F494052

General Info

Members Datasets Scaffolds Average Seq Length
1449 1022 823 428

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306091|2551725600
Length 464
Sequence ISTSVLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGTGGTRFARFPGPGEPRNIFDKLEDCAVIQQLTRATPAVSLHIPWDKVSDLGALKEKGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIGKALGSKALTVWVGDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYLIAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAANGFDPAHMLDQSHNVTDPIESLMTSAMEVGRAYAQALIVDRKALAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRASXFLRTRTVESRGSGAEGIPRSKIQRATKLPSISFRNMVYPLLPIQREGDSWALKAFWYS

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276019 Ensifer aridi TW10 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
11 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
12 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
13 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
14 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
15 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
16 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2512875024 Mesorhizobium loti R88b Isolate Nodule
19 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
25 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
33 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
34 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2516143018 Ensifer sp. BR816 Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
40 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
41 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
42 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
43 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
44 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
45 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
46 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
47 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
48 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
49 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
50 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
51 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
52 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
53 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
54 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
55 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
56 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
57 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
58 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
59 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
60 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
61 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
62 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
63 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
66 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
67 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
68 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
69 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
70 2643221557 Ensifer sp. Root558 Isolate Unclassified
71 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
72 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
73 2643221580 Devosia sp. Root635 Isolate Unclassified
74 2643221591 Devosia sp. Root685 Isolate Unclassified
75 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
76 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
77 2643221599 Rhizobium sp. Root708 Isolate Unclassified
78 2643221607 Rhizobium sp. Root73 Isolate Unclassified
79 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
80 2643221610 Ensifer sp. Root74 Isolate Unclassified
81 2643221618 Ensifer sp. Root231 Isolate Unclassified
82 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
83 2643221626 Ensifer sp. Root31 Isolate Unclassified
84 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
85 2643221629 Devosia sp. Root105 Isolate Unclassified
86 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
87 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
88 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
89 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
90 2643221655 Ensifer sp. Root1252 Isolate Unclassified
91 2643221659 Ensifer sp. Root127 Isolate Unclassified
92 2643221662 Devosia sp. Root413D1 Isolate Unclassified
93 2643221668 Ensifer sp. Root423 Isolate Unclassified
94 2643221674 Devosia sp. Root436 Isolate Unclassified
95 2643221675 Ensifer sp. Root1298 Isolate Unclassified
96 2643221680 Ensifer sp. Root1312 Isolate Unclassified
97 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
98 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
99 2643221698 Ensifer sp. Root142 Isolate Unclassified
100 2643221712 Ensifer sp. Root258 Isolate Unclassified
101 2643221723 Ensifer sp. Root278 Isolate Unclassified
102 2643221726 Ensifer sp. Root954 Isolate Unclassified
103 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
104 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
105 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
106 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
107 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
108 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
109 2718217882 Rhizobium sp. N741 Isolate Nodule
110 2718218009 Rhizobium sp. N561 Isolate Nodule
111 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
112 2718218363 Rhizobium sp. N113 Isolate Nodule
113 2718218365 Rhizobium sp. N731 Isolate Nodule
114 2718218366 Rhizobium sp. N621 Isolate Nodule
115 2721755514 Rhizobium sp. N6212 Isolate Nodule
116 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
117 2721755810 Rhizobium sp. N871 Isolate Nodule
118 2728369365 Rhizobium sp. N1341 Isolate Nodule
119 2728369397 Rhizobium sp. N1314 Isolate Nodule
120 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
121 2738543024 Aminobacter sp. AP02 Isolate Unclassified
122 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
123 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
124 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
125 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
126 2773857925 Microvirga vignae BR3299 Isolate Unclassified
127 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
128 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
129 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
130 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
131 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
132 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
133 2791355256 Rhizobium sp. M10 Isolate Nodule
134 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
135 2791355260 Rhizobium sp. L9 Isolate Nodule
136 2791355261 Rhizobium sp. J15 Isolate Nodule
137 2791355262 Rhizobium sp. M1 Isolate Nodule
138 2791355263 Rhizobium chutanense C5 Isolate Nodule
139 2791355264 Rhizobium sp. S9 Isolate Nodule
140 2791355265 Rhizobium sp. H4 Isolate Nodule
141 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
142 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
143 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
144 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
145 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
146 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
147 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
148 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
149 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
150 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
151 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
152 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
153 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
154 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
155 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
156 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
157 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
158 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
159 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
160 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
161 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
162 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
163 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
164 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
165 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
166 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
167 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
168 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
169 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
170 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
171 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
172 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
173 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
174 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
175 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
176 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
177 2844163670 Ensifer sp. 1H6 Isolate Unclassified
178 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
179 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
180 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
181 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
182 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
183 2854911287 Brucella lupini LUP21 Isolate Unclassified
184 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
185 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
186 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
187 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
188 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
189 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
190 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
191 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
192 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
193 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
194 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
195 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
196 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
197 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
198 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
199 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
200 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
201 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
202 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
203 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
204 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
205 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
206 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
207 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
208 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
209 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
210 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
211 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
212 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
213 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
214 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
215 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
216 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
217 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
218 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
219 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
220 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
221 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
222 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
223 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
224 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
225 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
226 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
227 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
228 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
229 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
230 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
231 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
232 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
233 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
234 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
235 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
236 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
237 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
238 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
239 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
240 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
241 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
242 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
243 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
244 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
245 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
246 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
247 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
248 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
249 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
250 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
251 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
252 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
253 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
254 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
255 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
256 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
257 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
258 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
259 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
260 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
261 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
262 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
263 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
264 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
265 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
266 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
267 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
268 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
269 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
270 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
271 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
272 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
273 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
274 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
275 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
276 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
277 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
278 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
279 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
280 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
281 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
282 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
283 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
284 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
285 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
286 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
287 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
288 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
289 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
290 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
291 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
292 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
293 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
294 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
295 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
296 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
297 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
298 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
299 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
300 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
301 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
302 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
303 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
304 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
305 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
306 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
307 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
308 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
309 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
310 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
311 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
312 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
313 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
314 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
315 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
316 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
317 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
318 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
319 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
320 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
321 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
322 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
323 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
324 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
325 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
326 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
327 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
328 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
329 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
330 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
331 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
332 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
333 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
334 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
335 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
336 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
337 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
338 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
339 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
340 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
341 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
342 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
343 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
344 2932401849 Devosia sp. 2618 Isolate Rhizosphere
345 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
346 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
347 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
348 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
349 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
350 2936381700 Rhizobium chutanense C16 Isolate Unclassified
351 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
352 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
353 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
354 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
355 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
356 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
357 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
358 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
359 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
360 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
361 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
362 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
363 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
364 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
365 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
366 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
367 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
368 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
369 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
370 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
371 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
372 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
373 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
374 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
375 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
376 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
377 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
378 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
379 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
380 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
381 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
382 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
383 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
384 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
385 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
386 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
387 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
388 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
389 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
390 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
391 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
392 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
393 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
394 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
395 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
396 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
397 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
398 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
399 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
400 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
401 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
