F494052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1449 | 1022 | 823 | 428 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2551306091|2551725600 |
| Length | 464 |
| Sequence | ISTSVLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGTGGTRFARFPGPGEPRNIFDKLEDCAVIQQLTRATPAVSLHIPWDKVSDLGALKEKGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIGKALGSKALTVWVGDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYLIAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAANGFDPAHMLDQSHNVTDPIESLMTSAMEVGRAYAQALIVDRKALAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRASXFLRTRTVESRGSGAEGIPRSKIQRATKLPSISFRNMVYPLLPIQREGDSWALKAFWYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 6 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 7 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 8 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 11 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 12 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 13 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 14 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 15 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 16 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 17 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 18 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 19 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 22 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 25 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 26 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 27 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 28 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 29 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 30 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 33 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 34 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 35 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 36 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 37 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 38 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 39 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 40 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 41 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 42 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 43 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 44 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 45 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 46 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 47 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 48 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 49 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 50 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 51 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 52 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 53 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 54 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 55 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 56 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 57 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 58 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 59 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 60 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 61 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 62 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 63 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 64 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 65 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 66 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 67 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 68 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 69 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 70 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 71 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 72 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 73 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 74 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 75 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 76 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 77 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 78 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 79 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 80 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 81 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 82 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 83 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 84 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 85 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 86 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 87 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 88 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 89 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 90 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 91 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 92 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 93 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 94 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 95 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 96 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 97 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 98 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 99 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 100 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 101 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 102 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 103 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 104 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 105 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 106 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 107 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 108 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 109 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 110 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 111 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 112 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 113 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 114 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 115 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 116 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 117 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 118 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 119 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 120 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 121 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 122 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 123 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 124 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 125 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 126 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 127 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 128 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 129 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 130 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 131 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 132 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 133 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 134 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 135 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 136 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 137 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 138 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 139 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 140 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 141 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 142 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 143 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 144 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 145 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 146 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 147 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 148 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 149 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 150 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 151 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 152 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 153 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 154 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 155 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 156 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 157 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 158 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 159 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 160 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 161 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 162 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 163 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 164 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 165 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 166 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 167 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 168 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 169 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 170 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 171 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 172 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 173 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 174 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 175 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 176 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 177 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 178 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 179 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 180 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 181 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 182 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 183 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 184 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 185 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 186 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 187 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 188 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 189 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 190 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 191 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 192 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 193 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 194 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 195 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 196 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 197 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 198 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 199 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 200 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 201 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 202 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 203 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 204 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 205 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 206 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 207 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 208 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 209 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 210 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 211 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 212 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 213 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 214 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 215 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 216 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 217 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 218 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 219 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 220 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 221 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 222 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 223 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 224 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 225 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 226 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 227 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 228 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 229 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 230 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 231 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 232 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 233 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 234 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 235 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 236 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 237 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 238 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 239 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 240 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 241 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 242 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 243 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 244 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 245 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 246 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 247 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 248 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 249 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 250 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 251 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 252 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 253 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 254 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 255 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 256 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 257 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 258 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 259 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 260 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 261 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 262 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 263 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 264 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 265 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 266 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 267 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 268 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 269 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 270 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 271 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 272 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 273 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 274 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 275 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 276 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 277 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 278 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 279 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 280 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 281 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 282 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 283 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 284 