2935612301 230
507 iso_pu_bacteria 2935616580 2935623844 230
508 iso_pu_bacteria 2935638405 2935639619 230
509 iso_pu_bacteria 2935648319 2935650141 230
510 iso_pu_bacteria 2935656913 2935658288 230
511 iso_pu_bacteria 2935665750 2935667542 230
512 iso_pu_bacteria 2935675223 2935682895 230
513 iso_pu_bacteria 2935684952 2935687558 230
514 iso_pu_bacteria 2935694250 2935696470 230
515 iso_pu_bacteria 2935703347 2935705283 230
516 iso_pu_bacteria 2935713505 2935719018 230
517 iso_pu_bacteria 2935722832 2935728670 230
518 iso_pu_bacteria 2935732158 2935736734 230
519 iso_pu_bacteria 2935741537 2935746264 230
520 iso_pu_bacteria 2935750917 2935753524 230
521 iso_pu_bacteria 2935760218 2935767721 230
522 iso_pu_bacteria 2935769743 2935770483 230
523 iso_pu_bacteria 2935777560 2935782490 230
524 iso_pu_bacteria 2935785616 2935786464 230
525 iso_pu_bacteria 2935793552 2935794519 230
526 iso_pu_bacteria 2935801545 2935807028 230
527 iso_pu_bacteria 2935810662 2935814057 230
528 iso_pu_bacteria 2935819856 2935823789 230
529 iso_pu_bacteria 2935827899 2935829101 230
530 iso_pu_bacteria 2935837841 2935845364 230
531 iso_pu_bacteria 2935847175 2935854427 230
532 iso_pu_bacteria 2935855204 2935861931 230
533 iso_pu_bacteria 2935864058 2935872819 230
534 iso_pu_bacteria 2935873716 2935880394 230
535 iso_pu_bacteria 2935908558 2935913479 230
536 iso_pu_bacteria 2935916978 2935923376 230
537 iso_pu_bacteria 2935926038 2935931204 230
538 iso_pu_bacteria 2935934488 2935935486 230
539 iso_pu_bacteria 2935942939 2935947052 230
540 iso_pu_bacteria 2935951376 2935953853 230
541 iso_pu_bacteria 2935959822 2935961510 230
542 iso_pu_bacteria 2935967501 2935968879 230
543 iso_pu_bacteria 2935984226 2935985920 230
544 iso_pu_bacteria 2935992306 2935995004 230
545 iso_pu_bacteria 2936002035 2936006097 230
546 iso_pu_bacteria 2936011229 2936013300 230
547 iso_pu_bacteria 2936019824 2936021613 230
548 iso_pu_bacteria 2936028420 2936030593 230
549 iso_pu_bacteria 2936037263 2936039612 230
550 iso_pu_bacteria 2936046547 2936047807 230
551 iso_pu_bacteria 2936055302 2936057809 230
552 iso_pu_bacteria 2940556831 2940559437 230
553 iso_pu_bacteria 2941538514 2941545665 230
554 iso_pu_bacteria 3005483717 3005489140 230
555 iso_pu_bacteria 3005506211 3005511194 230
556 iso_pu_bacteria 3005587118 3005592045 230
557 iso_pu_bacteria 3005710791 3005712109 230
558 iso_pu_bacteria 8016511872 8016516924 230
559 iso_pu_bacteria 8016522445 8016524504 230
560 iso_pu_bacteria 8016530956 8016538064 230
561 iso_pu_bacteria 8016539877 8016542340 230
562 iso_pu_bacteria 8016548790 8016550937 230
563 iso_pu_bacteria 8016557553 8016559350 230
564 iso_pu_bacteria 8016566248 8016567727 230
565 iso_pu_bacteria 8016575299 8016580421 230
566 iso_pu_bacteria 8016583857 8016588631 230
567 iso_pu_bacteria 8016595262 8016597291 230
568 iso_pu_bacteria 8016603502 8016604968 230
569 iso_pu_bacteria 8016613128 8016620043 230
570 iso_pu_bacteria 8016622563 8016624262 230
571 iso_pu_bacteria 8016630954 8016637671 230
572 iso_pu_bacteria 8017057580 8017059646 230
573 iso_pu_bacteria 8019530166 8019537732 230
574 iso_pu_bacteria 8019538911 8019539362 230
575 iso_pu_bacteria 8019576017 8019579120 230
576 iso_pu_bacteria 8019586578 8019597174 230
577 iso_pu_bacteria 8019597564 8019604517 230
578 iso_pu_bacteria 8019687851 8019694562 230
579 iso_pu_bacteria 8055742211 8055749633 230
580 3300003203 JGI25406J46586_10029632 JGI25406J46586_100296322 231
581 3300005985 Ga0081539_10000958 Ga0081539_100009587 231
582 3300006871 Ga0075434_100006045 Ga0075434_1000060455 231
583 3300013296 Ga0157374_10022044 Ga0157374_100220449 231
584 3300025915 Ga0207693_10300721 Ga0207693_103007212 231
585 3300031616 Ga0307508_10144279 Ga0307508_101442792 231
586 3300032005 Ga0307411_10102847 Ga0307411_101028472 231
587 3300035121 Ga0373960_0132965 Ga0373960_0132965_96_812 231
588 3300046528 Ga0495642_0032875 Ga0495642_0032875_966_1685 231
589 3300046648 Ga0495611_0017586 Ga0495611_0017586_449_1168 231
590 3300047469 Ga0495673_0042363 Ga0495673_0042363_25_744 231
591 3300047469 Ga0495673_0043580 Ga0495673_0043580_474_1193 231
592 3300048929 Ga0496126_0467551 Ga0496126_0467551_263_982 231
593 3300050512 nmdc:mga0n895_8338_c1 nmdc:mga0n895_8338_c1_3749_4456 231
594 3300053096 Ga0500641_0097233 Ga0500641_0097233_472_1191 231
595 3300053116 Ga0500592_024540 Ga0500592_024540_236_955 231
596 3300053124 Ga0500617_148009 Ga0500617_148009_138_857 231
597 3300053143 Ga0500579_114888 Ga0500579_114888_297_1016 231
598 3300053148 Ga0500590_040995 Ga0500590_040995_148_867 231
599 3300053158 Ga0500627_0030431 Ga0500627_0030431_1165_1884 231
600 3300053160 Ga0500633_0022583 Ga0500633_0022583_765_1484 231
601 3300053731 Ga0500609_004261 Ga0500609_004261_385_1104 231
602 iso_pu_bacteria 2508501128 2509146650 231
603 3300005355 Ga0070671_100273068 Ga0070671_1002730682 232
604 3300005367 Ga0070667_100125652 Ga0070667_1001256522 232
605 3300005577 Ga0068857_100178355 Ga0068857_1001783551 232
606 3300005614 Ga0068856_100131687 Ga0068856_1001316873 232
607 3300006177 Ga0075362_10028330 Ga0075362_100283301 232
608 3300009093 Ga0105240_10339230 Ga0105240_103392302 232
609 3300009147 Ga0114129_10419060 Ga0114129_104190602 232
610 3300013104 Ga0157370_10230358 Ga0157370_102303582 232
611 3300013105 Ga0157369_10013948 Ga0157369_100139481 232
612 3300013307 Ga0157372_10078452 Ga0157372_100784523 232
613 3300020080 Ga0206350_11646629 Ga0206350_116466293 232
614 3300020081 Ga0206354_10138454 Ga0206354_101384541 232
615 3300025931 Ga0207644_10360358 Ga0207644_103603582 232
616 3300026116 Ga0207674_10147250 Ga0207674_101472501 232
617 3300031616 Ga0307508_10000063 Ga0307508_100000632 232
618 3300031616 Ga0307508_10162486 Ga0307508_101624861 232
619 3300032002 Ga0307416_100721809 Ga0307416_1007218091 232
620 3300035089 Ga0373944_0038867 Ga0373944_0038867_649_1368 232
621 3300035725 Ga0373947_0275424 Ga0373947_0275424_113_832 232
622 3300046455 Ga0495603_0062571 Ga0495603_0062571_765_1484 232
623 3300046501 Ga0495607_0165028 Ga0495607_0165028_337_1053 232
624 3300046558 Ga0495633_0139616 Ga0495633_0139616_44_763 232
625 3300046664 Ga0495659_0080509 Ga0495659_0080509_168_887 232
626 3300048912 Ga0496109_0009612 Ga0496109_0009612_6821_7540 232
627 3300048913 Ga0496110_0083574 Ga0496110_0083574_1294_2013 232
628 3300048914 Ga0496111_0001105 Ga0496111_0001105_7009_7728 232
629 3300048915 Ga0496112_0013107 Ga0496112_0013107_3707_4426 232
630 3300048916 Ga0496113_0002366 Ga0496113_0002366_3249_3968 232
631 3300048918 Ga0496115_0009221 Ga0496115_0009221_3112_3831 232
632 3300050507 nmdc:mga05p37_734481_c1 nmdc:mga05p37_734481_c1_195_914 232
633 3300059426 Ga0590077_025092 Ga0590077_025092_417_1148 232
634 iso_pu_bacteria 2513237104 2513717832 232
635 iso_pu_bacteria 2513237141 2513887693 232
636 iso_pu_bacteria 8006933436 8006934816 232
637 iso_pu_bacteria 8006973647 8006974784 232
638 3300003215 JGI25153J46596_10038013 JGI25153J46596_100380131 233
639 3300005435 Ga0070714_100220629 Ga0070714_1002206292 233
640 3300005546 Ga0070696_100086014 Ga0070696_1000860142 233
641 3300009094 Ga0111539_10004709 Ga0111539_100047098 233
642 3300009147 Ga0114129_11206551 Ga0114129_112065511 233
643 3300009551 Ga0105238_10292697 Ga0105238_102926973 233
644 3300025254 Ga0209148_1000900 Ga0209148_10009007 233
645 3300025261 Ga0209233_1003397 Ga0209233_10033972 233
646 3300025272 Ga0209455_1004957 Ga0209455_10049576 233