402 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
403 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
404 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
405 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
406 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
407 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
408 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
409 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
410 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
411 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
412 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
413 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
414 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
415 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
416 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
417 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
418 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
419 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
420 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
421 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
422 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
423 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
424 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
425 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
426 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
427 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
428 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
429 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
430 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
431 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
432 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
433 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
434 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
435 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
436 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
437 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
438 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
439 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
440 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
441 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
442 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
443 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
444 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
445 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
446 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
447 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
448 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
449 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
450 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
451 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
452 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
453 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
454 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
455 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
456 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
457 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
458 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
459 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
460 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
461 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
462 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
463 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
464 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
465 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
466 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
467 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
468 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
469 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
470 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
471 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
472 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
473 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
474 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
475 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
476 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
477 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
478 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
479 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
480 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
481 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
482 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
483 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
484 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
485 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
486 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
487 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
488 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
489 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
490 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
491 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
492 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
493 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
494 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
495 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
496 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
497 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
498 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
499 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
500 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
501 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
502 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
503 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
504 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
505 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
506 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
507 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
508 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
509 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
510 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
511 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
512 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
513 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
514 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
515 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
516 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
517 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
518 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
519 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
520 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
521 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
522 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
523 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
524 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
525 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
526 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
527 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
528 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
529 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
530 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
531 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
532 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
533 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
534 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
535 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
536 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
537 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
538 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
539 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
540 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
541 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
542 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
543 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
544 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
545 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
546 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
547 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
548 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
549 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
550 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
551 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
552 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
553 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
554 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
555 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
556 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
557 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
558 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
559 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
560 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
561 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
562 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
563 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
564 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
565 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
566 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
567 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
568 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
569 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
570 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
571 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
572 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
573 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
574 2996893221 Rhizobium sp. R635 Isolate Nodule
575 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
576 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
577 3004167301 Mesorhizobium loti 582 Isolate Unclassified
578 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
579 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
580 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
581 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
582 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
583 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
584 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
585 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
586 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
587 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
588 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
589 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
590 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
591 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
592 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
593 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
594 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
595 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
596 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
597 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
598 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
599 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
600 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
601 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
602 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
603 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
604 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
605 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
606 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
607 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
608 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
609 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
610 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
611 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
612 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
613 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
614 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
615 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
616 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
617 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
618 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
619 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
620 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
621 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
622 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
623 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
624 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
625 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
626 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
627 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
628 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
629 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
630 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
631 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
632 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
633 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
634 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
635 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
636 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
637 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
638 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
639 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
640 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
641 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
642 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
643 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
644 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
645 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
646 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
647 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
648 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
649 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
650 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
651 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
652 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
653 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
654 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
655 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
656 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
657 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
658 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
659 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
660 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
661 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
662 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
663 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
664 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
665 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
666 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
667 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
668 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
669 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
670 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
671 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
672 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
673 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
674 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
675 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
676 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
677 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
678 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
679 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
680 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
681 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
682 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
683 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
684 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
685 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
686 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
687 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
688 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
689 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
690 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
691 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
692 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
693 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
694 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
695 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
696 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
697 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
698 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
699 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
700 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
701 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
702 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
703 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
704 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
705 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
706 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
707 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
708 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
709 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
710 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
711 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
712 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
713 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
714 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
715 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
716 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
717 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
718 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
719 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
720 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
721 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
722 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
723 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
724 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
725 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
726 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
727 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
728 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
729 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
730 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
731 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
732 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
733 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
734 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
735 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
736 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
737 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
738 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
739 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
740 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
741 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
742 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
743 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
744 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
745 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
746 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
747 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
748 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
749 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
750 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
783 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
784 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
785 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
786 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
788 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
790 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
791 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
792 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
793 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
794 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
795 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
796 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
797 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
798 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
799 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
800 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
801 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
802 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
803 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
804 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
805 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
806 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
807 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
808 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
809 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
810 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
811 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
812 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
813 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
814 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
815 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
816 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