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 285 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 286 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 287 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 288 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 289 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 290 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 291 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 292 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 293 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 294 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 295 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 296 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 297 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 298 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 299 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 300 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 301 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 302 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 303 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 304 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 305 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 306 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 307 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 308 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 309 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 310 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 311 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 312 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 313 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 314 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 315 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 316 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 317 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 318 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 319 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 320 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 321 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 322 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 323 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 324 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 325 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 326 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 327 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 328 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 329 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 330 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 331 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 332 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 333 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 334 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 335 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 336 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 337 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 338 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 339 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 340 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 341 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 342 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 343 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 344 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 345 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 346 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 347 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 348 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 349 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 350 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 351 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 352 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 353 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 354 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 355 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 356 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 357 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 358 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 359 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 360 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 361 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 362 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 363 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 364 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 365 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 366 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 367 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 368 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 369 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 370 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 371 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 372 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 373 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 374 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 375 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 376 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 377 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 378 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 379 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 380 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 381 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 382 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 383 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 384 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 385 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 386 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 387 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 388 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 389 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 390 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 391 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 392 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 393 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 394 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 395 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 396 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 397 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 398 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 399 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 400 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 401 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 402 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 403 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 404 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 405 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 406 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 407 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 408 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 409 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 410 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 411 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 412 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 413 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 414 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 415 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 416 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 417 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 418 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 419 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 420 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 421 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 422 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 423 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 424 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 425 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 426 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 427 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 428 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 429 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 430 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 431 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 432 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 433 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 434 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 435 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 436 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 437 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 438 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 439 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 440 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 441 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 442 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 443 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 444 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 445 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 446 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 447 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 448 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 449 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 450 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 451 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 452 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 453 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 454 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 455 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 456 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 457 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 458 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 459 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 460 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 461 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 462 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 463 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 464 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 465 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 466 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 467 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 468 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 469 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 470 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 471 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 472 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 473 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 474 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 475 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 476 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 477 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 478 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 479 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 480 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 481 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 482 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 483 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 484 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 485 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 486 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 487 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 488 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 489 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 490 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 491 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 492 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 493 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 494 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 495 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 496 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 497 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 498 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 499 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 500 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 501 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 502 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 503 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 504 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 505 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 506 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 507 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 508 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 509 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 510 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 511 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 512 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 513 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 514 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 515 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 516 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 517 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 518 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 519 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 520 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 521 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 522 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 523 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 524 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 525 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 526 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 527 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 528 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 529 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 530 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 531 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 532 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 533 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 534 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 535 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 536 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 537 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 538 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 539 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 540 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 541 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 542 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 543 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 544 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 545 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 546 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 547 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 548 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 549 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 550 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 551 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 552 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 553 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 554 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 555 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 556 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 557 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 558 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 559 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 560 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 561 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 562 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 563 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 564 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 565 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 