647 3300025297 Ga0209758_1006083 Ga0209758_10060838 233
648 3300025922 Ga0207646_10105609 Ga0207646_101056092 233
649 3300025924 Ga0207694_10100380 Ga0207694_101003802 233
650 3300025929 Ga0207664_10027347 Ga0207664_100273475 233
651 3300027907 Ga0207428_10000153 Ga0207428_1000015370 233
652 3300037853 Ga0436364_0322463 Ga0436364_0322463_209_910 233
653 3300044658 Ga0466972_0010885 Ga0466972_0010885_1069_1782 233
654 3300044684 Ga0466966_0052188 Ga0466966_0052188_465_1166 233
655 3300044693 Ga0466961_0000311 Ga0466961_0000311_505_1206 233
656 3300044735 Ga0466968_0002021 Ga0466968_0002021_4733_5446 233
657 3300044901 Ga0466960_0010159 Ga0466960_0010159_592_1305 233
658 3300045049 Ga0466959_0052297 Ga0466959_0052297_2016_2717 233
659 3300046459 Ga0495629_0000913 Ga0495629_0000913_15782_16483 233
660 3300046462 Ga0495651_0052377 Ga0495651_0052377_2224_2925 233
661 3300046474 Ga0495605_0216166 Ga0495605_0216166_14_715 233
662 3300046476 Ga0495662_0136179 Ga0495662_0136179_402_1103 233
663 3300046507 Ga0495606_0005723 Ga0495606_0005723_1109_1813 233
664 3300046511 Ga0495608_0077014 Ga0495608_0077014_227_928 233
665 3300046515 Ga0495620_0119015 Ga0495620_0119015_107_808 233
666 3300046517 Ga0495630_0579363 Ga0495630_0579363_103_804 233
667 3300046524 Ga0495648_0111763 Ga0495648_0111763_260_961 233
668 3300046533 Ga0495640_0050334 Ga0495640_0050334_220_921 233
669 3300046538 Ga0495609_0072648 Ga0495609_0072648_255_956 233
670 3300046660 Ga0495625_0077443 Ga0495625_0077443_367_1068 233
671 3300046683 Ga0495658_0327898 Ga0495658_0327898_110_811 233
672 3300046690 Ga0495624_0242967 Ga0495624_0242967_82_783 233
673 3300047321 Ga0495676_0145248 Ga0495676_0145248_168_869 233
674 3300048907 Ga0496104_0031565 Ga0496104_0031565_3921_4622 233
675 3300048922 Ga0496119_0010049 Ga0496119_0010049_1946_2647 233
676 3300048929 Ga0496126_0016331 Ga0496126_0016331_2871_3572 233
677 3300050511 nmdc:mga08y16_34_c1 nmdc:mga08y16_34_c1_55839_56573 233
678 3300053085 Ga0495619_0133930 Ga0495619_0133930_769_1470 233
679 3300053119 Ga0500595_019669 Ga0500595_019669_1267_1968 233
680 3300053136 Ga0500559_0062637 Ga0500559_0062637_787_1488 233
681 3300061719 Ga0466962_0186089 Ga0466962_0186089_248_949 233
682 iso_pu_bacteria 2513237096 2513656083 233
683 iso_pu_bacteria 2513237137 2513862889 233
684 iso_pu_bacteria 2513237145 2513920908 233
685 iso_pu_bacteria 2517572143 2517895904 233
686 iso_pu_bacteria 2524023228 2524534772 233
687 iso_pu_bacteria 2602042107 2603857526 233
688 iso_pu_bacteria 2667528175 2671122695 233
689 iso_pu_bacteria 2671180139 2671693394 233
690 iso_pu_bacteria 2728368998 2728754209 233
691 iso_pu_bacteria 2791355197 2793069670 233
692 iso_pu_bacteria 2857524615 2857526913 233
693 iso_pu_bacteria 2876808645 2876809978 233
694 iso_pu_bacteria 2879110137 2879113715 233
695 iso_pu_bacteria 2885374607 2885377854 233
696 iso_pu_bacteria 2893066018 2893070070 233
697 iso_pu_bacteria 2903748898 2903756009 233
698 iso_pu_bacteria 2904690495 2904693383 233
699 iso_pu_bacteria 2904699407 2904707037 233
700 iso_pu_bacteria 2906610324 2906615631 233
701 iso_pu_bacteria 2906635258 2906635584 233
702 iso_pu_bacteria 2906660503 2906665064 233
703 iso_pu_bacteria 2908739725 2908745548 233
704 iso_pu_bacteria 2908756301 2908763537 233
705 iso_pu_bacteria 2919073203 2919078030 233
706 iso_pu_bacteria 2922425934 2922432375 233
707 iso_pu_bacteria 2935630451 2935630797 233
708 iso_pu_bacteria 2941507105 2941507449 233
709 iso_pu_bacteria 2941515067 2941515876 233
710 iso_pu_bacteria 2941523033 2941523416 233
711 iso_pu_bacteria 3005474847 3005476663 233
712 iso_pu_bacteria 8019555841 8019563838 233
713 iso_pu_bacteria 8019565922 8019573907 233
714 3300003162 Ga0006778J45830_1005206 Ga0006778J45830_10052061 234
715 3300003214 JGI25165J46597_1004533 JGI25165J46597_10045332 234
716 3300003215 JGI25153J46596_10001736 JGI25153J46596_1000173615 234
717 3300003215 JGI25153J46596_10003826 JGI25153J46596_1000382610 234
718 3300003215 JGI25153J46596_10004140 JGI25153J46596_100041403 234
719 3300003215 JGI25153J46596_10011700 JGI25153J46596_100117004 234
720 3300003354 JGI25160J50197_1002670 JGI25160J50197_10026702 234
721 3300003354 JGI25160J50197_1009335 JGI25160J50197_10093352 234
722 3300003544 Ga0007417J51691_1021109 Ga0007417J51691_10211091 234
723 3300003568 Ga0006781J51513_1004680 Ga0006781J51513_10046801 234
724 3300003577 Ga0007416J51690_1011819 Ga0007416J51690_10118191 234
725 3300003579 Ga0007429J51699_1006648 Ga0007429J51699_10066481 234
726 3300003693 Ga0032354_1001469 Ga0032354_10014691 234
727 3300003735 Ga0006780_1000642 Ga0006780_10006421 234
728 3300003752 Ga0055539_1013566 Ga0055539_10135661 234
729 3300003775 Ga0055524_1029581 Ga0055524_10295812 234
730 3300003794 Ga0055531_10006809 Ga0055531_100068094 234
731 3300003911 JGI25405J52794_10040334 JGI25405J52794_100403342 234
732 3300004625 Ga0055543_1005069 Ga0055543_10050693 234
733 3300005262 Ga0065165_1001376 Ga0065165_100137621 234
734 3300005262 Ga0065165_1003381 Ga0065165_10033816 234
735 3300005262 Ga0065165_1006721 Ga0065165_10067214 234
736 3300005262 Ga0065165_1042564 Ga0065165_10425642 234
737 3300005347 Ga0070668_100027694 Ga0070668_1000276946 234
738 3300005355 Ga0070671_100045130 Ga0070671_1000451304 234
739 3300005366 Ga0070659_100519196 Ga0070659_1005191962 234
740 3300005455 Ga0070663_100067660 Ga0070663_1000676602 234
741 3300005548 Ga0070665_100082234 Ga0070665_1000822342 234
742 3300005564 Ga0070664_100291013 Ga0070664_1002910133 234
743 3300005578 Ga0068854_100201872 Ga0068854_1002018722 234
744 3300005614 Ga0068856_100425696 Ga0068856_1004256962 234
745 3300005614 Ga0068856_100552487 Ga0068856_1005524872 234
746 3300005616 Ga0068852_100835030 Ga0068852_1008350301 234
747 3300005842 Ga0068858_100094941 Ga0068858_1000949414 234
748 3300005983 Ga0081540_1010413 Ga0081540_10104131 234
749 3300006051 Ga0075364_10031891 Ga0075364_100318913 234
750 3300006178 Ga0075367_10058666 Ga0075367_100586663 234
751 3300006186 Ga0075369_10021528 Ga0075369_100215282 234
752 3300006195 Ga0075366_10036160 Ga0075366_100361602 234
753 3300006353 Ga0075370_10043400 Ga0075370_100434003 234
754 3300006942 Ga0099824_1013868 Ga0099824_101386810 234
755 3300006942 Ga0099824_1013868 Ga0099824_10138689 234
756 3300006943 Ga0099822_1054877 Ga0099822_10548772 234
757 3300006944 Ga0099823_1032665 Ga0099823_10326658 234
758 3300009148 Ga0105243_10088252 Ga0105243_100882522 234
759 3300009177 Ga0105248_10113191 Ga0105248_101131914 234
760 3300009545 Ga0105237_10033065 Ga0105237_100330654 234
761 3300009545 Ga0105237_10072458 Ga0105237_100724582 234
762 3300013308 Ga0157375_10174904 Ga0157375_101749044 234
763 3300015261 Ga0182006_1087717 Ga0182006_10877172 234
764 3300020081 Ga0206354_10070692 Ga0206354_100706921 234
765 3300021320 Ga0214544_1000005 Ga0214544_1000005170 234
766 3300021321 Ga0214542_1000004 Ga0214542_1000004174 234
767 3300021324 Ga0214545_1000005 Ga0214545_1000005223 234
768 3300021327 Ga0214543_1000564 Ga0214543_100056459 234
769 3300022467 Ga0224712_10139776 Ga0224712_101397761 234
770 3300025253 Ga0209677_106176 Ga0209677_1061764 234
771 3300025261 Ga0209233_1001052 Ga0209233_10010524 234
772 3300025273 Ga0209673_1015590 Ga0209673_10155904 234
773 3300025295 Ga0209564_1003825 Ga0209564_100382510 234
774 3300025295 Ga0209564_1012222 Ga0209564_10122223 234
775 3300025297 Ga0209758_1000102 Ga0209758_100010249 234