817 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
818 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
819 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
820 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
821 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
822 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
823 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
824 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
825 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
826 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
827 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
828 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
829 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
830 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
831 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
832 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
833 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
834 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
835 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
836 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
837 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
838 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
839 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
840 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
841 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
842 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
843 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
844 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
845 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
846 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
847 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
848 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
849 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
850 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
851 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
852 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
853 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
854 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
855 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
856 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
857 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
858 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
859 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
860 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
861 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
862 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
863 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
864 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
865 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
866 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
867 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
868 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
869 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
870 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
871 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
872 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
873 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
874 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
875 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
876 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
877 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
878 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
879 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
880 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
881 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
882 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
883 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
884 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
885 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
886 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
887 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
888 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
889 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
890 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
891 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
892 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
893 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
894 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
895 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
896 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
897 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
898 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
899 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
900 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
901 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
902 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
903 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
904 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
905 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
906 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
907 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
908 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
909 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
910 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
911 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
912 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
913 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
914 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
915 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
916 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
917 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
918 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
919 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
920 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
921 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
922 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
923 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
924 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
925 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
926 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
927 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
928 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
929 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
930 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
931 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
932 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
933 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
934 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
935 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
936 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
937 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
938 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
939 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
940 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
941 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
942 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
943 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
944 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
945 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
946 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
947 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
948 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
949 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
950 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
951 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
952 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
953 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
954 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
955 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
956 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
957 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
958 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
959 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
960 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
961 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
962 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
963 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
964 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
965 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
966 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
967 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
968 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
969 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
970 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
971 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
972 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
973 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
974 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
975 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
976 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
977 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
978 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
979 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
980 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
981 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
982 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
983 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
984 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
985 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
986 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
987 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
988 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
989 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
990 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
991 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
992 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
993 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
994 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
995 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
996 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
997 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
998 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
999 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1000 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1001 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1002 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1003 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1004 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1005 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1006 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1007 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1008 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1009 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1010 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1011 8005382845 Rhizobium sp. R634 Isolate Nodule
1012 8005395548 Rhizobium sp. R339 Isolate Nodule
1013 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1014 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1015 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1016 8024501048 Rhizobium sp. H4 Isolate Nodule
1017 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1018 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1019 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1020 8056382006 Rhizobium croatiense 13T Isolate Nodule
1021 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1022 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.8
Metatranscriptomes 0
Isolates 43.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 36.09
Rhizoplane 1.79
Rhizosphere 42.17
Stem 0
Stem Tuber 0
Unclassified 11.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000012 3300002074 Bacteria 152599
2 JGI24034J26672_10000003 3300002239 Bacteria 501747
3 JGI24751J29686_10000931 3300002459 Bacteria 6560
4 JGI25157J39369_1001297 3300002741 Bacteria 10014
5 JGI25152J39213_1002620 3300002773 Bacteria 6697
6 JGI25152J39213_1003646 3300002773 Bacteria 5189
7 JGI25159J45721_1000003 3300002987 Bacteria 274069
8 JGI25151J46595_10011278 3300003187 Bacteria 4116
9 JGI25406J46586_10010437 3300003203 Bacteria 4121
10 JGI25165J46597_1000037 3300003214 Bacteria 285722
11 JGI25165J46597_1001939 3300003214 Bacteria 8155
12 JGI25153J46596_10021365 3300003215 Bacteria 2414
13 JGI25160J50197_1000003 3300003354 Bacteria 482719
14 JGI25161J50226_1001593 3300003374 Bacteria 6618
15 Ga0055542_1000403 3300003762 Bacteria 42485
16 Ga0055526_1002818 3300003771 Bacteria 11506
17 Ga0055526_1012650 3300003771 Bacteria 3657
18 Ga0055524_1000061 3300003775 Bacteria 135241
19 Ga0055524_1000789 3300003775 Bacteria 21114
20 Ga0055524_1006013 3300003775 Bacteria 5328
21 Ga0055536_1002760 3300003781 Bacteria 9721
22 Ga0055530_10002372 3300003791 Bacteria 12207
23 Ga0055540_1000026 3300003792 Bacteria 189071
24 Ga0055531_10027659 3300003794 Bacteria 1982
25 Ga0055543_1000158 3300004625 Bacteria 56811
26 Ga0065165_1000084 3300005262 Bacteria 154822
27 Ga0065165_1003834 3300005262 Bacteria 10014
28 Ga0065704_10101196 3300005289 Bacteria 2246
29 Ga0065712_10077146 3300005290 Bacteria 3542
30 Ga0065715_10002994 3300005293 Bacteria 4324
31 Ga0065707_10004904 3300005295 Bacteria 3272
32 Ga0065707_10114068 3300005295 Bacteria 2300
33 Ga0070690_100003582 3300005330 Bacteria 8531
34 Ga0070690_100009128 3300005330 Bacteria 5738
35 Ga0070670_100000001 3300005331 Bacteria 728788
36 Ga0070670_100000095 3300005331 Bacteria 83302
37 Ga0070670_100011486 3300005331 Bacteria 7577
38 Ga0070670_100058327 3300005331 Bacteria 3314
39 Ga0070670_100128254 3300005331 Bacteria 2189
40 Ga0070670_100232100 3300005331 Bacteria 1606
41 Ga0070677_10052188 3300005333 Bacteria 1658
42 Ga0070677_10066304 3300005333 Bacteria 1505
43 Ga0070666_10008240 3300005335 Bacteria 6461
44 Ga0070666_10008433 3300005335 Bacteria 6400
45 Ga0070666_10022918 3300005335 Bacteria 4061
46 Ga0070680_100036315 3300005336 Bacteria 3981
47 Ga0070680_100124089 3300005336 Bacteria 2157
48 Ga0070680_100129635 3300005336 Bacteria 2109
49 Ga0070680_100260627 3300005336 Bacteria 1467
50 Ga0068868_100025316 3300005338 Bacteria 4512
51 Ga0070660_100007853 3300005339 Bacteria 7440
52 Ga0070689_100017803 3300005340 Bacteria 5223
53 Ga0070689_100027792 3300005340 Bacteria 4268
54 Ga0070687_100103610 3300005343 Bacteria 1598
55 Ga0070668_100077261 3300005347 Bacteria 2602
56 Ga0070668_100077888 3300005347 Bacteria 2592
57 Ga0070669_100003348 3300005353 Bacteria 11524
58 Ga0070669_100005889 3300005353 Bacteria 8845
59 Ga0070675_100017449 3300005354 Bacteria 5703
60 Ga0070675_100019228 3300005354 Bacteria 5441
61 Ga0070675_100032654 3300005354 Bacteria 4214
62 Ga0070671_100000008 3300005355 Bacteria 207831
63 Ga0070671_100036107 3300005355 Bacteria 4098
64 Ga0070674_100034401 3300005356 Bacteria 3384
65 Ga0070673_100011286 3300005364 Bacteria 6092
66 Ga0070688_100014320 3300005365 Bacteria 4490
67 Ga0070688_100050573 3300005365 Bacteria 2590
68 Ga0070667_100000023 3300005367 Bacteria 199687
69 Ga0070667_100000116 3300005367 Bacteria 102137
70 Ga0070667_100043273 3300005367 Bacteria 3779
71 Ga0070667_100084988 3300005367 Bacteria 2713
72 Ga0070667_100247865 3300005367 Bacteria 1592
73 Ga0070710_10001104 3300005437 Bacteria 12775
74 Ga0070701_10074240 3300005438 Bacteria 1826
75 Ga0070705_100031594 3300005440 Bacteria 2933
76 Ga0070705_100040575 3300005440 Bacteria 2648
77 Ga0070708_100052938 3300005445 Bacteria 3600
78 Ga0070678_100031951 3300005456 Bacteria 3637
79 Ga0070678_100036939 3300005456 Bacteria 3424
80 Ga0070678_100115763 3300005456 Bacteria 2105
81 Ga0070681_10000808 3300005458 Bacteria 26152
82 Ga0070681_10025626 3300005458 Bacteria 5932
83 Ga0068867_100041560 3300005459 Bacteria 3360
84 Ga0070685_10000007 3300005466 Bacteria 180539
85 Ga0070685_10068977 3300005466 Bacteria 2090
86 Ga0070706_100009688 3300005467 Bacteria 8953
87 Ga0070706_100015675 3300005467 Bacteria 7001
88 Ga0070706_100216805 3300005467 Bacteria 1786
89 Ga0070707_100002461 3300005468 Bacteria 17647
90 Ga0070707_100006029 3300005468 Bacteria 11312
91 Ga0070707_100060644 3300005468 Bacteria 3628
92 Ga0070698_100001987 3300005471 Bacteria 22694
93 Ga0070698_100004345 3300005471 Bacteria 15581
94 Ga0070699_100002830 3300005518 Bacteria 15479
95 Ga0070699_100039132 3300005518 Bacteria 4106
96 Ga0070699_100195352 3300005518 Bacteria 1798
97 Ga0070699_100202437 3300005518 Bacteria 1766
98 Ga0070684_100076965 3300005535 Bacteria 2946
99 Ga0070697_100006577 3300005536 Bacteria 9007
100 Ga0068853_100002303 3300005539 Bacteria 14278
101 Ga0068853_100025799 3300005539 Bacteria 4933
102 Ga0068853_100238424 3300005539 Bacteria 1666
103 Ga0070672_100012851 3300005543 Bacteria 5897
104 Ga0070672_100230904 3300005543 Bacteria 1554
105 Ga0070672_100271197 3300005543 Bacteria 1433
106 Ga0070686_100095608 3300005544 Bacteria 1996
107 Ga0070686_100168088 3300005544 Bacteria 1549
108 Ga0070695_100004821 3300005545 Bacteria 7939
109 Ga0070696_100020844 3300005546 Bacteria 4442
110 Ga0070665_100007908 3300005548 Bacteria 10785
111 Ga0070665_100017258 3300005548 Bacteria 7244
112 Ga0070665_100107192 3300005548 Bacteria 2796
113 Ga0070665_100238851 3300005548 Bacteria 1818
114 Ga0070704_100044646 3300005549 Bacteria 3081
115 Ga0068855_100013608 3300005563 Bacteria 9810
116 Ga0068855_100035817 3300005563 Bacteria 5910
117 Ga0068855_100095697 3300005563 Bacteria 3422
118 Ga0070664_100022513 3300005564 Bacteria 5197
119 Ga0070664_100033055 3300005564 Bacteria 4329
120 Ga0070664_100037216 3300005564 Bacteria 4090
121 Ga0068857_100034814 3300005577 Bacteria 4456
122 Ga0068854_100020014 3300005578 Bacteria 4518
123 Ga0068854_100037222 3300005578 Bacteria 3414
124 Ga0068856_100030133 3300005614 Bacteria 5304
125 Ga0070702_100002988 3300005615 Bacteria 7473
126 Ga0068852_100002040 3300005616 Bacteria 13758
127 Ga0068852_100069392 3300005616 Bacteria 3089
128 Ga0068859_100000668 3300005617 Bacteria 34291
129 Ga0068859_100006383 3300005617 Bacteria 11961
130 Ga0068859_100017106 3300005617 Bacteria 7281
131 Ga0068859_100017495 3300005617 Bacteria 7205
132 Ga0068859_100051193 3300005617 Bacteria 4150
133 Ga0068859_100063413 3300005617 Bacteria 3726
134 Ga0068859_100074880 3300005617 Bacteria 3425
135 Ga0068859_100238140 3300005617 Bacteria 1909
136 Ga0068864_100000012 3300005618 Bacteria 335070
137 Ga0068864_100005239 3300005618 Bacteria 10628
138 Ga0068864_100014954 3300005618 Bacteria 6450
139 Ga0068864_100028391 3300005618 Bacteria 4728
140 Ga0068864_100081545 3300005618 Bacteria 2836
141 Ga0068861_100007061 3300005719 Bacteria 7679
142 Ga0068861_100025828 3300005719 Bacteria 4265
143 Ga0068861_100164950 3300005719 Bacteria 1831
144 Ga0068851_10031070 3300005834 Bacteria 2651
145 Ga0068870_10002937 3300005840 Bacteria 7181
146 Ga0068863_100008263 3300005841 Bacteria 10167
147 Ga0068863_100037293 3300005841 Bacteria 4628
148 Ga0068863_100041004 3300005841 Bacteria 4401
149 Ga0068863_100089215 3300005841 Bacteria 2923
150 Ga0068863_100252924 3300005841 Bacteria 1702
151 Ga0068858_100000277 3300005842 Bacteria 55193
152 Ga0068858_100020349 3300005842 Bacteria 6206
153 Ga0068858_100026415 3300005842 Bacteria 5395
154 Ga0068858_100041035 3300005842 Bacteria 4292
155 Ga0068858_100049389 3300005842 Bacteria 3897
156 Ga0068858_100183098 3300005842 Bacteria 1978
157 Ga0068858_100185801 3300005842 Bacteria 1963
158 Ga0068858_100262419 3300005842 Bacteria 1642
159 Ga0068858_100325902 3300005842 Bacteria 1469
160 Ga0068860_100000179 3300005843 Bacteria 102844
161 Ga0068860_100000928 3300005843 Bacteria 32413
162 Ga0068860_100001934 3300005843 Bacteria 21903
163 Ga0068860_100004331 3300005843 Bacteria 14508
164 Ga0068860_100032404 3300005843 Bacteria 5021
165 Ga0068860_100064120 3300005843 Bacteria 3490
166 Ga0068860_100090703 3300005843 Bacteria 2911
167 Ga0068862_100000023 3300005844 Bacteria 203389
168 Ga0068862_100020342 3300005844 Bacteria 5544
169 Ga0068862_100024291 3300005844 Bacteria 5084
170 Ga0068862_100076106 3300005844 Bacteria 2904
171 Ga0068862_100115327 3300005844 Bacteria 2362
172 Ga0068862_100125365 3300005844 Bacteria 2267
173 Ga0081455_10003635 3300005937 Bacteria 17668
174 Ga0081538_10009289 3300005981 Bacteria 8228
175 Ga0081540_1008024 3300005983 Bacteria 7427
176 Ga0081540_1042137 3300005983 Bacteria 2358
177 Ga0081539_10005442 3300005985 Bacteria 12996
178 Ga0075365_10055948 3300006038 Bacteria 2621
179 Ga0075365_10087006 3300006038 Bacteria 2124
180 Ga0075368_10059850 3300006042 Bacteria 1524
181 Ga0075363_100073249 3300006048 Bacteria 1864
182 Ga0075364_10029947 3300006051 Bacteria 3492
183 Ga0075367_10048240 3300006178 Bacteria 2508
184 Ga0075367_10101414 3300006178 Bacteria 1760
185 Ga0075366_10053164 3300006195 Bacteria 2406
186 Ga0075366_10062662 3300006195 Bacteria 2210
187 Ga0075366_10078689 3300006195 Bacteria 1968
188 Ga0075366_10111357 3300006195 Bacteria 1646
189 Ga0097621_100008990 3300006237 Bacteria 7228
190 Ga0097621_100026654 3300006237 Bacteria 4537
191 Ga0097621_100044981 3300006237 Bacteria 3564
192 Ga0097621_100154976 3300006237 Bacteria 1966
193 Ga0075370_10026675 3300006353 Bacteria 3201
194 Ga0068871_100025223 3300006358 Bacteria 4622
195 Ga0068871_100040634 3300006358 Bacteria 3726
196 Ga0068871_100048649 3300006358 Bacteria 3424
197 Ga0068871_100121143 3300006358 Bacteria 2209
198 Ga0075428_100000060 3300006844 Bacteria 88550
199 Ga0075433_10085443 3300006852 Bacteria 2785
200 Ga0075433_10206822 3300006852 Bacteria 1745
201 Ga0075434_100129087 3300006871 Bacteria 2546
202 Ga0075434_100325279 3300006871 Bacteria 1558
203 Ga0068865_100055560 3300006881 Unclassified 2755
204 Ga0075436_100000008 3300006914 Bacteria 279288
205 Ga0097620_100000668 3300006931 Bacteria 34291