566 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 567 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 568 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 569 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 570 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 571 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 572 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 573 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 574 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 575 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 576 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 577 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 578 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 579 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 580 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 581 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 582 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 583 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 584 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 585 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 586 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 587 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 588 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 589 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 590 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 591 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 592 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 593 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 594 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 595 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 596 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 597 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 598 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 599 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 600 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 601 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 602 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 603 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 604 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 605 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 606 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 607 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 608 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 609 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 610 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 611 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 612 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 613 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 614 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 615 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 616 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 617 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 618 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 619 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 620 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 621 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 622 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 624 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 625 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 626 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 627 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 628 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 629 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 630 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 631 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 632 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 633 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 634 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 635 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 636 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 637 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 638 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 639 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 640 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 641 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 642 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 643 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 644 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 645 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 646 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 647 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 648 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 649 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 650 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 651 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 652 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 653 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 654 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 655 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 656 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 657 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 658 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 659 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 660 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 661 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 662 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 663 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 664 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 665 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 666 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 667 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 668 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 669 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 670 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 671 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 672 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 673 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 674 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 675 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 676 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 677 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 678 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 679 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 680 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 682 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 683 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 684 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 685 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 686 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 687 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 688 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 690 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 691 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 692 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 693 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 694 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 695 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 697 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 698 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 700 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 701 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 702 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 703 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 704 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 705 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 706 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 707 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 708 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 709 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 710 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 711 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 712 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 713 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 714 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 715 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 716 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 717 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 718 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 719 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 720 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 721 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 722 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 723 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 724 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 725 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 726 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 727 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 728 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 729 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 730 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 731 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 732 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 733 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 734 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 735 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 736 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 737 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 738 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 739 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 740 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 741 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 742 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 743 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 744 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 745 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 746 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 747 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 748 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 749 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 750 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 751 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 752 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 753 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 754 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 755 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 756 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 758 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 785 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 791 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 793 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 795 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 796 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 797 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 798 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 799 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 800 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 801 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 802 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 803 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 804 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 805 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 806 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 808 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 809 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 810 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 811 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 812 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 813 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 814 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 815 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 816 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 817 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 818 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 819 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 820 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 821 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 822 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 823 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 824 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 825 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 826 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 827 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 828 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 829 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 830 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 831 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 832 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 833 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 834 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 835 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 836 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 837 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 838 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 839 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 840 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 841 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 842 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 843 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 844 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 845 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 846 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 847 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 848 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 849 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 850 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 851 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 852 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 853 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 854 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 855 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 856 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 857 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 858 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 859 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 860 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 861 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 862 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 863 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 864 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 865 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 866 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 867 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 868 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 869 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 870 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 871 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 872 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 873 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 874 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 875 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 876 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 878 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 879 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 880 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 882 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 883 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 884 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 886 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 887 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 888 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 889 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 