776 3300025297 Ga0209758_1001188 Ga0209758_100118811 234
777 3300025297 Ga0209758_1001605 Ga0209758_100160513 234
778 3300025297 Ga0209758_1004134 Ga0209758_10041344 234
779 3300025299 Ga0209256_1013127 Ga0209256_10131274 234
780 3300025302 Ga0207426_1000354 Ga0207426_100035437 234
781 3300025302 Ga0207426_1003427 Ga0207426_10034273 234
782 3300025302 Ga0207426_1004280 Ga0207426_10042802 234
783 3300025304 Ga0209257_1001262 Ga0209257_10012624 234
784 3300025304 Ga0209257_1064884 Ga0209257_10648841 234
785 3300025901 Ga0207688_10090991 Ga0207688_100909913 234
786 3300025904 Ga0207647_10019007 Ga0207647_100190073 234
787 3300025914 Ga0207671_10098760 Ga0207671_100987601 234
788 3300025914 Ga0207671_10411173 Ga0207671_104111731 234
789 3300025941 Ga0207711_10786049 Ga0207711_107860491 234
790 3300025949 Ga0207667_10166711 Ga0207667_101667112 234
791 3300025949 Ga0207667_10679273 Ga0207667_106792731 234
792 3300025986 Ga0207658_10093331 Ga0207658_100933314 234
793 3300026023 Ga0207677_10369299 Ga0207677_103692992 234
794 3300026041 Ga0207639_10169613 Ga0207639_101696134 234
795 3300026088 Ga0207641_10186155 Ga0207641_101861553 234
796 3300026118 Ga0207675_100125057 Ga0207675_1001250572 234
797 3300027296 Ga0209389_1000021 Ga0209389_100002115 234
798 3300027296 Ga0209389_1000086 Ga0209389_100008673 234
799 3300027357 Ga0209589_1000027 Ga0209589_100002712 234
800 3300027361 Ga0209489_100313 Ga0209489_10031373 234
801 3300027361 Ga0209489_105143 Ga0209489_10514324 234
802 3300027363 Ga0209700_100483 Ga0209700_10048325 234
803 3300033180 Ga0307510_10079158 Ga0307510_100791585 234
804 3300037418 Ga0395900_0025652 Ga0395900_0025652_2977_3681 234
805 3300037418 Ga0395900_0502955 Ga0395900_0502955_316_1020 234
806 3300037471 Ga0395905_0005393 Ga0395905_0005393_8015_8731 234
807 3300038443 Ga0395901_0180976 Ga0395901_0180976_1179_1895 234
808 3300044658 Ga0466972_0000268 Ga0466972_0000268_4756_5460 234
809 3300044658 Ga0466972_0232184 Ga0466972_0232184_102_806 234
810 3300045976 Ga0466967_0262376 Ga0466967_0262376_683_1387 234
811 3300046460 Ga0495638_0017480 Ga0495638_0017480_2803_3507 234
812 3300046462 Ga0495651_0018793 Ga0495651_0018793_2032_2736 234
813 3300046471 Ga0495650_0110791 Ga0495650_0110791_172_876 234
814 3300046474 Ga0495605_0059800 Ga0495605_0059800_929_1633 234
815 3300046477 Ga0495664_0036527 Ga0495664_0036527_2121_2825 234
816 3300046506 Ga0495583_0090772 Ga0495583_0090772_318_1022 234
817 3300046522 Ga0495643_0191416 Ga0495643_0191416_133_837 234
818 3300046529 Ga0495652_0021351 Ga0495652_0021351_2997_3701 234
819 3300046542 Ga0495597_0133670 Ga0495597_0133670_37_741 234
820 3300046543 Ga0495645_0006636 Ga0495645_0006636_6900_7604 234
821 3300046559 Ga0495667_0338480 Ga0495667_0338480_125_829 234
822 3300046616 Ga0495668_0053955 Ga0495668_0053955_913_1617 234
823 3300046642 Ga0495634_0226375 Ga0495634_0226375_252_956 234
824 3300046674 Ga0495588_0012745 Ga0495588_0012745_1736_2440 234
825 3300046675 Ga0495657_0023411 Ga0495657_0023411_750_1454 234
826 3300046678 Ga0495599_0023100 Ga0495599_0023100_2055_2759 234
827 3300046679 Ga0495623_0115298 Ga0495623_0115298_53_757 234
828 3300046680 Ga0495646_0254712 Ga0495646_0254712_78_782 234
829 3300047319 Ga0495674_0023635 Ga0495674_0023635_1945_2649 234
830 3300047320 Ga0495672_0242940 Ga0495672_0242940_29_733 234
831 3300047321 Ga0495676_0417388 Ga0495676_0417388_49_753 234
832 3300047322 Ga0495680_0006961 Ga0495680_0006961_2873_3577 234
833 3300047323 Ga0495683_0188214 Ga0495683_0188214_112_816 234
834 3300047444 Ga0495675_0016604 Ga0495675_0016604_1665_2369 234
835 3300047447 Ga0495685_152001 Ga0495685_152001_30_734 234
836 3300047469 Ga0495673_0038526 Ga0495673_0038526_1404_2108 234
837 3300047472 Ga0495686_0051010 Ga0495686_0051010_1417_2121 234
838 3300048088 Ga0495602_0048749 Ga0495602_0048749_2681_3385 234
839 3300048091 Ga0495626_0044330 Ga0495626_0044330_956_1660 234
840 3300048903 Ga0496100_0067873 Ga0496100_0067873_886_1590 234
841 3300048905 Ga0496102_0092413 Ga0496102_0092413_637_1341 234
842 3300048906 Ga0496103_0087932 Ga0496103_0087932_135_839 234
843 3300048907 Ga0496104_0057600 Ga0496104_0057600_1801_2505 234
844 3300048908 Ga0496105_0036534 Ga0496105_0036534_1723_2427 234
845 3300048909 Ga0496106_0135844 Ga0496106_0135844_1019_1723 234
846 3300048910 Ga0496107_0265871 Ga0496107_0265871_397_1101 234
847 3300048911 Ga0496108_0028405 Ga0496108_0028405_848_1552 234
848 3300048912 Ga0496109_0056204 Ga0496109_0056204_983_1687 234
849 3300048913 Ga0496110_0394115 Ga0496110_0394115_504_1208 234
850 3300048915 Ga0496112_0004212 Ga0496112_0004212_6656_7360 234
851 3300048917 Ga0496114_0175359 Ga0496114_0175359_754_1458 234
852 3300048920 Ga0496117_0260907 Ga0496117_0260907_132_836 234
853 3300048921 Ga0496118_0072041 Ga0496118_0072041_1270_1974 234
854 3300048922 Ga0496119_0059543 Ga0496119_0059543_1406_2110 234
855 3300048923 Ga0496120_0219816 Ga0496120_0219816_154_858 234
856 3300048924 Ga0496121_0009515 Ga0496121_0009515_7060_7764 234
857 3300048924 Ga0496121_0288475 Ga0496121_0288475_324_1028 234
858 3300048927 Ga0496124_0158870 Ga0496124_0158870_519_1223 234
859 3300048928 Ga0496125_0105823 Ga0496125_0105823_132_836 234
860 3300048928 Ga0496125_0151299 Ga0496125_0151299_373_1077 234
861 3300048929 Ga0496126_0059599 Ga0496126_0059599_2307_3011 234
862 3300049460 Ga0495682_0042087 Ga0495682_0042087_695_1399 234
863 3300049573 Ga0501037_0116571 Ga0501037_0116571_922_1632 234
864 3300049822 Ga0501035_0036075 Ga0501035_0036075_733_1443 234
865 3300050491 nmdc:mga00v17_23676_c1 nmdc:mga00v17_23676_c1_1658_2362 234
866 3300050492 nmdc:mga0yw44_96245_c1 nmdc:mga0yw44_96245_c1_490_1194 234
867 3300050493 nmdc:mga0k408_237919_c1 nmdc:mga0k408_237919_c1_107_811 234
868 3300053084 Ga0495595_0020690 Ga0495595_0020690_1531_2235 234
869 3300053086 Ga0500578_0155667 Ga0500578_0155667_394_1098 234
870 3300053087 Ga0500643_000016 Ga0500643_000016_163962_164666 234
871 3300053090 Ga0500646_0041940 Ga0500646_0041940_484_1188 234
872 3300053094 Ga0500566_0003091 Ga0500566_0003091_7742_8446 234
873 3300053094 Ga0500566_0105695 Ga0500566_0105695_214_918 234
874 3300053096 Ga0500641_0067011 Ga0500641_0067011_414_1118 234
875 3300053103 Ga0500555_008692 Ga0500555_008692_2002_2706 234
876 3300053104 Ga0500556_0064238 Ga0500556_0064238_640_1344 234
877 3300053105 Ga0500557_003716 Ga0500557_003716_403_1107 234
878 3300053128 Ga0500626_067116 Ga0500626_067116_395_1099 234
879 3300053130 Ga0500642_0000109 Ga0500642_0000109_25871_26575 234
880 3300053136 Ga0500559_0029582 Ga0500559_0029582_265_969 234
881 3300053139 Ga0500568_0045737 Ga0500568_0045737_349_1053 234
882 3300053148 Ga0500590_021786 Ga0500590_021786_788_1492 234
883 3300053151 Ga0500604_0062277 Ga0500604_0062277_84_788 234
884 3300053153 Ga0500616_0260809 Ga0500616_0260809_22_726 234
885 3300053156 Ga0500622_0025854 Ga0500622_0025854_1191_1895 234
886 3300053161 Ga0500634_0019449 Ga0500634_0019449_1756_2460 234
887 3300053177 Ga0500636_0036683 Ga0500636_0036683_512_1216 234
888 3300053729 Ga0500625_022262 Ga0500625_022262_1789_2493 234
889 3300053730 Ga0500645_026052 Ga0500645_026052_591_1295 234
890 3300053736 Ga0500599_002093 Ga0500599_002093_482_1186 234
891 3300053737 Ga0500601_000997 Ga0500601_000997_2062_2766 234
892 iso_pu_bacteria 2513237098 2513675266 234
893 iso_pu_bacteria 2513237101 2513696383 234
894 iso_pu_bacteria 2524023210 2524469134 234