206 Ga0097620_100006383 3300006931 Bacteria 11961
207 Ga0097620_100017106 3300006931 Bacteria 7281
208 Ga0097620_100017496 3300006931 Bacteria 7205
209 Ga0097620_100051192 3300006931 Bacteria 4150
210 Ga0097620_100063413 3300006931 Bacteria 3726
211 Ga0097620_100074883 3300006931 Bacteria 3425
212 Ga0097620_100238152 3300006931 Bacteria 1909
213 Ga0099825_1022929 3300006941 Bacteria 3921
214 Ga0099824_1025812 3300006942 Bacteria 3145
215 Ga0099822_1007677 3300006943 Bacteria 13908
216 Ga0079104_1000093 3300006946 Bacteria 130633
217 Ga0079104_1002731 3300006946 Bacteria 9004
218 Ga0079104_1005856 3300006946 Bacteria 4797
219 Ga0099794_10000291 3300007265 Bacteria 17263
220 Ga0105240_10010945 3300009093 Bacteria 12709
221 Ga0105240_10136790 3300009093 Bacteria 2934
222 Ga0111539_10000002 3300009094 Bacteria 983359
223 Ga0111539_10000050 3300009094 Bacteria 118845
224 Ga0111539_10004626 3300009094 Bacteria 17967
225 Ga0111539_10102811 3300009094 Bacteria 3353
226 Ga0111539_10109105 3300009094 Unclassified 3248
227 Ga0111539_10155248 3300009094 Bacteria 2678
228 Ga0105245_10012954 3300009098 Bacteria 7270
229 Ga0105247_10000003 3300009101 Bacteria 694517
230 Ga0105247_10007589 3300009101 Bacteria 6645
231 Ga0105247_10015183 3300009101 Bacteria 4617
232 Ga0105247_10025927 3300009101 Bacteria 3538
233 Ga0114129_10038907 3300009147 Bacteria 6704
234 Ga0114129_10049278 3300009147 Bacteria 5918
235 Ga0114129_10062012 3300009147 Bacteria 5224
236 Ga0114129_10092285 3300009147 Bacteria 4195
237 Ga0114129_10099497 3300009147 Bacteria 4025
238 Ga0114129_10270891 3300009147 Bacteria 2271
239 Ga0114129_10282551 3300009147 Bacteria 2217
240 Ga0105243_10101570 3300009148 Bacteria 2388
241 Ga0105241_10064936 3300009174 Bacteria 2819
242 Ga0105241_10086598 3300009174 Bacteria 2464
243 Ga0105241_10108804 3300009174 Bacteria 2216
244 Ga0105241_10280166 3300009174 Bacteria 1423
245 Ga0105242_10009081 3300009176 Bacteria 7635
246 Ga0105242_10014725 3300009176 Bacteria 6057
247 Ga0105242_10037035 3300009176 Bacteria 3917
248 Ga0105248_10045650 3300009177 Bacteria 4913
249 Ga0105248_10300329 3300009177 Bacteria 1808
250 Ga0105237_10000659 3300009545 Bacteria 47952
251 Ga0105237_10003125 3300009545 Bacteria 19928
252 Ga0105237_10007526 3300009545 Bacteria 11906
253 Ga0105237_10063666 3300009545 Bacteria 3686
254 Ga0105237_10071599 3300009545 Bacteria 3461
255 Ga0105237_10085691 3300009545 Unclassified 3140
256 Ga0105237_10161736 3300009545 Bacteria 2237
257 Ga0105237_10205210 3300009545 Bacteria 1971
258 Ga0105238_10013092 3300009551 Bacteria 8369
259 Ga0105238_10015087 3300009551 Bacteria 7824
260 Ga0105249_10000004 3300009553 Bacteria 368014
261 Ga0105249_10011832 3300009553 Bacteria 7670
262 Ga0105249_10017322 3300009553 Bacteria 6397
263 Ga0105249_10094769 3300009553 Bacteria 2798
264 Ga0105249_10140229 3300009553 Bacteria 2317
265 Ga0105249_10189362 3300009553 Bacteria 2007
266 Ga0105239_10041756 3300010375 Bacteria 5026
267 Ga0105239_10043547 3300010375 Bacteria 4921
268 Ga0105239_10048669 3300010375 Bacteria 4648
269 Ga0105239_10090435 3300010375 Bacteria 3377
270 Ga0105239_10115790 3300010375 Bacteria 2974
271 Ga0105239_10119301 3300010375 Bacteria 2928
272 Ga0105239_10248527 3300010375 Bacteria 1998
273 Ga0105246_10000071 3300011119 Bacteria 42029
274 Ga0157373_10002597 3300013100 Bacteria 13723
275 Ga0157373_10010988 3300013100 Bacteria 6666
276 Ga0157373_10055873 3300013100 Bacteria 2804
277 Ga0157369_10085402 3300013105 Bacteria 3373
278 Ga0157369_10107931 3300013105 Bacteria 2961
279 Ga0171463_1001 3300013249 Bacteria 1406070
280 Ga0157374_10031258 3300013296 Bacteria 4838
281 Ga0157374_10103653 3300013296 Bacteria 2730
282 Ga0157378_10023318 3300013297 Bacteria 5447
283 Ga0163162_10009664 3300013306 Bacteria 9381
284 Ga0163162_10135162 3300013306 Bacteria 2576
285 Ga0157372_10308227 3300013307 Bacteria 1842
286 Ga0157375_10006167 3300013308 Bacteria 10446
287 Ga0157375_10081203 3300013308 Bacteria 3282
288 Ga0157375_10084021 3300013308 Bacteria 3231
289 Ga0157375_10296498 3300013308 Bacteria 1780
290 Ga0163163_10000026 3300014325 Bacteria 179198
291 Ga0163163_10000436 3300014325 Bacteria 38165
292 Ga0163163_10015631 3300014325 Bacteria 7023
293 Ga0163163_10018136 3300014325 Bacteria 6579
294 Ga0163163_10020521 3300014325 Bacteria 6224
295 Ga0163163_10033994 3300014325 Bacteria 4935
296 Ga0163163_10063306 3300014325 Bacteria 3667
297 Ga0163163_10087176 3300014325 Bacteria 3132
298 Ga0163163_10173783 3300014325 Bacteria 2201
299 Ga0163163_10204098 3300014325 Bacteria 2025
300 Ga0157380_10000514 3300014326 Bacteria 23717
301 Ga0157380_10006982 3300014326 Bacteria 7992
302 Ga0157380_10008405 3300014326 Bacteria 7366
303 Ga0157380_10010159 3300014326 Bacteria 6765
304 Ga0157380_10013232 3300014326 Bacteria 6009
305 Ga0157380_10024587 3300014326 Bacteria 4560
306 Ga0157380_10028179 3300014326 Bacteria 4279
307 Ga0157380_10101542 3300014326 Bacteria 2397
308 Ga0157380_10162018 3300014326 Bacteria 1945
309 Ga0182008_10015167 3300014497 Bacteria 4026
310 Ga0157379_10031766 3300014968 Bacteria 4704
311 Ga0157379_10043503 3300014968 Bacteria 4010
312 Ga0183365_10137 3300015684 Bacteria 1916
313 Ga0183363_1032 3300015690 Bacteria 48614
314 Ga0163161_10044606 3300017792 Bacteria 3194
315 Ga0214542_1000011 3300021321 Bacteria 238260
316 Ga0214542_1008060 3300021321 Bacteria 17792
317 Ga0214543_1000004 3300021327 Bacteria 527190
318 Ga0214543_1000259 3300021327 Bacteria 81880
319 Ga0213876_10002813 3300021384 Bacteria 10124
320 Ga0213871_10004950 3300021441 Bacteria 2712
321 Ga0228711_1000019 3300022739 Bacteria 111795
322 Ga0228710_1000022 3300022740 Bacteria 111795
323 Ga0207672_1000445 3300025223 Bacteria 5261
324 Ga0209563_103701 3300025230 Bacteria 3098
325 Ga0207425_1000736 3300025245 Bacteria 17202
326 Ga0209026_1000013 3300025250 Bacteria 415633
327 Ga0209677_100643 3300025253 Bacteria 18518
328 Ga0209677_103007 3300025253 Bacteria 5832
329 Ga0209148_1000266 3300025254 Bacteria 82141
330 Ga0209148_1000474 3300025254 Bacteria 42596
331 Ga0209148_1009957 3300025254 Bacteria 1824
332 Ga0209148_1011910 3300025254 Bacteria 1604
333 Ga0209759_1000149 3300025256 Bacteria 120932
334 Ga0209129_1000113 3300025258 Bacteria 145178
335 Ga0209129_1002521 3300025258 Bacteria 8925
336 Ga0209233_1000102 3300025261 Bacteria 285774
337 Ga0209233_1000201 3300025261 Bacteria 123566
338 Ga0209233_1003536 3300025261 Bacteria 5494
339 Ga0209233_1003653 3300025261 Bacteria 5385
340 Ga0209455_1000234 3300025272 Bacteria 70076
341 Ga0209455_1001414 3300025272 Bacteria 10881
342 Ga0209455_1004746 3300025272 Bacteria 4360
343 Ga0209673_1003797 3300025273 Bacteria 8576
344 Ga0209130_1000005 3300025284 Bacteria 599620
345 Ga0209676_1000097 3300025292 Bacteria 237203
346 Ga0209676_1008514 3300025292 Bacteria 4563
347 Ga0209025_1000044 3300025294 Bacteria 349480
348 Ga0209025_1000295 3300025294 Bacteria 111489
349 Ga0209564_1000093 3300025295 Bacteria 245793
350 Ga0209564_1000186 3300025295 Bacteria 147120
351 Ga0209758_1000172 3300025297 Bacteria 147763
352 Ga0209758_1003660 3300025297 Bacteria 13697
353 Ga0209758_1015042 3300025297 Bacteria 4044
354 Ga0209050_1000228 3300025298 Bacteria 123537
355 Ga0209050_1000489 3300025298 Bacteria 68506
356 Ga0209050_1004684 3300025298 Bacteria 9085
357 Ga0209256_1000027 3300025299 Bacteria 423283
358 Ga0209256_1000030 3300025299 Bacteria 414828
359 Ga0209256_1002044 3300025299 Bacteria 17914
360 Ga0207426_1000015 3300025302 Bacteria 599316
361 Ga0209051_1000004 3300025303 Bacteria 1155596
362 Ga0209051_1025463 3300025303 Bacteria 2406
363 Ga0209257_1000423 3300025304 Bacteria 81354
364 Ga0209257_1010078 3300025304 Bacteria 4884
365 Ga0207682_10008562 3300025893 Bacteria 4044
366 Ga0207682_10054532 3300025893 Bacteria 1661
367 Ga0207682_10059892 3300025893 Bacteria 1592
368 Ga0207692_10054139 3300025898 Bacteria 2047
369 Ga0207710_10000001 3300025900 Bacteria 1797433
370 Ga0207710_10010227 3300025900 Bacteria 3945
371 Ga0207710_10015559 3300025900 Bacteria 3217
372 Ga0207710_10027279 3300025900 Bacteria 2472
373 Ga0207688_10054327 3300025901 Bacteria 2247
374 Ga0207699_10074917 3300025906 Bacteria 2080
375 Ga0207645_10066238 3300025907 Bacteria 2309
376 Ga0207645_10131458 3300025907 Bacteria 1629
377 Ga0207643_10004683 3300025908 Bacteria 7339
378 Ga0207643_10039937 3300025908 Bacteria 2640
379 Ga0207705_10148970 3300025909 Bacteria 1752
380 Ga0207684_10045941 3300025910 Bacteria 3705
381 Ga0207684_10094752 3300025910 Bacteria 2546
382 Ga0207654_10046135 3300025911 Bacteria 2484
383 Ga0207654_10073132 3300025911 Bacteria 2042
384 Ga0207707_10006417 3300025912 Bacteria 10271
385 Ga0207707_10023883 3300025912 Bacteria 5346
386 Ga0207695_10000008 3300025913 Bacteria 1058268
387 Ga0207695_10113346 3300025913 Bacteria 2688
388 Ga0207671_10001797 3300025914 Bacteria 23996
389 Ga0207671_10062949 3300025914 Bacteria 2756
390 Ga0207671_10070889 3300025914 Bacteria 2599
391 Ga0207671_10108418 3300025914 Bacteria 2111
392 Ga0207693_10041585 3300025915 Bacteria 3619
393 Ga0207663_10069960 3300025916 Bacteria 2260
394 Ga0207660_10096169 3300025917 Bacteria 2205
395 Ga0207662_10003226 3300025918 Bacteria 8351
396 Ga0207646_10000897 3300025922 Bacteria 38370
397 Ga0207681_10001769 3300025923 Bacteria 13881
398 Ga0207681_10002874 3300025923 Bacteria 10883
399 Ga0207694_10003165 3300025924 Bacteria 13139
400 Ga0207694_10168470 3300025924 Bacteria 1772
401 Ga0207650_10000002 3300025925 Bacteria 1439222
402 Ga0207650_10000006 3300025925 Bacteria 544730
403 Ga0207650_10093386 3300025925 Bacteria 2303
404 Ga0207659_10185954 3300025926 Bacteria 1650
405 Ga0207664_10028123 3300025929 Bacteria 4270
406 Ga0207644_10000019 3300025931 Bacteria 170919
407 Ga0207644_10005864 3300025931 Bacteria 8006
408 Ga0207644_10044518 3300025931 Bacteria 3153
409 Ga0207706_10001920 3300025933 Bacteria 20417
410 Ga0207706_10087741 3300025933 Bacteria 2736
411 Ga0207706_10147100 3300025933 Bacteria 2072
412 Ga0207686_10015421 3300025934 Bacteria 4272
413 Ga0207670_10004621 3300025936 Bacteria 7452
414 Ga0207704_10023768 3300025938 Bacteria 3310
415 Ga0207704_10049131 3300025938 Bacteria 2535
416 Ga0207691_10026129 3300025940 Bacteria 5479
417 Ga0207691_10050920 3300025940 Bacteria 3789
418 Ga0207691_10083656 3300025940 Bacteria 2865
419 Ga0207691_10091002 3300025940 Bacteria 2734
420 Ga0207691_10102332 3300025940 Bacteria 2555
421 Ga0207691_10145852 3300025940 Bacteria 2083
422 Ga0207711_10003845 3300025941 Bacteria 12915
423 Ga0207711_10005157 3300025941 Bacteria 11069
424 Ga0207711_10203326 3300025941 Bacteria 1808
425 Ga0207689_10037772 3300025942 Bacteria 4003
426 Ga0207689_10139500 3300025942 Bacteria 1997
427 Ga0207679_10058560 3300025945 Bacteria 2855
428 Ga0207667_10009181 3300025949 Bacteria 11680
429 Ga0207667_10063348 3300025949 Bacteria 3863
430 Ga0207667_10417946 3300025949 Bacteria 1364
431 Ga0207651_10018310 3300025960 Bacteria 4164
432 Ga0207651_10131574 3300025960 Bacteria 1916
433 Ga0207712_10000008 3300025961 Bacteria 527957
434 Ga0207712_10013011 3300025961 Bacteria 5329
435 Ga0207712_10018934 3300025961 Bacteria 4491
436 Ga0207640_10140741 3300025981 Bacteria 1758
437 Ga0207658_10000001 3300025986 Bacteria 1439333
438 Ga0207658_10000566 3300025986 Bacteria 33572
439 Ga0207658_10020522 3300025986 Bacteria 4575
440 Ga0207658_10293016 3300025986 Bacteria 1399
441 Ga0207703_10000080 3300026035 Bacteria 111786
442 Ga0207703_10049252 3300026035 Bacteria 3405
443 Ga0207703_10096342 3300026035 Bacteria 2498
444 Ga0207703_10139946 3300026035 Bacteria 2099
445 Ga0207703_10168821 3300026035 Bacteria 1923
446 Ga0207639_10002007 3300026041 Bacteria 13718
447 Ga0207639_10025773 3300026041 Bacteria 4265
448 Ga0207639_10111072 3300026041 Bacteria 2234
449 Ga0207708_10027499 3300026075 Bacteria 4306
450 Ga0207708_10063572 3300026075 Bacteria 2820
451 Ga0207708_10083355 3300026075 Bacteria 2458
452 Ga0207641_10010982 3300026088 Bacteria 7423
453 Ga0207641_10034514 3300026088 Bacteria 4209
454 Ga0207641_10062192 3300026088 Bacteria 3185
455 Ga0207641_10070522 3300026088 Bacteria 3003
456 Ga0207641_10072330 3300026088 Bacteria 2969
457 Ga0207641_10290615 3300026088 Bacteria 1540
458 Ga0207648_10010770 3300026089 Bacteria 8640
459 Ga0207648_10089361 3300026089 Bacteria 2691
460 Ga0207648_10273239 3300026089 Bacteria 1510
461 Ga0207676_10000001 3300026095 Bacteria 1439222
462 Ga0207676_10011127 3300026095 Bacteria 6423
463 Ga0207676_10020600 3300026095 Bacteria 4827
464 Ga0207674_10033670 3300026116 Bacteria 5363
465 Ga0207675_100001206 3300026118 Bacteria 25753
466 Ga0207675_100002146 3300026118 Bacteria 19587
467 Ga0207675_100006135 3300026118 Bacteria 11424
468 Ga0207675_100031090 3300026118 Bacteria 4971
469 Ga0207675_100038809 3300026118 Bacteria 4444
470 Ga0207675_100104968 3300026118 Bacteria 2663
471 Ga0207675_100180377 3300026118 Bacteria 2022
472 Ga0207683_10016248 3300026121 Bacteria 6333
473 Ga0207683_10019417 3300026121 Bacteria 5804
474 Ga0207683_10082422 3300026121 Bacteria 2857
475 Ga0207698_10130633 3300026142 Bacteria 2145
476 Ga0209281_1000084 3300027111 Bacteria 254215
477 Ga0209281_1000200 3300027111 Bacteria 135685
478 Ga0209281_1000227 3300027111 Bacteria 119329
479 Ga0209589_1000042 3300027357 Bacteria 122436
480 Ga0209489_100095 3300027361 Bacteria 122436
481 Ga0209700_100095 3300027363 Bacteria 122436
482 Ga0209282_1000042 3300027666 Bacteria 119329
483 Ga0209588_1002309 3300027671 Bacteria 5162
484 Ga0209974_10015904 3300027876 Bacteria 2498
485 Ga0207428_10000026 3300027907 Bacteria 255539
486 Ga0207428_10000937 3300027907 Bacteria 32446
487 Ga0268266_10001081 3300028379 Bacteria 34140
488 Ga0268266_10009418 3300028379 Bacteria 8602
489 Ga0268266_10026439 3300028379 Bacteria 4938
490 Ga0268266_10044635 3300028379 Bacteria 3789
491 Ga0268266_10068908 3300028379 Bacteria 3064
492 Ga0268266_10171582 3300028379 Bacteria 1969
493 Ga0268265_10000035 3300028380 Bacteria 207267
494 Ga0268265_10000436 3300028380 Bacteria 44235
495 Ga0268265_10045156 3300028380 Bacteria 3286
496 Ga0268264_10000061 3300028381 Bacteria 303123
497 Ga0268264_10000153 3300028381 Bacteria 157298
498 Ga0268264_10002586 3300028381 Bacteria 15829
499 Ga0268264_10003066 3300028381 Bacteria 14474
500 Ga0268264_10020209 3300028381 Bacteria 5443
501 Ga0268264_10056606 3300028381 Bacteria 3278
502 Ga0307517_10000115 3300028786 Bacteria 118327
503 Ga0307517_10040568 3300028786 Bacteria 5063
504 Ga0307517_10065943 3300028786 Bacteria 3340
505 Ga0307515_10000123 3300028794 Bacteria 186601
506 Ga0307515_10001309 3300028794 Bacteria 56564
507 Ga0307515_10006687 3300028794 Bacteria 22962
508 Ga0307515_10006795 3300028794 Bacteria 22758
509 Ga0307515_10010448 3300028794 Bacteria 17785
510 Ga0307515_10042388 3300028794 Bacteria 7121
511 Ga0307515_10076789 3300028794 Bacteria 4423
512 Ga0307515_10186638 3300028794 Bacteria 2000
513 Ga0265338_10023127 3300028800 Bacteria 6400
514 Ga0307511_10000541 3300030521 Bacteria 40505
515 Ga0307511_10062089 3300030521 Bacteria 2840
516 Ga0307512_10034667 3300030522 Bacteria 4314
517 Ga0316181_1183610 3300030744 Bacteria 5049
518 Ga0265325_10048230 3300031241 Bacteria 2202
519 Ga0265316_10013079 3300031344 Bacteria 7402
520 Ga0307513_10002506 3300031456 Bacteria 25411
521 Ga0307513_10012786 3300031456 Bacteria 10337
522 Ga0307513_10015322 3300031456 Bacteria 9298
523 Ga0307513_10095926 3300031456 Bacteria 3005
524 Ga0307513_10124414 3300031456 Bacteria 2538
525 Ga0307509_10000333 3300031507 Bacteria 77879
526 Ga0307509_10000539 3300031507 Bacteria 64754
527 Ga0307509_10022078 3300031507 Bacteria 7185
528 Ga0307509_10033967 3300031507 Bacteria 5608
529 Ga0307509_10036877 3300031507 Bacteria 5348
530 Ga0307509_10086071 3300031507 Bacteria 3232
531 Ga0307509_10200130 3300031507 Bacteria 1835
532 Ga0307408_100022215 3300031548 Bacteria 4308
533 Ga0307408_100074110 3300031548 Bacteria 2525
534 Ga0307508_10000640 3300031616 Bacteria 42119
535 Ga0307508_10000727 3300031616 Bacteria 39082
536 Ga0307508_10006268 3300031616 Bacteria 11201
537 Ga0307508_10008420 3300031616 Bacteria 9526
538 Ga0307508_10079883 3300031616 Bacteria 2852
539 Ga0307514_10001271 3300031649 Bacteria 32966
540 Ga0307514_10019042 3300031649 Bacteria 5621
541 Ga0265314_10058516 3300031711 Bacteria 2640
542 Ga0265342_10076793 3300031712 Bacteria 1936
543 Ga0316576_10003425 3300031727 Bacteria 9283
544 Ga0316578_10111996 3300031728 Bacteria 1639
545 Ga0307516_10017736 3300031730 Bacteria 7417
546 Ga0307516_10033117 3300031730 Bacteria 5201
547 Ga0307516_10156730 3300031730 Bacteria 2031
548 Ga0307516_10162414 3300031730 Bacteria 1983
549 Ga0307405_10010158 3300031731 Bacteria 4861
550 Ga0307413_10030431 3300031824 Bacteria 3033
551 Ga0307413_10117523 3300031824 Bacteria 1794
552 Ga0307413_10144382 3300031824 Bacteria 1649
553 Ga0307410_10041291 3300031852 Bacteria 3041
554 Ga0307410_10057438 3300031852 Bacteria 2650
555 Ga0307406_10010677 3300031901 Bacteria 5186
556 Ga0307407_10025776 3300031903 Bacteria 3104
557 Ga0307412_10010376 3300031911 Bacteria 5362
558 Ga0307412_10099922 3300031911 Bacteria 2050
559 Ga0307412_10106108 3300031911 Bacteria 1997
560 Ga0307412_10127381 3300031911 Bacteria 1844
561 Ga0315914_1000009 3300031967 Bacteria 182444
562 Ga0307409_100000814 3300031995 Bacteria 14314
563 Ga0307409_100039573 3300031995 Bacteria 3500
564 Ga0307409_100154027 3300031995 Bacteria 2000
565 Ga0307416_100021865 3300032002 Bacteria 4604
566 Ga0307414_10013742 3300032004 Bacteria 4828
567 Ga0307414_10084921 3300032004 Bacteria 2330
568 Ga0307411_10001811 3300032005 Bacteria 9059
569 Ga0307411_10003000 3300032005 Bacteria 7689
570 Ga0307411_10046706 3300032005 Bacteria 2794
571 Ga0307411_10157309 3300032005 Bacteria 1697
572 Ga0307415_100203445 3300032126 Bacteria 1573
573 Ga0307510_10000023 3300033180 Bacteria 155640
574 Ga0307510_10007145 3300033180 Bacteria 13293
575 Ga0307510_10056415 3300033180 Bacteria 4091
576 Ga0307510_10065641 3300033180 Bacteria 3673
577 Ga0307510_10071237 3300033180 Bacteria 3464
578 Ga0307510_10104077 3300033180 Bacteria 2613
579 Ga0315913_1000015 3300033430 Bacteria 119325
580 Ga0315915_1000013 3300033464 Bacteria 182438
581 Ga0316574_0063443 3300035398 Bacteria 2324
582 Ga0373931_0037306 3300035691 Bacteria 2537
583 Ga0373927_0000141 3300035695 Bacteria 55933
584 Ga0373937_0253682 3300036401 Bacteria 1658
585 Ga0316582_0006931 3300036647 Bacteria 5995
586 Ga0316582_0178748 3300036647 Bacteria 1443
587 Ga0373925_0002260 3300037068 Bacteria 15592
588 Ga0373925_0037538 3300037068 Bacteria 3577
589 Ga0373925_0289752 3300037068 Bacteria 1320
590 Ga0395905_0000091 3300037471 Bacteria 151747
591 Ga0395905_0001489 3300037471 Bacteria 28024
592 Ga0395905_0023190 3300037471 Bacteria 5866
593 Ga0395905_0140917 3300037471 Bacteria 2268
594 Ga0395901_0004559 3300038443 Bacteria 13986
595 Ga0400483_150886 3300039062 Bacteria 6031
596 Ga0436365_0492506 3300039437 Bacteria 6832
597 Ga0436360_1140827 3300039438 Bacteria 4316
598 Ga0436361_0276468 3300039447 Bacteria 5303
599 Ga0439465_0029187 3300041413 Bacteria 1752
600 Ga0451791_1040051 3300041451 Bacteria 5797
601 Ga0451807_0254012 3300041486 Bacteria 3634
602 Ga0439433_0011253 3300041999 Bacteria 1958
603 Ga0439449_0009998 3300042007 Bacteria 3590
604 Ga0439462_0006603 3300042015 Bacteria 2887
605 Ga0450919_000188 3300042121 Bacteria 6676
606 Ga0450896_005054 3300042133 Bacteria 1796
607 Ga0439459_0015402 3300042438 Bacteria 1401
608 Ga0451577_0003794 3300042876 Bacteria 16448
609 Ga0466969_0000198 3300044656 Bacteria 32667
610 Ga0453683_0021967 3300044673 Bacteria 4072
611 Ga0466966_0004454 3300044684 Bacteria 9237
612 Ga0466966_0012023 3300044684 Bacteria 5737
613 Ga0466961_0008979 3300044693 Bacteria 6378
614 Ga0466961_0035887 3300044693 Bacteria 3182
615 Ga0466963_0004084 3300044694 Bacteria 8445
616 Ga0453684_0126776 3300044712 Bacteria 3070
617 Ga0466971_0007674 3300044719 Bacteria 4705
618 Ga0466970_0012562 3300044765 Bacteria 4333
619 Ga0466957_0050523 3300044842 Bacteria 2530
620 Ga0466959_0016963 3300045049 Bacteria 5331
621 Ga0451576_0004545 3300045051 Bacteria 17969
622 Ga0451576_0328538 3300045051 Bacteria 1601
623 Ga0466958_0014422 3300045836 Bacteria 4512
624 Ga0466967_0014366 3300045976 Bacteria 6165
625 Ga0495617_000377 3300046452 Bacteria 24634
626 Ga0495638_0002960 3300046460 Bacteria 13557
627 Ga0495638_0003111 3300046460 Bacteria 13152
628 Ga0495638_0032266 3300046460 Bacteria 3359
629 Ga0495638_0033066 3300046460 Bacteria 3309
630 Ga0495638_0042772 3300046460 Bacteria 2861
631 Ga0495653_0000009 3300046463 Bacteria 304207
632 Ga0495650_0000184 3300046471 Bacteria 136939
633 Ga0495650_0000240 3300046471 Bacteria 109029
634 Ga0495584_0001561 3300046491 Bacteria 13600
635 Ga0495606_0001061 3300046507 Bacteria 39727
636 Ga0495606_0004320 3300046507 Bacteria 14293
637 Ga0495610_0009062 3300046512 Bacteria 6344
638 Ga0495610_0024493 3300046512 Bacteria 3255
639 Ga0495616_0005415 3300046513 Bacteria 7863
640 Ga0495632_0003595 3300046519 Bacteria 10912
641 Ga0495632_0015652 3300046519 Bacteria 4241
642 Ga0495644_0000287 3300046523 Bacteria 23293
643 Ga0495654_0062965 3300046530 Bacteria 1777
644 Ga0495609_0000866 3300046538 Bacteria 22239
645 Ga0495609_0083056 3300046538 Bacteria 1399
646 Ga0495645_0034890 3300046543 Bacteria 3668
647 Ga0495656_0002526 3300046615 Bacteria 6092
648 Ga0495656_0022562 3300046615 Bacteria 2467
649 Ga0495668_0000002 3300046616 Bacteria 763179
650 Ga0495668_0002028 3300046616 Bacteria 17669
651 Ga0495668_0008340 3300046616 Bacteria 6487
652 Ga0495668_0044664 3300046616 Bacteria 2463
653 Ga0495611_0000347 3300046648 Bacteria 30158
654 Ga0495625_0000990 3300046660 Bacteria 37644
655 Ga0495625_0007420 3300046660 Bacteria 9548
656 Ga0495625_0025679 3300046660 Bacteria 4465
657 Ga0495625_0037357 3300046660 Bacteria 3564
658 Ga0495625_0091715 3300046660 Bacteria 2100
659 Ga0495658_0154754 3300046683 Bacteria 1410
660 Ga0495671_0000926 3300046692 Bacteria 20774
661 Ga0495649_0022211 3300046694 Bacteria 3550
662 Ga0495677_0000287 3300047445 Bacteria 22154
663 Ga0495681_0034048 3300047470 Bacteria 2542
664 Ga0495686_0040467 3300047472 Bacteria 2972