890 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 891 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 900 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 901 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 902 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 903 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 904 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 905 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 906 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 907 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 908 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 909 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 910 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 911 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 912 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 913 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 914 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 915 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 916 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 917 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 918 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 919 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 920 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 922 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 923 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 924 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 925 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 926 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 927 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 928 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 929 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 930 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 931 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 932 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 933 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 934 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 935 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 936 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 937 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 938 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 939 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 940 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 941 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 942 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 943 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 944 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 945 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 946 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 947 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 948 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 949 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 950 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 951 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 952 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 953 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 954 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 955 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 956 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 957 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 958 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 959 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 960 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 961 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 962 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 963 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 964 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 965 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 966 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 967 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 968 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 969 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 970 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 971 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 972 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 973 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 974 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 975 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 976 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 977 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 978 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 979 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 980 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 981 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 982 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 983 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 984 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 985 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 986 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 987 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 988 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 989 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 990 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 991 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 992 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 993 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 994 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 995 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 996 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 997 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 998 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 999 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1000 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1001 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1002 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1003 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1004 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1005 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1006 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1007 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1008 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1009 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1010 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1011 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1012 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1013 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1014 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1015 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1016 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1017 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1018 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1019 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1020 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1021 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1022 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.8 |
| Metatranscriptomes | 0 |
| Isolates | 43.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.42 |
| Nodule | 36.09 |
| Rhizoplane | 1.79 |
| Rhizosphere | 42.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000012 | 3300002074 | Bacteria | 152599 |
| 2 | JGI24034J26672_10000003 | 3300002239 | Bacteria | 501747 |
| 3 | JGI24751J29686_10000931 | 3300002459 | Bacteria | 6560 |
| 4 | JGI25157J39369_1001297 | 3300002741 | Bacteria | 10014 |
| 5 | JGI25152J39213_1002620 | 3300002773 | Bacteria | 6697 |
| 6 | JGI25152J39213_1003646 | 3300002773 | Bacteria | 5189 |
| 7 | JGI25159J45721_1000003 | 3300002987 | Bacteria | 274069 |
| 8 | JGI25151J46595_10011278 | 3300003187 | Bacteria | 4116 |
| 9 | JGI25406J46586_10010437 | 3300003203 | Bacteria | 4121 |
| 10 | JGI25165J46597_1000037 | 3300003214 | Bacteria | 285722 |
| 11 | JGI25165J46597_1001939 | 3300003214 | Bacteria | 8155 |
| 12 | JGI25153J46596_10021365 | 3300003215 | Bacteria | 2414 |
| 13 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 14 | JGI25161J50226_1001593 | 3300003374 | Bacteria | 6618 |
| 15 | Ga0055542_1000403 | 3300003762 | Bacteria | 42485 |
| 16 | Ga0055526_1002818 | 3300003771 | Bacteria | 11506 |
| 17 | Ga0055526_1012650 | 3300003771 | Bacteria | 3657 |
| 18 | Ga0055524_1000061 | 3300003775 | Bacteria | 135241 |
| 19 | Ga0055524_1000789 | 3300003775 | Bacteria | 21114 |
| 20 | Ga0055524_1006013 | 3300003775 | Bacteria | 5328 |
| 21 | Ga0055536_1002760 | 3300003781 | Bacteria | 9721 |
| 22 | Ga0055530_10002372 | 3300003791 | Bacteria | 12207 |
| 23 | Ga0055540_1000026 | 3300003792 | Bacteria | 189071 |
| 24 | Ga0055531_10027659 | 3300003794 | Bacteria | 1982 |
| 25 | Ga0055543_1000158 | 3300004625 | Bacteria | 56811 |
| 26 | Ga0065165_1000084 | 3300005262 | Bacteria | 154822 |
| 27 | Ga0065165_1003834 | 3300005262 | Bacteria | 10014 |
| 28 | Ga0065704_10101196 | 3300005289 | Bacteria | 2246 |
| 29 | Ga0065712_10077146 | 3300005290 | Bacteria | 3542 |
| 30 | Ga0065715_10002994 | 3300005293 | Bacteria | 4324 |
| 31 | Ga0065707_10004904 | 3300005295 | Bacteria | 3272 |
| 32 | Ga0065707_10114068 | 3300005295 | Bacteria | 2300 |
| 33 | Ga0070690_100003582 | 3300005330 | Bacteria | 8531 |
| 34 | Ga0070690_100009128 | 3300005330 | Bacteria | 5738 |
| 35 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 36 | Ga0070670_100000095 | 3300005331 | Bacteria | 83302 |
| 37 | Ga0070670_100011486 | 3300005331 | Bacteria | 7577 |
| 38 | Ga0070670_100058327 | 3300005331 | Bacteria | 3314 |
| 39 | Ga0070670_100128254 | 3300005331 | Bacteria | 2189 |
| 40 | Ga0070670_100232100 | 3300005331 | Bacteria | 1606 |
| 41 | Ga0070677_10052188 | 3300005333 | Bacteria | 1658 |
| 42 | Ga0070677_10066304 | 3300005333 | Bacteria | 1505 |
| 43 | Ga0070666_10008240 | 3300005335 | Bacteria | 6461 |
| 44 | Ga0070666_10008433 | 3300005335 | Bacteria | 6400 |
| 45 | Ga0070666_10022918 | 3300005335 | Bacteria | 4061 |
| 46 | Ga0070680_100036315 | 3300005336 | Bacteria | 3981 |
| 47 | Ga0070680_100124089 | 3300005336 | Bacteria | 2157 |
| 48 | Ga0070680_100129635 | 3300005336 | Bacteria | 2109 |
| 49 | Ga0070680_100260627 | 3300005336 | Bacteria | 1467 |
| 50 | Ga0068868_100025316 | 3300005338 | Bacteria | 4512 |
| 51 | Ga0070660_100007853 | 3300005339 | Bacteria | 7440 |
| 52 | Ga0070689_100017803 | 3300005340 | Bacteria | 5223 |
| 53 | Ga0070689_100027792 | 3300005340 | Bacteria | 4268 |
| 54 | Ga0070687_100103610 | 3300005343 | Bacteria | 1598 |
| 55 | Ga0070668_100077261 | 3300005347 | Bacteria | 2602 |
| 56 | Ga0070668_100077888 | 3300005347 | Bacteria | 2592 |
| 57 | Ga0070669_100003348 | 3300005353 | Bacteria | 11524 |
| 58 | Ga0070669_100005889 | 3300005353 | Bacteria | 8845 |
| 59 | Ga0070675_100017449 | 3300005354 | Bacteria | 5703 |
| 60 | Ga0070675_100019228 | 3300005354 | Bacteria | 5441 |
| 61 | Ga0070675_100032654 | 3300005354 | Bacteria | 4214 |
| 62 | Ga0070671_100000008 | 3300005355 | Bacteria | 207831 |
| 63 | Ga0070671_100036107 | 3300005355 | Bacteria | 4098 |
| 64 | Ga0070674_100034401 | 3300005356 | Bacteria | 3384 |
| 65 | Ga0070673_100011286 | 3300005364 | Bacteria | 6092 |
| 66 | Ga0070688_100014320 | 3300005365 | Bacteria | 4490 |
| 67 | Ga0070688_100050573 | 3300005365 | Bacteria | 2590 |
| 68 | Ga0070667_100000023 | 3300005367 | Bacteria | 199687 |
| 69 | Ga0070667_100000116 | 3300005367 | Bacteria | 102137 |
| 70 | Ga0070667_100043273 | 3300005367 | Bacteria | 3779 |
| 71 | Ga0070667_100084988 | 3300005367 | Bacteria | 2713 |
| 72 | Ga0070667_100247865 | 3300005367 | Bacteria | 1592 |
| 73 | Ga0070710_10001104 | 3300005437 | Bacteria | 12775 |
| 74 | Ga0070701_10074240 | 3300005438 | Bacteria | 1826 |
| 75 | Ga0070705_100031594 | 3300005440 | Bacteria | 2933 |
| 76 | Ga0070705_100040575 | 3300005440 | Bacteria | 2648 |
| 77 | Ga0070708_100052938 | 3300005445 | Bacteria | 3600 |
| 78 | Ga0070678_100031951 | 3300005456 | Bacteria | 3637 |
| 79 | Ga0070678_100036939 | 3300005456 | Bacteria | 3424 |
| 80 | Ga0070678_100115763 | 3300005456 | Bacteria | 2105 |
| 81 | Ga0070681_10000808 | 3300005458 | Bacteria | 26152 |
| 82 | Ga0070681_10025626 | 3300005458 | Bacteria | 5932 |
| 83 | Ga0068867_100041560 | 3300005459 | Bacteria | 3360 |
| 84 | Ga0070685_10000007 | 3300005466 | Bacteria | 180539 |
| 85 | Ga0070685_10068977 | 3300005466 | Bacteria | 2090 |
| 86 | Ga0070706_100009688 | 3300005467 | Bacteria | 8953 |
| 87 | Ga0070706_100015675 | 3300005467 | Bacteria | 7001 |
| 88 | Ga0070706_100216805 | 3300005467 | Bacteria | 1786 |
| 89 | Ga0070707_100002461 | 3300005468 | Bacteria | 17647 |
| 90 | Ga0070707_100006029 | 3300005468 | Bacteria | 11312 |
| 91 | Ga0070707_100060644 | 3300005468 | Bacteria | 3628 |
| 92 | Ga0070698_100001987 | 3300005471 | Bacteria | 22694 |
| 93 | Ga0070698_100004345 | 3300005471 | Bacteria | 15581 |
| 94 | Ga0070699_100002830 | 3300005518 | Bacteria | 15479 |
| 95 | Ga0070699_100039132 | 3300005518 | Bacteria | 4106 |
| 96 | Ga0070699_100195352 | 3300005518 | Bacteria | 1798 |
| 97 | Ga0070699_100202437 | 3300005518 | Bacteria | 1766 |
| 98 | Ga0070684_100076965 | 3300005535 | Bacteria | 2946 |
| 99 | Ga0070697_100006577 | 3300005536 | Bacteria | 9007 |
| 100 | Ga0068853_100002303 | 3300005539 | Bacteria | 14278 |
| 101 | Ga0068853_100025799 | 3300005539 | Bacteria | 4933 |
| 102 | Ga0068853_100238424 | 3300005539 | Bacteria | 1666 |
| 103 | Ga0070672_100012851 | 3300005543 | Bacteria | 5897 |
| 104 | Ga0070672_100230904 | 3300005543 | Bacteria | 1554 |
| 105 | Ga0070672_100271197 | 3300005543 | Bacteria | 1433 |
| 106 | Ga0070686_100095608 | 3300005544 | Bacteria | 1996 |
| 107 | Ga0070686_100168088 | 3300005544 | Bacteria | 1549 |
| 108 | Ga0070695_100004821 | 3300005545 | Bacteria | 7939 |
| 109 | Ga0070696_100020844 | 3300005546 | Bacteria | 4442 |
| 110 | Ga0070665_100007908 | 3300005548 | Bacteria | 10785 |
| 111 | Ga0070665_100017258 | 3300005548 | Bacteria | 7244 |
| 112 | Ga0070665_100107192 | 3300005548 | Bacteria | 2796 |
| 113 | Ga0070665_100238851 | 3300005548 | Bacteria | 1818 |
| 114 | Ga0070704_100044646 | 3300005549 | Bacteria | 3081 |
| 115 | Ga0068855_100013608 | 3300005563 | Bacteria | 9810 |
| 116 | Ga0068855_100035817 | 3300005563 | Bacteria | 5910 |
| 117 | Ga0068855_100095697 | 3300005563 | Bacteria | 3422 |
| 118 | Ga0070664_100022513 | 3300005564 | Bacteria | 5197 |
| 119 | Ga0070664_100033055 | 3300005564 | Bacteria | 4329 |
| 120 | Ga0070664_100037216 | 3300005564 | Bacteria | 4090 |
| 121 | Ga0068857_100034814 | 3300005577 | Bacteria | 4456 |
| 122 | Ga0068854_100020014 | 3300005578 | Bacteria | 4518 |
| 123 | Ga0068854_100037222 | 3300005578 | Bacteria | 3414 |
| 124 | Ga0068856_100030133 | 3300005614 | Bacteria | 5304 |
| 125 | Ga0070702_100002988 | 3300005615 | Bacteria | 7473 |
| 126 | Ga0068852_100002040 | 3300005616 | Bacteria | 13758 |
| 127 | Ga0068852_100069392 | 3300005616 | Bacteria | 3089 |
| 128 | Ga0068859_100000668 | 3300005617 | Bacteria | 34291 |
| 129 | Ga0068859_100006383 | 3300005617 | Bacteria | 11961 |
| 130 | Ga0068859_100017106 | 3300005617 | Bacteria | 7281 |
| 131 | Ga0068859_100017495 | 3300005617 | Bacteria | 7205 |
| 132 | Ga0068859_100051193 | 3300005617 | Bacteria | 4150 |
| 133 | Ga0068859_100063413 | 3300005617 | Bacteria | 3726 |
| 134 | Ga0068859_100074880 | 3300005617 | Bacteria | 3425 |
| 135 | Ga0068859_100238140 | 3300005617 | Bacteria | 1909 |
| 136 | Ga0068864_100000012 | 3300005618 | Bacteria | 335070 |
| 137 | Ga0068864_100005239 | 3300005618 | Bacteria | 10628 |
| 138 | Ga0068864_100014954 | 3300005618 | Bacteria | 6450 |
| 139 | Ga0068864_100028391 | 3300005618 | Bacteria | 4728 |
| 140 | Ga0068864_100081545 | 3300005618 | Bacteria | 2836 |
| 141 | Ga0068861_100007061 | 3300005719 | Bacteria | 7679 |
| 142 | Ga0068861_100025828 | 3300005719 | Bacteria | 4265 |
| 143 | Ga0068861_100164950 | 3300005719 | Bacteria | 1831 |
| 144 | Ga0068851_10031070 | 3300005834 | Bacteria | 2651 |
| 145 | Ga0068870_10002937 | 3300005840 | Bacteria | 7181 |
| 146 | Ga0068863_100008263 | 3300005841 | Bacteria | 10167 |
| 147 | Ga0068863_100037293 | 3300005841 | Bacteria | 4628 |