895 iso_pu_bacteria 2643221651 2644287239 234
896 iso_pu_bacteria 2721755755 2723842889 234
897 iso_pu_bacteria 2791355199 2793080229 234
898 iso_pu_bacteria 2874604998 2874606449 234
899 iso_pu_bacteria 2889033259 2889033803 234
900 iso_pu_bacteria 2903768456 2903771445 234
901 iso_pu_bacteria 2922361189 2922367203 234
902 iso_pu_bacteria 2922386360 2922390070 234
903 iso_pu_bacteria 8006964411 8006966721 234
904 iso_pu_bacteria 8006984368 8006989640 234
905 iso_pu_bacteria 8006994254 8006998023 234
906 iso_pu_bacteria 8056673599 8056675058 234
907 iso_pu_bacteria 8056681323 8056681855 234
908 iso_pu_bacteria 8056689827 8056696253 234
909 3300005336 Ga0070680_100308636 Ga0070680_1003086361 235
910 3300005458 Ga0070681_10295193 Ga0070681_102951932 235
911 3300005547 Ga0070693_100372648 Ga0070693_1003726481 235
912 3300005842 Ga0068858_100476957 Ga0068858_1004769572 235
913 3300009545 Ga0105237_10031990 Ga0105237_1003199010 235
914 3300009551 Ga0105238_10071229 Ga0105238_100712294 235
915 3300009551 Ga0105238_10112637 Ga0105238_101126371 235
916 3300025904 Ga0207647_10128573 Ga0207647_101285732 235
917 3300025912 Ga0207707_10427961 Ga0207707_104279612 235
918 3300026035 Ga0207703_10104559 Ga0207703_101045592 235
919 3300037312 Ga0395899_0050606 Ga0395899_0050606_97_810 235
920 3300039437 Ga0436365_0108820 Ga0436365_0108820_2873_3583 235
921 3300039437 Ga0436365_1361824 Ga0436365_1361824_255_965 235
922 3300048910 Ga0496107_0033816 Ga0496107_0033816_1385_2101 235
923 3300048924 Ga0496121_0001057 Ga0496121_0001057_410_1414 235
924 3300048929 Ga0496126_0018583 Ga0496126_0018583_4203_4919 235
925 3300049580 Ga0501046_0326812 Ga0501046_0326812_283_1041 235
926 3300005329 Ga0070683_100353009 Ga0070683_1003530092 236
927 3300005336 Ga0070680_100088017 Ga0070680_1000880174 236
928 3300005337 Ga0070682_100025295 Ga0070682_1000252952 236
929 3300005344 Ga0070661_100353940 Ga0070661_1003539402 236
930 3300005434 Ga0070709_10005526 Ga0070709_100055261 236
931 3300005434 Ga0070709_10171116 Ga0070709_101711162 236
932 3300005435 Ga0070714_100081991 Ga0070714_1000819913 236
933 3300005436 Ga0070713_100130356 Ga0070713_1001303562 236
934 3300005439 Ga0070711_100007048 Ga0070711_1000070485 236
935 3300005455 Ga0070663_100422958 Ga0070663_1004229582 236
936 3300005539 Ga0068853_100387662 Ga0068853_1003876621 236
937 3300005539 Ga0068853_100540120 Ga0068853_1005401202 236
938 3300005548 Ga0070665_100148314 Ga0070665_1001483143 236
939 3300005548 Ga0070665_100171758 Ga0070665_1001717582 236
940 3300005563 Ga0068855_100059386 Ga0068855_1000593862 236
941 3300005578 Ga0068854_100151272 Ga0068854_1001512721 236
942 3300005834 Ga0068851_10244567 Ga0068851_102445672 236
943 3300006173 Ga0070716_100141225 Ga0070716_1001412252 236
944 3300006175 Ga0070712_100857464 Ga0070712_1008574641 236
945 3300009093 Ga0105240_10098710 Ga0105240_100987102 236
946 3300009093 Ga0105240_10574421 Ga0105240_105744211 236
947 3300009174 Ga0105241_10050926 Ga0105241_100509263 236
948 3300009545 Ga0105237_10041954 Ga0105237_100419545 236
949 3300009545 Ga0105237_10150599 Ga0105237_101505992 236
950 3300009551 Ga0105238_10030444 Ga0105238_100304448 236
951 3300009551 Ga0105238_10108125 Ga0105238_101081252 236
952 3300013296 Ga0157374_10047182 Ga0157374_100471825 236
953 3300021377 Ga0213874_10013003 Ga0213874_100130033 236
954 3300021377 Ga0213874_10103166 Ga0213874_101031661 236
955 3300021388 Ga0213875_10097599 Ga0213875_100975991 236
956 3300021441 Ga0213871_10016627 Ga0213871_100166273 236
957 3300022467 Ga0224712_10064366 Ga0224712_100643661 236
958 3300022467 Ga0224712_10070990 Ga0224712_100709901 236
959 3300025906 Ga0207699_10035636 Ga0207699_100356365 236
960 3300025906 Ga0207699_10412455 Ga0207699_104124552 236
961 3300025912 Ga0207707_10000827 Ga0207707_1000082716 236
962 3300025914 Ga0207671_10072431 Ga0207671_100724312 236
963 3300025914 Ga0207671_10096180 Ga0207671_100961804 236
964 3300025916 Ga0207663_10184937 Ga0207663_101849372 236
965 3300025921 Ga0207652_10483385 Ga0207652_104833851 236
966 3300025924 Ga0207694_10057271 Ga0207694_100572713 236
967 3300025924 Ga0207694_10150477 Ga0207694_101504772 236
968 3300025939 Ga0207665_10174494 Ga0207665_101744942 236
969 3300025944 Ga0207661_10001422 Ga0207661_100014222 236
970 3300025944 Ga0207661_10122812 Ga0207661_101228124 236
971 3300026041 Ga0207639_10631308 Ga0207639_106313081 236
972 3300026041 Ga0207639_10943170 Ga0207639_109431701 236
973 3300028379 Ga0268266_10317439 Ga0268266_103174391 236
974 3300031249 Ga0265339_10001394 Ga0265339_1000139411 236
975 3300031711 Ga0265314_10157186 Ga0265314_101571862 236
976 3300035083 Ga0373926_0055251 Ga0373926_0055251_669_1382 236
977 3300035111 Ga0373923_0079043 Ga0373923_0079043_530_1243 236
978 3300035113 Ga0373936_0008700 Ga0373936_0008700_137_850 236
979 3300035116 Ga0373945_0097535 Ga0373945_0097535_399_1112 236
980 3300035117 Ga0373953_0011700 Ga0373953_0011700_686_1399 236
981 3300035119 Ga0373956_0108293 Ga0373956_0108293_480_1193 236
982 3300035120 Ga0373957_0202208 Ga0373957_0202208_27_740 236
983 3300035170 Ga0373943_0169966 Ga0373943_0169966_50_763 236
984 3300035171 Ga0373946_0079414 Ga0373946_0079414_407_1120 236
985 3300035692 Ga0373935_0048301 Ga0373935_0048301_1734_2447 236
986 3300035695 Ga0373927_0174958 Ga0373927_0174958_124_837 236
987 3300035724 Ga0373933_0342226 Ga0373933_0342226_161_874 236
988 3300035725 Ga0373947_0066850 Ga0373947_0066850_804_1517 236
989 3300036401 Ga0373937_0232745 Ga0373937_0232745_337_1050 236
990 3300036401 Ga0373937_0798680 Ga0373937_0798680_102_815 236
991 3300037418 Ga0395900_0009563 Ga0395900_0009563_5859_6572 236
992 3300037466 Ga0395898_0051337 Ga0395898_0051337_2913_3626 236
993 3300039438 Ga0436360_0582206 Ga0436360_0582206_1241_1954 236
994 3300039438 Ga0436360_0620676 Ga0436360_0620676_110_823 236
995 3300039447 Ga0436361_0568203 Ga0436361_0568203_156_869 236
996 3300039450 Ga0436363_0827034 Ga0436363_0827034_3169_3882 236
997 3300039450 Ga0436363_1336752 Ga0436363_1336752_90_803 236
998 3300044693 Ga0466961_0042051 Ga0466961_0042051_768_1481 236
999 3300044694 Ga0466963_0454104 Ga0466963_0454104_83_796 236
1000 3300044765 Ga0466970_0353401 Ga0466970_0353401_25_738 236
1001 3300045049 Ga0466959_0045853 Ga0466959_0045853_1244_1957 236
1002 3300045976 Ga0466967_0353595 Ga0466967_0353595_274_990 236
1003 3300046455 Ga0495603_0129051 Ga0495603_0129051_622_1335 236
1004 3300046463 Ga0495653_0166213 Ga0495653_0166213_558_1271 236
1005 3300046472 Ga0495580_0041291 Ga0495580_0041291_654_1367 236
1006 3300046473 Ga0495582_0169322 Ga0495582_0169322_420_1133 236
1007 3300046475 Ga0495639_0184197 Ga0495639_0184197_233_946 236
1008 3300046477 Ga0495664_0038112 Ga0495664_0038112_1858_2571 236
1009 3300046512 Ga0495610_0129064 Ga0495610_0129064_224_937 236
1010 3300046516 Ga0495628_0239962 Ga0495628_0239962_177_890 236
1011 3300046517 Ga0495630_0096705 Ga0495630_0096705_959_1672 236
1012 3300046529 Ga0495652_0031369 Ga0495652_0031369_311_1024 236
1013 3300046529 Ga0495652_0275783 Ga0495652_0275783_277_990 236
1014 3300046531 Ga0495665_0017301 Ga0495665_0017301_1245_1958 236
1015 3300046559 Ga0495667_0038192 Ga0495667_0038192_258_971 236
1016 3300046663 Ga0495635_0178771 Ga0495635_0178771_573_1286 236
1017 3300046680 Ga0495646_0049680 Ga0495646_0049680_363_1076 236
1018 3300046681 Ga0495647_0016960 Ga0495647_0016960_1842_2555 236