665 Ga0495686_0040964 3300047472 Bacteria 2951
666 Ga0496101_0099942 3300048904 Bacteria 2169
667 Ga0496101_0100295 3300048904 Bacteria 2166
668 Ga0496102_0003979 3300048905 Bacteria 12519
669 Ga0496102_0105810 3300048905 Bacteria 2618
670 Ga0496102_0109711 3300048905 Bacteria 2572
671 Ga0496104_0010257 3300048907 Bacteria 8368
672 Ga0496104_0030153 3300048907 Bacteria 5038
673 Ga0496105_0070919 3300048908 Bacteria 2880
674 Ga0496106_0000980 3300048909 Bacteria 20817
675 Ga0496106_0004082 3300048909 Bacteria 10891
676 Ga0496107_0172183 3300048910 Bacteria 1607
677 Ga0496109_0031019 3300048912 Bacteria 4793
678 Ga0496111_0199515 3300048914 Bacteria 1488
679 Ga0496112_0004020 3300048915 Bacteria 12332
680 Ga0496114_0004364 3300048917 Bacteria 10953
681 Ga0496114_0027194 3300048917 Bacteria 4684
682 Ga0496114_0090051 3300048917 Bacteria 2604
683 Ga0496114_0142678 3300048917 Bacteria 2075
684 Ga0496114_0167835 3300048917 Bacteria 1912
685 Ga0496116_0014580 3300048919 Bacteria 6266
686 Ga0496117_0000434 3300048920 Bacteria 69571
687 Ga0496117_0002639 3300048920 Bacteria 22240
688 Ga0496117_0005831 3300048920 Bacteria 12760
689 Ga0496118_0005579 3300048921 Bacteria 14247
690 Ga0496119_0013173 3300048922 Bacteria 6615
691 Ga0496120_0001446 3300048923 Bacteria 28425
692 Ga0496121_0000353 3300048924 Bacteria 95678
693 Ga0496121_0006775 3300048924 Bacteria 14050
694 Ga0496121_0018849 3300048924 Bacteria 6926
695 Ga0496121_0052320 3300048924 Bacteria 3431
696 Ga0496122_0000137 3300048925 Bacteria 170016
697 Ga0496122_0001470 3300048925 Bacteria 37937
698 Ga0496123_0000018 3300048926 Bacteria 404553
699 Ga0496123_0000022 3300048926 Bacteria 361832
700 Ga0496124_0000285 3300048927 Bacteria 95893
701 Ga0496124_0003608 3300048927 Bacteria 18803
702 Ga0496124_0022230 3300048927 Bacteria 5820
703 Ga0496124_0192186 3300048927 Bacteria 1560
704 Ga0496124_0198544 3300048927 Bacteria 1528
705 Ga0496125_0000215 3300048928 Bacteria 118487
706 Ga0496125_0000318 3300048928 Bacteria 93900
707 Ga0496125_0025330 3300048928 Bacteria 5435
708 Ga0496125_0038719 3300048928 Bacteria 4119
709 Ga0496126_0080068 3300048929 Bacteria 2891
710 Ga0496126_0108498 3300048929 Bacteria 2420
711 Ga0495682_0000291 3300049460 Bacteria 38579
712 Ga0495682_0033963 3300049460 Bacteria 1882
713 Ga0501033_0153066 3300049570 Bacteria 1663
714 Ga0501033_0171860 3300049570 Bacteria 1556
715 Ga0501034_0000807 3300049571 Bacteria 46580
716 Ga0501034_0070465 3300049571 Bacteria 3507
717 Ga0501034_0123694 3300049571 Bacteria 2572
718 Ga0501034_0202866 3300049571 Bacteria 1940
719 Ga0501034_0260860 3300049571 Bacteria 1675
720 Ga0501036_0076433 3300049572 Bacteria 2832
721 Ga0501036_0133631 3300049572 Bacteria 2094
722 Ga0501037_0057199 3300049573 Bacteria 2847
723 Ga0501041_0121754 3300049577 Bacteria 1622
724 Ga0501046_0013179 3300049580 Bacteria 7011
725 Ga0501046_0096412 3300049580 Bacteria 2272
726 Ga0501047_0033253 3300049581 Bacteria 4977
727 Ga0501067_0033911 3300049583 Bacteria 2833
728 Ga0501069_0046654 3300049585 Bacteria 2404
729 Ga0501070_0167135 3300049586 Bacteria 1813
730 Ga0501071_0016463 3300049587 Bacteria 5085
731 Ga0501072_0130240 3300049588 Bacteria 2005
732 Ga0501073_0001736 3300049589 Bacteria 16195
733 Ga0501076_0037579 3300049592 Bacteria 3798
734 Ga0501076_0057722 3300049592 Bacteria 3083
735 Ga0501077_0027847 3300049593 Bacteria 3589
736 Ga0501077_0088836 3300049593 Bacteria 1959
737 Ga0501079_0010367 3300049741 Bacteria 7082
738 Ga0501080_0000921 3300049742 Bacteria 24022
739 Ga0501080_0093028 3300049742 Bacteria 2800
740 Ga0501080_0298596 3300049742 Bacteria 1461
741 Ga0501081_0026182 3300049743 Bacteria 3931
742 Ga0501081_0127915 3300049743 Bacteria 1813
743 Ga0501083_0007148 3300049744 Bacteria 7924
744 Ga0501035_0000263 3300049822 Bacteria 62255
745 Ga0501035_0017062 3300049822 Bacteria 6690
746 Ga0501035_0169841 3300049822 Bacteria 1884
747 Ga0501044_0059852 3300049823 Bacteria 3901
748 Ga0501045_0106666 3300049824 Bacteria 2076
749 Ga0501045_0199936 3300049824 Bacteria 1489
750 nmdc:mga03n38_52311_c1 3300050490 Bacteria 1827
751 nmdc:mga00v17_23585_c1 3300050491 Bacteria 3560
752 nmdc:mga0yw44_6756_c1 3300050492 Bacteria 5573
753 nmdc:mga0k408_61113_c1 3300050493 Bacteria 2190
754 nmdc:mga0k408_8011_c1 3300050493 Bacteria 1719
755 nmdc:mga06z11_3482_c1 3300050494 Bacteria 6096
756 nmdc:mga06z11_56445_c1 3300050494 Bacteria 2031
757 nmdc:mga07m45_156856_c1 3300050496 Bacteria 1321
758 nmdc:mga07m45_28522_c1 3300050496 Bacteria 3081
759 nmdc:mga05p37_152813_c1 3300050507 Bacteria 2822
760 nmdc:mga05p37_15503_c1 3300050507 Bacteria 9162
761 nmdc:mga05p37_49098_c1 3300050507 Bacteria 5191
762 nmdc:mga05p37_756_c1 3300050507 Bacteria 35847
763 nmdc:mga06r32_94733_c1 3300050510 Bacteria 2922
764 nmdc:mga08y16_143302_c1 3300050511 Bacteria 2484
765 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
766 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
767 nmdc:mga08y16_39329_c1 3300050511 Unclassified 4963
768 nmdc:mga08y16_53155_c1 3300050511 Bacteria 4237
769 nmdc:mga0n895_128986_c1 3300050512 Bacteria 2553
770 nmdc:mga0n895_377336_c1 3300050512 Bacteria 1435
771 nmdc:mga0rr50_125558_c1 3300050513 Bacteria 2048
772 nmdc:mga0rr50_555_c1 3300050513 Bacteria 20080
773 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
774 nmdc:mga0a205_100102_c1 3300050515 Bacteria 2797
775 nmdc:mga0a205_125077_c1 3300050515 Bacteria 2471
776 nmdc:mga0a205_138747_c1 3300050515 Bacteria 2331
777 nmdc:mga0a205_203908_c1 3300050515 Bacteria 1867
778 nmdc:mga0a205_263127_c1 3300050515 Bacteria 1602
779 nmdc:mga0a205_40160_c1 3300050515 Bacteria 4504
780 nmdc:mga0a205_65705_c1 3300050515 Bacteria 3505
781 Ga0500578_0001295 3300053086 Bacteria 25808
782 Ga0500643_000173 3300053087 Bacteria 63279
783 Ga0500644_0017307 3300053088 Bacteria 2091
784 Ga0500644_0045479 3300053088 Bacteria 1479
785 Ga0500647_0010667 3300053091 Bacteria 4074
786 Ga0500566_0000353 3300053094 Bacteria 24984
787 Ga0500640_000097 3300053095 Bacteria 15377
788 Ga0500555_007872 3300053103 Bacteria 3030
789 Ga0500556_0000447 3300053104 Bacteria 29406
790 Ga0500572_000165 3300053111 Bacteria 22976
791 Ga0500572_000219 3300053111 Bacteria 20348
792 Ga0500592_012512 3300053116 Bacteria 1359
793 Ga0500595_017015 3300053119 Bacteria 2696
794 Ga0500608_000287 3300053122 Bacteria 19708
795 Ga0500608_003613 3300053122 Bacteria 5833
796 Ga0500614_001090 3300053123 Bacteria 6715
797 Ga0500652_000611 3300053131 Bacteria 12307
798 Ga0500559_0000241 3300053136 Bacteria 43480
799 Ga0500559_0003511 3300053136 Bacteria 7681
800 Ga0500559_0004615 3300053136 Bacteria 6508
801 Ga0500568_0001443 3300053139 Bacteria 15328
802 Ga0500577_0002449 3300053142 Bacteria 4749
803 Ga0500603_001328 3300053150 Bacteria 5670
804 Ga0500616_0000554 3300053153 Bacteria 46158
805 Ga0500616_0000902 3300053153 Bacteria 32595
806 Ga0500620_020810 3300053155 Bacteria 1951
807 Ga0500622_0000146 3300053156 Bacteria 74615
808 Ga0500622_0007254 3300053156 Bacteria 6311
809 Ga0500627_0000002 3300053158 Bacteria 235747
810 Ga0500627_0058474 3300053158 Bacteria 1692
811 Ga0500630_001600 3300053159 Bacteria 10834
812 Ga0500634_0003106 3300053161 Bacteria 7288
813 Ga0500638_009701 3300053162 Bacteria 4180
814 Ga0500639_000023 3300053163 Bacteria 85696
815 Ga0500639_005725 3300053163 Bacteria 6383
816 Ga0500636_0029297 3300053177 Bacteria 3251
817 Ga0500636_0029703 3300053177 Bacteria 3231
818 Ga0500637_0036213 3300053178 Bacteria 2770
819 Ga0500596_000750 3300053735 Bacteria 6389
820 Ga0500587_001814 3300053739 Bacteria 3036
821 Ga0501084_0012130 3300054114 Bacteria 7133
822 Ga0501082_0092288 3300060353 Bacteria 2616
823 Ga0466962_0000986 3300061719 Bacteria 12971

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0140917 Ga0395905_0140917_1121_2239 366
2 3300053088 Ga0500644_0017307 Ga0500644_0017307_10_1131 373
3 3300026075 Ga0207708_10083355 Ga0207708_100833552 374
4 3300049570 Ga0501033_0153066 Ga0501033_0153066_497_1639 380
5 3300049580 Ga0501046_0096412 Ga0501046_0096412_1119_2261 380
6 3300037068 Ga0373925_0289752 Ga0373925_0289752_43_1197 384
7 3300031507 Ga0307509_10000539 Ga0307509_1000053932 391
8 3300033180 Ga0307510_10056415 Ga0307510_100564153 391
9 iso_pu_bacteria 2977907340 2977911605 391
10 3300049586 Ga0501070_0167135 Ga0501070_0167135_570_1748 392
11 3300050496 nmdc:mga07m45_156856_c1 nmdc:mga07m45_156856_c1_126_1307 393
12 iso_pu_bacteria 2597489875 2597816475 393
13 3300049588 Ga0501072_0130240 Ga0501072_0130240_635_1942 396
14 iso_pu_bacteria 2869169390 2869171938 397
15 iso_pu_bacteria 2906354277 2906355469 401
16 3300050512 nmdc:mga0n895_377336_c1 nmdc:mga0n895_377336_c1_12_1223 403
17 3300025907 Ga0207645_10066238 Ga0207645_100662381 404
18 3300026089 Ga0207648_10273239 Ga0207648_102732391 404
19 iso_pu_bacteria 2551306092 2551736324 405
20 3300005842 Ga0068858_100020349 Ga0068858_1000203491 406
21 3300026035 Ga0207703_10096342 Ga0207703_100963422 406
22 3300048924 Ga0496121_0006775 Ga0496121_0006775_3414_4697 406
23 3300003203 JGI25406J46586_10010437 JGI25406J46586_100104372 408
24 3300005985 Ga0081539_10005442 Ga0081539_1000544210 408
25 3300006941 Ga0099825_1022929 Ga0099825_10229295 408
26 3300006942 Ga0099824_1025812 Ga0099824_10258123 408
27 3300006943 Ga0099822_1007677 Ga0099822_10076775 408
28 3300027357 Ga0209589_1000042 Ga0209589_100004240 408
29 3300027361 Ga0209489_100095 Ga0209489_10009540 408
30 3300027363 Ga0209700_100095 Ga0209700_10009540 408
31 3300053139 Ga0500568_0001443 Ga0500568_0001443_90_1382 410
32 3300030521 Ga0307511_10062089 Ga0307511_100620892 411
33 3300025230 Ga0209563_103701 Ga0209563_1037012 412
34 3300031901 Ga0307406_10010677 Ga0307406_100106775 412
35 3300046683 Ga0495658_0154754 Ga0495658_0154754_135_1373 412
36 3300048919 Ga0496116_0014580 Ga0496116_0014580_1131_2423 412
37 3300048927 Ga0496124_0000285 Ga0496124_0000285_37831_39123 412
38 3300010375 Ga0105239_10248527 Ga0105239_102485271 413
39 3300025914 Ga0207671_10108418 Ga0207671_101084182 413
40 3300027876 Ga0209974_10015904 Ga0209974_100159042 413
41 3300028786 Ga0307517_10000115 Ga0307517_10000115102 413
42 3300031507 Ga0307509_10200130 Ga0307509_102001301 413
43 3300031616 Ga0307508_10008420 Ga0307508_100084202 413
44 3300031730 Ga0307516_10017736 Ga0307516_100177363 413
45 3300031730 Ga0307516_10156730 Ga0307516_101567302 413
46 3300031730 Ga0307516_10162414 Ga0307516_101624141 413
47 3300044673 Ga0453683_0021967 Ga0453683_0021967_2644_3933 413
48 3300045051 Ga0451576_0004545 Ga0451576_0004545_5537_6826 413
49 3300046660 Ga0495625_0007420 Ga0495625_0007420_4785_6074 413
50 3300046660 Ga0495625_0091715 Ga0495625_0091715_150_1439 413
51 3300048909 Ga0496106_0004082 Ga0496106_0004082_5703_7001 413
52 3300048917 Ga0496114_0142678 Ga0496114_0142678_313_1602 413
53 3300048920 Ga0496117_0005831 Ga0496117_0005831_4995_6293 413
54 3300048921 Ga0496118_0005579 Ga0496118_0005579_11064_12362 413
55 3300048924 Ga0496121_0000353 Ga0496121_0000353_93960_95258 413
56 3300048927 Ga0496124_0003608 Ga0496124_0003608_7814_9112 413
57 3300048928 Ga0496125_0025330 Ga0496125_0025330_1572_2870 413
58 3300053119 Ga0500595_017015 Ga0500595_017015_28_1326 413
59 iso_pu_bacteria 2551306087 2551704015 413
60 3300009174 Ga0105241_10086598 Ga0105241_100865982 414
61 3300009545 Ga0105237_10205210 Ga0105237_102052102 414
62 3300025911 Ga0207654_10046135 Ga0207654_100461352 414
63 3300031456 Ga0307513_10124414 Ga0307513_101244142 414
64 3300031507 Ga0307509_10086071 Ga0307509_100860713 414
65 3300031616 Ga0307508_10006268 Ga0307508_100062687 414
66 3300044684 Ga0466966_0012023 Ga0466966_0012023_3507_4805 414
67 3300045049 Ga0466959_0016963 Ga0466959_0016963_1414_2712 414
68 3300053111 Ga0500572_000219 Ga0500572_000219_7912_9207 414
69 3300053136 Ga0500559_0000241 Ga0500559_0000241_36134_37429 414
70 3300053163 Ga0500639_005725 Ga0500639_005725_2486_3781 414
71 3300053735 Ga0500596_000750 Ga0500596_000750_3210_4505 414
72 3300005543 Ga0070672_100230904 Ga0070672_1002309042 415
73 3300025940 Ga0207691_10145852 Ga0207691_101458522 415
74 3300053104 Ga0500556_0000447 Ga0500556_0000447_16980_18287 415
75 iso_pu_bacteria 2551306089 2551710324 415
76 iso_pu_bacteria 8004395343 8004396193 415
77 3300005440 Ga0070705_100031594 Ga0070705_1000315942 418
78 3300031852 Ga0307410_10057438 Ga0307410_100574382 418
79 3300032126 Ga0307415_100203445 Ga0307415_1002034452 418
80 3300050515 nmdc:mga0a205_125077_c1 nmdc:mga0a205_125077_c1_1003_2295 418
81 3300053122 Ga0500608_000287 Ga0500608_000287_8384_9676 418
82 3300035691 Ga0373931_0037306 Ga0373931_0037306_446_1738 420
83 iso_pu_bacteria 8057132660 8057136108 420
84 3300048905 Ga0496102_0003979 Ga0496102_0003979_1260_2549 421
85 3300046507 Ga0495606_0001061 Ga0495606_0001061_11436_12728 422
86 iso_pu_bacteria 2738541317 2738945072 422
87 iso_pu_bacteria 2913308742 2913309698 422
88 3300003791 Ga0055530_10002372 Ga0055530_100023723 423
89 3300003792 Ga0055540_1000026 Ga0055540_100002611 423
90 3300003794 Ga0055531_10027659 Ga0055531_100276591 423
91 3300005983 Ga0081540_1008024 Ga0081540_10080246 423
92 3300013308 Ga0157375_10296498 Ga0157375_102964982 423
93 3300025298 Ga0209050_1000228 Ga0209050_100022868 423
94 3300025303 Ga0209051_1000004 Ga0209051_1000004490 423
95 3300025304 Ga0209257_1000423 Ga0209257_100042347 423
96 iso_pu_bacteria 2551306091 2551725600 423
97 3300006195 Ga0075366_10078689 Ga0075366_100786892 424
98 3300028794 Ga0307515_10076789 Ga0307515_100767892 424
99 3300050493 nmdc:mga0k408_8011_c1 nmdc:mga0k408_8011_c1_11_1303 424
100 iso_pu_bacteria 2891373044 2891376690 424
101 iso_pu_bacteria 2965032056 2965035758 424
102 iso_pu_bacteria 2509276018 2509370175 425
103 iso_pu_bacteria 2510065059 2510319699 425
104 iso_pu_bacteria 2643221580 2643909516 425
105 iso_pu_bacteria 2643221591 2643964347 425
106 iso_pu_bacteria 2643221674 2644411085 425
107 iso_pu_bacteria 2687453392 2688601275 425
108 iso_pu_bacteria 2765235802 2765469047 425
109 iso_pu_bacteria 2844002411 2844004271 425
110 iso_pu_bacteria 2856328259 2856332196 425
111 iso_pu_bacteria 2856334872 2856338886 425
112 iso_pu_bacteria 2856342000 2856348670 425
113 iso_pu_bacteria 2857367948 2857371050 425
114 iso_pu_bacteria 2869249662 2869253765 425
115 iso_pu_bacteria 2869264136 2869269506 425
116 iso_pu_bacteria 2869271264 2869277845 425
117 iso_pu_bacteria 2871459585 2871465886 425
118 iso_pu_bacteria 2874131515 2874136801 425
119 iso_pu_bacteria 2874162495 2874164565 425
120 iso_pu_bacteria 2876399893 2876404370 425
121 iso_pu_bacteria 2888343758 2888350254 425
122 iso_pu_bacteria 2894817345 2894820716 425
123 iso_pu_bacteria 2895880812 2895883379 425
124 iso_pu_bacteria 2906363423 2906367746 425
125 iso_pu_bacteria 2906370794 2906372477 425
126 iso_pu_bacteria 2906386501 2906392454 425
127 iso_pu_bacteria 2906393657 2906395155 425
128 iso_pu_bacteria 2906408224 2906411472 425
129 iso_pu_bacteria 2917554339 2917558091 425
130 iso_pu_bacteria 2922151315 2922156953 425
131 iso_pu_bacteria 2922172374 2922175223 425
132 iso_pu_bacteria 2922178524 2922183997 425
133 iso_pu_bacteria 2924733363 2924738104 425
134 iso_pu_bacteria 2924748358 2924749445 425
135 iso_pu_bacteria 2924754689 2924762734 425
136 iso_pu_bacteria 2932401849 2932404247 425
137 iso_pu_bacteria 2937868953 2937874306 425
138 iso_pu_bacteria 2958122699 2958125137 425
139 iso_pu_bacteria 2958137437 2958141906 425
140 iso_pu_bacteria 2961136820 2961140506 425
141 iso_pu_bacteria 2965025482 2965029003 425
142 iso_pu_bacteria 2965047637 2965050288 425
143 iso_pu_bacteria 2965089291 2965095730 425
144 iso_pu_bacteria 2970524798 2970525365 425
145 iso_pu_bacteria 2970547951 2970549931 425
146 iso_pu_bacteria 2977872689 2977878531 425
147 iso_pu_bacteria 2977915119 2977916070 425
148 iso_pu_bacteria 2977935797 2977940060 425
149 iso_pu_bacteria 2977957713 2977959933 425
150 iso_pu_bacteria 2979793036 2979798757 425
151 iso_pu_bacteria 2987673487 2987674074 425
152 iso_pu_bacteria 2989349275 2989351505 425
153 iso_pu_bacteria 2989771324 2989772697 425
154 iso_pu_bacteria 3004195979 3004200122 425
155 iso_pu_bacteria 3004268573 3004271993 425
156 iso_pu_bacteria 649633066 649875705 425
157 iso_pu_bacteria 8002285264 8002287281 425
158 iso_pu_bacteria 8004300914 8004303725 425
159 iso_pu_bacteria 8004361976 8004368446 425
160 iso_pu_bacteria 8054558443 8054562324 425
161 iso_pu_bacteria 8055617313 8055624679 425
162 3300009545 Ga0105237_10000659 Ga0105237_1000065946 426
163 3300010375 Ga0105239_10041756 Ga0105239_100417561 426
164 3300028379 Ga0268266_10171582 Ga0268266_101715822 426
165 3300031616 Ga0307508_10079883 Ga0307508_100798833 426
166 iso_pu_bacteria 2503198000 2503204654 426
167 iso_pu_bacteria 2508501122 2509106951 426
168 iso_pu_bacteria 2508501123 2509117880 426
169 iso_pu_bacteria 2508501127 2509145538 426
170 iso_pu_bacteria 2509276019 2509375093 426
171 iso_pu_bacteria 2509276033 2509448425 426
172 iso_pu_bacteria 2510065057 2510303561 426
173 iso_pu_bacteria 2510917026 2511168621 426
174 iso_pu_bacteria 2510917028 2511184475 426
175 iso_pu_bacteria 2510917030 2511199836 426
176 iso_pu_bacteria 2511231052 2511500433 426
177 iso_pu_bacteria 2512047086 2512531893 426
178 iso_pu_bacteria 2512875016 2512934620 426
179 iso_pu_bacteria 2512875024 2512962966 426
180 iso_pu_bacteria 2512875026 2512972778 426
181 iso_pu_bacteria 2513237086 2513585409 426
182 iso_pu_bacteria 2513237089 2513602833 426
183 iso_pu_bacteria 2513237090 2513613549 426
184 iso_pu_bacteria 2513237091 2513616657 426
185 iso_pu_bacteria 2513237140 2513885653 426
186 iso_pu_bacteria 2513237143 2513903996 426
187 iso_pu_bacteria 2513237144 2513911468 426
188 iso_pu_bacteria 2513237156 2513986207 426
189 iso_pu_bacteria 2513237159 2513996672 426
190 iso_pu_bacteria 2513237160 2514005085 426
191 iso_pu_bacteria 2513237164 2514039036 426
192 iso_pu_bacteria 2513237305 2514419094 426
193 iso_pu_bacteria 2513237351 2514589385 426
194 iso_pu_bacteria 2515154107 2515607635 426
195 iso_pu_bacteria 2515154114 2515642528 426
196 iso_pu_bacteria 2516143018 2516204428 426
197 iso_pu_bacteria 2516653046 2516891765 426
198 iso_pu_bacteria 2517487022 2517568563 426
199 iso_pu_bacteria 2524023207 2524450620 426
200 iso_pu_bacteria 2529292951 2530644541 426
201 iso_pu_bacteria 2551306084 2551677055 426
202 iso_pu_bacteria 2551306085 2551684021 426
203 iso_pu_bacteria 2551306090 2551719191 426
204 iso_pu_bacteria 2551306093 2551743814 426
205 iso_pu_bacteria 2558860100 2558866197 426
206 iso_pu_bacteria 2582581283 2585164905 426
207 iso_pu_bacteria 2582581299 2585231954 426
208 iso_pu_bacteria 2582581306 2585265283 426
209 iso_pu_bacteria 2582581308 2585278258 426
210 iso_pu_bacteria 2582581865 2585385583 426
211 iso_pu_bacteria 2582581866 2585391999 426
212 iso_pu_bacteria 2585427527 2585532082 426
213 iso_pu_bacteria 2585428057 2587730720 426
214 iso_pu_bacteria 2585428058 2587736984 426
215 iso_pu_bacteria 2585428062 2587758090 426
216 iso_pu_bacteria 2588253510 2588294900 426
217 iso_pu_bacteria 2588253730 2588514232 426
218 iso_pu_bacteria 2599185156 2599332400 426
219 iso_pu_bacteria 2599185236 2599720767 426
220 iso_pu_bacteria 2599185301 2599935902 426
221 iso_pu_bacteria 2615840626 2616307776 426
222 iso_pu_bacteria 2643221550 2643771809 426
223 iso_pu_bacteria 2643221564 2643839579 426
224 iso_pu_bacteria 2643221592 2643967744 426
225 iso_pu_bacteria 2643221595 2643988257 426
226 iso_pu_bacteria 2643221599 2644003454 426
227 iso_pu_bacteria 2643221607 2644047248 426
228 iso_pu_bacteria 2643221625 2644140566 426
229 iso_pu_bacteria 2643221627 2644156501 426
230 iso_pu_bacteria 2643221629 2644164400 426
231 iso_pu_bacteria 2643221634 2644195554 426
232 iso_pu_bacteria 2643221636 2644199619 426
233 iso_pu_bacteria 2643221644 2644243939 426
234 iso_pu_bacteria 2643221648 2644273533 426
235 iso_pu_bacteria 2643221662 2644346329 426
236 iso_pu_bacteria 2643221686 2644480037 426
237 iso_pu_bacteria 2657244999 2657681807 426
238 iso_pu_bacteria 2671180139 2671695376 426
239 iso_pu_bacteria 2690316117 2692317348 426
240 iso_pu_bacteria 2693429783 2694632389 426
241 iso_pu_bacteria 2693429784 2694640525 426
242 iso_pu_bacteria 2718217882 2719183808 426
243 iso_pu_bacteria 2718218009 2719728249 426
244 iso_pu_bacteria 2718218232 2720611192 426
245 iso_pu_bacteria 2718218363 2721145110 426
246 iso_pu_bacteria 2718218365 2721155847 426
247 iso_pu_bacteria 2718218366 2721167197 426
248 iso_pu_bacteria 2721755514 2722838175 426
249 iso_pu_bacteria 2721755686 2723578448 426
250 iso_pu_bacteria 2721755810 2724042443 426
251 iso_pu_bacteria 2728369365 2730161948 426
252 iso_pu_bacteria 2728369397 2730300954 426
253 iso_pu_bacteria 2738543024 2739308297 426
254 iso_pu_bacteria 2751185821 2753461255 426
255 iso_pu_bacteria 2756170246 2756674713 426
256 iso_pu_bacteria 2791355082 2792583012 426
257 iso_pu_bacteria 2791355091 2792623899 426
258 iso_pu_bacteria 2791355092 2792629721 426
259 iso_pu_bacteria 2791355094 2792638055 426
260 iso_pu_bacteria 2791355123 2792746415 426
261 iso_pu_bacteria 2791355256 2793298934 426
262 iso_pu_bacteria 2791355259 2793317169 426
263 iso_pu_bacteria 2791355260 2793324002 426
264 iso_pu_bacteria 2791355261 2793325688 426
265 iso_pu_bacteria 2791355262 2793333113 426
266 iso_pu_bacteria 2791355263 2793340088 426
267 iso_pu_bacteria 2791355264 2793346285 426
268 iso_pu_bacteria 2791355265 2793355502 426
269 iso_pu_bacteria 2802428858 2802720404 426
270 iso_pu_bacteria 2802428859 2802726224 426
271 iso_pu_bacteria 2802428860 2802731612 426
272 iso_pu_bacteria 2802428861 2802739363 426
273 iso_pu_bacteria 2802428862 2802742505 426
274 iso_pu_bacteria 2802428863 2802749210 426
275 iso_pu_bacteria 2802429268 2804750827 426
276 iso_pu_bacteria 2802429605 2805929099 426
277 iso_pu_bacteria 2802429606 2805937200 426
278 iso_pu_bacteria 2838022645 2838027223 426
279 iso_pu_bacteria 2838042994 2838045913 426
280 iso_pu_bacteria 2838074704 2838075279 426
281 iso_pu_bacteria 2838668709 2838671537 426
282 iso_pu_bacteria 2838701080 2838704196 426
283 iso_pu_bacteria 2841734538 2841735686 426
284 iso_pu_bacteria 2842146304 2842149186 426
285 iso_pu_bacteria 2842192696 2842195303 426