| 148 | Ga0068863_100041004 | 3300005841 | Bacteria | 4401 |
| 149 | Ga0068863_100089215 | 3300005841 | Bacteria | 2923 |
| 150 | Ga0068863_100252924 | 3300005841 | Bacteria | 1702 |
| 151 | Ga0068858_100000277 | 3300005842 | Bacteria | 55193 |
| 152 | Ga0068858_100020349 | 3300005842 | Bacteria | 6206 |
| 153 | Ga0068858_100026415 | 3300005842 | Bacteria | 5395 |
| 154 | Ga0068858_100041035 | 3300005842 | Bacteria | 4292 |
| 155 | Ga0068858_100049389 | 3300005842 | Bacteria | 3897 |
| 156 | Ga0068858_100183098 | 3300005842 | Bacteria | 1978 |
| 157 | Ga0068858_100185801 | 3300005842 | Bacteria | 1963 |
| 158 | Ga0068858_100262419 | 3300005842 | Bacteria | 1642 |
| 159 | Ga0068858_100325902 | 3300005842 | Bacteria | 1469 |
| 160 | Ga0068860_100000179 | 3300005843 | Bacteria | 102844 |
| 161 | Ga0068860_100000928 | 3300005843 | Bacteria | 32413 |
| 162 | Ga0068860_100001934 | 3300005843 | Bacteria | 21903 |
| 163 | Ga0068860_100004331 | 3300005843 | Bacteria | 14508 |
| 164 | Ga0068860_100032404 | 3300005843 | Bacteria | 5021 |
| 165 | Ga0068860_100064120 | 3300005843 | Bacteria | 3490 |
| 166 | Ga0068860_100090703 | 3300005843 | Bacteria | 2911 |
| 167 | Ga0068862_100000023 | 3300005844 | Bacteria | 203389 |
| 168 | Ga0068862_100020342 | 3300005844 | Bacteria | 5544 |
| 169 | Ga0068862_100024291 | 3300005844 | Bacteria | 5084 |
| 170 | Ga0068862_100076106 | 3300005844 | Bacteria | 2904 |
| 171 | Ga0068862_100115327 | 3300005844 | Bacteria | 2362 |
| 172 | Ga0068862_100125365 | 3300005844 | Bacteria | 2267 |
| 173 | Ga0081455_10003635 | 3300005937 | Bacteria | 17668 |
| 174 | Ga0081538_10009289 | 3300005981 | Bacteria | 8228 |
| 175 | Ga0081540_1008024 | 3300005983 | Bacteria | 7427 |
| 176 | Ga0081540_1042137 | 3300005983 | Bacteria | 2358 |
| 177 | Ga0081539_10005442 | 3300005985 | Bacteria | 12996 |
| 178 | Ga0075365_10055948 | 3300006038 | Bacteria | 2621 |
| 179 | Ga0075365_10087006 | 3300006038 | Bacteria | 2124 |
| 180 | Ga0075368_10059850 | 3300006042 | Bacteria | 1524 |
| 181 | Ga0075363_100073249 | 3300006048 | Bacteria | 1864 |
| 182 | Ga0075364_10029947 | 3300006051 | Bacteria | 3492 |
| 183 | Ga0075367_10048240 | 3300006178 | Bacteria | 2508 |
| 184 | Ga0075367_10101414 | 3300006178 | Bacteria | 1760 |
| 185 | Ga0075366_10053164 | 3300006195 | Bacteria | 2406 |
| 186 | Ga0075366_10062662 | 3300006195 | Bacteria | 2210 |
| 187 | Ga0075366_10078689 | 3300006195 | Bacteria | 1968 |
| 188 | Ga0075366_10111357 | 3300006195 | Bacteria | 1646 |
| 189 | Ga0097621_100008990 | 3300006237 | Bacteria | 7228 |
| 190 | Ga0097621_100026654 | 3300006237 | Bacteria | 4537 |
| 191 | Ga0097621_100044981 | 3300006237 | Bacteria | 3564 |
| 192 | Ga0097621_100154976 | 3300006237 | Bacteria | 1966 |
| 193 | Ga0075370_10026675 | 3300006353 | Bacteria | 3201 |
| 194 | Ga0068871_100025223 | 3300006358 | Bacteria | 4622 |
| 195 | Ga0068871_100040634 | 3300006358 | Bacteria | 3726 |
| 196 | Ga0068871_100048649 | 3300006358 | Bacteria | 3424 |
| 197 | Ga0068871_100121143 | 3300006358 | Bacteria | 2209 |
| 198 | Ga0075428_100000060 | 3300006844 | Bacteria | 88550 |
| 199 | Ga0075433_10085443 | 3300006852 | Bacteria | 2785 |
| 200 | Ga0075433_10206822 | 3300006852 | Bacteria | 1745 |
| 201 | Ga0075434_100129087 | 3300006871 | Bacteria | 2546 |
| 202 | Ga0075434_100325279 | 3300006871 | Bacteria | 1558 |
| 203 | Ga0068865_100055560 | 3300006881 | Unclassified | 2755 |
| 204 | Ga0075436_100000008 | 3300006914 | Bacteria | 279288 |
| 205 | Ga0097620_100000668 | 3300006931 | Bacteria | 34291 |
| 206 | Ga0097620_100006383 | 3300006931 | Bacteria | 11961 |
| 207 | Ga0097620_100017106 | 3300006931 | Bacteria | 7281 |
| 208 | Ga0097620_100017496 | 3300006931 | Bacteria | 7205 |
| 209 | Ga0097620_100051192 | 3300006931 | Bacteria | 4150 |
| 210 | Ga0097620_100063413 | 3300006931 | Bacteria | 3726 |
| 211 | Ga0097620_100074883 | 3300006931 | Bacteria | 3425 |
| 212 | Ga0097620_100238152 | 3300006931 | Bacteria | 1909 |
| 213 | Ga0099825_1022929 | 3300006941 | Bacteria | 3921 |
| 214 | Ga0099824_1025812 | 3300006942 | Bacteria | 3145 |
| 215 | Ga0099822_1007677 | 3300006943 | Bacteria | 13908 |
| 216 | Ga0079104_1000093 | 3300006946 | Bacteria | 130633 |
| 217 | Ga0079104_1002731 | 3300006946 | Bacteria | 9004 |
| 218 | Ga0079104_1005856 | 3300006946 | Bacteria | 4797 |
| 219 | Ga0099794_10000291 | 3300007265 | Bacteria | 17263 |
| 220 | Ga0105240_10010945 | 3300009093 | Bacteria | 12709 |
| 221 | Ga0105240_10136790 | 3300009093 | Bacteria | 2934 |
| 222 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 223 | Ga0111539_10000050 | 3300009094 | Bacteria | 118845 |
| 224 | Ga0111539_10004626 | 3300009094 | Bacteria | 17967 |
| 225 | Ga0111539_10102811 | 3300009094 | Bacteria | 3353 |
| 226 | Ga0111539_10109105 | 3300009094 | Unclassified | 3248 |
| 227 | Ga0111539_10155248 | 3300009094 | Bacteria | 2678 |
| 228 | Ga0105245_10012954 | 3300009098 | Bacteria | 7270 |
| 229 | Ga0105247_10000003 | 3300009101 | Bacteria | 694517 |
| 230 | Ga0105247_10007589 | 3300009101 | Bacteria | 6645 |
| 231 | Ga0105247_10015183 | 3300009101 | Bacteria | 4617 |
| 232 | Ga0105247_10025927 | 3300009101 | Bacteria | 3538 |
| 233 | Ga0114129_10038907 | 3300009147 | Bacteria | 6704 |
| 234 | Ga0114129_10049278 | 3300009147 | Bacteria | 5918 |
| 235 | Ga0114129_10062012 | 3300009147 | Bacteria | 5224 |
| 236 | Ga0114129_10092285 | 3300009147 | Bacteria | 4195 |
| 237 | Ga0114129_10099497 | 3300009147 | Bacteria | 4025 |
| 238 | Ga0114129_10270891 | 3300009147 | Bacteria | 2271 |
| 239 | Ga0114129_10282551 | 3300009147 | Bacteria | 2217 |
| 240 | Ga0105243_10101570 | 3300009148 | Bacteria | 2388 |
| 241 | Ga0105241_10064936 | 3300009174 | Bacteria | 2819 |
| 242 | Ga0105241_10086598 | 3300009174 | Bacteria | 2464 |
| 243 | Ga0105241_10108804 | 3300009174 | Bacteria | 2216 |
| 244 | Ga0105241_10280166 | 3300009174 | Bacteria | 1423 |
| 245 | Ga0105242_10009081 | 3300009176 | Bacteria | 7635 |
| 246 | Ga0105242_10014725 | 3300009176 | Bacteria | 6057 |
| 247 | Ga0105242_10037035 | 3300009176 | Bacteria | 3917 |
| 248 | Ga0105248_10045650 | 3300009177 | Bacteria | 4913 |
| 249 | Ga0105248_10300329 | 3300009177 | Bacteria | 1808 |
| 250 | Ga0105237_10000659 | 3300009545 | Bacteria | 47952 |
| 251 | Ga0105237_10003125 | 3300009545 | Bacteria | 19928 |
| 252 | Ga0105237_10007526 | 3300009545 | Bacteria | 11906 |
| 253 | Ga0105237_10063666 | 3300009545 | Bacteria | 3686 |
| 254 | Ga0105237_10071599 | 3300009545 | Bacteria | 3461 |
| 255 | Ga0105237_10085691 | 3300009545 | Unclassified | 3140 |
| 256 | Ga0105237_10161736 | 3300009545 | Bacteria | 2237 |
| 257 | Ga0105237_10205210 | 3300009545 | Bacteria | 1971 |
| 258 | Ga0105238_10013092 | 3300009551 | Bacteria | 8369 |
| 259 | Ga0105238_10015087 | 3300009551 | Bacteria | 7824 |
| 260 | Ga0105249_10000004 | 3300009553 | Bacteria | 368014 |
| 261 | Ga0105249_10011832 | 3300009553 | Bacteria | 7670 |
| 262 | Ga0105249_10017322 | 3300009553 | Bacteria | 6397 |
| 263 | Ga0105249_10094769 | 3300009553 | Bacteria | 2798 |
| 264 | Ga0105249_10140229 | 3300009553 | Bacteria | 2317 |
| 265 | Ga0105249_10189362 | 3300009553 | Bacteria | 2007 |
| 266 | Ga0105239_10041756 | 3300010375 | Bacteria | 5026 |
| 267 | Ga0105239_10043547 | 3300010375 | Bacteria | 4921 |
| 268 | Ga0105239_10048669 | 3300010375 | Bacteria | 4648 |
| 269 | Ga0105239_10090435 | 3300010375 | Bacteria | 3377 |
| 270 | Ga0105239_10115790 | 3300010375 | Bacteria | 2974 |
| 271 | Ga0105239_10119301 | 3300010375 | Bacteria | 2928 |
| 272 | Ga0105239_10248527 | 3300010375 | Bacteria | 1998 |
| 273 | Ga0105246_10000071 | 3300011119 | Bacteria | 42029 |
| 274 | Ga0157373_10002597 | 3300013100 | Bacteria | 13723 |
| 275 | Ga0157373_10010988 | 3300013100 | Bacteria | 6666 |
| 276 | Ga0157373_10055873 | 3300013100 | Bacteria | 2804 |
| 277 | Ga0157369_10085402 | 3300013105 | Bacteria | 3373 |
| 278 | Ga0157369_10107931 | 3300013105 | Bacteria | 2961 |
| 279 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 280 | Ga0157374_10031258 | 3300013296 | Bacteria | 4838 |
| 281 | Ga0157374_10103653 | 3300013296 | Bacteria | 2730 |
| 282 | Ga0157378_10023318 | 3300013297 | Bacteria | 5447 |
| 283 | Ga0163162_10009664 | 3300013306 | Bacteria | 9381 |
| 284 | Ga0163162_10135162 | 3300013306 | Bacteria | 2576 |
| 285 | Ga0157372_10308227 | 3300013307 | Bacteria | 1842 |
| 286 | Ga0157375_10006167 | 3300013308 | Bacteria | 10446 |
| 287 | Ga0157375_10081203 | 3300013308 | Bacteria | 3282 |
| 288 | Ga0157375_10084021 | 3300013308 | Bacteria | 3231 |
| 289 | Ga0157375_10296498 | 3300013308 | Bacteria | 1780 |
| 290 | Ga0163163_10000026 | 3300014325 | Bacteria | 179198 |
| 291 | Ga0163163_10000436 | 3300014325 | Bacteria | 38165 |
| 292 | Ga0163163_10015631 | 3300014325 | Bacteria | 7023 |
| 293 | Ga0163163_10018136 | 3300014325 | Bacteria | 6579 |
| 294 | Ga0163163_10020521 | 3300014325 | Bacteria | 6224 |
| 295 | Ga0163163_10033994 | 3300014325 | Bacteria | 4935 |
| 296 | Ga0163163_10063306 | 3300014325 | Bacteria | 3667 |
| 297 | Ga0163163_10087176 | 3300014325 | Bacteria | 3132 |
| 298 | Ga0163163_10173783 | 3300014325 | Bacteria | 2201 |
| 299 | Ga0163163_10204098 | 3300014325 | Bacteria | 2025 |
| 300 | Ga0157380_10000514 | 3300014326 | Bacteria | 23717 |
| 301 | Ga0157380_10006982 | 3300014326 | Bacteria | 7992 |
| 302 | Ga0157380_10008405 | 3300014326 | Bacteria | 7366 |
| 303 | Ga0157380_10010159 | 3300014326 | Bacteria | 6765 |
| 304 | Ga0157380_10013232 | 3300014326 | Bacteria | 6009 |
| 305 | Ga0157380_10024587 | 3300014326 | Bacteria | 4560 |
| 306 | Ga0157380_10028179 | 3300014326 | Bacteria | 4279 |
| 307 | Ga0157380_10101542 | 3300014326 | Bacteria | 2397 |
| 308 | Ga0157380_10162018 | 3300014326 | Bacteria | 1945 |
| 309 | Ga0182008_10015167 | 3300014497 | Bacteria | 4026 |
| 310 | Ga0157379_10031766 | 3300014968 | Bacteria | 4704 |
| 311 | Ga0157379_10043503 | 3300014968 | Bacteria | 4010 |
| 312 | Ga0183365_10137 | 3300015684 | Bacteria | 1916 |
| 313 | Ga0183363_1032 | 3300015690 | Bacteria | 48614 |
| 314 | Ga0163161_10044606 | 3300017792 | Bacteria | 3194 |
| 315 | Ga0214542_1000011 | 3300021321 | Bacteria | 238260 |
| 316 | Ga0214542_1008060 | 3300021321 | Bacteria | 17792 |
| 317 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 318 | Ga0214543_1000259 | 3300021327 | Bacteria | 81880 |
| 319 | Ga0213876_10002813 | 3300021384 | Bacteria | 10124 |
| 320 | Ga0213871_10004950 | 3300021441 | Bacteria | 2712 |
| 321 | Ga0228711_1000019 | 3300022739 | Bacteria | 111795 |
| 322 | Ga0228710_1000022 | 3300022740 | Bacteria | 111795 |
| 323 | Ga0207672_1000445 | 3300025223 | Bacteria | 5261 |
| 324 | Ga0209563_103701 | 3300025230 | Bacteria | 3098 |
| 325 | Ga0207425_1000736 | 3300025245 | Bacteria | 17202 |
| 326 | Ga0209026_1000013 | 3300025250 | Bacteria | 415633 |
| 327 | Ga0209677_100643 | 3300025253 | Bacteria | 18518 |
| 328 | Ga0209677_103007 | 3300025253 | Bacteria | 5832 |
| 329 | Ga0209148_1000266 | 3300025254 | Bacteria | 82141 |
| 330 | Ga0209148_1000474 | 3300025254 | Bacteria | 42596 |
| 331 | Ga0209148_1009957 | 3300025254 | Bacteria | 1824 |
| 332 | Ga0209148_1011910 | 3300025254 | Bacteria | 1604 |
| 333 | Ga0209759_1000149 | 3300025256 | Bacteria | 120932 |
| 334 | Ga0209129_1000113 | 3300025258 | Bacteria | 145178 |
| 335 | Ga0209129_1002521 | 3300025258 | Bacteria | 8925 |
| 336 | Ga0209233_1000102 | 3300025261 | Bacteria | 285774 |
| 337 | Ga0209233_1000201 | 3300025261 | Bacteria | 123566 |
| 338 | Ga0209233_1003536 | 3300025261 | Bacteria | 5494 |
| 339 | Ga0209233_1003653 | 3300025261 | Bacteria | 5385 |
| 340 | Ga0209455_1000234 | 3300025272 | Bacteria | 70076 |
| 341 | Ga0209455_1001414 | 3300025272 | Bacteria | 10881 |
| 342 | Ga0209455_1004746 | 3300025272 | Bacteria | 4360 |
| 343 | Ga0209673_1003797 | 3300025273 | Bacteria | 8576 |
| 344 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 345 | Ga0209676_1000097 | 3300025292 | Bacteria | 237203 |
| 346 | Ga0209676_1008514 | 3300025292 | Bacteria | 4563 |
| 347 | Ga0209025_1000044 | 3300025294 | Bacteria | 349480 |
| 348 | Ga0209025_1000295 | 3300025294 | Bacteria | 111489 |
| 349 | Ga0209564_1000093 | 3300025295 | Bacteria | 245793 |
| 350 | Ga0209564_1000186 | 3300025295 | Bacteria | 147120 |
| 351 | Ga0209758_1000172 | 3300025297 | Bacteria | 147763 |
| 352 | Ga0209758_1003660 | 3300025297 | Bacteria | 13697 |
| 353 | Ga0209758_1015042 | 3300025297 | Bacteria | 4044 |
| 354 | Ga0209050_1000228 | 3300025298 | Bacteria | 123537 |
| 355 | Ga0209050_1000489 | 3300025298 | Bacteria | 68506 |
| 356 | Ga0209050_1004684 | 3300025298 | Bacteria | 9085 |
| 357 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 358 | Ga0209256_1000030 | 3300025299 | Bacteria | 414828 |
| 359 | Ga0209256_1002044 | 3300025299 | Bacteria | 17914 |
| 360 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 361 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 362 | Ga0209051_1025463 | 3300025303 | Bacteria | 2406 |
| 363 | Ga0209257_1000423 | 3300025304 | Bacteria | 81354 |
| 364 | Ga0209257_1010078 | 3300025304 | Bacteria | 4884 |
| 365 | Ga0207682_10008562 | 3300025893 | Bacteria | 4044 |
| 366 | Ga0207682_10054532 | 3300025893 | Bacteria | 1661 |
| 367 | Ga0207682_10059892 | 3300025893 | Bacteria | 1592 |
| 368 | Ga0207692_10054139 | 3300025898 | Bacteria | 2047 |
| 369 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 370 | Ga0207710_10010227 | 3300025900 | Bacteria | 3945 |
| 371 | Ga0207710_10015559 | 3300025900 | Bacteria | 3217 |
| 372 | Ga0207710_10027279 | 3300025900 | Bacteria | 2472 |
| 373 | Ga0207688_10054327 | 3300025901 | Bacteria | 2247 |
| 374 | Ga0207699_10074917 | 3300025906 | Bacteria | 2080 |
| 375 | Ga0207645_10066238 | 3300025907 | Bacteria | 2309 |
| 376 | Ga0207645_10131458 | 3300025907 | Bacteria | 1629 |
| 377 | Ga0207643_10004683 | 3300025908 | Bacteria | 7339 |
| 378 | Ga0207643_10039937 | 3300025908 | Bacteria | 2640 |
| 379 | Ga0207705_10148970 | 3300025909 | Bacteria | 1752 |
| 380 | Ga0207684_10045941 | 3300025910 | Bacteria | 3705 |
| 381 | Ga0207684_10094752 | 3300025910 | Bacteria | 2546 |
| 382 | Ga0207654_10046135 | 3300025911 | Bacteria | 2484 |
| 383 | Ga0207654_10073132 | 3300025911 | Bacteria | 2042 |
| 384 | Ga0207707_10006417 | 3300025912 | Bacteria | 10271 |
| 385 | Ga0207707_10023883 | 3300025912 | Bacteria | 5346 |
| 386 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 387 | Ga0207695_10113346 | 3300025913 | Bacteria | 2688 |
| 388 | Ga0207671_10001797 | 3300025914 | Bacteria | 23996 |
| 389 | Ga0207671_10062949 | 3300025914 | Bacteria | 2756 |
| 390 | Ga0207671_10070889 | 3300025914 | Bacteria | 2599 |
| 391 | Ga0207671_10108418 | 3300025914 | Bacteria | 2111 |
| 392 | Ga0207693_10041585 | 3300025915 | Bacteria | 3619 |
| 393 | Ga0207663_10069960 | 3300025916 | Bacteria | 2260 |
| 394 | Ga0207660_10096169 | 3300025917 | Bacteria | 2205 |
| 395 | Ga0207662_10003226 | 3300025918 | Bacteria | 8351 |
| 396 | Ga0207646_10000897 | 3300025922 | Bacteria | 38370 |
| 397 | Ga0207681_10001769 | 3300025923 | Bacteria | 13881 |
| 398 | Ga0207681_10002874 | 3300025923 | Bacteria | 10883 |
| 399 | Ga0207694_10003165 | 3300025924 | Bacteria | 13139 |
| 400 | Ga0207694_10168470 | 3300025924 | Bacteria | 1772 |
| 401 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 402 | Ga0207650_10000006 | 3300025925 | Bacteria | 544730 |
| 403 | Ga0207650_10093386 | 3300025925 | Bacteria | 2303 |
| 404 | Ga0207659_10185954 | 3300025926 | Bacteria | 1650 |
| 405 | Ga0207664_10028123 | 3300025929 | Bacteria | 4270 |
| 406 | Ga0207644_10000019 | 3300025931 | Bacteria | 170919 |
| 407 | Ga0207644_10005864 | 3300025931 | Bacteria | 8006 |
| 408 | Ga0207644_10044518 | 3300025931 | Bacteria | 3153 |
| 409 | Ga0207706_10001920 | 3300025933 | Bacteria | 20417 |
| 410 | Ga0207706_10087741 | 3300025933 | Bacteria | 2736 |
| 411 | Ga0207706_10147100 | 3300025933 | Bacteria | 2072 |
| 412 | Ga0207686_10015421 | 3300025934 | Bacteria | 4272 |
| 413 | Ga0207670_10004621 | 3300025936 | Bacteria | 7452 |
| 414 | Ga0207704_10023768 | 3300025938 | Bacteria | 3310 |
| 415 | Ga0207704_10049131 | 3300025938 | Bacteria | 2535 |
| 416 | Ga0207691_10026129 | 3300025940 | Bacteria | 5479 |
| 417 | Ga0207691_10050920 | 3300025940 | Bacteria | 3789 |