1019 3300046683 Ga0495658_0007033 Ga0495658_0007033_4498_5211 236
1020 3300046690 Ga0495624_0053556 Ga0495624_0053556_985_1698 236
1021 3300047315 Ga0495581_0025894 Ga0495581_0025894_2338_3051 236
1022 3300047317 Ga0495604_0147868 Ga0495604_0147868_427_1140 236
1023 3300047319 Ga0495674_0074047 Ga0495674_0074047_199_912 236
1024 3300047321 Ga0495676_0111442 Ga0495676_0111442_849_1562 236
1025 3300048917 Ga0496114_0118920 Ga0496114_0118920_1023_1736 236
1026 3300048925 Ga0496122_0057569 Ga0496122_0057569_1459_2172 236
1027 3300048929 Ga0496126_0312937 Ga0496126_0312937_28_741 236
1028 3300049571 Ga0501034_0024633 Ga0501034_0024633_2885_3610 236
1029 3300049574 Ga0501038_0074567 Ga0501038_0074567_548_1273 236
1030 3300049586 Ga0501070_0042138 Ga0501070_0042138_2582_3295 236
1031 3300049742 Ga0501080_0083252 Ga0501080_0083252_1542_2255 236
1032 3300049822 Ga0501035_0373790 Ga0501035_0373790_424_1149 236
1033 3300053077 Ga0495601_0134564 Ga0495601_0134564_883_1596 236
1034 3300053077 Ga0495601_0209693 Ga0495601_0209693_97_810 236
1035 3300053078 Ga0495612_0040544 Ga0495612_0040544_270_983 236
1036 3300053078 Ga0495612_0076464 Ga0495612_0076464_263_976 236
1037 3300053085 Ga0495619_0063210 Ga0495619_0063210_285_998 236
1038 3300061719 Ga0466962_0067990 Ga0466962_0067990_259_972 236
1039 3300001979 JGI24740J21852_10000767 JGI24740J21852_1000076713 237
1040 3300002737 JGI25162J39368_1000277 JGI25162J39368_100027745 237
1041 3300002987 JGI25159J45721_1001498 JGI25159J45721_10014987 237
1042 3300003162 Ga0006778J45830_1037934 Ga0006778J45830_10379341 237
1043 3300003203 JGI25406J46586_10000042 JGI25406J46586_100000423 237
1044 3300003203 JGI25406J46586_10001462 JGI25406J46586_1000146211 237
1045 3300003214 JGI25165J46597_1003489 JGI25165J46597_10034892 237
1046 3300003659 JGI25404J52841_10058120 JGI25404J52841_100581201 237
1047 3300004798 Ga0058859_11354442 Ga0058859_113544422 237
1048 3300005365 Ga0070688_100154951 Ga0070688_1001549512 237
1049 3300005366 Ga0070659_100330430 Ga0070659_1003304302 237
1050 3300005366 Ga0070659_100691825 Ga0070659_1006918251 237
1051 3300005434 Ga0070709_10010952 Ga0070709_100109523 237
1052 3300005435 Ga0070714_100002233 Ga0070714_10000223312 237
1053 3300005437 Ga0070710_10000549 Ga0070710_1000054917 237
1054 3300005439 Ga0070711_100017942 Ga0070711_1000179423 237
1055 3300005439 Ga0070711_100069372 Ga0070711_1000693722 237
1056 3300005456 Ga0070678_100047311 Ga0070678_1000473112 237
1057 3300005466 Ga0070685_10168476 Ga0070685_101684761 237
1058 3300005467 Ga0070706_100158402 Ga0070706_1001584023 237
1059 3300005548 Ga0070665_100026397 Ga0070665_1000263975 237
1060 3300005548 Ga0070665_100153970 Ga0070665_1001539704 237
1061 3300005985 Ga0081539_10000099 Ga0081539_10000099139 237
1062 3300006028 Ga0070717_10063343 Ga0070717_100633432 237
1063 3300006038 Ga0075365_10059515 Ga0075365_100595153 237
1064 3300006048 Ga0075363_100049181 Ga0075363_1000491815 237
1065 3300006051 Ga0075364_10121089 Ga0075364_101210892 237
1066 3300006163 Ga0070715_10001749 Ga0070715_100017492 237
1067 3300006173 Ga0070716_100005320 Ga0070716_1000053202 237
1068 3300006173 Ga0070716_100033588 Ga0070716_1000335883 237
1069 3300006178 Ga0075367_10011261 Ga0075367_100112613 237
1070 3300006186 Ga0075369_10061887 Ga0075369_100618871 237
1071 3300006353 Ga0075370_10043189 Ga0075370_100431892 237
1072 3300009093 Ga0105240_10146636 Ga0105240_101466362 237
1073 3300009101 Ga0105247_10363603 Ga0105247_103636031 237
1074 3300009545 Ga0105237_10442143 Ga0105237_104421432 237
1075 3300009551 Ga0105238_10128331 Ga0105238_101283312 237
1076 3300010375 Ga0105239_10567219 Ga0105239_105672191 237
1077 3300013102 Ga0157371_10024676 Ga0157371_100246762 237
1078 3300013104 Ga0157370_10029467 Ga0157370_100294673 237
1079 3300013296 Ga0157374_10347474 Ga0157374_103474742 237
1080 3300013307 Ga0157372_10108336 Ga0157372_101083363 237
1081 3300014325 Ga0163163_10033749 Ga0163163_100337496 237
1082 3300014325 Ga0163163_10878467 Ga0163163_108784671 237
1083 3300025898 Ga0207692_10001489 Ga0207692_100014898 237
1084 3300025905 Ga0207685_10003252 Ga0207685_100032522 237
1085 3300025906 Ga0207699_10006246 Ga0207699_100062466 237
1086 3300025915 Ga0207693_10000565 Ga0207693_1000056527 237
1087 3300025916 Ga0207663_10003532 Ga0207663_100035328 237
1088 3300025916 Ga0207663_10248595 Ga0207663_102485951 237
1089 3300025928 Ga0207700_10003591 Ga0207700_100035913 237
1090 3300025939 Ga0207665_10000127 Ga0207665_1000012726 237
1091 3300025939 Ga0207665_10029628 Ga0207665_100296283 237
1092 3300026121 Ga0207683_10307777 Ga0207683_103077773 237
1093 3300026142 Ga0207698_10103666 Ga0207698_101036662 237
1094 3300031730 Ga0307516_10035746 Ga0307516_100357463 237
1095 3300035170 Ga0373943_0033966 Ga0373943_0033966_593_1309 237
1096 3300035691 Ga0373931_0045065 Ga0373931_0045065_1411_2127 237
1097 3300035691 Ga0373931_0464179 Ga0373931_0464179_84_800 237
1098 3300035695 Ga0373927_0017005 Ga0373927_0017005_3794_4510 237
1099 3300035725 Ga0373947_0159889 Ga0373947_0159889_304_1020 237
1100 3300037068 Ga0373925_0023145 Ga0373925_0023145_2988_3704 237
1101 3300037466 Ga0395898_0040500 Ga0395898_0040500_1602_2339 237
1102 3300038443 Ga0395901_0437762 Ga0395901_0437762_52_768 237
1103 3300044765 Ga0466970_0012632 Ga0466970_0012632_1527_2279 237
1104 3300046455 Ga0495603_0083049 Ga0495603_0083049_152_868 237
1105 3300046460 Ga0495638_0022023 Ga0495638_0022023_185_901 237
1106 3300046512 Ga0495610_0031207 Ga0495610_0031207_1417_2133 237
1107 3300046518 Ga0495631_0025217 Ga0495631_0025217_585_1301 237
1108 3300046519 Ga0495632_0111837 Ga0495632_0111837_540_1256 237
1109 3300046520 Ga0495637_0031199 Ga0495637_0031199_255_971 237
1110 3300046522 Ga0495643_0036114 Ga0495643_0036114_961_1677 237
1111 3300046557 Ga0495622_0009802 Ga0495622_0009802_2194_2910 237
1112 3300046674 Ga0495588_0208071 Ga0495588_0208071_169_885 237
1113 3300047472 Ga0495686_0018504 Ga0495686_0018504_3013_3729 237
1114 3300047472 Ga0495686_0060450 Ga0495686_0060450_1028_1744 237
1115 3300048905 Ga0496102_0052153 Ga0496102_0052153_376_1092 237
1116 3300048905 Ga0496102_0310543 Ga0496102_0310543_638_1453 237
1117 3300048906 Ga0496103_0451226 Ga0496103_0451226_92_808 237
1118 3300048907 Ga0496104_0011964 Ga0496104_0011964_4618_5334 237
1119 3300048908 Ga0496105_0110603 Ga0496105_0110603_456_1172 237
1120 3300048910 Ga0496107_0083233 Ga0496107_0083233_1135_1851 237
1121 3300048911 Ga0496108_0270666 Ga0496108_0270666_428_1144 237
1122 3300048911 Ga0496108_0743687 Ga0496108_0743687_62_778 237
1123 3300048912 Ga0496109_0022973 Ga0496109_0022973_2724_3440 237
1124 3300048912 Ga0496109_0387945 Ga0496109_0387945_414_1130 237
1125 3300048913 Ga0496110_0379849 Ga0496110_0379849_447_1163 237
1126 3300048915 Ga0496112_0000052 Ga0496112_0000052_10872_11588 237
1127 3300048915 Ga0496112_0038470 Ga0496112_0038470_1196_1912 237
1128 3300048915 Ga0496112_0125607 Ga0496112_0125607_479_1195 237
1129 3300048916 Ga0496113_0159709 Ga0496113_0159709_463_1179 237
1130 3300048916 Ga0496113_0490827 Ga0496113_0490827_223_939 237
1131 3300048916 Ga0496113_0759438 Ga0496113_0759438_41_757 237
1132 3300048918 Ga0496115_0185245 Ga0496115_0185245_304_1020 237
1133 3300048919 Ga0496116_0005214 Ga0496116_0005214_2155_2871 237
1134 3300048920 Ga0496117_0016824 Ga0496117_0016824_20_736 237
1135 3300048922 Ga0496119_0201349 Ga0496119_0201349_167_883 237
1136 3300048924 Ga0496121_0017186 Ga0496121_0017186_6310_7026 237