286 iso_pu_bacteria 2842198810 2842203404 426
287 iso_pu_bacteria 2842205361 2842210326 426
288 iso_pu_bacteria 2842250916 2842253647 426
289 iso_pu_bacteria 2842264693 2842270238 426
290 iso_pu_bacteria 2842278818 2842283780 426
291 iso_pu_bacteria 2842317721 2842319046 426
292 iso_pu_bacteria 2842428310 2842434060 426
293 iso_pu_bacteria 2842434925 2842440451 426
294 iso_pu_bacteria 2842441272 2842444024 426
295 iso_pu_bacteria 2842462802 2842468479 426
296 iso_pu_bacteria 2842469257 2842474997 426
297 iso_pu_bacteria 2842482326 2842486981 426
298 iso_pu_bacteria 2842489311 2842491496 426
299 iso_pu_bacteria 2842495871 2842499564 426
300 iso_pu_bacteria 2842521101 2842521602 426
301 iso_pu_bacteria 2842922631 2842922668 426
302 iso_pu_bacteria 2844009547 2844009936 426
303 iso_pu_bacteria 2847417321 2847417584 426
304 iso_pu_bacteria 2847686936 2847689286 426
305 iso_pu_bacteria 2848992105 2848992390 426
306 iso_pu_bacteria 2850079185 2850079887 426
307 iso_pu_bacteria 2854911287 2854916636 426
308 iso_pu_bacteria 2855825444 2855828133 426
309 iso_pu_bacteria 2855839649 2855839905 426
310 iso_pu_bacteria 2855872281 2855873471 426
311 iso_pu_bacteria 2856314179 2856314762 426
312 iso_pu_bacteria 2856320880 2856328245 426
313 iso_pu_bacteria 2856349417 2856350655 426
314 iso_pu_bacteria 2856364286 2856367296 426
315 iso_pu_bacteria 2857349434 2857354185 426
316 iso_pu_bacteria 2858800743 2858803878 426
317 iso_pu_bacteria 2869162929 2869164677 426
318 iso_pu_bacteria 2869234852 2869236424 426
319 iso_pu_bacteria 2869242130 2869244021 426
320 iso_pu_bacteria 2869256925 2869257869 426
321 iso_pu_bacteria 2869278585 2869282210 426
322 iso_pu_bacteria 2869285874 2869287579 426
323 iso_pu_bacteria 2871429161 2871431103 426
324 iso_pu_bacteria 2871435913 2871436650 426
325 iso_pu_bacteria 2871444079 2871449899 426
326 iso_pu_bacteria 2871451962 2871452507 426
327 iso_pu_bacteria 2871466892 2871469612 426
328 iso_pu_bacteria 2871474448 2871480573 426
329 iso_pu_bacteria 2871481445 2871485123 426
330 iso_pu_bacteria 2871495908 2871502066 426
331 iso_pu_bacteria 2874102143 2874105442 426
332 iso_pu_bacteria 2874109183 2874109965 426
333 iso_pu_bacteria 2874116593 2874119028 426
334 iso_pu_bacteria 2874123672 2874129661 426
335 iso_pu_bacteria 2874139085 2874145532 426
336 iso_pu_bacteria 2874146452 2874150375 426
337 iso_pu_bacteria 2874155637 2874157430 426
338 iso_pu_bacteria 2874168670 2874171602 426
339 iso_pu_bacteria 2876363079 2876363117 426
340 iso_pu_bacteria 2876369609 2876370747 426
341 iso_pu_bacteria 2876377896 2876381159 426
342 iso_pu_bacteria 2876386047 2876392686 426
343 iso_pu_bacteria 2876392853 2876394220 426
344 iso_pu_bacteria 2876413966 2876416526 426
345 iso_pu_bacteria 2876420981 2876427484 426
346 iso_pu_bacteria 2878730984 2878736685 426
347 iso_pu_bacteria 2878738818 2878740184 426
348 iso_pu_bacteria 2878745973 2878747716 426
349 iso_pu_bacteria 2878753008 2878755050 426
350 iso_pu_bacteria 2878760144 2878765967 426
351 iso_pu_bacteria 2878767105 2878773189 426
352 iso_pu_bacteria 2878788777 2878793685 426
353 iso_pu_bacteria 2881155292 2881158559 426
354 iso_pu_bacteria 2881161766 2881164235 426
355 iso_pu_bacteria 2881861095 2881861497 426
356 iso_pu_bacteria 2882632389 2882632919 426
357 iso_pu_bacteria 2885305155 2885306100 426
358 iso_pu_bacteria 2885312484 2885314839 426
359 iso_pu_bacteria 2885326080 2885327995 426
360 iso_pu_bacteria 2885334103 2885340462 426
361 iso_pu_bacteria 2885342637 2885343291 426
362 iso_pu_bacteria 2885350715 2885353625 426
363 iso_pu_bacteria 2888337043 2888342544 426
364 iso_pu_bacteria 2888350351 2888352120 426
365 iso_pu_bacteria 2889010040 2889014105 426
366 iso_pu_bacteria 2889016732 2889021185 426
367 iso_pu_bacteria 2889790730 2889792856 426
368 iso_pu_bacteria 2889914905 2889915011 426
369 iso_pu_bacteria 2896384573 2896391647 426
370 iso_pu_bacteria 2903448605 2903449471 426
371 iso_pu_bacteria 2903492973 2903498832 426
372 iso_pu_bacteria 2903492973 2903499464 426
373 iso_pu_bacteria 2903513507 2903517854 426
374 iso_pu_bacteria 2903521522 2903525067 426
375 iso_pu_bacteria 2903528002 2903531514 426
376 iso_pu_bacteria 2903540706 2903546949 426
377 iso_pu_bacteria 2904659560 2904660936 426
378 iso_pu_bacteria 2906308376 2906310117 426
379 iso_pu_bacteria 2906321335 2906322989 426
380 iso_pu_bacteria 2906328253 2906329059 426
381 iso_pu_bacteria 2906378014 2906384089 426
382 iso_pu_bacteria 2906401398 2906406875 426
383 iso_pu_bacteria 2906414383 2906414951 426
384 iso_pu_bacteria 2906427513 2906435715 426
385 iso_pu_bacteria 2913295892 2913298083 426
386 iso_pu_bacteria 2915650412 2915652492 426
387 iso_pu_bacteria 2915980308 2915980693 426
388 iso_pu_bacteria 2915986958 2915990567 426
389 iso_pu_bacteria 2915993759 2915998210 426
390 iso_pu_bacteria 2916000859 2916001014 426
391 iso_pu_bacteria 2916007675 2916011095 426
392 iso_pu_bacteria 2916014648 2916015515 426
393 iso_pu_bacteria 2916021584 2916025438 426
394 iso_pu_bacteria 2916028427 2916031124 426
395 iso_pu_bacteria 2916035215 2916036421 426
396 iso_pu_bacteria 2916041962 2916045662 426
397 iso_pu_bacteria 2916048683 2916053733 426
398 iso_pu_bacteria 2916055098 2916057312 426
399 iso_pu_bacteria 2916061851 2916063740 426
400 iso_pu_bacteria 2916068649 2916068687 426
401 iso_pu_bacteria 2916076590 2916082169 426
402 iso_pu_bacteria 2920760137 2920763487 426
403 iso_pu_bacteria 2921201388 2921207032 426
404 iso_pu_bacteria 2921208531 2921212228 426
405 iso_pu_bacteria 2921237296 2921242014 426
406 iso_pu_bacteria 2921244191 2921248910 426
407 iso_pu_bacteria 2921250672 2921257249 426
408 iso_pu_bacteria 2921257292 2921260928 426
409 iso_pu_bacteria 2921263974 2921266387 426
410 iso_pu_bacteria 2921282425 2921288504 426
411 iso_pu_bacteria 2921289301 2921294443 426
412 iso_pu_bacteria 2921296804 2921302837 426
413 iso_pu_bacteria 2922130491 2922137066 426
414 iso_pu_bacteria 2922158528 2922161052 426
415 iso_pu_bacteria 2922185730 2922187164 426
416 iso_pu_bacteria 2924144063 2924149818 426
417 iso_pu_bacteria 2924150972 2924156595 426
418 iso_pu_bacteria 2924158325 2924163403 426
419 iso_pu_bacteria 2924165586 2924170423 426
420 iso_pu_bacteria 2924172951 2924177706 426
421 iso_pu_bacteria 2924179722 2924183560 426
422 iso_pu_bacteria 2924186466 2924190796 426
423 iso_pu_bacteria 2924193448 2924199067 426
424 iso_pu_bacteria 2924200457 2924205599 426
425 iso_pu_bacteria 2924207177 2924209141 426
426 iso_pu_bacteria 2924214083 2924216527 426
427 iso_pu_bacteria 2924221636 2924228339 426
428 iso_pu_bacteria 2924228884 2924232827 426
429 iso_pu_bacteria 2924718760 2924722953 426
430 iso_pu_bacteria 2924741084 2924744348 426
431 iso_pu_bacteria 2924762789 2924768377 426
432 iso_pu_bacteria 2924776078 2924777784 426
433 iso_pu_bacteria 2924784321 2924791269 426
434 iso_pu_bacteria 2936367885 2936370237 426
435 iso_pu_bacteria 2936375103 2936377909 426
436 iso_pu_bacteria 2936381700 2936384104 426
437 iso_pu_bacteria 2936996657 2936997840 426
438 iso_pu_bacteria 2937002841 2937007629 426
439 iso_pu_bacteria 2937009748 2937014877 426
440 iso_pu_bacteria 2937016420 2937022379 426
441 iso_pu_bacteria 2937023124 2937023297 426
442 iso_pu_bacteria 2937029754 2937034619 426
443 iso_pu_bacteria 2937036028 2937041220 426
444 iso_pu_bacteria 2937042894 2937045973 426
445 iso_pu_bacteria 2937049772 2937051814 426
446 iso_pu_bacteria 2937056579 2937062655 426
447 iso_pu_bacteria 2937063883 2937068355 426
448 iso_pu_bacteria 2937071275 2937074828 426
449 iso_pu_bacteria 2937078374 2937078831 426
450 iso_pu_bacteria 2937084907 2937086625 426
451 iso_pu_bacteria 2937091812 2937095221 426
452 iso_pu_bacteria 2937098957 2937104411 426
453 iso_pu_bacteria 2937106411 2937112423 426
454 iso_pu_bacteria 2937113482 2937119551 426
455 iso_pu_bacteria 2937119839 2937126111 426
456 iso_pu_bacteria 2937126314 2937131534 426
457 iso_pu_bacteria 2937813078 2937815403 426
458 iso_pu_bacteria 2937822353 2937825862 426
459 iso_pu_bacteria 2937836603 2937837117 426
460 iso_pu_bacteria 2937843397 2937845985 426
461 iso_pu_bacteria 2937848649 2937851090 426
462 iso_pu_bacteria 2937861824 2937867466 426
463 iso_pu_bacteria 2937877337 2937881591 426
464 iso_pu_bacteria 2937891427 2937892944 426
465 iso_pu_bacteria 2937972304 2937976826 426
466 iso_pu_bacteria 2937980651 2937986413 426
467 iso_pu_bacteria 2937994558 2938000500 426
468 iso_pu_bacteria 2941499720 2941500811 426
469 iso_pu_bacteria 2957375807 2957382147 426
470 iso_pu_bacteria 2957382221 2957388597 426
471 iso_pu_bacteria 2957388812 2957393976 426
472 iso_pu_bacteria 2957395598 2957399094 426
473 iso_pu_bacteria 2957402308 2957403355 426
474 iso_pu_bacteria 2957408893 2957412023 426
475 iso_pu_bacteria 2957415311 2957418125 426
476 iso_pu_bacteria 2957430029 2957434082 426
477 iso_pu_bacteria 2957437181 2957442548 426
478 iso_pu_bacteria 2957443900 2957447218 426
479 iso_pu_bacteria 2957450854 2957455251 426
480 iso_pu_bacteria 2957457609 2957462732 426
481 iso_pu_bacteria 2957464669 2957466224 426
482 iso_pu_bacteria 2957471148 2957472155 426
483 iso_pu_bacteria 2957478035 2957479693 426
484 iso_pu_bacteria 2957484790 2957484910 426
485 iso_pu_bacteria 2957491536 2957496125 426
486 iso_pu_bacteria 2957498199 2957500588 426
487 iso_pu_bacteria 2957505466 2957508204 426
488 iso_pu_bacteria 2958034702 2958037984 426
489 iso_pu_bacteria 2958041894 2958042166 426
490 iso_pu_bacteria 2958041894 2958049298 426
491 iso_pu_bacteria 2958064165 2958066576 426
492 iso_pu_bacteria 2958071322 2958076460 426
493 iso_pu_bacteria 2958084443 2958088721 426
494 iso_pu_bacteria 2958092219 2958095319 426
495 iso_pu_bacteria 2958100919 2958102419 426
496 iso_pu_bacteria 2958108152 2958113560 426
497 iso_pu_bacteria 2958115193 2958119824 426
498 iso_pu_bacteria 2958130278 2958131981 426
499 iso_pu_bacteria 2958144490 2958151069 426
500 iso_pu_bacteria 2958165035 2958171157 426
501 iso_pu_bacteria 2958172287 2958174945 426
502 iso_pu_bacteria 2958179912 2958181784 426
503 iso_pu_bacteria 2960584000 2960589364 426
504 iso_pu_bacteria 2960591022 2960594676 426
505 iso_pu_bacteria 2960597568 2960603471 426
506 iso_pu_bacteria 2960603979 2960608780 426
507 iso_pu_bacteria 2960610863 2960614395 426
508 iso_pu_bacteria 2960617483 2960621606 426
509 iso_pu_bacteria 2960624210 2960628900 426
510 iso_pu_bacteria 2960631154 2960637547 426
511 iso_pu_bacteria 2960637947 2960645030 426
512 iso_pu_bacteria 2960645483 2960648006 426
513 iso_pu_bacteria 2960652885 2960658383 426
514 iso_pu_bacteria 2960660292 2960660502 426
515 iso_pu_bacteria 2960667422 2960672263 426
516 iso_pu_bacteria 2960674078 2960677211 426
517 iso_pu_bacteria 2960680706 2960686521 426
518 iso_pu_bacteria 2960687367 2960690376 426
519 iso_pu_bacteria 2960693952 2960698914 426
520 iso_pu_bacteria 2961077736 2961079628 426
521 iso_pu_bacteria 2961114664 2961120600 426
522 iso_pu_bacteria 2961127735 2961136265 426
523 iso_pu_bacteria 2961163497 2961169586 426
524 iso_pu_bacteria 2961170736 2961176908 426
525 iso_pu_bacteria 2961183825 2961187900 426
526 iso_pu_bacteria 2963644680 2963650996 426
527 iso_pu_bacteria 2964607997 2964610199 426
528 iso_pu_bacteria 2964615318 2964618927 426
529 iso_pu_bacteria 2964621998 2964627982 426
530 iso_pu_bacteria 2964628898 2964632714 426
531 iso_pu_bacteria 2964636051 2964639036 426
532 iso_pu_bacteria 2964643177 2964649304 426
533 iso_pu_bacteria 2964649959 2964650241 426
534 iso_pu_bacteria 2964656573 2964661157 426
535 iso_pu_bacteria 2964663802 2964668172 426
536 iso_pu_bacteria 2964670856 2964677324 426
537 iso_pu_bacteria 2964678106 2964683382 426
538 iso_pu_bacteria 2964685014 2964690611 426
539 iso_pu_bacteria 2964691889 2964694700 426
540 iso_pu_bacteria 2964698721 2964700570 426
541 iso_pu_bacteria 2964705432 2964709885 426
542 iso_pu_bacteria 2964712639 2964717307 426
543 iso_pu_bacteria 2964719344 2964722969 426
544 iso_pu_bacteria 2965018300 2965024074 426
545 iso_pu_bacteria 2965062239 2965067683 426
546 iso_pu_bacteria 2967664464 2967671509 426
547 iso_pu_bacteria 2967671571 2967675357 426
548 iso_pu_bacteria 2967678726 2967684794 426
549 iso_pu_bacteria 2967686174 2967691435 426
550 iso_pu_bacteria 2967693043 2967694979 426
551 iso_pu_bacteria 2967699805 2967704130 426
552 iso_pu_bacteria 2967706974 2967712160 426
553 iso_pu_bacteria 2967714385 2967714573 426
554 iso_pu_bacteria 2967721400 2967722552 426
555 iso_pu_bacteria 2967728569 2967730468 426
556 iso_pu_bacteria 2967735183 2967739323 426
557 iso_pu_bacteria 2967742019 2967745641 426
558 iso_pu_bacteria 2967748971 2967754962 426
559 iso_pu_bacteria 2967755722 2967759328 426
560 iso_pu_bacteria 2967762386 2967766480 426
561 iso_pu_bacteria 2967769361 2967774642 426
562 iso_pu_bacteria 2967775926 2967782554 426
563 iso_pu_bacteria 2967996073 2968000989 426
564 iso_pu_bacteria 2968003550 2968007042 426
565 iso_pu_bacteria 2968016561 2968021470 426
566 iso_pu_bacteria 2968083720 2968085712 426
567 iso_pu_bacteria 2968091066 2968093078 426
568 iso_pu_bacteria 2968097103 2968102716 426
569 iso_pu_bacteria 2968110612 2968111909 426
570 iso_pu_bacteria 2968117919 2968120257 426
571 iso_pu_bacteria 2968128360 2968130450 426
572 iso_pu_bacteria 2968171901 2968177990 426
573 iso_pu_bacteria 2970019648 2970022866 426
574 iso_pu_bacteria 2970026789 2970030489 426
575 iso_pu_bacteria 2970033650 2970037035 426
576 iso_pu_bacteria 2970040964 2970041190 426
577 iso_pu_bacteria 2970047711 2970052810 426
578 iso_pu_bacteria 2970054988 2970056767 426
579 iso_pu_bacteria 2970061556 2970067896 426
580 iso_pu_bacteria 2970068827 2970073931 426
581 iso_pu_bacteria 2970076120 2970081698 426
582 iso_pu_bacteria 2970082768 2970088460 426
583 iso_pu_bacteria 2970088815 2970091377 426
584 iso_pu_bacteria 2970095765 2970101995 426
585 iso_pu_bacteria 2970102677 2970105908 426
586 iso_pu_bacteria 2970109326 2970115681 426
587 iso_pu_bacteria 2970116247 2970117547 426
588 iso_pu_bacteria 2970122695 2970124301 426
589 iso_pu_bacteria 2970129317 2970131477 426
590 iso_pu_bacteria 2970136068 2970136684 426
591 iso_pu_bacteria 2970143518 2970147676 426
592 iso_pu_bacteria 2970149975 2970151795 426
593 iso_pu_bacteria 2970156795 2970163349 426
594 iso_pu_bacteria 2970164137 2970170027 426
595 iso_pu_bacteria 2970170962 2970175749 426
596 iso_pu_bacteria 2970177841 2970181989 426
597 iso_pu_bacteria 2970184632 2970189218 426
598 iso_pu_bacteria 2970191845 2970196635 426
599 iso_pu_bacteria 2970469710 2970476574 426
600 iso_pu_bacteria 2970489779 2970494309 426
601 iso_pu_bacteria 2970503327 2970509580 426
602 iso_pu_bacteria 2970510686 2970513466 426
603 iso_pu_bacteria 2970532167 2970538960 426
604 iso_pu_bacteria 2970554993 2970560822 426
605 iso_pu_bacteria 2970593180 2970596817 426
606 iso_pu_bacteria 2970619444 2970620417 426
607 iso_pu_bacteria 2970627176 2970632161 426
608 iso_pu_bacteria 2977516862 2977519998 426
609 iso_pu_bacteria 2977523885 2977528403 426
610 iso_pu_bacteria 2977530762 2977535771 426
611 iso_pu_bacteria 2977537788 2977543876 426
612 iso_pu_bacteria 2977544691 2977549555 426
613 iso_pu_bacteria 2977551784 2977553587 426
614 iso_pu_bacteria 2977558990 2977564805 426
615 iso_pu_bacteria 2977565890 2977571811 426
616 iso_pu_bacteria 2977572785 2977574602 426
617 iso_pu_bacteria 2977579622 2977584514 426
618 iso_pu_bacteria 2977821940 2977824190 426
619 iso_pu_bacteria 2977828996 2977834425 426
620 iso_pu_bacteria 2977843712 2977846631 426
621 iso_pu_bacteria 2977851361 2977857549 426
622 iso_pu_bacteria 2977864932 2977868487 426
623 iso_pu_bacteria 2977898635 2977900011 426
624 iso_pu_bacteria 2977922695 2977923428 426
625 iso_pu_bacteria 2977942078 2977949663 426
626 iso_pu_bacteria 2977971508 2977980260 426
627 iso_pu_bacteria 2977986579 2977992332 426
628 iso_pu_bacteria 2979710463 2979713811 426
629 iso_pu_bacteria 2979742915 2979748952 426
630 iso_pu_bacteria 2979772303 2979774507 426
631 iso_pu_bacteria 2979779861 2979780980 426
632 iso_pu_bacteria 2979808191 2979814368 426
633 iso_pu_bacteria 2987636660 2987642405 426
634 iso_pu_bacteria 2987652177 2987653732 426
635 iso_pu_bacteria 2987659509 2987665727 426
636 iso_pu_bacteria 2987666974 2987668010 426
637 iso_pu_bacteria 2996310559 2996315912 426
638 iso_pu_bacteria 2996341866 2996347001 426
639 iso_pu_bacteria 2996348954 2996356297 426
640 iso_pu_bacteria 2996386984 2996390861 426
641 iso_pu_bacteria 2996893221 2996896920 426
642 iso_pu_bacteria 3000135777 3000138012 426
643 iso_pu_bacteria 3003930520 3003931856 426
644 iso_pu_bacteria 3004167301 3004172383 426
645 iso_pu_bacteria 3004188549 3004194776 426
646 iso_pu_bacteria 3004203850 3004210487 426
647 iso_pu_bacteria 3004211236 3004212732 426
648 iso_pu_bacteria 3004218560 3004221422 426
649 iso_pu_bacteria 3004232784 3004238258 426
650 iso_pu_bacteria 3004248173 3004250832 426
651 iso_pu_bacteria 3004275668 3004282601 426
652 iso_pu_bacteria 3004289098 3004295462 426
653 iso_pu_bacteria 3004334049 3004338232 426
654 iso_pu_bacteria 3005416602 3005416795 426
655 iso_pu_bacteria 3005445848 3005451363 426
656 iso_pu_bacteria 637000159 637077794 426
657 iso_pu_bacteria 643692032 643824450 426
658 iso_pu_bacteria 648276728 648738526 426
659 iso_pu_bacteria 8003992118 8003992357 426
660 iso_pu_bacteria 8003999396 8003999686 426
661 iso_pu_bacteria 8004312739 8004320168 426
662 iso_pu_bacteria 8004374579 8004376629 426
663 iso_pu_bacteria 8004387939 8004390315 426
664 iso_pu_bacteria 8004445564 8004446200 426
665 iso_pu_bacteria 8004633249 8004635683 426
666 iso_pu_bacteria 8004640170 8004647078 426
667 iso_pu_bacteria 8004703790 8004707408 426
668 iso_pu_bacteria 8004714634 8004716379 426
669 iso_pu_bacteria 8004727605 8004734887 426
670 iso_pu_bacteria 8005289223 8005289268 426
671 iso_pu_bacteria 8005314921 8005320558 426
672 iso_pu_bacteria 8005376324 8005381918 426
673 iso_pu_bacteria 8005382845 8005388793 426
674 iso_pu_bacteria 8005395548 8005397595 426
675 iso_pu_bacteria 8005688590 8005689485 426
676 iso_pu_bacteria 8018127388 8018130402 426
677 iso_pu_bacteria 8024501048 8024505629 426
678 iso_pu_bacteria 8049293176 8049293383 426
679 iso_pu_bacteria 8056382006 8056383565 426
680 3300005293 Ga0065715_10002994 Ga0065715_100029943 427
681 3300005468 Ga0070707_100060644 Ga0070707_1000606443 427
682 3300005545 Ga0070695_100004821 Ga0070695_1000048215 427
683 3300005546 Ga0070696_100020844 Ga0070696_1000208443 427
684 3300005617 Ga0068859_100000668 Ga0068859_1000006686 427
685 3300005844 Ga0068862_100125365 Ga0068862_1001253652 427
686 3300006931 Ga0097620_100000668 Ga0097620_1000006686 427
687 3300042015 Ga0439462_0006603 Ga0439462_0006603_1334_2617 427
688 3300050515 nmdc:mga0a205_138747_c1 nmdc:mga0a205_138747_c1_322_1605 427
689 iso_pu_bacteria 2508501050 2508729199 427
690 iso_pu_bacteria 2508501114 2509078009 427
691 iso_pu_bacteria 2599185352 2600191359 427
692 iso_pu_bacteria 2643221557 2643806193 427
693 iso_pu_bacteria 2643221563 2643832745 427
694 iso_pu_bacteria 2643221608 2644053460 427
695 iso_pu_bacteria 2643221610 2644070203 427
696 iso_pu_bacteria 2643221618 2644103339 427
697 iso_pu_bacteria 2643221626 2644144278 427
698 iso_pu_bacteria 2643221655 2644306269 427
699 iso_pu_bacteria 2643221659 2644330518 427
700 iso_pu_bacteria 2643221668 2644377455 427
701 iso_pu_bacteria 2643221675 2644420965 427
702 iso_pu_bacteria 2643221680 2644454488 427
703 iso_pu_bacteria 2643221689 2644496850 427
704 iso_pu_bacteria 2643221698 2644542735 427
705 iso_pu_bacteria 2643221712 2644611880 427
706 iso_pu_bacteria 2643221723 2644671871 427
707 iso_pu_bacteria 2643221726 2644692426 427
708 iso_pu_bacteria 2773857925 2774871506 427
709 iso_pu_bacteria 2775506901 2776258853 427
710 iso_pu_bacteria 2835312727 2835312838 427
711 iso_pu_bacteria 2844163670 2844165153 427
712 iso_pu_bacteria 2882456835 2882459405 427
713 iso_pu_bacteria 2894232714 2894237114 427
714 iso_pu_bacteria 2920822456 2920823277 427
715 3300003187 JGI25151J46595_10011278 JGI25151J46595_100112783 428
716 3300005331 Ga0070670_100000001 Ga0070670_100000001431 428
717 3300005331 Ga0070670_100128254 Ga0070670_1001282542 428
718 3300005333 Ga0070677_10066304 Ga0070677_100663041 428
719 3300005335 Ga0070666_10008433 Ga0070666_100084332 428
720 3300005353 Ga0070669_100003348 Ga0070669_1000033484 428
721 3300005355 Ga0070671_100000008 Ga0070671_100000008157 428
722 3300005365 Ga0070688_100014320 Ga0070688_1000143202 428
723 3300005367 Ga0070667_100000023 Ga0070667_10000002317 428
724 3300005466 Ga0070685_10000007 Ga0070685_1000000744 428
725 3300005548 Ga0070665_100107192 Ga0070665_1001071922 428
726 3300005617 Ga0068859_100017106 Ga0068859_1000171065 428
727 3300005618 Ga0068864_100000012 Ga0068864_10000001271 428
728 3300005719 Ga0068861_100025828 Ga0068861_1000258282 428
729 3300005841 Ga0068863_100089215 Ga0068863_1000892154 428
730 3300005842 Ga0068858_100026415 Ga0068858_1000264152 428
731 3300005843 Ga0068860_100001934 Ga0068860_10000193416 428
732 3300005844 Ga0068862_100024291 Ga0068862_1000242912 428
733 3300006042 Ga0075368_10059850 Ga0075368_100598502 428
734 3300006048 Ga0075363_100073249 Ga0075363_1000732492 428
735 3300006051 Ga0075364_10029947 Ga0075364_100299472 428
736 3300006195 Ga0075366_10053164 Ga0075366_100531642 428
737 3300006195 Ga0075366_10062662 Ga0075366_100626622 428
738 3300006237 Ga0097621_100154976 Ga0097621_1001549762 428
739 3300006353 Ga0075370_10026675 Ga0075370_100266752 428
740 3300006931 Ga0097620_100017106 Ga0097620_1000171065 428
741 3300009174 Ga0105241_10064936 Ga0105241_100649361 428
742 3300009553 Ga0105249_10011832 Ga0105249_100118324 428
743 3300010375 Ga0105239_10119301 Ga0105239_101193012 428
744 3300014325 Ga0163163_10000436 Ga0163163_1000043628 428
745 3300014325 Ga0163163_10087176 Ga0163163_100871762 428
746 3300014325 Ga0163163_10204098 Ga0163163_102040982 428
747 3300025294 Ga0209025_1000044 Ga0209025_100004489 428
748 3300025893 Ga0207682_10059892 Ga0207682_100598921 428
749 3300025911 Ga0207654_10073132 Ga0207654_100731321 428
750 3300025923 Ga0207681_10001769 Ga0207681_100017699 428
751 3300025925 Ga0207650_10000002 Ga0207650_100000021106 428