| 418 | Ga0207691_10083656 | 3300025940 | Bacteria | 2865 |
| 419 | Ga0207691_10091002 | 3300025940 | Bacteria | 2734 |
| 420 | Ga0207691_10102332 | 3300025940 | Bacteria | 2555 |
| 421 | Ga0207691_10145852 | 3300025940 | Bacteria | 2083 |
| 422 | Ga0207711_10003845 | 3300025941 | Bacteria | 12915 |
| 423 | Ga0207711_10005157 | 3300025941 | Bacteria | 11069 |
| 424 | Ga0207711_10203326 | 3300025941 | Bacteria | 1808 |
| 425 | Ga0207689_10037772 | 3300025942 | Bacteria | 4003 |
| 426 | Ga0207689_10139500 | 3300025942 | Bacteria | 1997 |
| 427 | Ga0207679_10058560 | 3300025945 | Bacteria | 2855 |
| 428 | Ga0207667_10009181 | 3300025949 | Bacteria | 11680 |
| 429 | Ga0207667_10063348 | 3300025949 | Bacteria | 3863 |
| 430 | Ga0207667_10417946 | 3300025949 | Bacteria | 1364 |
| 431 | Ga0207651_10018310 | 3300025960 | Bacteria | 4164 |
| 432 | Ga0207651_10131574 | 3300025960 | Bacteria | 1916 |
| 433 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 434 | Ga0207712_10013011 | 3300025961 | Bacteria | 5329 |
| 435 | Ga0207712_10018934 | 3300025961 | Bacteria | 4491 |
| 436 | Ga0207640_10140741 | 3300025981 | Bacteria | 1758 |
| 437 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 438 | Ga0207658_10000566 | 3300025986 | Bacteria | 33572 |
| 439 | Ga0207658_10020522 | 3300025986 | Bacteria | 4575 |
| 440 | Ga0207658_10293016 | 3300025986 | Bacteria | 1399 |
| 441 | Ga0207703_10000080 | 3300026035 | Bacteria | 111786 |
| 442 | Ga0207703_10049252 | 3300026035 | Bacteria | 3405 |
| 443 | Ga0207703_10096342 | 3300026035 | Bacteria | 2498 |
| 444 | Ga0207703_10139946 | 3300026035 | Bacteria | 2099 |
| 445 | Ga0207703_10168821 | 3300026035 | Bacteria | 1923 |
| 446 | Ga0207639_10002007 | 3300026041 | Bacteria | 13718 |
| 447 | Ga0207639_10025773 | 3300026041 | Bacteria | 4265 |
| 448 | Ga0207639_10111072 | 3300026041 | Bacteria | 2234 |
| 449 | Ga0207708_10027499 | 3300026075 | Bacteria | 4306 |
| 450 | Ga0207708_10063572 | 3300026075 | Bacteria | 2820 |
| 451 | Ga0207708_10083355 | 3300026075 | Bacteria | 2458 |
| 452 | Ga0207641_10010982 | 3300026088 | Bacteria | 7423 |
| 453 | Ga0207641_10034514 | 3300026088 | Bacteria | 4209 |
| 454 | Ga0207641_10062192 | 3300026088 | Bacteria | 3185 |
| 455 | Ga0207641_10070522 | 3300026088 | Bacteria | 3003 |
| 456 | Ga0207641_10072330 | 3300026088 | Bacteria | 2969 |
| 457 | Ga0207641_10290615 | 3300026088 | Bacteria | 1540 |
| 458 | Ga0207648_10010770 | 3300026089 | Bacteria | 8640 |
| 459 | Ga0207648_10089361 | 3300026089 | Bacteria | 2691 |
| 460 | Ga0207648_10273239 | 3300026089 | Bacteria | 1510 |
| 461 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 462 | Ga0207676_10011127 | 3300026095 | Bacteria | 6423 |
| 463 | Ga0207676_10020600 | 3300026095 | Bacteria | 4827 |
| 464 | Ga0207674_10033670 | 3300026116 | Bacteria | 5363 |
| 465 | Ga0207675_100001206 | 3300026118 | Bacteria | 25753 |
| 466 | Ga0207675_100002146 | 3300026118 | Bacteria | 19587 |
| 467 | Ga0207675_100006135 | 3300026118 | Bacteria | 11424 |
| 468 | Ga0207675_100031090 | 3300026118 | Bacteria | 4971 |
| 469 | Ga0207675_100038809 | 3300026118 | Bacteria | 4444 |
| 470 | Ga0207675_100104968 | 3300026118 | Bacteria | 2663 |
| 471 | Ga0207675_100180377 | 3300026118 | Bacteria | 2022 |
| 472 | Ga0207683_10016248 | 3300026121 | Bacteria | 6333 |
| 473 | Ga0207683_10019417 | 3300026121 | Bacteria | 5804 |
| 474 | Ga0207683_10082422 | 3300026121 | Bacteria | 2857 |
| 475 | Ga0207698_10130633 | 3300026142 | Bacteria | 2145 |
| 476 | Ga0209281_1000084 | 3300027111 | Bacteria | 254215 |
| 477 | Ga0209281_1000200 | 3300027111 | Bacteria | 135685 |
| 478 | Ga0209281_1000227 | 3300027111 | Bacteria | 119329 |
| 479 | Ga0209589_1000042 | 3300027357 | Bacteria | 122436 |
| 480 | Ga0209489_100095 | 3300027361 | Bacteria | 122436 |
| 481 | Ga0209700_100095 | 3300027363 | Bacteria | 122436 |
| 482 | Ga0209282_1000042 | 3300027666 | Bacteria | 119329 |
| 483 | Ga0209588_1002309 | 3300027671 | Bacteria | 5162 |
| 484 | Ga0209974_10015904 | 3300027876 | Bacteria | 2498 |
| 485 | Ga0207428_10000026 | 3300027907 | Bacteria | 255539 |
| 486 | Ga0207428_10000937 | 3300027907 | Bacteria | 32446 |
| 487 | Ga0268266_10001081 | 3300028379 | Bacteria | 34140 |
| 488 | Ga0268266_10009418 | 3300028379 | Bacteria | 8602 |
| 489 | Ga0268266_10026439 | 3300028379 | Bacteria | 4938 |
| 490 | Ga0268266_10044635 | 3300028379 | Bacteria | 3789 |
| 491 | Ga0268266_10068908 | 3300028379 | Bacteria | 3064 |
| 492 | Ga0268266_10171582 | 3300028379 | Bacteria | 1969 |
| 493 | Ga0268265_10000035 | 3300028380 | Bacteria | 207267 |
| 494 | Ga0268265_10000436 | 3300028380 | Bacteria | 44235 |
| 495 | Ga0268265_10045156 | 3300028380 | Bacteria | 3286 |
| 496 | Ga0268264_10000061 | 3300028381 | Bacteria | 303123 |
| 497 | Ga0268264_10000153 | 3300028381 | Bacteria | 157298 |
| 498 | Ga0268264_10002586 | 3300028381 | Bacteria | 15829 |
| 499 | Ga0268264_10003066 | 3300028381 | Bacteria | 14474 |
| 500 | Ga0268264_10020209 | 3300028381 | Bacteria | 5443 |
| 501 | Ga0268264_10056606 | 3300028381 | Bacteria | 3278 |
| 502 | Ga0307517_10000115 | 3300028786 | Bacteria | 118327 |
| 503 | Ga0307517_10040568 | 3300028786 | Bacteria | 5063 |
| 504 | Ga0307517_10065943 | 3300028786 | Bacteria | 3340 |
| 505 | Ga0307515_10000123 | 3300028794 | Bacteria | 186601 |
| 506 | Ga0307515_10001309 | 3300028794 | Bacteria | 56564 |
| 507 | Ga0307515_10006687 | 3300028794 | Bacteria | 22962 |
| 508 | Ga0307515_10006795 | 3300028794 | Bacteria | 22758 |
| 509 | Ga0307515_10010448 | 3300028794 | Bacteria | 17785 |
| 510 | Ga0307515_10042388 | 3300028794 | Bacteria | 7121 |
| 511 | Ga0307515_10076789 | 3300028794 | Bacteria | 4423 |
| 512 | Ga0307515_10186638 | 3300028794 | Bacteria | 2000 |
| 513 | Ga0265338_10023127 | 3300028800 | Bacteria | 6400 |
| 514 | Ga0307511_10000541 | 3300030521 | Bacteria | 40505 |
| 515 | Ga0307511_10062089 | 3300030521 | Bacteria | 2840 |
| 516 | Ga0307512_10034667 | 3300030522 | Bacteria | 4314 |
| 517 | Ga0316181_1183610 | 3300030744 | Bacteria | 5049 |
| 518 | Ga0265325_10048230 | 3300031241 | Bacteria | 2202 |
| 519 | Ga0265316_10013079 | 3300031344 | Bacteria | 7402 |
| 520 | Ga0307513_10002506 | 3300031456 | Bacteria | 25411 |
| 521 | Ga0307513_10012786 | 3300031456 | Bacteria | 10337 |
| 522 | Ga0307513_10015322 | 3300031456 | Bacteria | 9298 |
| 523 | Ga0307513_10095926 | 3300031456 | Bacteria | 3005 |
| 524 | Ga0307513_10124414 | 3300031456 | Bacteria | 2538 |
| 525 | Ga0307509_10000333 | 3300031507 | Bacteria | 77879 |
| 526 | Ga0307509_10000539 | 3300031507 | Bacteria | 64754 |
| 527 | Ga0307509_10022078 | 3300031507 | Bacteria | 7185 |
| 528 | Ga0307509_10033967 | 3300031507 | Bacteria | 5608 |
| 529 | Ga0307509_10036877 | 3300031507 | Bacteria | 5348 |
| 530 | Ga0307509_10086071 | 3300031507 | Bacteria | 3232 |
| 531 | Ga0307509_10200130 | 3300031507 | Bacteria | 1835 |
| 532 | Ga0307408_100022215 | 3300031548 | Bacteria | 4308 |
| 533 | Ga0307408_100074110 | 3300031548 | Bacteria | 2525 |
| 534 | Ga0307508_10000640 | 3300031616 | Bacteria | 42119 |
| 535 | Ga0307508_10000727 | 3300031616 | Bacteria | 39082 |
| 536 | Ga0307508_10006268 | 3300031616 | Bacteria | 11201 |
| 537 | Ga0307508_10008420 | 3300031616 | Bacteria | 9526 |
| 538 | Ga0307508_10079883 | 3300031616 | Bacteria | 2852 |
| 539 | Ga0307514_10001271 | 3300031649 | Bacteria | 32966 |
| 540 | Ga0307514_10019042 | 3300031649 | Bacteria | 5621 |
| 541 | Ga0265314_10058516 | 3300031711 | Bacteria | 2640 |
| 542 | Ga0265342_10076793 | 3300031712 | Bacteria | 1936 |
| 543 | Ga0316576_10003425 | 3300031727 | Bacteria | 9283 |
| 544 | Ga0316578_10111996 | 3300031728 | Bacteria | 1639 |
| 545 | Ga0307516_10017736 | 3300031730 | Bacteria | 7417 |
| 546 | Ga0307516_10033117 | 3300031730 | Bacteria | 5201 |
| 547 | Ga0307516_10156730 | 3300031730 | Bacteria | 2031 |
| 548 | Ga0307516_10162414 | 3300031730 | Bacteria | 1983 |
| 549 | Ga0307405_10010158 | 3300031731 | Bacteria | 4861 |
| 550 | Ga0307413_10030431 | 3300031824 | Bacteria | 3033 |
| 551 | Ga0307413_10117523 | 3300031824 | Bacteria | 1794 |
| 552 | Ga0307413_10144382 | 3300031824 | Bacteria | 1649 |
| 553 | Ga0307410_10041291 | 3300031852 | Bacteria | 3041 |
| 554 | Ga0307410_10057438 | 3300031852 | Bacteria | 2650 |
| 555 | Ga0307406_10010677 | 3300031901 | Bacteria | 5186 |
| 556 | Ga0307407_10025776 | 3300031903 | Bacteria | 3104 |
| 557 | Ga0307412_10010376 | 3300031911 | Bacteria | 5362 |
| 558 | Ga0307412_10099922 | 3300031911 | Bacteria | 2050 |
| 559 | Ga0307412_10106108 | 3300031911 | Bacteria | 1997 |
| 560 | Ga0307412_10127381 | 3300031911 | Bacteria | 1844 |
| 561 | Ga0315914_1000009 | 3300031967 | Bacteria | 182444 |
| 562 | Ga0307409_100000814 | 3300031995 | Bacteria | 14314 |
| 563 | Ga0307409_100039573 | 3300031995 | Bacteria | 3500 |
| 564 | Ga0307409_100154027 | 3300031995 | Bacteria | 2000 |
| 565 | Ga0307416_100021865 | 3300032002 | Bacteria | 4604 |
| 566 | Ga0307414_10013742 | 3300032004 | Bacteria | 4828 |
| 567 | Ga0307414_10084921 | 3300032004 | Bacteria | 2330 |
| 568 | Ga0307411_10001811 | 3300032005 | Bacteria | 9059 |
| 569 | Ga0307411_10003000 | 3300032005 | Bacteria | 7689 |
| 570 | Ga0307411_10046706 | 3300032005 | Bacteria | 2794 |
| 571 | Ga0307411_10157309 | 3300032005 | Bacteria | 1697 |
| 572 | Ga0307415_100203445 | 3300032126 | Bacteria | 1573 |
| 573 | Ga0307510_10000023 | 3300033180 | Bacteria | 155640 |
| 574 | Ga0307510_10007145 | 3300033180 | Bacteria | 13293 |
| 575 | Ga0307510_10056415 | 3300033180 | Bacteria | 4091 |
| 576 | Ga0307510_10065641 | 3300033180 | Bacteria | 3673 |
| 577 | Ga0307510_10071237 | 3300033180 | Bacteria | 3464 |
| 578 | Ga0307510_10104077 | 3300033180 | Bacteria | 2613 |
| 579 | Ga0315913_1000015 | 3300033430 | Bacteria | 119325 |
| 580 | Ga0315915_1000013 | 3300033464 | Bacteria | 182438 |
| 581 | Ga0316574_0063443 | 3300035398 | Bacteria | 2324 |
| 582 | Ga0373931_0037306 | 3300035691 | Bacteria | 2537 |
| 583 | Ga0373927_0000141 | 3300035695 | Bacteria | 55933 |
| 584 | Ga0373937_0253682 | 3300036401 | Bacteria | 1658 |
| 585 | Ga0316582_0006931 | 3300036647 | Bacteria | 5995 |
| 586 | Ga0316582_0178748 | 3300036647 | Bacteria | 1443 |
| 587 | Ga0373925_0002260 | 3300037068 | Bacteria | 15592 |
| 588 | Ga0373925_0037538 | 3300037068 | Bacteria | 3577 |
| 589 | Ga0373925_0289752 | 3300037068 | Bacteria | 1320 |
| 590 | Ga0395905_0000091 | 3300037471 | Bacteria | 151747 |
| 591 | Ga0395905_0001489 | 3300037471 | Bacteria | 28024 |
| 592 | Ga0395905_0023190 | 3300037471 | Bacteria | 5866 |
| 593 | Ga0395905_0140917 | 3300037471 | Bacteria | 2268 |
| 594 | Ga0395901_0004559 | 3300038443 | Bacteria | 13986 |
| 595 | Ga0400483_150886 | 3300039062 | Bacteria | 6031 |
| 596 | Ga0436365_0492506 | 3300039437 | Bacteria | 6832 |
| 597 | Ga0436360_1140827 | 3300039438 | Bacteria | 4316 |
| 598 | Ga0436361_0276468 | 3300039447 | Bacteria | 5303 |
| 599 | Ga0439465_0029187 | 3300041413 | Bacteria | 1752 |
| 600 | Ga0451791_1040051 | 3300041451 | Bacteria | 5797 |
| 601 | Ga0451807_0254012 | 3300041486 | Bacteria | 3634 |
| 602 | Ga0439433_0011253 | 3300041999 | Bacteria | 1958 |
| 603 | Ga0439449_0009998 | 3300042007 | Bacteria | 3590 |
| 604 | Ga0439462_0006603 | 3300042015 | Bacteria | 2887 |
| 605 | Ga0450919_000188 | 3300042121 | Bacteria | 6676 |
| 606 | Ga0450896_005054 | 3300042133 | Bacteria | 1796 |
| 607 | Ga0439459_0015402 | 3300042438 | Bacteria | 1401 |
| 608 | Ga0451577_0003794 | 3300042876 | Bacteria | 16448 |
| 609 | Ga0466969_0000198 | 3300044656 | Bacteria | 32667 |
| 610 | Ga0453683_0021967 | 3300044673 | Bacteria | 4072 |
| 611 | Ga0466966_0004454 | 3300044684 | Bacteria | 9237 |
| 612 | Ga0466966_0012023 | 3300044684 | Bacteria | 5737 |
| 613 | Ga0466961_0008979 | 3300044693 | Bacteria | 6378 |
| 614 | Ga0466961_0035887 | 3300044693 | Bacteria | 3182 |
| 615 | Ga0466963_0004084 | 3300044694 | Bacteria | 8445 |
| 616 | Ga0453684_0126776 | 3300044712 | Bacteria | 3070 |
| 617 | Ga0466971_0007674 | 3300044719 | Bacteria | 4705 |
| 618 | Ga0466970_0012562 | 3300044765 | Bacteria | 4333 |
| 619 | Ga0466957_0050523 | 3300044842 | Bacteria | 2530 |
| 620 | Ga0466959_0016963 | 3300045049 | Bacteria | 5331 |
| 621 | Ga0451576_0004545 | 3300045051 | Bacteria | 17969 |
| 622 | Ga0451576_0328538 | 3300045051 | Bacteria | 1601 |
| 623 | Ga0466958_0014422 | 3300045836 | Bacteria | 4512 |
| 624 | Ga0466967_0014366 | 3300045976 | Bacteria | 6165 |
| 625 | Ga0495617_000377 | 3300046452 | Bacteria | 24634 |
| 626 | Ga0495638_0002960 | 3300046460 | Bacteria | 13557 |
| 627 | Ga0495638_0003111 | 3300046460 | Bacteria | 13152 |
| 628 | Ga0495638_0032266 | 3300046460 | Bacteria | 3359 |
| 629 | Ga0495638_0033066 | 3300046460 | Bacteria | 3309 |
| 630 | Ga0495638_0042772 | 3300046460 | Bacteria | 2861 |
| 631 | Ga0495653_0000009 | 3300046463 | Bacteria | 304207 |
| 632 | Ga0495650_0000184 | 3300046471 | Bacteria | 136939 |
| 633 | Ga0495650_0000240 | 3300046471 | Bacteria | 109029 |
| 634 | Ga0495584_0001561 | 3300046491 | Bacteria | 13600 |
| 635 | Ga0495606_0001061 | 3300046507 | Bacteria | 39727 |
| 636 | Ga0495606_0004320 | 3300046507 | Bacteria | 14293 |
| 637 | Ga0495610_0009062 | 3300046512 | Bacteria | 6344 |
| 638 | Ga0495610_0024493 | 3300046512 | Bacteria | 3255 |
| 639 | Ga0495616_0005415 | 3300046513 | Bacteria | 7863 |
| 640 | Ga0495632_0003595 | 3300046519 | Bacteria | 10912 |
| 641 | Ga0495632_0015652 | 3300046519 | Bacteria | 4241 |
| 642 | Ga0495644_0000287 | 3300046523 | Bacteria | 23293 |
| 643 | Ga0495654_0062965 | 3300046530 | Bacteria | 1777 |
| 644 | Ga0495609_0000866 | 3300046538 | Bacteria | 22239 |
| 645 | Ga0495609_0083056 | 3300046538 | Bacteria | 1399 |
| 646 | Ga0495645_0034890 | 3300046543 | Bacteria | 3668 |
| 647 | Ga0495656_0002526 | 3300046615 | Bacteria | 6092 |
| 648 | Ga0495656_0022562 | 3300046615 | Bacteria | 2467 |
| 649 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 650 | Ga0495668_0002028 | 3300046616 | Bacteria | 17669 |
| 651 | Ga0495668_0008340 | 3300046616 | Bacteria | 6487 |
| 652 | Ga0495668_0044664 | 3300046616 | Bacteria | 2463 |
| 653 | Ga0495611_0000347 | 3300046648 | Bacteria | 30158 |
| 654 | Ga0495625_0000990 | 3300046660 | Bacteria | 37644 |
| 655 | Ga0495625_0007420 | 3300046660 | Bacteria | 9548 |
| 656 | Ga0495625_0025679 | 3300046660 | Bacteria | 4465 |
| 657 | Ga0495625_0037357 | 3300046660 | Bacteria | 3564 |
| 658 | Ga0495625_0091715 | 3300046660 | Bacteria | 2100 |
| 659 | Ga0495658_0154754 | 3300046683 | Bacteria | 1410 |
| 660 | Ga0495671_0000926 | 3300046692 | Bacteria | 20774 |
| 661 | Ga0495649_0022211 | 3300046694 | Bacteria | 3550 |
| 662 | Ga0495677_0000287 | 3300047445 | Bacteria | 22154 |
| 663 | Ga0495681_0034048 | 3300047470 | Bacteria | 2542 |
| 664 | Ga0495686_0040467 | 3300047472 | Bacteria | 2972 |
| 665 | Ga0495686_0040964 | 3300047472 | Bacteria | 2951 |
| 666 | Ga0496101_0099942 | 3300048904 | Bacteria | 2169 |
| 667 | Ga0496101_0100295 | 3300048904 | Bacteria | 2166 |
| 668 | Ga0496102_0003979 | 3300048905 | Bacteria | 12519 |
| 669 | Ga0496102_0105810 | 3300048905 | Bacteria | 2618 |
| 670 | Ga0496102_0109711 | 3300048905 | Bacteria | 2572 |
| 671 | Ga0496104_0010257 | 3300048907 | Bacteria | 8368 |
| 672 | Ga0496104_0030153 | 3300048907 | Bacteria | 5038 |
| 673 | Ga0496105_0070919 | 3300048908 | Bacteria | 2880 |
| 674 | Ga0496106_0000980 | 3300048909 | Bacteria | 20817 |
| 675 | Ga0496106_0004082 | 3300048909 | Bacteria | 10891 |
| 676 | Ga0496107_0172183 | 3300048910 | Bacteria | 1607 |
| 677 | Ga0496109_0031019 | 3300048912 | Bacteria | 4793 |
| 678 | Ga0496111_0199515 | 3300048914 | Bacteria | 1488 |
| 679 | Ga0496112_0004020 | 3300048915 | Bacteria | 12332 |
| 680 | Ga0496114_0004364 | 3300048917 | Bacteria | 10953 |
| 681 | Ga0496114_0027194 | 3300048917 | Bacteria | 4684 |
| 682 | Ga0496114_0090051 | 3300048917 | Bacteria | 2604 |
| 683 | Ga0496114_0142678 | 3300048917 | Bacteria | 2075 |
| 684 | Ga0496114_0167835 | 3300048917 | Bacteria | 1912 |
| 685 | Ga0496116_0014580 | 3300048919 | Bacteria | 6266 |
| 686 | Ga0496117_0000434 | 3300048920 | Bacteria | 69571 |
| 687 | Ga0496117_0002639 | 3300048920 | Bacteria | 22240 |
| 688 | Ga0496117_0005831 | 3300048920 | Bacteria | 12760 |
| 689 | Ga0496118_0005579 | 3300048921 | Bacteria | 14247 |
| 690 | Ga0496119_0013173 | 3300048922 | Bacteria | 6615 |