1137 3300048927 Ga0496124_0127208 Ga0496124_0127208_660_1379 237
1138 3300048928 Ga0496125_0015170 Ga0496125_0015170_1337_2053 237
1139 3300048928 Ga0496125_0276335 Ga0496125_0276335_103_822 237
1140 3300049568 Ga0501031_0000655 Ga0501031_0000655_6233_6952 237
1141 3300049568 Ga0501031_0001803 Ga0501031_0001803_9591_10310 237
1142 3300049569 Ga0501032_0000161 Ga0501032_0000161_47777_48496 237
1143 3300049570 Ga0501033_0000672 Ga0501033_0000672_23258_23977 237
1144 3300049570 Ga0501033_0001580 Ga0501033_0001580_15584_16303 237
1145 3300049571 Ga0501034_0000072 Ga0501034_0000072_87581_88300 237
1146 3300049572 Ga0501036_0000250 Ga0501036_0000250_28839_29558 237
1147 3300049573 Ga0501037_0000030 Ga0501037_0000030_93064_93783 237
1148 3300049573 Ga0501037_0001059 Ga0501037_0001059_5271_5990 237
1149 3300049574 Ga0501038_0000826 Ga0501038_0000826_21835_22554 237
1150 3300049574 Ga0501038_0057490 Ga0501038_0057490_2077_2796 237
1151 3300049575 Ga0501039_0012015 Ga0501039_0012015_4740_5459 237
1152 3300049577 Ga0501041_0151158 Ga0501041_0151158_375_1094 237
1153 3300049578 Ga0501042_0073646 Ga0501042_0073646_1617_2336 237
1154 3300049579 Ga0501043_0000357 Ga0501043_0000357_8198_8917 237
1155 3300049579 Ga0501043_0023451 Ga0501043_0023451_1267_1986 237
1156 3300049580 Ga0501046_0023974 Ga0501046_0023974_1957_2676 237
1157 3300049580 Ga0501046_0091706 Ga0501046_0091706_1268_1987 237
1158 3300049581 Ga0501047_0001531 Ga0501047_0001531_20491_21210 237
1159 3300049581 Ga0501047_0208882 Ga0501047_0208882_478_1197 237
1160 3300049582 Ga0501048_0000477 Ga0501048_0000477_7469_8188 237
1161 3300049583 Ga0501067_0000068 Ga0501067_0000068_15277_15996 237
1162 3300049584 Ga0501068_0001116 Ga0501068_0001116_13343_14062 237
1163 3300049586 Ga0501070_0002354 Ga0501070_0002354_9236_9955 237
1164 3300049588 Ga0501072_0000835 Ga0501072_0000835_8672_9391 237
1165 3300049589 Ga0501073_0000009 Ga0501073_0000009_103406_104125 237
1166 3300049590 Ga0501074_0000716 Ga0501074_0000716_2908_3627 237
1167 3300049741 Ga0501079_0000251 Ga0501079_0000251_27357_28076 237
1168 3300049742 Ga0501080_0004321 Ga0501080_0004321_5581_6300 237
1169 3300049744 Ga0501083_0039237 Ga0501083_0039237_151_870 237
1170 3300049822 Ga0501035_0000067 Ga0501035_0000067_25023_25742 237
1171 3300049822 Ga0501035_0035252 Ga0501035_0035252_1746_2465 237
1172 3300049822 Ga0501035_0329252 Ga0501035_0329252_66_785 237
1173 3300049823 Ga0501044_0002804 Ga0501044_0002804_4041_4760 237
1174 3300049823 Ga0501044_0064150 Ga0501044_0064150_2302_3021 237
1175 3300049823 Ga0501044_0142659 Ga0501044_0142659_621_1340 237
1176 3300049824 Ga0501045_0164291 Ga0501045_0164291_234_953 237
1177 3300050491 nmdc:mga00v17_26685_c1 nmdc:mga00v17_26685_c1_2004_2720 237
1178 3300050494 nmdc:mga06z11_100307_c1 nmdc:mga06z11_100307_c1_110_826 237
1179 3300050494 nmdc:mga06z11_21201_c1 nmdc:mga06z11_21201_c1_1345_2061 237
1180 3300050516 nmdc:mga0sz30_10116_c1 nmdc:mga0sz30_10116_c1_1492_2208 237
1181 3300053088 Ga0500644_0008381 Ga0500644_0008381_913_1629 237
1182 3300053093 Ga0500651_0071542 Ga0500651_0071542_939_1655 237
1183 3300053094 Ga0500566_0000751 Ga0500566_0000751_14902_15618 237
1184 3300053096 Ga0500641_0001845 Ga0500641_0001845_994_1710 237
1185 3300053098 Ga0500650_0004589 Ga0500650_0004589_3866_4582 237
1186 3300053104 Ga0500556_0000238 Ga0500556_0000238_14095_14811 237
1187 3300053108 Ga0500562_038244 Ga0500562_038244_223_939 237
1188 3300053116 Ga0500592_000799 Ga0500592_000799_1218_1934 237
1189 3300053122 Ga0500608_004588 Ga0500608_004588_4140_4856 237
1190 3300053125 Ga0500618_032582 Ga0500618_032582_112_828 237
1191 3300053130 Ga0500642_0000092 Ga0500642_0000092_5621_6337 237
1192 3300053131 Ga0500652_001613 Ga0500652_001613_2738_3454 237
1193 3300053136 Ga0500559_0000492 Ga0500559_0000492_21477_22193 237
1194 3300053139 Ga0500568_0002222 Ga0500568_0002222_5885_6601 237
1195 3300053142 Ga0500577_0000135 Ga0500577_0000135_6476_7192 237
1196 3300053148 Ga0500590_091519 Ga0500590_091519_525_1241 237
1197 3300053153 Ga0500616_0000197 Ga0500616_0000197_42565_43281 237
1198 3300053156 Ga0500622_0000966 Ga0500622_0000966_19526_20242 237
1199 3300053161 Ga0500634_0012476 Ga0500634_0012476_383_1099 237
1200 3300053177 Ga0500636_0026379 Ga0500636_0026379_1989_2705 237
1201 3300053178 Ga0500637_0094288 Ga0500637_0094288_603_1319 237
1202 3300054114 Ga0501084_0012720 Ga0501084_0012720_1671_2390 237
1203 3300060353 Ga0501082_0008921 Ga0501082_0008921_1675_2394 237
1204 3300000549 LJQas_1006154 LJQas_10061541 238
1205 3300003659 JGI25404J52841_10016701 JGI25404J52841_100167011 238
1206 3300004800 Ga0058861_12010056 Ga0058861_120100561 238
1207 3300005336 Ga0070680_100011514 Ga0070680_1000115145 238
1208 3300005338 Ga0068868_100288646 Ga0068868_1002886462 238
1209 3300005339 Ga0070660_100359116 Ga0070660_1003591162 238
1210 3300005341 Ga0070691_10062835 Ga0070691_100628352 238
1211 3300005347 Ga0070668_100034676 Ga0070668_1000346762 238
1212 3300005347 Ga0070668_100312648 Ga0070668_1003126481 238
1213 3300005356 Ga0070674_100097673 Ga0070674_1000976732 238
1214 3300005366 Ga0070659_100214544 Ga0070659_1002145443 238
1215 3300005436 Ga0070713_100004820 Ga0070713_1000048209 238
1216 3300005436 Ga0070713_100058748 Ga0070713_1000587485 238
1217 3300005441 Ga0070700_100069003 Ga0070700_1000690032 238
1218 3300005455 Ga0070663_100326240 Ga0070663_1003262402 238
1219 3300005456 Ga0070678_100041320 Ga0070678_1000413203 238
1220 3300005457 Ga0070662_100712441 Ga0070662_1007124411 238
1221 3300005535 Ga0070684_100010958 Ga0070684_1000109583 238
1222 3300005539 Ga0068853_100011007 Ga0068853_1000110071 238
1223 3300005548 Ga0070665_100143198 Ga0070665_1001431983 238
1224 3300005563 Ga0068855_100155264 Ga0068855_1001552642 238
1225 3300005563 Ga0068855_100235166 Ga0068855_1002351661 238
1226 3300005563 Ga0068855_100291329 Ga0068855_1002913293 238
1227 3300005577 Ga0068857_100049570 Ga0068857_1000495707 238
1228 3300005614 Ga0068856_100188069 Ga0068856_1001880693 238
1229 3300005616 Ga0068852_100038969 Ga0068852_1000389693 238
1230 3300005718 Ga0068866_10111408 Ga0068866_101114082 238
1231 3300005719 Ga0068861_100168874 Ga0068861_1001688742 238
1232 3300005834 Ga0068851_10011299 Ga0068851_100112992 238
1233 3300005843 Ga0068860_100153346 Ga0068860_1001533463 238
1234 3300005844 Ga0068862_100105017 Ga0068862_1001050172 238
1235 3300005937 Ga0081455_10012165 Ga0081455_100121656 238
1236 3300005983 Ga0081540_1011157 Ga0081540_10111576 238
1237 3300006028 Ga0070717_10000884 Ga0070717_1000088419 238
1238 3300006028 Ga0070717_10003176 Ga0070717_1000317610 238
1239 3300006173 Ga0070716_100434674 Ga0070716_1004346742 238
1240 3300006177 Ga0075362_10047595 Ga0075362_100475952 238
1241 3300006178 Ga0075367_10028491 Ga0075367_100284912 238
1242 3300009093 Ga0105240_10025997 Ga0105240_1002599710 238
1243 3300009094 Ga0111539_10392146 Ga0111539_103921462 238
1244 3300009176 Ga0105242_10237267 Ga0105242_102372672 238
1245 3300009176 Ga0105242_10406877 Ga0105242_104068771 238
1246 3300009545 Ga0105237_10049749 Ga0105237_100497493 238
1247 3300009551 Ga0105238_10016659 Ga0105238_100166593 238
1248 3300009551 Ga0105238_10178649 Ga0105238_101786492 238
1249 3300013105 Ga0157369_10014664 Ga0157369_1001466411 238
1250 3300013296 Ga0157374_10007888 Ga0157374_100078889 238
1251 3300013306 Ga0163162_10315157 Ga0163162_103151572 238