752 3300025925 Ga0207650_10093386 Ga0207650_100933862 428
753 3300025931 Ga0207644_10000019 Ga0207644_10000019159 428
754 3300025941 Ga0207711_10003845 Ga0207711_100038455 428
755 3300025942 Ga0207689_10037772 Ga0207689_100377722 428
756 3300025960 Ga0207651_10018310 Ga0207651_100183102 428
757 3300025986 Ga0207658_10000001 Ga0207658_10000001249 428
758 3300026088 Ga0207641_10070522 Ga0207641_100705224 428
759 3300026088 Ga0207641_10072330 Ga0207641_100723302 428
760 3300026095 Ga0207676_10000001 Ga0207676_100000011106 428
761 3300026118 Ga0207675_100031090 Ga0207675_1000310902 428
762 3300028379 Ga0268266_10009418 Ga0268266_100094185 428
763 3300028380 Ga0268265_10000436 Ga0268265_1000043631 428
764 3300028381 Ga0268264_10000061 Ga0268264_10000061245 428
765 3300031911 Ga0307412_10127381 Ga0307412_101273811 428
766 3300042133 Ga0450896_005054 Ga0450896_005054_65_1366 428
767 3300048928 Ga0496125_0038719 Ga0496125_0038719_2077_3372 428
768 3300049587 Ga0501071_0016463 Ga0501071_0016463_2866_4176 428
769 3300049743 Ga0501081_0026182 Ga0501081_0026182_1018_2328 428
770 3300050491 nmdc:mga00v17_23585_c1 nmdc:mga00v17_23585_c1_986_2287 428
771 3300050493 nmdc:mga0k408_61113_c1 nmdc:mga0k408_61113_c1_153_1454 428
772 3300050496 nmdc:mga07m45_28522_c1 nmdc:mga07m45_28522_c1_453_1754 428
773 3300053116 Ga0500592_012512 Ga0500592_012512_39_1325 428
774 iso_pu_bacteria 2513237094 2513639516 428
775 iso_pu_bacteria 2513237104 2513721414 428
776 iso_pu_bacteria 2844315083 2844319556 428
777 iso_pu_bacteria 2903727486 2903734493 428
778 iso_pu_bacteria 2906602504 2906609288 428
779 iso_pu_bacteria 2932794094 2932795551 428
780 iso_pu_bacteria 2932801729 2932807853 428
781 iso_pu_bacteria 2935883170 2935886030 428
782 iso_pu_bacteria 2941531003 2941534932 428
783 iso_pu_bacteria 8019648815 8019659183 428
784 iso_pu_bacteria 8056967851 8056968549 428
785 3300009094 Ga0111539_10102811 Ga0111539_101028112 429
786 3300010375 Ga0105239_10115790 Ga0105239_101157903 429
787 3300014326 Ga0157380_10101542 Ga0157380_101015422 429
788 3300014968 Ga0157379_10031766 Ga0157379_100317662 429
789 3300028786 Ga0307517_10065943 Ga0307517_100659431 429
790 3300028794 Ga0307515_10010448 Ga0307515_100104483 429
791 3300031649 Ga0307514_10001271 Ga0307514_1000127110 429
792 3300031824 Ga0307413_10144382 Ga0307413_101443821 429
793 3300032004 Ga0307414_10013742 Ga0307414_100137422 429
794 3300032004 Ga0307414_10084921 Ga0307414_100849212 429
795 3300035695 Ga0373927_0000141 Ga0373927_0000141_18907_20196 429
796 3300037068 Ga0373925_0002260 Ga0373925_0002260_7452_8741 429
797 3300037068 Ga0373925_0037538 Ga0373925_0037538_1433_2722 429
798 3300037471 Ga0395905_0001489 Ga0395905_0001489_10640_11929 429
799 3300037471 Ga0395905_0023190 Ga0395905_0023190_3811_5100 429
800 3300041999 Ga0439433_0011253 Ga0439433_0011253_580_1869 429
801 3300042876 Ga0451577_0003794 Ga0451577_0003794_6518_7807 429
802 3300044712 Ga0453684_0126776 Ga0453684_0126776_130_1419 429
803 3300046452 Ga0495617_000377 Ga0495617_000377_10347_11636 429
804 3300046460 Ga0495638_0033066 Ga0495638_0033066_1176_2465 429
805 3300046471 Ga0495650_0000184 Ga0495650_0000184_126275_127564 429
806 3300046471 Ga0495650_0000240 Ga0495650_0000240_32155_33444 429
807 3300046491 Ga0495584_0001561 Ga0495584_0001561_9613_10902 429
808 3300046523 Ga0495644_0000287 Ga0495644_0000287_11679_12968 429
809 3300046538 Ga0495609_0000866 Ga0495609_0000866_11065_12354 429
810 3300046615 Ga0495656_0002526 Ga0495656_0002526_123_1412 429
811 3300046616 Ga0495668_0002028 Ga0495668_0002028_14866_16155 429
812 3300046648 Ga0495611_0000347 Ga0495611_0000347_10260_11549 429
813 3300046692 Ga0495671_0000926 Ga0495671_0000926_10189_11478 429
814 3300047445 Ga0495677_0000287 Ga0495677_0000287_10479_11768 429
815 3300048910 Ga0496107_0172183 Ga0496107_0172183_190_1479 429
816 3300048920 Ga0496117_0000434 Ga0496117_0000434_16037_17326 429
817 3300048925 Ga0496122_0001470 Ga0496122_0001470_5939_7228 429
818 3300048926 Ga0496123_0000018 Ga0496123_0000018_321233_322522 429
819 3300048927 Ga0496124_0022230 Ga0496124_0022230_360_1649 429
820 3300048927 Ga0496124_0198544 Ga0496124_0198544_51_1355 429
821 3300048928 Ga0496125_0000215 Ga0496125_0000215_98427_99716 429
822 3300048928 Ga0496125_0000318 Ga0496125_0000318_33937_35241 429
823 3300049460 Ga0495682_0000291 Ga0495682_0000291_12662_13951 429
824 3300049571 Ga0501034_0000807 Ga0501034_0000807_9398_10687 429
825 3300049571 Ga0501034_0260860 Ga0501034_0260860_278_1567 429
826 3300049572 Ga0501036_0076433 Ga0501036_0076433_1267_2556 429
827 3300049585 Ga0501069_0046654 Ga0501069_0046654_714_2003 429
828 3300049822 Ga0501035_0169841 Ga0501035_0169841_318_1607 429
829 3300049824 Ga0501045_0199936 Ga0501045_0199936_119_1408 429
830 3300050490 nmdc:mga03n38_52311_c1 nmdc:mga03n38_52311_c1_214_1503 429
831 3300050494 nmdc:mga06z11_3482_c1 nmdc:mga06z11_3482_c1_1569_2858 429
832 3300053136 Ga0500559_0004615 Ga0500559_0004615_872_2161 429
833 3300053156 Ga0500622_0007254 Ga0500622_0007254_4566_5855 429
834 3300053161 Ga0500634_0003106 Ga0500634_0003106_1668_2957 429
835 3300002741 JGI25157J39369_1001297 JGI25157J39369_10012979 430
836 3300002773 JGI25152J39213_1002620 JGI25152J39213_10026204 430
837 3300002773 JGI25152J39213_1003646 JGI25152J39213_10036462 430
838 3300003214 JGI25165J46597_1000037 JGI25165J46597_1000037247 430
839 3300003214 JGI25165J46597_1001939 JGI25165J46597_10019394 430
840 3300003215 JGI25153J46596_10021365 JGI25153J46596_100213653 430
841 3300003762 Ga0055542_1000403 Ga0055542_100040326 430
842 3300003771 Ga0055526_1002818 Ga0055526_10028183 430
843 3300003775 Ga0055524_1000061 Ga0055524_100006146 430
844 3300003775 Ga0055524_1006013 Ga0055524_10060132 430
845 3300005262 Ga0065165_1003834 Ga0065165_10038345 430
846 3300005336 Ga0070680_100036315 Ga0070680_1000363151 430
847 3300005339 Ga0070660_100007853 Ga0070660_1000078538 430
848 3300005365 Ga0070688_100050573 Ga0070688_1000505732 430
849 3300005438 Ga0070701_10074240 Ga0070701_100742402 430
850 3300005467 Ga0070706_100009688 Ga0070706_1000096882 430
851 3300005518 Ga0070699_100195352 Ga0070699_1001953522 430
852 3300005539 Ga0068853_100002303 Ga0068853_10000230318 430
853 3300005539 Ga0068853_100025799 Ga0068853_1000257992 430
854 3300005548 Ga0070665_100007908 Ga0070665_10000790811 430
855 3300005549 Ga0070704_100044646 Ga0070704_1000446462 430
856 3300005563 Ga0068855_100013608 Ga0068855_1000136084 430
857 3300005563 Ga0068855_100095697 Ga0068855_1000956972 430
858 3300005617 Ga0068859_100063413 Ga0068859_1000634132 430
859 3300005618 Ga0068864_100081545 Ga0068864_1000815452 430
860 3300005719 Ga0068861_100164950 Ga0068861_1001649502 430
861 3300005842 Ga0068858_100325902 Ga0068858_1003259021 430
862 3300005844 Ga0068862_100076106 Ga0068862_1000761062 430
863 3300006038 Ga0075365_10055948 Ga0075365_100559482 430
864 3300006038 Ga0075365_10087006 Ga0075365_100870062 430
865 3300006178 Ga0075367_10048240 Ga0075367_100482402 430
866 3300006852 Ga0075433_10206822 Ga0075433_102068222 430
867 3300006871 Ga0075434_100129087 Ga0075434_1001290872 430
868 3300006931 Ga0097620_100063413 Ga0097620_1000634132 430
869 3300006946 Ga0079104_1000093 Ga0079104_100009389 430
870 3300006946 Ga0079104_1002731 Ga0079104_10027316 430
871 3300006946 Ga0079104_1005856 Ga0079104_10058562 430
872 3300009094 Ga0111539_10004626 Ga0111539_100046264 430
873 3300009147 Ga0114129_10049278 Ga0114129_100492783 430
874 3300009147 Ga0114129_10062012 Ga0114129_100620123 430
875 3300009147 Ga0114129_10092285 Ga0114129_100922851 430
876 3300009147 Ga0114129_10282551 Ga0114129_102825512 430
877 3300009174 Ga0105241_10280166 Ga0105241_102801661 430
878 3300009545 Ga0105237_10161736 Ga0105237_101617362 430
879 3300009551 Ga0105238_10013092 Ga0105238_100130922 430
880 3300009553 Ga0105249_10189362 Ga0105249_101893622 430
881 3300010375 Ga0105239_10048669 Ga0105239_100486692 430
882 3300010375 Ga0105239_10090435 Ga0105239_100904352 430
883 3300011119 Ga0105246_10000071 Ga0105246_1000007127 430
884 3300013100 Ga0157373_10002597 Ga0157373_100025972 430
885 3300013105 Ga0157369_10107931 Ga0157369_101079312 430
886 3300014326 Ga0157380_10010159 Ga0157380_100101595 430
887 3300014326 Ga0157380_10013232 Ga0157380_100132322 430
888 3300014497 Ga0182008_10015167 Ga0182008_100151672 430
889 3300021321 Ga0214542_1000011 Ga0214542_100001151 430
890 3300021321 Ga0214542_1008060 Ga0214542_100806014 430
891 3300021327 Ga0214543_1000004 Ga0214543_1000004450 430
892 3300021327 Ga0214543_1000259 Ga0214543_100025950 430
893 3300021441 Ga0213871_10004950 Ga0213871_100049502 430
894 3300022739 Ga0228711_1000019 Ga0228711_100001996 430
895 3300022740 Ga0228710_1000022 Ga0228710_100002296 430
896 3300025245 Ga0207425_1000736 Ga0207425_10007363 430
897 3300025253 Ga0209677_103007 Ga0209677_1030074 430
898 3300025254 Ga0209148_1000266 Ga0209148_100026613 430
899 3300025254 Ga0209148_1009957 Ga0209148_10099571 430
900 3300025258 Ga0209129_1000113 Ga0209129_1000113106 430
901 3300025258 Ga0209129_1002521 Ga0209129_10025217 430
902 3300025261 Ga0209233_1000102 Ga0209233_1000102247 430
903 3300025261 Ga0209233_1000201 Ga0209233_100020185 430
904 3300025272 Ga0209455_1000234 Ga0209455_100023463 430
905 3300025273 Ga0209673_1003797 Ga0209673_10037974 430
906 3300025295 Ga0209564_1000186 Ga0209564_1000186106 430
907 3300025297 Ga0209758_1000172 Ga0209758_1000172106 430
908 3300025297 Ga0209758_1003660 Ga0209758_10036606 430
909 3300025297 Ga0209758_1015042 Ga0209758_10150422 430
910 3300025298 Ga0209050_1000489 Ga0209050_100048939 430
911 3300025299 Ga0209256_1000030 Ga0209256_100003046 430
912 3300025303 Ga0209051_1025463 Ga0209051_10254633 430
913 3300025908 Ga0207643_10039937 Ga0207643_100399372 430
914 3300025909 Ga0207705_10148970 Ga0207705_101489701 430
915 3300025910 Ga0207684_10094752 Ga0207684_100947522 430
916 3300025914 Ga0207671_10001797 Ga0207671_1000179711 430
917 3300025924 Ga0207694_10003165 Ga0207694_100031656 430
918 3300025933 Ga0207706_10001920 Ga0207706_100019206 430
919 3300025942 Ga0207689_10139500 Ga0207689_101395002 430
920 3300025949 Ga0207667_10009181 Ga0207667_100091817 430
921 3300025949 Ga0207667_10063348 Ga0207667_100633483 430
922 3300026041 Ga0207639_10002007 Ga0207639_1000200718 430
923 3300026041 Ga0207639_10025773 Ga0207639_100257732 430
924 3300026118 Ga0207675_100180377 Ga0207675_1001803772 430
925 3300027111 Ga0209281_1000084 Ga0209281_1000084197 430
926 3300027111 Ga0209281_1000200 Ga0209281_100020076 430
927 3300027111 Ga0209281_1000227 Ga0209281_1000227102 430
928 3300027666 Ga0209282_1000042 Ga0209282_1000042102 430
929 3300028379 Ga0268266_10001081 Ga0268266_100010812 430
930 3300028380 Ga0268265_10045156 Ga0268265_100451563 430
931 3300028786 Ga0307517_10040568 Ga0307517_100405683 430
932 3300028794 Ga0307515_10000123 Ga0307515_10000123136 430
933 3300028794 Ga0307515_10006687 Ga0307515_100066874 430
934 3300028794 Ga0307515_10006795 Ga0307515_1000679516 430
935 3300028794 Ga0307515_10042388 Ga0307515_100423882 430
936 3300028794 Ga0307515_10186638 Ga0307515_101866382 430
937 3300030522 Ga0307512_10034667 Ga0307512_100346672 430
938 3300031456 Ga0307513_10095926 Ga0307513_100959263 430
939 3300031507 Ga0307509_10033967 Ga0307509_100339672 430
940 3300031548 Ga0307408_100074110 Ga0307408_1000741102 430
941 3300031616 Ga0307508_10000640 Ga0307508_100006408 430
942 3300031649 Ga0307514_10019042 Ga0307514_100190423 430
943 3300031727 Ga0316576_10003425 Ga0316576_100034257 430
944 3300031728 Ga0316578_10111996 Ga0316578_101119962 430
945 3300031730 Ga0307516_10033117 Ga0307516_100331173 430
946 3300031911 Ga0307412_10010376 Ga0307412_100103762 430
947 3300031911 Ga0307412_10099922 Ga0307412_100999222 430
948 3300031967 Ga0315914_1000009 Ga0315914_100000925 430
949 3300033180 Ga0307510_10065641 Ga0307510_100656413 430
950 3300033430 Ga0315913_1000015 Ga0315913_1000015102 430
951 3300033464 Ga0315915_1000013 Ga0315915_1000013163 430
952 3300035398 Ga0316574_0063443 Ga0316574_0063443_866_2158 430
953 3300036647 Ga0316582_0006931 Ga0316582_0006931_856_2148 430
954 3300036647 Ga0316582_0178748 Ga0316582_0178748_46_1338 430
955 3300038443 Ga0395901_0004559 Ga0395901_0004559_5875_7167 430
956 3300039438 Ga0436360_1140827 Ga0436360_1140827_1580_2872 430
957 3300039447 Ga0436361_0276468 Ga0436361_0276468_411_1703 430
958 3300041413 Ga0439465_0029187 Ga0439465_0029187_381_1673 430
959 3300042007 Ga0439449_0009998 Ga0439449_0009998_202_1494 430
960 3300042121 Ga0450919_000188 Ga0450919_000188_4396_5688 430
961 3300046460 Ga0495638_0002960 Ga0495638_0002960_3683_4975 430
962 3300046460 Ga0495638_0042772 Ga0495638_0042772_339_1631 430
963 3300046512 Ga0495610_0009062 Ga0495610_0009062_3000_4292 430
964 3300046519 Ga0495632_0003595 Ga0495632_0003595_9052_10344 430
965 3300046519 Ga0495632_0015652 Ga0495632_0015652_414_1706 430
966 3300046660 Ga0495625_0000990 Ga0495625_0000990_17353_18645 430
967 3300047472 Ga0495686_0040964 Ga0495686_0040964_1470_2762 430
968 3300048905 Ga0496102_0105810 Ga0496102_0105810_1312_2604 430
969 3300048907 Ga0496104_0030153 Ga0496104_0030153_118_1416 430
970 3300048909 Ga0496106_0000980 Ga0496106_0000980_17733_19025 430
971 3300048914 Ga0496111_0199515 Ga0496111_0199515_115_1407 430
972 3300048915 Ga0496112_0004020 Ga0496112_0004020_1110_2402 430
973 3300048917 Ga0496114_0004364 Ga0496114_0004364_6486_7778 430
974 3300048917 Ga0496114_0090051 Ga0496114_0090051_1187_2485 430
975 3300048920 Ga0496117_0002639 Ga0496117_0002639_3040_4332 430
976 3300048922 Ga0496119_0013173 Ga0496119_0013173_1636_2928 430
977 3300048923 Ga0496120_0001446 Ga0496120_0001446_15152_16444 430
978 3300048925 Ga0496122_0000137 Ga0496122_0000137_77607_78899 430
979 3300048926 Ga0496123_0000022 Ga0496123_0000022_89641_90933 430
980 3300048929 Ga0496126_0080068 Ga0496126_0080068_39_1388 430
981 3300049571 Ga0501034_0070465 Ga0501034_0070465_1387_2679 430
982 3300049571 Ga0501034_0202866 Ga0501034_0202866_462_1754 430
983 3300049592 Ga0501076_0057722 Ga0501076_0057722_326_1618 430
984 3300049742 Ga0501080_0093028 Ga0501080_0093028_413_1705 430
985 3300050492 nmdc:mga0yw44_6756_c1 nmdc:mga0yw44_6756_c1_3818_5110 430
986 3300050507 nmdc:mga05p37_15503_c1 nmdc:mga05p37_15503_c1_5955_7250 430
987 3300050507 nmdc:mga05p37_49098_c1 nmdc:mga05p37_49098_c1_3803_5095 430
988 3300050510 nmdc:mga06r32_94733_c1 nmdc:mga06r32_94733_c1_1583_2878 430
989 3300050511 nmdc:mga08y16_53155_c1 nmdc:mga08y16_53155_c1_2645_3937 430
990 3300050512 nmdc:mga0n895_128986_c1 nmdc:mga0n895_128986_c1_312_1604 430
991 3300050515 nmdc:mga0a205_203908_c1 nmdc:mga0a205_203908_c1_313_1605 430
992 3300050515 nmdc:mga0a205_263127_c1 nmdc:mga0a205_263127_c1_228_1520 430
993 3300050515 nmdc:mga0a205_40160_c1 nmdc:mga0a205_40160_c1_342_1634 430
994 3300053088 Ga0500644_0045479 Ga0500644_0045479_127_1419 430
995 3300053103 Ga0500555_007872 Ga0500555_007872_85_1377 430
996 3300053131 Ga0500652_000611 Ga0500652_000611_9461_10753 430
997 3300053142 Ga0500577_0002449 Ga0500577_0002449_1763_3055 430
998 3300053153 Ga0500616_0000902 Ga0500616_0000902_29908_31200 430
999 3300053155 Ga0500620_020810 Ga0500620_020810_590_1882 430
1000 3300053156 Ga0500622_0000146 Ga0500622_0000146_47631_48923 430
1001 3300053158 Ga0500627_0058474 Ga0500627_0058474_115_1407 430
1002 3300053739 Ga0500587_001814 Ga0500587_001814_235_1527 430
1003 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003253 431
1004 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003434 431
1005 3300003374 JGI25161J50226_1001593 JGI25161J50226_10015934 431
1006 3300003771 Ga0055526_1012650 Ga0055526_10126502 431
1007 3300003775 Ga0055524_1000789 Ga0055524_100078919 431
1008 3300003781 Ga0055536_1002760 Ga0055536_100276015 431
1009 3300004625 Ga0055543_1000158 Ga0055543_100015824 431
1010 3300005262 Ga0065165_1000084 Ga0065165_1000084110 431
1011 3300005295 Ga0065707_10114068 Ga0065707_101140682 431
1012 3300005330 Ga0070690_100003582 Ga0070690_1000035823 431
1013 3300005331 Ga0070670_100058327 Ga0070670_1000583272 431
1014 3300005335 Ga0070666_10022918 Ga0070666_100229183 431
1015 3300005336 Ga0070680_100124089 Ga0070680_1001240892 431
1016 3300005340 Ga0070689_100017803 Ga0070689_1000178033 431
1017 3300005340 Ga0070689_100027792 Ga0070689_1000277924 431
1018 3300005343 Ga0070687_100103610 Ga0070687_1001036101 431
1019 3300005347 Ga0070668_100077261 Ga0070668_1000772612 431
1020 3300005354 Ga0070675_100019228 Ga0070675_1000192282 431
1021 3300005354 Ga0070675_100032654 Ga0070675_1000326543 431
1022 3300005356 Ga0070674_100034401 Ga0070674_1000344012 431
1023 3300005364 Ga0070673_100011286 Ga0070673_1000112864 431
1024 3300005367 Ga0070667_100000116 Ga0070667_10000011667 431
1025 3300005367 Ga0070667_100084988 Ga0070667_1000849883 431
1026 3300005367 Ga0070667_100247865 Ga0070667_1002478652 431
1027 3300005440 Ga0070705_100040575 Ga0070705_1000405752 431
1028 3300005445 Ga0070708_100052938 Ga0070708_1000529383 431
1029 3300005456 Ga0070678_100036939 Ga0070678_1000369392 431
1030 3300005456 Ga0070678_100115763 Ga0070678_1001157632 431
1031 3300005458 Ga0070681_10000808 Ga0070681_100008083 431
1032 3300005466 Ga0070685_10068977 Ga0070685_100689772 431
1033 3300005467 Ga0070706_100015675 Ga0070706_1000156753 431
1034 3300005467 Ga0070706_100216805 Ga0070706_1002168052 431
1035 3300005468 Ga0070707_100006029 Ga0070707_1000060297 431
1036 3300005471 Ga0070698_100004345 Ga0070698_1000043457 431
1037 3300005536 Ga0070697_100006577 Ga0070697_1000065775 431
1038 3300005543 Ga0070672_100012851 Ga0070672_1000128515 431
1039 3300005543 Ga0070672_100271197 Ga0070672_1002711971 431
1040 3300005548 Ga0070665_100017258 Ga0070665_1000172588 431
1041 3300005548 Ga0070665_100238851 Ga0070665_1002388512 431
1042 3300005564 Ga0070664_100022513 Ga0070664_1000225132 431
1043 3300005614 Ga0068856_100030133 Ga0068856_1000301335 431
1044 3300005615 Ga0070702_100002988 Ga0070702_1000029884 431
1045 3300005617 Ga0068859_100006383 Ga0068859_1000063835 431
1046 3300005617 Ga0068859_100017495 Ga0068859_1000174954 431
1047 3300005617 Ga0068859_100074880 Ga0068859_1000748802 431
1048 3300005617 Ga0068859_100238140 Ga0068859_1002381402 431
1049 3300005719 Ga0068861_100007061 Ga0068861_1000070612 431
1050 3300005840 Ga0068870_10002937 Ga0068870_100029373 431
1051 3300005841 Ga0068863_100041004 Ga0068863_1000410044 431
1052 3300005841 Ga0068863_100252924 Ga0068863_1002529242 431
1053 3300005842 Ga0068858_100041035 Ga0068858_1000410352 431
1054 3300005842 Ga0068858_100185801 Ga0068858_1001858012 431
1055 3300005843 Ga0068860_100000179 Ga0068860_10000017941 431
1056 3300005843 Ga0068860_100000928 Ga0068860_1000009284 431
1057 3300005843 Ga0068860_100004331 Ga0068860_10000433113 431
1058 3300005843 Ga0068860_100064120 Ga0068860_1000641203 431
1059 3300005843 Ga0068860_100090703 Ga0068860_1000907032 431
1060 3300005844 Ga0068862_100000023 Ga0068862_100000023121 431
1061 3300005844 Ga0068862_100020342 Ga0068862_1000203423 431
1062 3300005937 Ga0081455_10003635 Ga0081455_100036356 431
1063 3300005981 Ga0081538_10009289 Ga0081538_100092894 431
1064 3300005983 Ga0081540_1042137 Ga0081540_10421372 431
1065 3300006178 Ga0075367_10101414 Ga0075367_101014142 431
1066 3300006237 Ga0097621_100008990 Ga0097621_1000089903 431
1067 3300006358 Ga0068871_100048649 Ga0068871_1000486492 431
1068 3300006358 Ga0068871_100121143 Ga0068871_1001211432 431
1069 3300006931 Ga0097620_100006383 Ga0097620_1000063835 431
1070 3300006931 Ga0097620_100017496 Ga0097620_1000174964 431
1071 3300006931 Ga0097620_100074883 Ga0097620_1000748832 431
1072 3300006931 Ga0097620_100238152 Ga0097620_1002381522 431
1073 3300007265 Ga0099794_10000291 Ga0099794_1000029115 431
1074 3300009094 Ga0111539_10000050 Ga0111539_10000050103 431
1075 3300009101 Ga0105247_10007589 Ga0105247_100075894 431
1076 3300009147 Ga0114129_10270891 Ga0114129_102708912 431
1077 3300009148 Ga0105243_10101570 Ga0105243_101015703 431
1078 3300009177 Ga0105248_10045650 Ga0105248_100456502 431
1079 3300009551 Ga0105238_10015087 Ga0105238_100150873 431
1080 3300009553 Ga0105249_10000004 Ga0105249_10000004249 431
1081 3300013249 Ga0171463_1001 Ga0171463_1001788 431
1082 3300013296 Ga0157374_10103653 Ga0157374_101036532 431
1083 3300014325 Ga0163163_10015631 Ga0163163_100156312 431
1084 3300014325 Ga0163163_10020521 Ga0163163_100205212 431
1085 3300014325 Ga0163163_10063306 Ga0163163_100633064 431
1086 3300014325 Ga0163163_10173783 Ga0163163_101737832 431
1087 3300014326 Ga0157380_10006982 Ga0157380_100069825 431
1088 3300014326 Ga0157380_10008405 Ga0157380_100084056 431
1089 3300014326 Ga0157380_10028179 Ga0157380_100281792 431
1090 3300014968 Ga0157379_10043503 Ga0157379_100435032 431
1091 3300015684 Ga0183365_10137 Ga0183365_101372 431
1092 3300015690 Ga0183363_1032 Ga0183363_103246 431
1093 3300025250 Ga0209026_1000013 Ga0209026_100001330 431
1094 3300025253 Ga0209677_100643 Ga0209677_10064314 431
1095 3300025254 Ga0209148_1011910 Ga0209148_10119101 431
1096 3300025256 Ga0209759_1000149 Ga0209759_100014970 431
1097 3300025261 Ga0209233_1003536 Ga0209233_10035362 431
1098 3300025261 Ga0209233_1003653 Ga0209233_10036532 431
1099 3300025272 Ga0209455_1004746 Ga0209455_10047462 431
1100 3300025284 Ga0209130_1000005 Ga0209130_100000542 431
1101 3300025292 Ga0209676_1000097 Ga0209676_1000097212 431
1102 3300025292 Ga0209676_1008514 Ga0209676_10085144 431
1103 3300025294 Ga0209025_1000295 Ga0209025_100029567 431
1104 3300025295 Ga0209564_1000093 Ga0209564_100009345 431
1105 3300025298 Ga0209050_1004684 Ga0209050_10046842 431
1106 3300025299 Ga0209256_1000027 Ga0209256_1000027377 431
1107 3300025299 Ga0209256_1002044 Ga0209256_100204413 431
1108 3300025302 Ga0207426_1000015 Ga0207426_1000015557 431
1109 3300025304 Ga0209257_1010078 Ga0209257_10100782 431
1110 3300025893 Ga0207682_10008562 Ga0207682_100085622 431
1111 3300025893 Ga0207682_10054532 Ga0207682_100545321 431
1112 3300025900 Ga0207710_10010227 Ga0207710_100102272 431
1113 3300025900 Ga0207710_10015559 Ga0207710_100155592 431
1114 3300025901 Ga0207688_10054327 Ga0207688_100543272 431
1115 3300025907 Ga0207645_10131458 Ga0207645_101314582 431
1116 3300025908 Ga0207643_10004683 Ga0207643_100046833 431