| 691 | Ga0496120_0001446 | 3300048923 | Bacteria | 28425 |
| 692 | Ga0496121_0000353 | 3300048924 | Bacteria | 95678 |
| 693 | Ga0496121_0006775 | 3300048924 | Bacteria | 14050 |
| 694 | Ga0496121_0018849 | 3300048924 | Bacteria | 6926 |
| 695 | Ga0496121_0052320 | 3300048924 | Bacteria | 3431 |
| 696 | Ga0496122_0000137 | 3300048925 | Bacteria | 170016 |
| 697 | Ga0496122_0001470 | 3300048925 | Bacteria | 37937 |
| 698 | Ga0496123_0000018 | 3300048926 | Bacteria | 404553 |
| 699 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 700 | Ga0496124_0000285 | 3300048927 | Bacteria | 95893 |
| 701 | Ga0496124_0003608 | 3300048927 | Bacteria | 18803 |
| 702 | Ga0496124_0022230 | 3300048927 | Bacteria | 5820 |
| 703 | Ga0496124_0192186 | 3300048927 | Bacteria | 1560 |
| 704 | Ga0496124_0198544 | 3300048927 | Bacteria | 1528 |
| 705 | Ga0496125_0000215 | 3300048928 | Bacteria | 118487 |
| 706 | Ga0496125_0000318 | 3300048928 | Bacteria | 93900 |
| 707 | Ga0496125_0025330 | 3300048928 | Bacteria | 5435 |
| 708 | Ga0496125_0038719 | 3300048928 | Bacteria | 4119 |
| 709 | Ga0496126_0080068 | 3300048929 | Bacteria | 2891 |
| 710 | Ga0496126_0108498 | 3300048929 | Bacteria | 2420 |
| 711 | Ga0495682_0000291 | 3300049460 | Bacteria | 38579 |
| 712 | Ga0495682_0033963 | 3300049460 | Bacteria | 1882 |
| 713 | Ga0501033_0153066 | 3300049570 | Bacteria | 1663 |
| 714 | Ga0501033_0171860 | 3300049570 | Bacteria | 1556 |
| 715 | Ga0501034_0000807 | 3300049571 | Bacteria | 46580 |
| 716 | Ga0501034_0070465 | 3300049571 | Bacteria | 3507 |
| 717 | Ga0501034_0123694 | 3300049571 | Bacteria | 2572 |
| 718 | Ga0501034_0202866 | 3300049571 | Bacteria | 1940 |
| 719 | Ga0501034_0260860 | 3300049571 | Bacteria | 1675 |
| 720 | Ga0501036_0076433 | 3300049572 | Bacteria | 2832 |
| 721 | Ga0501036_0133631 | 3300049572 | Bacteria | 2094 |
| 722 | Ga0501037_0057199 | 3300049573 | Bacteria | 2847 |
| 723 | Ga0501041_0121754 | 3300049577 | Bacteria | 1622 |
| 724 | Ga0501046_0013179 | 3300049580 | Bacteria | 7011 |
| 725 | Ga0501046_0096412 | 3300049580 | Bacteria | 2272 |
| 726 | Ga0501047_0033253 | 3300049581 | Bacteria | 4977 |
| 727 | Ga0501067_0033911 | 3300049583 | Bacteria | 2833 |
| 728 | Ga0501069_0046654 | 3300049585 | Bacteria | 2404 |
| 729 | Ga0501070_0167135 | 3300049586 | Bacteria | 1813 |
| 730 | Ga0501071_0016463 | 3300049587 | Bacteria | 5085 |
| 731 | Ga0501072_0130240 | 3300049588 | Bacteria | 2005 |
| 732 | Ga0501073_0001736 | 3300049589 | Bacteria | 16195 |
| 733 | Ga0501076_0037579 | 3300049592 | Bacteria | 3798 |
| 734 | Ga0501076_0057722 | 3300049592 | Bacteria | 3083 |
| 735 | Ga0501077_0027847 | 3300049593 | Bacteria | 3589 |
| 736 | Ga0501077_0088836 | 3300049593 | Bacteria | 1959 |
| 737 | Ga0501079_0010367 | 3300049741 | Bacteria | 7082 |
| 738 | Ga0501080_0000921 | 3300049742 | Bacteria | 24022 |
| 739 | Ga0501080_0093028 | 3300049742 | Bacteria | 2800 |
| 740 | Ga0501080_0298596 | 3300049742 | Bacteria | 1461 |
| 741 | Ga0501081_0026182 | 3300049743 | Bacteria | 3931 |
| 742 | Ga0501081_0127915 | 3300049743 | Bacteria | 1813 |
| 743 | Ga0501083_0007148 | 3300049744 | Bacteria | 7924 |
| 744 | Ga0501035_0000263 | 3300049822 | Bacteria | 62255 |
| 745 | Ga0501035_0017062 | 3300049822 | Bacteria | 6690 |
| 746 | Ga0501035_0169841 | 3300049822 | Bacteria | 1884 |
| 747 | Ga0501044_0059852 | 3300049823 | Bacteria | 3901 |
| 748 | Ga0501045_0106666 | 3300049824 | Bacteria | 2076 |
| 749 | Ga0501045_0199936 | 3300049824 | Bacteria | 1489 |
| 750 | nmdc:mga03n38_52311_c1 | 3300050490 | Bacteria | 1827 |
| 751 | nmdc:mga00v17_23585_c1 | 3300050491 | Bacteria | 3560 |
| 752 | nmdc:mga0yw44_6756_c1 | 3300050492 | Bacteria | 5573 |
| 753 | nmdc:mga0k408_61113_c1 | 3300050493 | Bacteria | 2190 |
| 754 | nmdc:mga0k408_8011_c1 | 3300050493 | Bacteria | 1719 |
| 755 | nmdc:mga06z11_3482_c1 | 3300050494 | Bacteria | 6096 |
| 756 | nmdc:mga06z11_56445_c1 | 3300050494 | Bacteria | 2031 |
| 757 | nmdc:mga07m45_156856_c1 | 3300050496 | Bacteria | 1321 |
| 758 | nmdc:mga07m45_28522_c1 | 3300050496 | Bacteria | 3081 |
| 759 | nmdc:mga05p37_152813_c1 | 3300050507 | Bacteria | 2822 |
| 760 | nmdc:mga05p37_15503_c1 | 3300050507 | Bacteria | 9162 |
| 761 | nmdc:mga05p37_49098_c1 | 3300050507 | Bacteria | 5191 |
| 762 | nmdc:mga05p37_756_c1 | 3300050507 | Bacteria | 35847 |
| 763 | nmdc:mga06r32_94733_c1 | 3300050510 | Bacteria | 2922 |
| 764 | nmdc:mga08y16_143302_c1 | 3300050511 | Bacteria | 2484 |
| 765 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 766 | nmdc:mga08y16_33_c1 | 3300050511 | Bacteria | 172528 |
| 767 | nmdc:mga08y16_39329_c1 | 3300050511 | Unclassified | 4963 |
| 768 | nmdc:mga08y16_53155_c1 | 3300050511 | Bacteria | 4237 |
| 769 | nmdc:mga0n895_128986_c1 | 3300050512 | Bacteria | 2553 |
| 770 | nmdc:mga0n895_377336_c1 | 3300050512 | Bacteria | 1435 |
| 771 | nmdc:mga0rr50_125558_c1 | 3300050513 | Bacteria | 2048 |
| 772 | nmdc:mga0rr50_555_c1 | 3300050513 | Bacteria | 20080 |
| 773 | nmdc:mga08x19_16_c1 | 3300050514 | Bacteria | 348119 |
| 774 | nmdc:mga0a205_100102_c1 | 3300050515 | Bacteria | 2797 |
| 775 | nmdc:mga0a205_125077_c1 | 3300050515 | Bacteria | 2471 |
| 776 | nmdc:mga0a205_138747_c1 | 3300050515 | Bacteria | 2331 |
| 777 | nmdc:mga0a205_203908_c1 | 3300050515 | Bacteria | 1867 |
| 778 | nmdc:mga0a205_263127_c1 | 3300050515 | Bacteria | 1602 |
| 779 | nmdc:mga0a205_40160_c1 | 3300050515 | Bacteria | 4504 |
| 780 | nmdc:mga0a205_65705_c1 | 3300050515 | Bacteria | 3505 |
| 781 | Ga0500578_0001295 | 3300053086 | Bacteria | 25808 |
| 782 | Ga0500643_000173 | 3300053087 | Bacteria | 63279 |
| 783 | Ga0500644_0017307 | 3300053088 | Bacteria | 2091 |
| 784 | Ga0500644_0045479 | 3300053088 | Bacteria | 1479 |
| 785 | Ga0500647_0010667 | 3300053091 | Bacteria | 4074 |
| 786 | Ga0500566_0000353 | 3300053094 | Bacteria | 24984 |
| 787 | Ga0500640_000097 | 3300053095 | Bacteria | 15377 |
| 788 | Ga0500555_007872 | 3300053103 | Bacteria | 3030 |
| 789 | Ga0500556_0000447 | 3300053104 | Bacteria | 29406 |
| 790 | Ga0500572_000165 | 3300053111 | Bacteria | 22976 |
| 791 | Ga0500572_000219 | 3300053111 | Bacteria | 20348 |
| 792 | Ga0500592_012512 | 3300053116 | Bacteria | 1359 |
| 793 | Ga0500595_017015 | 3300053119 | Bacteria | 2696 |
| 794 | Ga0500608_000287 | 3300053122 | Bacteria | 19708 |
| 795 | Ga0500608_003613 | 3300053122 | Bacteria | 5833 |
| 796 | Ga0500614_001090 | 3300053123 | Bacteria | 6715 |
| 797 | Ga0500652_000611 | 3300053131 | Bacteria | 12307 |
| 798 | Ga0500559_0000241 | 3300053136 | Bacteria | 43480 |
| 799 | Ga0500559_0003511 | 3300053136 | Bacteria | 7681 |
| 800 | Ga0500559_0004615 | 3300053136 | Bacteria | 6508 |
| 801 | Ga0500568_0001443 | 3300053139 | Bacteria | 15328 |
| 802 | Ga0500577_0002449 | 3300053142 | Bacteria | 4749 |
| 803 | Ga0500603_001328 | 3300053150 | Bacteria | 5670 |
| 804 | Ga0500616_0000554 | 3300053153 | Bacteria | 46158 |
| 805 | Ga0500616_0000902 | 3300053153 | Bacteria | 32595 |
| 806 | Ga0500620_020810 | 3300053155 | Bacteria | 1951 |
| 807 | Ga0500622_0000146 | 3300053156 | Bacteria | 74615 |
| 808 | Ga0500622_0007254 | 3300053156 | Bacteria | 6311 |
| 809 | Ga0500627_0000002 | 3300053158 | Bacteria | 235747 |
| 810 | Ga0500627_0058474 | 3300053158 | Bacteria | 1692 |
| 811 | Ga0500630_001600 | 3300053159 | Bacteria | 10834 |
| 812 | Ga0500634_0003106 | 3300053161 | Bacteria | 7288 |
| 813 | Ga0500638_009701 | 3300053162 | Bacteria | 4180 |
| 814 | Ga0500639_000023 | 3300053163 | Bacteria | 85696 |
| 815 | Ga0500639_005725 | 3300053163 | Bacteria | 6383 |
| 816 | Ga0500636_0029297 | 3300053177 | Bacteria | 3251 |
| 817 | Ga0500636_0029703 | 3300053177 | Bacteria | 3231 |
| 818 | Ga0500637_0036213 | 3300053178 | Bacteria | 2770 |
| 819 | Ga0500596_000750 | 3300053735 | Bacteria | 6389 |
| 820 | Ga0500587_001814 | 3300053739 | Bacteria | 3036 |
| 821 | Ga0501084_0012130 | 3300054114 | Bacteria | 7133 |
| 822 | Ga0501082_0092288 | 3300060353 | Bacteria | 2616 |
| 823 | Ga0466962_0000986 | 3300061719 | Bacteria | 12971 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0140917 | Ga0395905_0140917_1121_2239 | 366 |
| 2 | 3300053088 | Ga0500644_0017307 | Ga0500644_0017307_10_1131 | 373 |
| 3 | 3300026075 | Ga0207708_10083355 | Ga0207708_100833552 | 374 |
| 4 | 3300049570 | Ga0501033_0153066 | Ga0501033_0153066_497_1639 | 380 |
| 5 | 3300049580 | Ga0501046_0096412 | Ga0501046_0096412_1119_2261 | 380 |
| 6 | 3300037068 | Ga0373925_0289752 | Ga0373925_0289752_43_1197 | 384 |
| 7 | 3300031507 | Ga0307509_10000539 | Ga0307509_1000053932 | 391 |
| 8 | 3300033180 | Ga0307510_10056415 | Ga0307510_100564153 | 391 |
| 9 | iso_pu_bacteria | 2977907340 | 2977911605 | 391 |
| 10 | 3300049586 | Ga0501070_0167135 | Ga0501070_0167135_570_1748 | 392 |
| 11 | 3300050496 | nmdc:mga07m45_156856_c1 | nmdc:mga07m45_156856_c1_126_1307 | 393 |
| 12 | iso_pu_bacteria | 2597489875 | 2597816475 | 393 |
| 13 | 3300049588 | Ga0501072_0130240 | Ga0501072_0130240_635_1942 | 396 |
| 14 | iso_pu_bacteria | 2869169390 | 2869171938 | 397 |
| 15 | iso_pu_bacteria | 2906354277 | 2906355469 | 401 |
| 16 | 3300050512 | nmdc:mga0n895_377336_c1 | nmdc:mga0n895_377336_c1_12_1223 | 403 |
| 17 | 3300025907 | Ga0207645_10066238 | Ga0207645_100662381 | 404 |
| 18 | 3300026089 | Ga0207648_10273239 | Ga0207648_102732391 | 404 |
| 19 | iso_pu_bacteria | 2551306092 | 2551736324 | 405 |
| 20 | 3300005842 | Ga0068858_100020349 | Ga0068858_1000203491 | 406 |
| 21 | 3300026035 | Ga0207703_10096342 | Ga0207703_100963422 | 406 |
| 22 | 3300048924 | Ga0496121_0006775 | Ga0496121_0006775_3414_4697 | 406 |
| 23 | 3300003203 | JGI25406J46586_10010437 | JGI25406J46586_100104372 | 408 |
| 24 | 3300005985 | Ga0081539_10005442 | Ga0081539_1000544210 | 408 |
| 25 | 3300006941 | Ga0099825_1022929 | Ga0099825_10229295 | 408 |
| 26 | 3300006942 | Ga0099824_1025812 | Ga0099824_10258123 | 408 |
| 27 | 3300006943 | Ga0099822_1007677 | Ga0099822_10076775 | 408 |
| 28 | 3300027357 | Ga0209589_1000042 | Ga0209589_100004240 | 408 |
| 29 | 3300027361 | Ga0209489_100095 | Ga0209489_10009540 | 408 |
| 30 | 3300027363 | Ga0209700_100095 | Ga0209700_10009540 | 408 |
| 31 | 3300053139 | Ga0500568_0001443 | Ga0500568_0001443_90_1382 | 410 |
| 32 | 3300030521 | Ga0307511_10062089 | Ga0307511_100620892 | 411 |
| 33 | 3300025230 | Ga0209563_103701 | Ga0209563_1037012 | 412 |
| 34 | 3300031901 | Ga0307406_10010677 | Ga0307406_100106775 | 412 |
| 35 | 3300046683 | Ga0495658_0154754 | Ga0495658_0154754_135_1373 | 412 |
| 36 | 3300048919 | Ga0496116_0014580 | Ga0496116_0014580_1131_2423 | 412 |
| 37 | 3300048927 | Ga0496124_0000285 | Ga0496124_0000285_37831_39123 | 412 |
| 38 | 3300010375 | Ga0105239_10248527 | Ga0105239_102485271 | 413 |
| 39 | 3300025914 | Ga0207671_10108418 | Ga0207671_101084182 | 413 |
| 40 | 3300027876 | Ga0209974_10015904 | Ga0209974_100159042 | 413 |
| 41 | 3300028786 | Ga0307517_10000115 | Ga0307517_10000115102 | 413 |
| 42 | 3300031507 | Ga0307509_10200130 | Ga0307509_102001301 | 413 |
| 43 | 3300031616 | Ga0307508_10008420 | Ga0307508_100084202 | 413 |
| 44 | 3300031730 | Ga0307516_10017736 | Ga0307516_100177363 | 413 |
| 45 | 3300031730 | Ga0307516_10156730 | Ga0307516_101567302 | 413 |
| 46 | 3300031730 | Ga0307516_10162414 | Ga0307516_101624141 | 413 |
| 47 | 3300044673 | Ga0453683_0021967 | Ga0453683_0021967_2644_3933 | 413 |
| 48 | 3300045051 | Ga0451576_0004545 | Ga0451576_0004545_5537_6826 | 413 |
| 49 | 3300046660 | Ga0495625_0007420 | Ga0495625_0007420_4785_6074 | 413 |
| 50 | 3300046660 | Ga0495625_0091715 | Ga0495625_0091715_150_1439 | 413 |
| 51 | 3300048909 | Ga0496106_0004082 | Ga0496106_0004082_5703_7001 | 413 |
| 52 | 3300048917 | Ga0496114_0142678 | Ga0496114_0142678_313_1602 | 413 |
| 53 | 3300048920 | Ga0496117_0005831 | Ga0496117_0005831_4995_6293 | 413 |
| 54 | 3300048921 | Ga0496118_0005579 | Ga0496118_0005579_11064_12362 | 413 |
| 55 | 3300048924 | Ga0496121_0000353 | Ga0496121_0000353_93960_95258 | 413 |
| 56 | 3300048927 | Ga0496124_0003608 | Ga0496124_0003608_7814_9112 | 413 |
| 57 | 3300048928 | Ga0496125_0025330 | Ga0496125_0025330_1572_2870 | 413 |
| 58 | 3300053119 | Ga0500595_017015 | Ga0500595_017015_28_1326 | 413 |
| 59 | iso_pu_bacteria | 2551306087 | 2551704015 | 413 |
| 60 | 3300009174 | Ga0105241_10086598 | Ga0105241_100865982 | 414 |
| 61 | 3300009545 | Ga0105237_10205210 | Ga0105237_102052102 | 414 |
| 62 | 3300025911 | Ga0207654_10046135 | Ga0207654_100461352 | 414 |
| 63 | 3300031456 | Ga0307513_10124414 | Ga0307513_101244142 | 414 |
| 64 | 3300031507 | Ga0307509_10086071 | Ga0307509_100860713 | 414 |
| 65 | 3300031616 | Ga0307508_10006268 | Ga0307508_100062687 | 414 |
| 66 | 3300044684 | Ga0466966_0012023 | Ga0466966_0012023_3507_4805 | 414 |
| 67 | 3300045049 | Ga0466959_0016963 | Ga0466959_0016963_1414_2712 | 414 |
| 68 | 3300053111 | Ga0500572_000219 | Ga0500572_000219_7912_9207 | 414 |
| 69 | 3300053136 | Ga0500559_0000241 | Ga0500559_0000241_36134_37429 | 414 |
| 70 | 3300053163 | Ga0500639_005725 | Ga0500639_005725_2486_3781 | 414 |
| 71 | 3300053735 | Ga0500596_000750 | Ga0500596_000750_3210_4505 | 414 |
| 72 | 3300005543 | Ga0070672_100230904 | Ga0070672_1002309042 | 415 |
| 73 | 3300025940 | Ga0207691_10145852 | Ga0207691_101458522 | 415 |
| 74 | 3300053104 | Ga0500556_0000447 | Ga0500556_0000447_16980_18287 | 415 |
| 75 | iso_pu_bacteria | 2551306089 | 2551710324 | 415 |
| 76 | iso_pu_bacteria | 8004395343 | 8004396193 | 415 |
| 77 | 3300005440 | Ga0070705_100031594 | Ga0070705_1000315942 | 418 |
| 78 | 3300031852 | Ga0307410_10057438 | Ga0307410_100574382 | 418 |
| 79 | 3300032126 | Ga0307415_100203445 | Ga0307415_1002034452 | 418 |
| 80 | 3300050515 | nmdc:mga0a205_125077_c1 | nmdc:mga0a205_125077_c1_1003_2295 | 418 |
| 81 | 3300053122 | Ga0500608_000287 | Ga0500608_000287_8384_9676 | 418 |
| 82 | 3300035691 | Ga0373931_0037306 | Ga0373931_0037306_446_1738 | 420 |
| 83 | iso_pu_bacteria | 8057132660 | 8057136108 | 420 |
| 84 | 3300048905 | Ga0496102_0003979 | Ga0496102_0003979_1260_2549 | 421 |
| 85 | 3300046507 | Ga0495606_0001061 | Ga0495606_0001061_11436_12728 | 422 |
| 86 | iso_pu_bacteria | 2738541317 | 2738945072 | 422 |
| 87 | iso_pu_bacteria | 2913308742 | 2913309698 | 422 |
| 88 | 3300003791 | Ga0055530_10002372 | Ga0055530_100023723 | 423 |
| 89 | 3300003792 | Ga0055540_1000026 | Ga0055540_100002611 | 423 |
| 90 | 3300003794 | Ga0055531_10027659 | Ga0055531_100276591 | 423 |
| 91 | 3300005983 | Ga0081540_1008024 | Ga0081540_10080246 | 423 |
| 92 | 3300013308 | Ga0157375_10296498 | Ga0157375_102964982 | 423 |
| 93 | 3300025298 | Ga0209050_1000228 | Ga0209050_100022868 | 423 |
| 94 | 3300025303 | Ga0209051_1000004 | Ga0209051_1000004490 | 423 |
| 95 | 3300025304 | Ga0209257_1000423 | Ga0209257_100042347 | 423 |
| 96 | iso_pu_bacteria | 2551306091 | 2551725600 | 423 |
| 97 | 3300006195 | Ga0075366_10078689 | Ga0075366_100786892 | 424 |
| 98 | 3300028794 | Ga0307515_10076789 | Ga0307515_100767892 | 424 |
| 99 | 3300050493 | nmdc:mga0k408_8011_c1 | nmdc:mga0k408_8011_c1_11_1303 | 424 |
| 100 | iso_pu_bacteria | 2891373044 | 2891376690 | 424 |
| 101 | iso_pu_bacteria | 2965032056 | 2965035758 | 424 |
| 102 | iso_pu_bacteria | 2509276018 | 2509370175 | 425 |
| 103 | iso_pu_bacteria | 2510065059 | 2510319699 | 425 |
| 104 | iso_pu_bacteria | 2643221580 | 2643909516 | 425 |
| 105 | iso_pu_bacteria | 2643221591 | 2643964347 | 425 |
| 106 | iso_pu_bacteria | 2643221674 | 2644411085 | 425 |
| 107 | iso_pu_bacteria | 2687453392 | 2688601275 | 425 |
| 108 | iso_pu_bacteria | 2765235802 | 2765469047 | 425 |
| 109 | iso_pu_bacteria | 2844002411 | 2844004271 | 425 |
| 110 | iso_pu_bacteria | 2856328259 | 2856332196 | 425 |
| 111 | iso_pu_bacteria | 2856334872 | 2856338886 | 425 |
| 112 | iso_pu_bacteria | 2856342000 | 2856348670 | 425 |
| 113 | iso_pu_bacteria | 2857367948 | 2857371050 | 425 |
| 114 | iso_pu_bacteria | 2869249662 | 2869253765 | 425 |
| 115 | iso_pu_bacteria | 2869264136 | 2869269506 | 425 |
| 116 | iso_pu_bacteria | 2869271264 | 2869277845 | 425 |
| 117 | iso_pu_bacteria | 2871459585 | 2871465886 | 425 |
| 118 | iso_pu_bacteria | 2874131515 | 2874136801 | 425 |
| 119 | iso_pu_bacteria | 2874162495 | 2874164565 | 425 |
| 120 | iso_pu_bacteria | 2876399893 | 2876404370 | 425 |
| 121 | iso_pu_bacteria | 2888343758 | 2888350254 | 425 |