1252 3300013308 Ga0157375_10119355 Ga0157375_101193552 238
1253 3300014326 Ga0157380_10858932 Ga0157380_108589322 238
1254 3300014968 Ga0157379_10789002 Ga0157379_107890021 238
1255 3300017792 Ga0163161_10071147 Ga0163161_100711472 238
1256 3300020069 Ga0197907_11371172 Ga0197907_113711722 238
1257 3300020070 Ga0206356_10790464 Ga0206356_107904643 238
1258 3300021377 Ga0213874_10078758 Ga0213874_100787582 238
1259 3300025254 Ga0209148_1023204 Ga0209148_10232041 238
1260 3300025272 Ga0209455_1004740 Ga0209455_10047403 238
1261 3300025297 Ga0209758_1002945 Ga0209758_100294512 238
1262 3300025321 Ga0207656_10020378 Ga0207656_100203783 238
1263 3300025899 Ga0207642_10143416 Ga0207642_101434161 238
1264 3300025904 Ga0207647_10215618 Ga0207647_102156182 238
1265 3300025912 Ga0207707_10002566 Ga0207707_100025668 238
1266 3300025913 Ga0207695_10284239 Ga0207695_102842392 238
1267 3300025914 Ga0207671_10035618 Ga0207671_100356186 238
1268 3300025916 Ga0207663_10180633 Ga0207663_101806332 238
1269 3300025917 Ga0207660_10001934 Ga0207660_1000193411 238
1270 3300025919 Ga0207657_10001315 Ga0207657_1000131515 238
1271 3300025919 Ga0207657_10238645 Ga0207657_102386452 238
1272 3300025921 Ga0207652_10001089 Ga0207652_100010895 238
1273 3300025928 Ga0207700_10001452 Ga0207700_1000145211 238
1274 3300025932 Ga0207690_10047179 Ga0207690_100471791 238
1275 3300025935 Ga0207709_10127840 Ga0207709_101278401 238
1276 3300025939 Ga0207665_10154968 Ga0207665_101549682 238
1277 3300025940 Ga0207691_10077623 Ga0207691_100776234 238
1278 3300025942 Ga0207689_10070761 Ga0207689_100707614 238
1279 3300025944 Ga0207661_10235943 Ga0207661_102359433 238
1280 3300025949 Ga0207667_10012575 Ga0207667_100125759 238
1281 3300025949 Ga0207667_10072969 Ga0207667_100729696 238
1282 3300025949 Ga0207667_10147895 Ga0207667_101478953 238
1283 3300025972 Ga0207668_10186470 Ga0207668_101864702 238
1284 3300026041 Ga0207639_10038223 Ga0207639_100382232 238
1285 3300026067 Ga0207678_10085373 Ga0207678_100853732 238
1286 3300026067 Ga0207678_10110846 Ga0207678_101108462 238
1287 3300026075 Ga0207708_10269013 Ga0207708_102690131 238
1288 3300026078 Ga0207702_10411177 Ga0207702_104111771 238
1289 3300026089 Ga0207648_10026143 Ga0207648_100261434 238
1290 3300026116 Ga0207674_10021123 Ga0207674_100211239 238
1291 3300026118 Ga0207675_100033884 Ga0207675_1000338843 238
1292 3300026121 Ga0207683_10042552 Ga0207683_100425522 238
1293 3300026121 Ga0207683_10106205 Ga0207683_101062053 238
1294 3300026142 Ga0207698_10503482 Ga0207698_105034822 238
1295 3300027907 Ga0207428_10098549 Ga0207428_100985492 238
1296 3300028379 Ga0268266_10062975 Ga0268266_100629753 238
1297 3300028380 Ga0268265_10218137 Ga0268265_102181371 238
1298 3300028381 Ga0268264_10067965 Ga0268264_100679653 238
1299 3300028573 Ga0265334_10024228 Ga0265334_100242283 238
1300 3300028786 Ga0307517_10000124 Ga0307517_1000012491 238
1301 3300028794 Ga0307515_10009381 Ga0307515_1000938112 238
1302 3300031250 Ga0265331_10102459 Ga0265331_101024592 238
1303 3300031456 Ga0307513_10153193 Ga0307513_101531932 238
1304 3300031711 Ga0265314_10002593 Ga0265314_100025935 238
1305 3300031712 Ga0265342_10063479 Ga0265342_100634792 238
1306 3300031712 Ga0265342_10146097 Ga0265342_101460971 238
1307 3300031815 Ga0316045_107024 Ga0316045_1070243 238
1308 3300035086 Ga0373934_0016039 Ga0373934_0016039_295_1014 238
1309 3300035117 Ga0373953_0017203 Ga0373953_0017203_257_976 238
1310 3300035118 Ga0373954_0002485 Ga0373954_0002485_1318_2037 238
1311 3300035118 Ga0373954_0002626 Ga0373954_0002626_3410_4129 238
1312 3300035119 Ga0373956_0064383 Ga0373956_0064383_373_1092 238
1313 3300035120 Ga0373957_0007070 Ga0373957_0007070_173_892 238
1314 3300035170 Ga0373943_0023109 Ga0373943_0023109_385_1104 238
1315 3300035172 Ga0373955_0003095 Ga0373955_0003095_4014_4733 238
1316 3300035172 Ga0373955_0029659 Ga0373955_0029659_1569_2288 238
1317 3300035410 Ga0373924_0007214 Ga0373924_0007214_1655_2374 238
1318 3300035410 Ga0373924_0011253 Ga0373924_0011253_1067_1786 238
1319 3300035410 Ga0373924_0144945 Ga0373924_0144945_38_757 238
1320 3300035692 Ga0373935_0002137 Ga0373935_0002137_10147_10866 238
1321 3300035692 Ga0373935_0213405 Ga0373935_0213405_322_1041 238
1322 3300035695 Ga0373927_0012355 Ga0373927_0012355_1155_1874 238
1323 3300035695 Ga0373927_0019441 Ga0373927_0019441_2119_2838 238
1324 3300035724 Ga0373933_0001835 Ga0373933_0001835_1067_1786 238
1325 3300035724 Ga0373933_0006528 Ga0373933_0006528_2048_2767 238
1326 3300035724 Ga0373933_0009573 Ga0373933_0009573_1807_2526 238
1327 3300035725 Ga0373947_0054441 Ga0373947_0054441_1617_2336 238
1328 3300037068 Ga0373925_0001877 Ga0373925_0001877_13275_13994 238
1329 3300039438 Ga0436360_0701610 Ga0436360_0701610_1033_1752 238
1330 3300039450 Ga0436363_1697773 Ga0436363_1697773_2609_3328 238
1331 3300041460 Ga0451802_0169913 Ga0451802_0169913_219_938 238
1332 3300044719 Ga0466971_0274903 Ga0466971_0274903_32_754 238
1333 3300045049 Ga0466959_0450840 Ga0466959_0450840_28_750 238
1334 3300045976 Ga0466967_0082354 Ga0466967_0082354_516_1235 238
1335 3300046454 Ga0495592_0006884 Ga0495592_0006884_2168_2887 238
1336 3300046454 Ga0495592_0080289 Ga0495592_0080289_82_801 238
1337 3300046455 Ga0495603_0005432 Ga0495603_0005432_2287_3006 238
1338 3300046459 Ga0495629_0000532 Ga0495629_0000532_8525_9244 238
1339 3300046459 Ga0495629_0013169 Ga0495629_0013169_1262_1981 238
1340 3300046461 Ga0495641_0008153 Ga0495641_0008153_5368_6087 238
1341 3300046462 Ga0495651_0068600 Ga0495651_0068600_367_1086 238
1342 3300046462 Ga0495651_0149459 Ga0495651_0149459_588_1307 238
1343 3300046462 Ga0495651_0302379 Ga0495651_0302379_22_741 238
1344 3300046463 Ga0495653_0010069 Ga0495653_0010069_1318_2037 238
1345 3300046472 Ga0495580_0056230 Ga0495580_0056230_1470_2189 238
1346 3300046473 Ga0495582_0000331 Ga0495582_0000331_23891_24610 238
1347 3300046474 Ga0495605_0161109 Ga0495605_0161109_82_801 238
1348 3300046475 Ga0495639_0000147 Ga0495639_0000147_11591_12310 238
1349 3300046476 Ga0495662_0000716 Ga0495662_0000716_13348_14067 238
1350 3300046477 Ga0495664_0005574 Ga0495664_0005574_4435_5154 238
1351 3300046499 Ga0495594_0000113 Ga0495594_0000113_23846_24565 238
1352 3300046511 Ga0495608_0004537 Ga0495608_0004537_71_790 238
1353 3300046511 Ga0495608_0009049 Ga0495608_0009049_3743_4462 238
1354 3300046514 Ga0495618_0010718 Ga0495618_0010718_3936_4655 238
1355 3300046514 Ga0495618_0016158 Ga0495618_0016158_3794_4513 238
1356 3300046516 Ga0495628_0001092 Ga0495628_0001092_21680_22399 238
1357 3300046516 Ga0495628_0062677 Ga0495628_0062677_387_1106 238
1358 3300046516 Ga0495628_0245717 Ga0495628_0245717_61_780 238
1359 3300046517 Ga0495630_0004274 Ga0495630_0004274_5544_6263 238
1360 3300046519 Ga0495632_0096435 Ga0495632_0096435_168_887 238
1361 3300046524 Ga0495648_0000776 Ga0495648_0000776_11272_11991 238
1362 3300046524 Ga0495648_0001514 Ga0495648_0001514_1521_2240 238
1363 3300046529 Ga0495652_0073625 Ga0495652_0073625_1339_2058 238
1364 3300046531 Ga0495665_0000291 Ga0495665_0000291_10089_10808 238
1365 3300046533 Ga0495640_0005851 Ga0495640_0005851_5730_6449 238
1366 3300046533 Ga0495640_0032424 Ga0495640_0032424_2431_3150 238
1367 3300046533 Ga0495640_0051488 Ga0495640_0051488_695_1414 238
1368 3300046536 Ga0495587_0018944 Ga0495587_0018944_1934_2653 238
1369 3300046536 Ga0495587_0021240 Ga0495587_0021240_1096_1815 238
1370 3300046543 Ga0495645_0037792 Ga0495645_0037792_2608_3327 238