1117 3300025910 Ga0207684_10045941 Ga0207684_100459412 431
1118 3300025912 Ga0207707_10006417 Ga0207707_100064174 431
1119 3300025917 Ga0207660_10096169 Ga0207660_100961692 431
1120 3300025923 Ga0207681_10002874 Ga0207681_100028744 431
1121 3300025926 Ga0207659_10185954 Ga0207659_101859541 431
1122 3300025931 Ga0207644_10005864 Ga0207644_100058643 431
1123 3300025933 Ga0207706_10087741 Ga0207706_100877412 431
1124 3300025933 Ga0207706_10147100 Ga0207706_101471002 431
1125 3300025936 Ga0207670_10004621 Ga0207670_100046214 431
1126 3300025938 Ga0207704_10049131 Ga0207704_100491312 431
1127 3300025940 Ga0207691_10026129 Ga0207691_100261293 431
1128 3300025940 Ga0207691_10083656 Ga0207691_100836562 431
1129 3300025940 Ga0207691_10091002 Ga0207691_100910022 431
1130 3300025949 Ga0207667_10417946 Ga0207667_104179461 431
1131 3300025960 Ga0207651_10131574 Ga0207651_101315741 431
1132 3300025961 Ga0207712_10000008 Ga0207712_10000008380 431
1133 3300025986 Ga0207658_10000566 Ga0207658_100005666 431
1134 3300025986 Ga0207658_10293016 Ga0207658_102930161 431
1135 3300026035 Ga0207703_10139946 Ga0207703_101399462 431
1136 3300026035 Ga0207703_10168821 Ga0207703_101688212 431
1137 3300026075 Ga0207708_10027499 Ga0207708_100274992 431
1138 3300026075 Ga0207708_10063572 Ga0207708_100635722 431
1139 3300026088 Ga0207641_10290615 Ga0207641_102906152 431
1140 3300026089 Ga0207648_10089361 Ga0207648_100893612 431
1141 3300026118 Ga0207675_100001206 Ga0207675_1000012068 431
1142 3300026118 Ga0207675_100002146 Ga0207675_1000021469 431
1143 3300026118 Ga0207675_100006135 Ga0207675_1000061358 431
1144 3300026118 Ga0207675_100038809 Ga0207675_1000388092 431
1145 3300026121 Ga0207683_10016248 Ga0207683_100162484 431
1146 3300026121 Ga0207683_10082422 Ga0207683_100824222 431
1147 3300027671 Ga0209588_1002309 Ga0209588_10023091 431
1148 3300027907 Ga0207428_10000937 Ga0207428_1000093728 431
1149 3300028379 Ga0268266_10026439 Ga0268266_100264392 431
1150 3300028379 Ga0268266_10044635 Ga0268266_100446354 431
1151 3300028380 Ga0268265_10000035 Ga0268265_10000035115 431
1152 3300028381 Ga0268264_10000153 Ga0268264_10000153108 431
1153 3300028381 Ga0268264_10002586 Ga0268264_1000258614 431
1154 3300028381 Ga0268264_10003066 Ga0268264_1000306613 431
1155 3300028381 Ga0268264_10056606 Ga0268264_100566063 431
1156 3300028794 Ga0307515_10001309 Ga0307515_1000130930 431
1157 3300028800 Ga0265338_10023127 Ga0265338_100231272 431
1158 3300030521 Ga0307511_10000541 Ga0307511_1000054127 431
1159 3300030744 Ga0316181_1183610 Ga0316181_11836103 431
1160 3300031241 Ga0265325_10048230 Ga0265325_100482302 431
1161 3300031344 Ga0265316_10013079 Ga0265316_100130795 431
1162 3300031456 Ga0307513_10002506 Ga0307513_100025066 431
1163 3300031456 Ga0307513_10012786 Ga0307513_100127864 431
1164 3300031456 Ga0307513_10015322 Ga0307513_100153222 431
1165 3300031507 Ga0307509_10000333 Ga0307509_1000033344 431
1166 3300031507 Ga0307509_10022078 Ga0307509_100220783 431
1167 3300031507 Ga0307509_10036877 Ga0307509_100368773 431
1168 3300031548 Ga0307408_100022215 Ga0307408_1000222153 431
1169 3300031616 Ga0307508_10000727 Ga0307508_1000072729 431
1170 3300031711 Ga0265314_10058516 Ga0265314_100585162 431
1171 3300031712 Ga0265342_10076793 Ga0265342_100767932 431
1172 3300031731 Ga0307405_10010158 Ga0307405_100101582 431
1173 3300031824 Ga0307413_10030431 Ga0307413_100304311 431
1174 3300031824 Ga0307413_10117523 Ga0307413_101175231 431
1175 3300031852 Ga0307410_10041291 Ga0307410_100412912 431
1176 3300031903 Ga0307407_10025776 Ga0307407_100257762 431
1177 3300031911 Ga0307412_10106108 Ga0307412_101061082 431
1178 3300031995 Ga0307409_100000814 Ga0307409_10000081410 431
1179 3300031995 Ga0307409_100039573 Ga0307409_1000395731 431
1180 3300031995 Ga0307409_100154027 Ga0307409_1001540272 431
1181 3300032002 Ga0307416_100021865 Ga0307416_1000218652 431
1182 3300032005 Ga0307411_10001811 Ga0307411_100018114 431
1183 3300032005 Ga0307411_10003000 Ga0307411_100030002 431
1184 3300033180 Ga0307510_10000023 Ga0307510_10000023123 431
1185 3300033180 Ga0307510_10007145 Ga0307510_100071452 431
1186 3300033180 Ga0307510_10104077 Ga0307510_101040772 431
1187 3300036401 Ga0373937_0253682 Ga0373937_0253682_267_1565 431
1188 3300037471 Ga0395905_0000091 Ga0395905_0000091_105483_106799 431
1189 3300041451 Ga0451791_1040051 Ga0451791_1040051_931_2229 431
1190 3300041486 Ga0451807_0254012 Ga0451807_0254012_532_1830 431
1191 3300042438 Ga0439459_0015402 Ga0439459_0015402_69_1367 431
1192 3300044656 Ga0466969_0000198 Ga0466969_0000198_12942_14258 431
1193 3300044684 Ga0466966_0004454 Ga0466966_0004454_4847_6163 431
1194 3300044693 Ga0466961_0008979 Ga0466961_0008979_1228_2544 431
1195 3300044693 Ga0466961_0035887 Ga0466961_0035887_1153_2469 431
1196 3300044719 Ga0466971_0007674 Ga0466971_0007674_2271_3587 431
1197 3300044765 Ga0466970_0012562 Ga0466970_0012562_2984_4300 431
1198 3300044842 Ga0466957_0050523 Ga0466957_0050523_686_2002 431
1199 3300045836 Ga0466958_0014422 Ga0466958_0014422_2785_4101 431
1200 3300046460 Ga0495638_0003111 Ga0495638_0003111_4361_5665 431
1201 3300046460 Ga0495638_0032266 Ga0495638_0032266_298_1644 431
1202 3300046463 Ga0495653_0000009 Ga0495653_0000009_252286_253581 431
1203 3300046507 Ga0495606_0004320 Ga0495606_0004320_2154_3449 431
1204 3300046512 Ga0495610_0024493 Ga0495610_0024493_636_1931 431
1205 3300046513 Ga0495616_0005415 Ga0495616_0005415_1990_3288 431
1206 3300046530 Ga0495654_0062965 Ga0495654_0062965_428_1723 431
1207 3300046615 Ga0495656_0022562 Ga0495656_0022562_967_2265 431
1208 3300046616 Ga0495668_0000002 Ga0495668_0000002_343602_344897 431
1209 3300046616 Ga0495668_0044664 Ga0495668_0044664_250_1548 431
1210 3300046660 Ga0495625_0025679 Ga0495625_0025679_2542_3840 431
1211 3300046660 Ga0495625_0037357 Ga0495625_0037357_757_2055 431
1212 3300046694 Ga0495649_0022211 Ga0495649_0022211_1196_2500 431
1213 3300047470 Ga0495681_0034048 Ga0495681_0034048_248_1546 431
1214 3300048904 Ga0496101_0099942 Ga0496101_0099942_607_1902 431
1215 3300048905 Ga0496102_0109711 Ga0496102_0109711_1076_2413 431
1216 3300048924 Ga0496121_0018849 Ga0496121_0018849_4271_5584 431
1217 3300048924 Ga0496121_0052320 Ga0496121_0052320_1844_3139 431
1218 3300048927 Ga0496124_0192186 Ga0496124_0192186_66_1361 431
1219 3300049571 Ga0501034_0123694 Ga0501034_0123694_995_2296 431
1220 3300049573 Ga0501037_0057199 Ga0501037_0057199_552_1853 431
1221 3300049580 Ga0501046_0013179 Ga0501046_0013179_3733_5034 431
1222 3300049581 Ga0501047_0033253 Ga0501047_0033253_3399_4700 431
1223 3300049583 Ga0501067_0033911 Ga0501067_0033911_494_1792 431
1224 3300049589 Ga0501073_0001736 Ga0501073_0001736_10320_11618 431
1225 3300049593 Ga0501077_0027847 Ga0501077_0027847_27_1325 431
1226 3300049741 Ga0501079_0010367 Ga0501079_0010367_1515_2813 431
1227 3300049742 Ga0501080_0000921 Ga0501080_0000921_12405_13703 431
1228 3300049742 Ga0501080_0298596 Ga0501080_0298596_87_1385 431
1229 3300049744 Ga0501083_0007148 Ga0501083_0007148_3352_4650 431
1230 3300049822 Ga0501035_0000263 Ga0501035_0000263_11120_12496 431
1231 3300049822 Ga0501035_0017062 Ga0501035_0017062_2124_3440 431
1232 3300049823 Ga0501044_0059852 Ga0501044_0059852_2324_3625 431
1233 3300050494 nmdc:mga06z11_56445_c1 nmdc:mga06z11_56445_c1_406_1704 431
1234 3300050507 nmdc:mga05p37_152813_c1 nmdc:mga05p37_152813_c1_875_2170 431
1235 3300050511 nmdc:mga08y16_33_c1 nmdc:mga08y16_33_c1_310_1605 431
1236 3300053086 Ga0500578_0001295 Ga0500578_0001295_22146_23459 431
1237 3300053087 Ga0500643_000173 Ga0500643_000173_22561_23856 431
1238 3300053091 Ga0500647_0010667 Ga0500647_0010667_1046_2341 431
1239 3300053094 Ga0500566_0000353 Ga0500566_0000353_1359_2654 431
1240 3300053095 Ga0500640_000097 Ga0500640_000097_4775_6070 431
1241 3300053111 Ga0500572_000165 Ga0500572_000165_5864_7159 431
1242 3300053122 Ga0500608_003613 Ga0500608_003613_329_1624 431
1243 3300053123 Ga0500614_001090 Ga0500614_001090_776_2071 431
1244 3300053136 Ga0500559_0003511 Ga0500559_0003511_524_1819 431
1245 3300053150 Ga0500603_001328 Ga0500603_001328_668_1963 431
1246 3300053158 Ga0500627_0000002 Ga0500627_0000002_68302_69597 431
1247 3300053159 Ga0500630_001600 Ga0500630_001600_5701_6996 431
1248 3300053162 Ga0500638_009701 Ga0500638_009701_1837_3132 431
1249 3300053163 Ga0500639_000023 Ga0500639_000023_76800_78095 431
1250 3300053177 Ga0500636_0029297 Ga0500636_0029297_1567_2862 431
1251 3300053177 Ga0500636_0029703 Ga0500636_0029703_420_1715 431
1252 3300053178 Ga0500637_0036213 Ga0500637_0036213_1050_2345 431
1253 3300054114 Ga0501084_0012130 Ga0501084_0012130_4260_5558 431
1254 3300061719 Ga0466962_0000986 Ga0466962_0000986_1597_2913 431
1255 iso_pu_bacteria 2739367756 2739790981 431
1256 3300005289 Ga0065704_10101196 Ga0065704_101011962 432
1257 3300005290 Ga0065712_10077146 Ga0065712_100771463 432
1258 3300005295 Ga0065707_10004904 Ga0065707_100049042 432
1259 3300005330 Ga0070690_100009128 Ga0070690_1000091282 432
1260 3300005331 Ga0070670_100011486 Ga0070670_1000114862 432
1261 3300005331 Ga0070670_100232100 Ga0070670_1002321002 432
1262 3300005333 Ga0070677_10052188 Ga0070677_100521882 432
1263 3300005335 Ga0070666_10008240 Ga0070666_100082402 432
1264 3300005336 Ga0070680_100129635 Ga0070680_1001296351 432
1265 3300005336 Ga0070680_100260627 Ga0070680_1002606271 432
1266 3300005338 Ga0068868_100025316 Ga0068868_1000253163 432
1267 3300005347 Ga0070668_100077888 Ga0070668_1000778882 432
1268 3300005353 Ga0070669_100005889 Ga0070669_1000058894 432
1269 3300005354 Ga0070675_100017449 Ga0070675_1000174494 432
1270 3300005355 Ga0070671_100036107 Ga0070671_1000361073 432
1271 3300005367 Ga0070667_100043273 Ga0070667_1000432732 432
1272 3300005437 Ga0070710_10001104 Ga0070710_100011044 432
1273 3300005456 Ga0070678_100031951 Ga0070678_1000319512 432
1274 3300005458 Ga0070681_10025626 Ga0070681_100256262 432
1275 3300005459 Ga0068867_100041560 Ga0068867_1000415602 432
1276 3300005468 Ga0070707_100002461 Ga0070707_10000246112 432
1277 3300005471 Ga0070698_100001987 Ga0070698_1000019879 432
1278 3300005518 Ga0070699_100039132 Ga0070699_1000391322 432
1279 3300005535 Ga0070684_100076965 Ga0070684_1000769652 432
1280 3300005539 Ga0068853_100238424 Ga0068853_1002384242 432
1281 3300005544 Ga0070686_100095608 Ga0070686_1000956082 432
1282 3300005563 Ga0068855_100035817 Ga0068855_1000358175 432
1283 3300005564 Ga0070664_100033055 Ga0070664_1000330554 432
1284 3300005564 Ga0070664_100037216 Ga0070664_1000372162 432
1285 3300005577 Ga0068857_100034814 Ga0068857_1000348142 432
1286 3300005578 Ga0068854_100020014 Ga0068854_1000200142 432
1287 3300005578 Ga0068854_100037222 Ga0068854_1000372222 432
1288 3300005616 Ga0068852_100002040 Ga0068852_1000020402 432
1289 3300005616 Ga0068852_100069392 Ga0068852_1000693923 432
1290 3300005617 Ga0068859_100051193 Ga0068859_1000511933 432
1291 3300005618 Ga0068864_100005239 Ga0068864_1000052394 432
1292 3300005618 Ga0068864_100014954 Ga0068864_1000149542 432
1293 3300005834 Ga0068851_10031070 Ga0068851_100310702 432
1294 3300005841 Ga0068863_100008263 Ga0068863_1000082632 432
1295 3300005841 Ga0068863_100037293 Ga0068863_1000372934 432
1296 3300005842 Ga0068858_100049389 Ga0068858_1000493892 432
1297 3300005842 Ga0068858_100183098 Ga0068858_1001830982 432
1298 3300005842 Ga0068858_100262419 Ga0068858_1002624191 432
1299 3300005843 Ga0068860_100032404 Ga0068860_1000324043 432
1300 3300005844 Ga0068862_100115327 Ga0068862_1001153272 432
1301 3300006195 Ga0075366_10111357 Ga0075366_101113572 432
1302 3300006237 Ga0097621_100026654 Ga0097621_1000266542 432
1303 3300006237 Ga0097621_100044981 Ga0097621_1000449812 432
1304 3300006358 Ga0068871_100025223 Ga0068871_1000252232 432
1305 3300006358 Ga0068871_100040634 Ga0068871_1000406343 432
1306 3300006844 Ga0075428_100000060 Ga0075428_10000006061 432
1307 3300006871 Ga0075434_100325279 Ga0075434_1003252792 432
1308 3300006881 Ga0068865_100055560 Ga0068865_1000555602 432
1309 3300006931 Ga0097620_100051192 Ga0097620_1000511923 432
1310 3300009093 Ga0105240_10010945 Ga0105240_1001094511 432
1311 3300009093 Ga0105240_10136790 Ga0105240_101367902 432
1312 3300009094 Ga0111539_10000002 Ga0111539_10000002729 432
1313 3300009094 Ga0111539_10109105 Ga0111539_101091052 432
1314 3300009098 Ga0105245_10012954 Ga0105245_100129542 432
1315 3300009101 Ga0105247_10015183 Ga0105247_100151832 432
1316 3300009101 Ga0105247_10025927 Ga0105247_100259271 432
1317 3300009147 Ga0114129_10038907 Ga0114129_100389072 432
1318 3300009147 Ga0114129_10099497 Ga0114129_100994972 432
1319 3300009174 Ga0105241_10108804 Ga0105241_101088042 432
1320 3300009176 Ga0105242_10009081 Ga0105242_100090814 432
1321 3300009176 Ga0105242_10014725 Ga0105242_100147254 432
1322 3300009177 Ga0105248_10300329 Ga0105248_103003292 432
1323 3300009545 Ga0105237_10003125 Ga0105237_1000312513 432
1324 3300009545 Ga0105237_10007526 Ga0105237_100075262 432
1325 3300009545 Ga0105237_10063666 Ga0105237_100636661 432
1326 3300009545 Ga0105237_10071599 Ga0105237_100715992 432
1327 3300009545 Ga0105237_10085691 Ga0105237_100856912 432
1328 3300009553 Ga0105249_10017322 Ga0105249_100173225 432
1329 3300009553 Ga0105249_10094769 Ga0105249_100947692 432
1330 3300009553 Ga0105249_10140229 Ga0105249_101402292 432
1331 3300010375 Ga0105239_10043547 Ga0105239_100435472 432
1332 3300013100 Ga0157373_10010988 Ga0157373_100109883 432
1333 3300013100 Ga0157373_10055873 Ga0157373_100558732 432
1334 3300013105 Ga0157369_10085402 Ga0157369_100854022 432
1335 3300013296 Ga0157374_10031258 Ga0157374_100312583 432
1336 3300013297 Ga0157378_10023318 Ga0157378_100233184 432
1337 3300013306 Ga0163162_10009664 Ga0163162_100096643 432
1338 3300013306 Ga0163162_10135162 Ga0163162_101351621 432
1339 3300013307 Ga0157372_10308227 Ga0157372_103082272 432
1340 3300013308 Ga0157375_10006167 Ga0157375_100061676 432
1341 3300013308 Ga0157375_10081203 Ga0157375_100812032 432
1342 3300013308 Ga0157375_10084021 Ga0157375_100840212 432
1343 3300014325 Ga0163163_10018136 Ga0163163_100181362 432
1344 3300014325 Ga0163163_10033994 Ga0163163_100339942 432
1345 3300014326 Ga0157380_10000514 Ga0157380_1000051413 432
1346 3300014326 Ga0157380_10024587 Ga0157380_100245872 432
1347 3300014326 Ga0157380_10162018 Ga0157380_101620181 432
1348 3300017792 Ga0163161_10044606 Ga0163161_100446062 432
1349 3300021384 Ga0213876_10002813 Ga0213876_100028134 432
1350 3300025254 Ga0209148_1000474 Ga0209148_100047419 432
1351 3300025272 Ga0209455_1001414 Ga0209455_10014144 432
1352 3300025898 Ga0207692_10054139 Ga0207692_100541392 432
1353 3300025906 Ga0207699_10074917 Ga0207699_100749172 432
1354 3300025912 Ga0207707_10023883 Ga0207707_100238834 432
1355 3300025913 Ga0207695_10000008 Ga0207695_10000008404 432
1356 3300025913 Ga0207695_10113346 Ga0207695_101133462 432
1357 3300025914 Ga0207671_10062949 Ga0207671_100629492 432
1358 3300025914 Ga0207671_10070889 Ga0207671_100708892 432
1359 3300025915 Ga0207693_10041585 Ga0207693_100415851 432
1360 3300025916 Ga0207663_10069960 Ga0207663_100699602 432
1361 3300025922 Ga0207646_10000897 Ga0207646_1000089727 432
1362 3300025924 Ga0207694_10168470 Ga0207694_101684702 432
1363 3300025929 Ga0207664_10028123 Ga0207664_100281234 432
1364 3300025931 Ga0207644_10044518 Ga0207644_100445182 432
1365 3300025934 Ga0207686_10015421 Ga0207686_100154212 432
1366 3300025938 Ga0207704_10023768 Ga0207704_100237682 432
1367 3300025940 Ga0207691_10050920 Ga0207691_100509202 432
1368 3300025940 Ga0207691_10102332 Ga0207691_101023322 432
1369 3300025941 Ga0207711_10005157 Ga0207711_100051572 432
1370 3300025941 Ga0207711_10203326 Ga0207711_102033262 432
1371 3300025945 Ga0207679_10058560 Ga0207679_100585602 432
1372 3300025961 Ga0207712_10013011 Ga0207712_100130112 432
1373 3300025961 Ga0207712_10018934 Ga0207712_100189342 432
1374 3300025981 Ga0207640_10140741 Ga0207640_101407412 432
1375 3300025986 Ga0207658_10020522 Ga0207658_100205222 432
1376 3300026035 Ga0207703_10049252 Ga0207703_100492523 432
1377 3300026041 Ga0207639_10111072 Ga0207639_101110722 432
1378 3300026088 Ga0207641_10010982 Ga0207641_100109825 432
1379 3300026088 Ga0207641_10034514 Ga0207641_100345143 432
1380 3300026088 Ga0207641_10062192 Ga0207641_100621922 432
1381 3300026089 Ga0207648_10010770 Ga0207648_100107706 432
1382 3300026095 Ga0207676_10011127 Ga0207676_100111274 432
1383 3300026116 Ga0207674_10033670 Ga0207674_100336701 432
1384 3300026121 Ga0207683_10019417 Ga0207683_100194172 432
1385 3300026142 Ga0207698_10130633 Ga0207698_101306332 432
1386 3300027907 Ga0207428_10000026 Ga0207428_1000002676 432
1387 3300028379 Ga0268266_10068908 Ga0268266_100689082 432
1388 3300028381 Ga0268264_10020209 Ga0268264_100202092 432
1389 3300032005 Ga0307411_10046706 Ga0307411_100467062 432
1390 3300032005 Ga0307411_10157309 Ga0307411_101573092 432
1391 3300033180 Ga0307510_10071237 Ga0307510_100712372 432
1392 3300039062 Ga0400483_150886 Ga0400483_150886_955_2262 432
1393 3300039437 Ga0436365_0492506 Ga0436365_0492506_3465_4763 432
1394 3300044694 Ga0466963_0004084 Ga0466963_0004084_3306_4604 432
1395 3300045976 Ga0466967_0014366 Ga0466967_0014366_376_1674 432
1396 3300046538 Ga0495609_0083056 Ga0495609_0083056_68_1366 432
1397 3300046543 Ga0495645_0034890 Ga0495645_0034890_982_2280 432
1398 3300046616 Ga0495668_0008340 Ga0495668_0008340_1936_3234 432
1399 3300047472 Ga0495686_0040467 Ga0495686_0040467_1284_2582 432
1400 3300048904 Ga0496101_0100295 Ga0496101_0100295_131_1429 432
1401 3300048907 Ga0496104_0010257 Ga0496104_0010257_5217_6515 432
1402 3300048908 Ga0496105_0070919 Ga0496105_0070919_213_1511 432
1403 3300048912 Ga0496109_0031019 Ga0496109_0031019_1987_3285 432
1404 3300048917 Ga0496114_0027194 Ga0496114_0027194_1783_3081 432
1405 3300048917 Ga0496114_0167835 Ga0496114_0167835_132_1430 432
1406 3300048929 Ga0496126_0108498 Ga0496126_0108498_977_2275 432
1407 3300049460 Ga0495682_0033963 Ga0495682_0033963_108_1406 432
1408 3300049570 Ga0501033_0171860 Ga0501033_0171860_31_1356 432
1409 3300049572 Ga0501036_0133631 Ga0501036_0133631_536_1834 432
1410 3300049577 Ga0501041_0121754 Ga0501041_0121754_293_1591 432
1411 3300049592 Ga0501076_0037579 Ga0501076_0037579_640_1938 432
1412 3300049593 Ga0501077_0088836 Ga0501077_0088836_282_1580 432
1413 3300049743 Ga0501081_0127915 Ga0501081_0127915_96_1394 432
1414 3300049824 Ga0501045_0106666 Ga0501045_0106666_740_2038 432
1415 3300050507 nmdc:mga05p37_756_c1 nmdc:mga05p37_756_c1_7546_8844 432
1416 3300050511 nmdc:mga08y16_143302_c1 nmdc:mga08y16_143302_c1_594_1892 432
1417 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_149568_150866 432
1418 3300050511 nmdc:mga08y16_39329_c1 nmdc:mga08y16_39329_c1_1298_2596 432
1419 3300050513 nmdc:mga0rr50_125558_c1 nmdc:mga0rr50_125558_c1_221_1519 432
1420 3300050515 nmdc:mga0a205_65705_c1 nmdc:mga0a205_65705_c1_1464_2762 432
1421 3300053153 Ga0500616_0000554 Ga0500616_0000554_23868_25166 432
1422 3300060353 Ga0501082_0092288 Ga0501082_0092288_1280_2578 432
1423 3300002074 JGI24748J21848_1000012 JGI24748J21848_100001246 433
1424 3300002239 JGI24034J26672_10000003 JGI24034J26672_10000003341 433
1425 3300002459 JGI24751J29686_10000931 JGI24751J29686_100009312 433
1426 3300005331 Ga0070670_100000095 Ga0070670_10000009520 433
1427 3300005518 Ga0070699_100002830 Ga0070699_1000028305 433
1428 3300005518 Ga0070699_100202437 Ga0070699_1002024372 433
1429 3300005544 Ga0070686_100168088 Ga0070686_1001680881 433
1430 3300005618 Ga0068864_100028391 Ga0068864_1000283912 433
1431 3300005842 Ga0068858_100000277 Ga0068858_10000027738 433
1432 3300006852 Ga0075433_10085443 Ga0075433_100854432 433
1433 3300006914 Ga0075436_100000008 Ga0075436_100000008212 433
1434 3300009094 Ga0111539_10155248 Ga0111539_101552482 433
1435 3300009101 Ga0105247_10000003 Ga0105247_10000003336 433
1436 3300009176 Ga0105242_10037035 Ga0105242_100370351 433
1437 3300014325 Ga0163163_10000026 Ga0163163_10000026107 433
1438 3300025223 Ga0207672_1000445 Ga0207672_10004453 433
1439 3300025900 Ga0207710_10000001 Ga0207710_10000001973 433
1440 3300025900 Ga0207710_10027279 Ga0207710_100272792 433
1441 3300025918 Ga0207662_10003226 Ga0207662_100032262 433
1442 3300025925 Ga0207650_10000006 Ga0207650_1000000643 433
1443 3300026035 Ga0207703_10000080 Ga0207703_1000008050 433
1444 3300026095 Ga0207676_10020600 Ga0207676_100206003 433
1445 3300026118 Ga0207675_100104968 Ga0207675_1001049682 433
1446 3300045051 Ga0451576_0328538 Ga0451576_0328538_185_1486 433
1447 3300050513 nmdc:mga0rr50_555_c1 nmdc:mga0rr50_555_c1_11717_13018 433
1448 3300050514 nmdc:mga08x19_16_c1 nmdc:mga08x19_16_c1_221923_223224 433
1449 3300050515 nmdc:mga0a205_100102_c1 nmdc:mga0a205_100102_c1_578_1879 433

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

80

305

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gjj-assembly1.cif.gz_B crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose 0.9706 5 426
3m0v-assembly1.cif.gz_C crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329l in complex with l-rhamnose 0.97 4 424
3m0y-assembly1.cif.gz_D crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose 0.97 4 423
3iud-assembly1.cif.gz_C cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase 0.97 4 424
4gjj-assembly1.cif.gz_B crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose 0.9684 5 426
ID Description Score Start End Superfamily
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9694 4 424 3.20.20.150
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9473 4 424 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8666 51 387 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8444 51 387 3.20.20.150
3uvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8102 26 421 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A529HK39-F1-model_v4 deleted 0.9826 75 226
AF-A0A3S2EWE7-F1-model_v4 deleted 0.9796 7 284
AF-A0A1I7M7X5-F1-model_v4 L-rhamnose isomerase / sugar isomerase 0.9794 7 283 GO:0016853
AF-A0A529L4P3-F1-model_v4 Sugar isomerase 0.9792 71 269 GO:0016853
AF-A0A3S1SYS7-F1-model_v4 Sugar isomerase 0.9786 7 206 GO:0016853

Feature Viewer

pLDDT pTM Quality
91.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map