1371 3300046557 Ga0495622_0004379 Ga0495622_0004379_976_1695 238
1372 3300046559 Ga0495667_0014817 Ga0495667_0014817_2503_3222 238
1373 3300046616 Ga0495668_0216692 Ga0495668_0216692_291_1010 238
1374 3300046642 Ga0495634_0003174 Ga0495634_0003174_11851_12570 238
1375 3300046642 Ga0495634_0011850 Ga0495634_0011850_2446_3165 238
1376 3300046663 Ga0495635_0000491 Ga0495635_0000491_20089_20808 238
1377 3300046663 Ga0495635_0007428 Ga0495635_0007428_953_1672 238
1378 3300046663 Ga0495635_0028493 Ga0495635_0028493_2431_3150 238
1379 3300046664 Ga0495659_0019004 Ga0495659_0019004_1126_1845 238
1380 3300046674 Ga0495588_0057864 Ga0495588_0057864_652_1371 238
1381 3300046675 Ga0495657_0011578 Ga0495657_0011578_2048_2767 238
1382 3300046675 Ga0495657_0021093 Ga0495657_0021093_2362_3081 238
1383 3300046675 Ga0495657_0176096 Ga0495657_0176096_253_972 238
1384 3300046678 Ga0495599_0019185 Ga0495599_0019185_3075_3794 238
1385 3300046678 Ga0495599_0122084 Ga0495599_0122084_721_1440 238
1386 3300046679 Ga0495623_0120508 Ga0495623_0120508_565_1284 238
1387 3300046680 Ga0495646_0031381 Ga0495646_0031381_1407_2126 238
1388 3300046680 Ga0495646_0040428 Ga0495646_0040428_1328_2047 238
1389 3300046681 Ga0495647_0007692 Ga0495647_0007692_743_1462 238
1390 3300046683 Ga0495658_0001211 Ga0495658_0001211_1117_1836 238
1391 3300046689 Ga0495613_0002051 Ga0495613_0002051_495_1214 238
1392 3300046689 Ga0495613_0104978 Ga0495613_0104978_219_938 238
1393 3300046689 Ga0495613_0109386 Ga0495613_0109386_49_768 238
1394 3300046689 Ga0495613_0249616 Ga0495613_0249616_168_887 238
1395 3300046690 Ga0495624_0008987 Ga0495624_0008987_3464_4183 238
1396 3300046809 Ga0495600_0008599 Ga0495600_0008599_3079_3798 238
1397 3300046809 Ga0495600_0103729 Ga0495600_0103729_796_1515 238
1398 3300047315 Ga0495581_0000620 Ga0495581_0000620_4275_4994 238
1399 3300047315 Ga0495581_0154759 Ga0495581_0154759_338_1057 238
1400 3300047315 Ga0495581_0229963 Ga0495581_0229963_149_868 238
1401 3300047317 Ga0495604_0005882 Ga0495604_0005882_6291_7010 238
1402 3300047319 Ga0495674_0001226 Ga0495674_0001226_4307_5026 238
1403 3300047319 Ga0495674_0111936 Ga0495674_0111936_217_936 238
1404 3300047321 Ga0495676_0044749 Ga0495676_0044749_1019_1738 238
1405 3300047322 Ga0495680_0095272 Ga0495680_0095272_168_887 238
1406 3300047444 Ga0495675_0005368 Ga0495675_0005368_1190_1909 238
1407 3300047471 Ga0495684_0000897 Ga0495684_0000897_19360_20079 238
1408 3300047471 Ga0495684_0052148 Ga0495684_0052148_1735_2454 238
1409 3300047471 Ga0495684_0172219 Ga0495684_0172219_585_1304 238
1410 3300047472 Ga0495686_0226041 Ga0495686_0226041_184_903 238
1411 3300047673 Ga0495593_0000389 Ga0495593_0000389_10704_11423 238
1412 3300048088 Ga0495602_0013144 Ga0495602_0013144_6561_7280 238
1413 3300048903 Ga0496100_0012832 Ga0496100_0012832_3687_4406 238
1414 3300048903 Ga0496100_0288218 Ga0496100_0288218_346_1065 238
1415 3300048903 Ga0496100_0305044 Ga0496100_0305044_31_750 238
1416 3300048906 Ga0496103_0425452 Ga0496103_0425452_14_733 238
1417 3300048907 Ga0496104_0158543 Ga0496104_0158543_902_1621 238
1418 3300048909 Ga0496106_0006109 Ga0496106_0006109_7020_7739 238
1419 3300048910 Ga0496107_0018364 Ga0496107_0018364_3946_4665 238
1420 3300048911 Ga0496108_0000764 Ga0496108_0000764_16519_17238 238
1421 3300048912 Ga0496109_0004357 Ga0496109_0004357_7444_8163 238
1422 3300048915 Ga0496112_0004915 Ga0496112_0004915_3706_4425 238
1423 3300048915 Ga0496112_0023568 Ga0496112_0023568_90_809 238
1424 3300048917 Ga0496114_0244542 Ga0496114_0244542_391_1110 238
1425 3300048918 Ga0496115_0279239 Ga0496115_0279239_175_894 238
1426 3300048924 Ga0496121_0001543 Ga0496121_0001543_24682_25401 238
1427 3300048928 Ga0496125_0047355 Ga0496125_0047355_1677_2396 238
1428 3300048928 Ga0496125_0152594 Ga0496125_0152594_712_1434 238
1429 3300048929 Ga0496126_0005900 Ga0496126_0005900_2531_3250 238
1430 3300048929 Ga0496126_0077667 Ga0496126_0077667_1127_1849 238
1431 3300048929 Ga0496126_0104250 Ga0496126_0104250_108_827 238
1432 3300048929 Ga0496126_0105850 Ga0496126_0105850_1325_2044 238
1433 3300048929 Ga0496126_0147005 Ga0496126_0147005_356_1075 238
1434 3300049568 Ga0501031_0163876 Ga0501031_0163876_583_1308 238
1435 3300049569 Ga0501032_0159161 Ga0501032_0159161_270_992 238
1436 3300049569 Ga0501032_0182983 Ga0501032_0182983_547_1272 238
1437 3300049570 Ga0501033_0006379 Ga0501033_0006379_1156_1878 238
1438 3300049572 Ga0501036_0265193 Ga0501036_0265193_63_785 238
1439 3300049573 Ga0501037_0033396 Ga0501037_0033396_588_1310 238
1440 3300049574 Ga0501038_0004208 Ga0501038_0004208_5211_5933 238
1441 3300049574 Ga0501038_0205716 Ga0501038_0205716_262_987 238
1442 3300049576 Ga0501040_0500770 Ga0501040_0500770_35_754 238
1443 3300049579 Ga0501043_0579497 Ga0501043_0579497_11_733 238
1444 3300049581 Ga0501047_0013515 Ga0501047_0013515_673_1395 238
1445 3300049586 Ga0501070_0204948 Ga0501070_0204948_754_1476 238
1446 3300049589 Ga0501073_0114093 Ga0501073_0114093_1030_1752 238
1447 3300049742 Ga0501080_0311972 Ga0501080_0311972_226_948 238
1448 3300049822 Ga0501035_0122045 Ga0501035_0122045_1097_1819 238
1449 3300049823 Ga0501044_0004858 Ga0501044_0004858_12266_12988 238
1450 3300049823 Ga0501044_0622559 Ga0501044_0622559_112_834 238
1451 3300049823 Ga0501044_0645009 Ga0501044_0645009_154_876 238
1452 3300050494 nmdc:mga06z11_250804_c1 nmdc:mga06z11_250804_c1_161_880 238
1453 3300050509 nmdc:mga0qj67_227519_c1 nmdc:mga0qj67_227519_c1_547_1266 238
1454 3300053077 Ga0495601_0015596 Ga0495601_0015596_1788_2507 238
1455 3300053078 Ga0495612_0061626 Ga0495612_0061626_51_770 238
1456 3300053084 Ga0495595_0019377 Ga0495595_0019377_63_782 238
1457 3300053084 Ga0495595_0029233 Ga0495595_0029233_949_1668 238
1458 3300053085 Ga0495619_0010830 Ga0495619_0010830_2853_3572 238
1459 3300053085 Ga0495619_0447829 Ga0495619_0447829_56_775 238
1460 3300053096 Ga0500641_0008013 Ga0500641_0008013_2228_2947 238
1461 3300053119 Ga0500595_003407 Ga0500595_003407_1449_2168 238
1462 3300053139 Ga0500568_0079638 Ga0500568_0079638_128_847 238
1463 3300053177 Ga0500636_0003333 Ga0500636_0003333_4059_4778 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

86

240

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9656 51 201
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.9524 49 201
3bqe-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) 0.9496 49 201
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9493 49 201
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9473 49 201
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9599 51 198 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.941 51 198 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9361 47 205 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9112 43 202 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9069 51 208 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q5W4M2-F1-model_v4 deleted 0.9965 53 231
AF-A0A2L1CRP3-F1-model_v4 deleted 0.9963 30 233
AF-A0A2V7ITR3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9937 53 225 GO:0008113
GO:0033744
GO:0036211
AF-A0A7Z1N7L7-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9934 77 225 GO:0008113
AF-A0A522GLU1-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9929 40 231 GO:0008113
GO:0033744
GO:0036211

Feature Viewer

pLDDT pTM Quality
89.03 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map