| 122 | iso_pu_bacteria | 2894817345 | 2894820716 | 425 |
| 123 | iso_pu_bacteria | 2895880812 | 2895883379 | 425 |
| 124 | iso_pu_bacteria | 2906363423 | 2906367746 | 425 |
| 125 | iso_pu_bacteria | 2906370794 | 2906372477 | 425 |
| 126 | iso_pu_bacteria | 2906386501 | 2906392454 | 425 |
| 127 | iso_pu_bacteria | 2906393657 | 2906395155 | 425 |
| 128 | iso_pu_bacteria | 2906408224 | 2906411472 | 425 |
| 129 | iso_pu_bacteria | 2917554339 | 2917558091 | 425 |
| 130 | iso_pu_bacteria | 2922151315 | 2922156953 | 425 |
| 131 | iso_pu_bacteria | 2922172374 | 2922175223 | 425 |
| 132 | iso_pu_bacteria | 2922178524 | 2922183997 | 425 |
| 133 | iso_pu_bacteria | 2924733363 | 2924738104 | 425 |
| 134 | iso_pu_bacteria | 2924748358 | 2924749445 | 425 |
| 135 | iso_pu_bacteria | 2924754689 | 2924762734 | 425 |
| 136 | iso_pu_bacteria | 2932401849 | 2932404247 | 425 |
| 137 | iso_pu_bacteria | 2937868953 | 2937874306 | 425 |
| 138 | iso_pu_bacteria | 2958122699 | 2958125137 | 425 |
| 139 | iso_pu_bacteria | 2958137437 | 2958141906 | 425 |
| 140 | iso_pu_bacteria | 2961136820 | 2961140506 | 425 |
| 141 | iso_pu_bacteria | 2965025482 | 2965029003 | 425 |
| 142 | iso_pu_bacteria | 2965047637 | 2965050288 | 425 |
| 143 | iso_pu_bacteria | 2965089291 | 2965095730 | 425 |
| 144 | iso_pu_bacteria | 2970524798 | 2970525365 | 425 |
| 145 | iso_pu_bacteria | 2970547951 | 2970549931 | 425 |
| 146 | iso_pu_bacteria | 2977872689 | 2977878531 | 425 |
| 147 | iso_pu_bacteria | 2977915119 | 2977916070 | 425 |
| 148 | iso_pu_bacteria | 2977935797 | 2977940060 | 425 |
| 149 | iso_pu_bacteria | 2977957713 | 2977959933 | 425 |
| 150 | iso_pu_bacteria | 2979793036 | 2979798757 | 425 |
| 151 | iso_pu_bacteria | 2987673487 | 2987674074 | 425 |
| 152 | iso_pu_bacteria | 2989349275 | 2989351505 | 425 |
| 153 | iso_pu_bacteria | 2989771324 | 2989772697 | 425 |
| 154 | iso_pu_bacteria | 3004195979 | 3004200122 | 425 |
| 155 | iso_pu_bacteria | 3004268573 | 3004271993 | 425 |
| 156 | iso_pu_bacteria | 649633066 | 649875705 | 425 |
| 157 | iso_pu_bacteria | 8002285264 | 8002287281 | 425 |
| 158 | iso_pu_bacteria | 8004300914 | 8004303725 | 425 |
| 159 | iso_pu_bacteria | 8004361976 | 8004368446 | 425 |
| 160 | iso_pu_bacteria | 8054558443 | 8054562324 | 425 |
| 161 | iso_pu_bacteria | 8055617313 | 8055624679 | 425 |
| 162 | 3300009545 | Ga0105237_10000659 | Ga0105237_1000065946 | 426 |
| 163 | 3300010375 | Ga0105239_10041756 | Ga0105239_100417561 | 426 |
| 164 | 3300028379 | Ga0268266_10171582 | Ga0268266_101715822 | 426 |
| 165 | 3300031616 | Ga0307508_10079883 | Ga0307508_100798833 | 426 |
| 166 | iso_pu_bacteria | 2503198000 | 2503204654 | 426 |
| 167 | iso_pu_bacteria | 2508501122 | 2509106951 | 426 |
| 168 | iso_pu_bacteria | 2508501123 | 2509117880 | 426 |
| 169 | iso_pu_bacteria | 2508501127 | 2509145538 | 426 |
| 170 | iso_pu_bacteria | 2509276019 | 2509375093 | 426 |
| 171 | iso_pu_bacteria | 2509276033 | 2509448425 | 426 |
| 172 | iso_pu_bacteria | 2510065057 | 2510303561 | 426 |
| 173 | iso_pu_bacteria | 2510917026 | 2511168621 | 426 |
| 174 | iso_pu_bacteria | 2510917028 | 2511184475 | 426 |
| 175 | iso_pu_bacteria | 2510917030 | 2511199836 | 426 |
| 176 | iso_pu_bacteria | 2511231052 | 2511500433 | 426 |
| 177 | iso_pu_bacteria | 2512047086 | 2512531893 | 426 |
| 178 | iso_pu_bacteria | 2512875016 | 2512934620 | 426 |
| 179 | iso_pu_bacteria | 2512875024 | 2512962966 | 426 |
| 180 | iso_pu_bacteria | 2512875026 | 2512972778 | 426 |
| 181 | iso_pu_bacteria | 2513237086 | 2513585409 | 426 |
| 182 | iso_pu_bacteria | 2513237089 | 2513602833 | 426 |
| 183 | iso_pu_bacteria | 2513237090 | 2513613549 | 426 |
| 184 | iso_pu_bacteria | 2513237091 | 2513616657 | 426 |
| 185 | iso_pu_bacteria | 2513237140 | 2513885653 | 426 |
| 186 | iso_pu_bacteria | 2513237143 | 2513903996 | 426 |
| 187 | iso_pu_bacteria | 2513237144 | 2513911468 | 426 |
| 188 | iso_pu_bacteria | 2513237156 | 2513986207 | 426 |
| 189 | iso_pu_bacteria | 2513237159 | 2513996672 | 426 |
| 190 | iso_pu_bacteria | 2513237160 | 2514005085 | 426 |
| 191 | iso_pu_bacteria | 2513237164 | 2514039036 | 426 |
| 192 | iso_pu_bacteria | 2513237305 | 2514419094 | 426 |
| 193 | iso_pu_bacteria | 2513237351 | 2514589385 | 426 |
| 194 | iso_pu_bacteria | 2515154107 | 2515607635 | 426 |
| 195 | iso_pu_bacteria | 2515154114 | 2515642528 | 426 |
| 196 | iso_pu_bacteria | 2516143018 | 2516204428 | 426 |
| 197 | iso_pu_bacteria | 2516653046 | 2516891765 | 426 |
| 198 | iso_pu_bacteria | 2517487022 | 2517568563 | 426 |
| 199 | iso_pu_bacteria | 2524023207 | 2524450620 | 426 |
| 200 | iso_pu_bacteria | 2529292951 | 2530644541 | 426 |
| 201 | iso_pu_bacteria | 2551306084 | 2551677055 | 426 |
| 202 | iso_pu_bacteria | 2551306085 | 2551684021 | 426 |
| 203 | iso_pu_bacteria | 2551306090 | 2551719191 | 426 |
| 204 | iso_pu_bacteria | 2551306093 | 2551743814 | 426 |
| 205 | iso_pu_bacteria | 2558860100 | 2558866197 | 426 |
| 206 | iso_pu_bacteria | 2582581283 | 2585164905 | 426 |
| 207 | iso_pu_bacteria | 2582581299 | 2585231954 | 426 |
| 208 | iso_pu_bacteria | 2582581306 | 2585265283 | 426 |
| 209 | iso_pu_bacteria | 2582581308 | 2585278258 | 426 |
| 210 | iso_pu_bacteria | 2582581865 | 2585385583 | 426 |
| 211 | iso_pu_bacteria | 2582581866 | 2585391999 | 426 |
| 212 | iso_pu_bacteria | 2585427527 | 2585532082 | 426 |
| 213 | iso_pu_bacteria | 2585428057 | 2587730720 | 426 |
| 214 | iso_pu_bacteria | 2585428058 | 2587736984 | 426 |
| 215 | iso_pu_bacteria | 2585428062 | 2587758090 | 426 |
| 216 | iso_pu_bacteria | 2588253510 | 2588294900 | 426 |
| 217 | iso_pu_bacteria | 2588253730 | 2588514232 | 426 |
| 218 | iso_pu_bacteria | 2599185156 | 2599332400 | 426 |
| 219 | iso_pu_bacteria | 2599185236 | 2599720767 | 426 |
| 220 | iso_pu_bacteria | 2599185301 | 2599935902 | 426 |
| 221 | iso_pu_bacteria | 2615840626 | 2616307776 | 426 |
| 222 | iso_pu_bacteria | 2643221550 | 2643771809 | 426 |
| 223 | iso_pu_bacteria | 2643221564 | 2643839579 | 426 |
| 224 | iso_pu_bacteria | 2643221592 | 2643967744 | 426 |
| 225 | iso_pu_bacteria | 2643221595 | 2643988257 | 426 |
| 226 | iso_pu_bacteria | 2643221599 | 2644003454 | 426 |
| 227 | iso_pu_bacteria | 2643221607 | 2644047248 | 426 |
| 228 | iso_pu_bacteria | 2643221625 | 2644140566 | 426 |
| 229 | iso_pu_bacteria | 2643221627 | 2644156501 | 426 |
| 230 | iso_pu_bacteria | 2643221629 | 2644164400 | 426 |
| 231 | iso_pu_bacteria | 2643221634 | 2644195554 | 426 |
| 232 | iso_pu_bacteria | 2643221636 | 2644199619 | 426 |
| 233 | iso_pu_bacteria | 2643221644 | 2644243939 | 426 |
| 234 | iso_pu_bacteria | 2643221648 | 2644273533 | 426 |
| 235 | iso_pu_bacteria | 2643221662 | 2644346329 | 426 |
| 236 | iso_pu_bacteria | 2643221686 | 2644480037 | 426 |
| 237 | iso_pu_bacteria | 2657244999 | 2657681807 | 426 |
| 238 | iso_pu_bacteria | 2671180139 | 2671695376 | 426 |
| 239 | iso_pu_bacteria | 2690316117 | 2692317348 | 426 |
| 240 | iso_pu_bacteria | 2693429783 | 2694632389 | 426 |
| 241 | iso_pu_bacteria | 2693429784 | 2694640525 | 426 |
| 242 | iso_pu_bacteria | 2718217882 | 2719183808 | 426 |
| 243 | iso_pu_bacteria | 2718218009 | 2719728249 | 426 |
| 244 | iso_pu_bacteria | 2718218232 | 2720611192 | 426 |
| 245 | iso_pu_bacteria | 2718218363 | 2721145110 | 426 |
| 246 | iso_pu_bacteria | 2718218365 | 2721155847 | 426 |
| 247 | iso_pu_bacteria | 2718218366 | 2721167197 | 426 |
| 248 | iso_pu_bacteria | 2721755514 | 2722838175 | 426 |
| 249 | iso_pu_bacteria | 2721755686 | 2723578448 | 426 |
| 250 | iso_pu_bacteria | 2721755810 | 2724042443 | 426 |
| 251 | iso_pu_bacteria | 2728369365 | 2730161948 | 426 |
| 252 | iso_pu_bacteria | 2728369397 | 2730300954 | 426 |
| 253 | iso_pu_bacteria | 2738543024 | 2739308297 | 426 |
| 254 | iso_pu_bacteria | 2751185821 | 2753461255 | 426 |
| 255 | iso_pu_bacteria | 2756170246 | 2756674713 | 426 |
| 256 | iso_pu_bacteria | 2791355082 | 2792583012 | 426 |
| 257 | iso_pu_bacteria | 2791355091 | 2792623899 | 426 |
| 258 | iso_pu_bacteria | 2791355092 | 2792629721 | 426 |
| 259 | iso_pu_bacteria | 2791355094 | 2792638055 | 426 |
| 260 | iso_pu_bacteria | 2791355123 | 2792746415 | 426 |
| 261 | iso_pu_bacteria | 2791355256 | 2793298934 | 426 |
| 262 | iso_pu_bacteria | 2791355259 | 2793317169 | 426 |
| 263 | iso_pu_bacteria | 2791355260 | 2793324002 | 426 |
| 264 | iso_pu_bacteria | 2791355261 | 2793325688 | 426 |
| 265 | iso_pu_bacteria | 2791355262 | 2793333113 | 426 |
| 266 | iso_pu_bacteria | 2791355263 | 2793340088 | 426 |
| 267 | iso_pu_bacteria | 2791355264 | 2793346285 | 426 |
| 268 | iso_pu_bacteria | 2791355265 | 2793355502 | 426 |
| 269 | iso_pu_bacteria | 2802428858 | 2802720404 | 426 |
| 270 | iso_pu_bacteria | 2802428859 | 2802726224 | 426 |
| 271 | iso_pu_bacteria | 2802428860 | 2802731612 | 426 |
| 272 | iso_pu_bacteria | 2802428861 | 2802739363 | 426 |
| 273 | iso_pu_bacteria | 2802428862 | 2802742505 | 426 |
| 274 | iso_pu_bacteria | 2802428863 | 2802749210 | 426 |
| 275 | iso_pu_bacteria | 2802429268 | 2804750827 | 426 |
| 276 | iso_pu_bacteria | 2802429605 | 2805929099 | 426 |
| 277 | iso_pu_bacteria | 2802429606 | 2805937200 | 426 |
| 278 | iso_pu_bacteria | 2838022645 | 2838027223 | 426 |
| 279 | iso_pu_bacteria | 2838042994 | 2838045913 | 426 |
| 280 | iso_pu_bacteria | 2838074704 | 2838075279 | 426 |
| 281 | iso_pu_bacteria | 2838668709 | 2838671537 | 426 |
| 282 | iso_pu_bacteria | 2838701080 | 2838704196 | 426 |
| 283 | iso_pu_bacteria | 2841734538 | 2841735686 | 426 |
| 284 | iso_pu_bacteria | 2842146304 | 2842149186 | 426 |
| 285 | iso_pu_bacteria | 2842192696 | 2842195303 | 426 |
| 286 | iso_pu_bacteria | 2842198810 | 2842203404 | 426 |
| 287 | iso_pu_bacteria | 2842205361 | 2842210326 | 426 |
| 288 | iso_pu_bacteria | 2842250916 | 2842253647 | 426 |
| 289 | iso_pu_bacteria | 2842264693 | 2842270238 | 426 |
| 290 | iso_pu_bacteria | 2842278818 | 2842283780 | 426 |
| 291 | iso_pu_bacteria | 2842317721 | 2842319046 | 426 |
| 292 | iso_pu_bacteria | 2842428310 | 2842434060 | 426 |
| 293 | iso_pu_bacteria | 2842434925 | 2842440451 | 426 |
| 294 | iso_pu_bacteria | 2842441272 | 2842444024 | 426 |
| 295 | iso_pu_bacteria | 2842462802 | 2842468479 | 426 |
| 296 | iso_pu_bacteria | 2842469257 | 2842474997 | 426 |
| 297 | iso_pu_bacteria | 2842482326 | 2842486981 | 426 |
| 298 | iso_pu_bacteria | 2842489311 | 2842491496 | 426 |
| 299 | iso_pu_bacteria | 2842495871 | 2842499564 | 426 |
| 300 | iso_pu_bacteria | 2842521101 | 2842521602 | 426 |
| 301 | iso_pu_bacteria | 2842922631 | 2842922668 | 426 |
| 302 | iso_pu_bacteria | 2844009547 | 2844009936 | 426 |
| 303 | iso_pu_bacteria | 2847417321 | 2847417584 | 426 |
| 304 | iso_pu_bacteria | 2847686936 | 2847689286 | 426 |
| 305 | iso_pu_bacteria | 2848992105 | 2848992390 | 426 |
| 306 | iso_pu_bacteria | 2850079185 | 2850079887 | 426 |
| 307 | iso_pu_bacteria | 2854911287 | 2854916636 | 426 |
| 308 | iso_pu_bacteria | 2855825444 | 2855828133 | 426 |
| 309 | iso_pu_bacteria | 2855839649 | 2855839905 | 426 |
| 310 | iso_pu_bacteria | 2855872281 | 2855873471 | 426 |
| 311 | iso_pu_bacteria | 2856314179 | 2856314762 | 426 |
| 312 | iso_pu_bacteria | 2856320880 | 2856328245 | 426 |
| 313 | iso_pu_bacteria | 2856349417 | 2856350655 | 426 |
| 314 | iso_pu_bacteria | 2856364286 | 2856367296 | 426 |
| 315 | iso_pu_bacteria | 2857349434 | 2857354185 | 426 |
| 316 | iso_pu_bacteria | 2858800743 | 2858803878 | 426 |
| 317 | iso_pu_bacteria | 2869162929 | 2869164677 | 426 |
| 318 | iso_pu_bacteria | 2869234852 | 2869236424 | 426 |
| 319 | iso_pu_bacteria | 2869242130 | 2869244021 | 426 |
| 320 | iso_pu_bacteria | 2869256925 | 2869257869 | 426 |
| 321 | iso_pu_bacteria | 2869278585 | 2869282210 | 426 |
| 322 | iso_pu_bacteria | 2869285874 | 2869287579 | 426 |
| 323 | iso_pu_bacteria | 2871429161 | 2871431103 | 426 |
| 324 | iso_pu_bacteria | 2871435913 | 2871436650 | 426 |
| 325 | iso_pu_bacteria | 2871444079 | 2871449899 | 426 |
| 326 | iso_pu_bacteria | 2871451962 | 2871452507 | 426 |
| 327 | iso_pu_bacteria | 2871466892 | 2871469612 | 426 |
| 328 | iso_pu_bacteria | 2871474448 | 2871480573 | 426 |
| 329 | iso_pu_bacteria | 2871481445 | 2871485123 | 426 |
| 330 | iso_pu_bacteria | 2871495908 | 2871502066 | 426 |
| 331 | iso_pu_bacteria | 2874102143 | 2874105442 | 426 |
| 332 | iso_pu_bacteria | 2874109183 | 2874109965 | 426 |
| 333 | iso_pu_bacteria | 2874116593 | 2874119028 | 426 |
| 334 | iso_pu_bacteria | 2874123672 | 2874129661 | 426 |
| 335 | iso_pu_bacteria | 2874139085 | 2874145532 | 426 |
| 336 | iso_pu_bacteria | 2874146452 | 2874150375 | 426 |
| 337 | iso_pu_bacteria | 2874155637 | 2874157430 | 426 |
| 338 | iso_pu_bacteria | 2874168670 | 2874171602 | 426 |
| 339 | iso_pu_bacteria | 2876363079 | 2876363117 | 426 |
| 340 | iso_pu_bacteria | 2876369609 | 2876370747 | 426 |
| 341 | iso_pu_bacteria | 2876377896 | 2876381159 | 426 |
| 342 | iso_pu_bacteria | 2876386047 | 2876392686 | 426 |
| 343 | iso_pu_bacteria | 2876392853 | 2876394220 | 426 |
| 344 | iso_pu_bacteria | 2876413966 | 2876416526 | 426 |
| 345 | iso_pu_bacteria | 2876420981 | 2876427484 | 426 |
| 346 | iso_pu_bacteria | 2878730984 | 2878736685 | 426 |
| 347 | iso_pu_bacteria | 2878738818 | 2878740184 | 426 |
| 348 | iso_pu_bacteria | 2878745973 | 2878747716 | 426 |
| 349 | iso_pu_bacteria | 2878753008 | 2878755050 | 426 |
| 350 | iso_pu_bacteria | 2878760144 | 2878765967 | 426 |
| 351 | iso_pu_bacteria | 2878767105 | 2878773189 | 426 |
| 352 | iso_pu_bacteria | 2878788777 | 2878793685 | 426 |
| 353 | iso_pu_bacteria | 2881155292 | 2881158559 | 426 |
| 354 | iso_pu_bacteria | 2881161766 | 2881164235 | 426 |
| 355 | iso_pu_bacteria | 2881861095 | 2881861497 | 426 |
| 356 | iso_pu_bacteria | 2882632389 | 2882632919 | 426 |
| 357 | iso_pu_bacteria | 2885305155 | 2885306100 | 426 |
| 358 | iso_pu_bacteria | 2885312484 | 2885314839 | 426 |
| 359 | iso_pu_bacteria | 2885326080 | 2885327995 | 426 |
| 360 | iso_pu_bacteria | 2885334103 | 2885340462 | 426 |
| 361 | iso_pu_bacteria | 2885342637 | 2885343291 | 426 |
| 362 | iso_pu_bacteria | 2885350715 | 2885353625 | 426 |
| 363 | iso_pu_bacteria | 2888337043 | 2888342544 | 426 |
| 364 | iso_pu_bacteria | 2888350351 | 2888352120 | 426 |
| 365 | iso_pu_bacteria | 2889010040 | 2889014105 | 426 |
| 366 | iso_pu_bacteria | 2889016732 | 2889021185 | 426 |
| 367 | iso_pu_bacteria | 2889790730 | 2889792856 | 426 |
| 368 | iso_pu_bacteria | 2889914905 | 2889915011 | 426 |
| 369 | iso_pu_bacteria | 2896384573 | 2896391647 | 426 |
| 370 | iso_pu_bacteria | 2903448605 | 2903449471 | 426 |
| 371 | iso_pu_bacteria | 2903492973 | 2903498832 | 426 |
| 372 | iso_pu_bacteria | 2903492973 | 2903499464 | 426 |
| 373 | iso_pu_bacteria | 2903513507 | 2903517854 | 426 |
| 374 | iso_pu_bacteria | 2903521522 | 2903525067 | 426 |
| 375 | iso_pu_bacteria | 2903528002 | 2903531514 | 426 |
| 376 | iso_pu_bacteria | 2903540706 | 2903546949 | 426 |
| 377 | iso_pu_bacteria | 2904659560 | 2904660936 | 426 |
| 378 | iso_pu_bacteria | 2906308376 | 2906310117 | 426 |
| 379 | iso_pu_bacteria | 2906321335 | 2906322989 | 426 |
| 380 | iso_pu_bacteria | 2906328253 | 2906329059 | 426 |
| 381 | iso_pu_bacteria | 2906378014 | 2906384089 | 426 |
| 382 | iso_pu_bacteria | 2906401398 | 2906406875 | 426 |
| 383 | iso_pu_bacteria | 2906414383 | 2906414951 | 426 |
| 384 | iso_pu_bacteria | 2906427513 | 2906435715 | 426 |
| 385 | iso_pu_bacteria | 2913295892 | 2913298083 | 426 |
| 386 | iso_pu_bacteria | 2915650412 | 2915652492 | 426 |
| 387 | iso_pu_bacteria | 2915980308 | 2915980693 | 426 |
| 388 | iso_pu_bacteria | 2915986958 | 2915990567 | 426 |
| 389 | iso_pu_bacteria | 2915993759 | 2915998210 | 426 |
| 390 | iso_pu_bacteria | 2916000859 | 2916001014 | 426 |
| 391 | iso_pu_bacteria | 2916007675 | 2916011095 | 426 |
| 392 | iso_pu_bacteria | 2916014648 | 2916015515 | 426 |
| 393 | iso_pu_bacteria | 2916021584 | 2916025438 | 426 |
| 394 | iso_pu_bacteria | 2916028427 | 2916031124 | 426 |
| 395 | iso_pu_bacteria | 2916035215 | 2916036421 | 426 |
| 396 | iso_pu_bacteria | 2916041962 | 2916045662 | 426 |
| 397 | iso_pu_bacteria | 2916048683 | 2916053733 | 426 |
| 398 | iso_pu_bacteria | 2916055098 | 2916057312 | 426 |
| 399 | iso_pu_bacteria | 2916061851 | 2916063740 | 426 |
| 400 | iso_pu_bacteria | 2916068649 | 2916068687 | 426 |
| 401 | iso_pu_bacteria | 2916076590 | 2916082169 | 426 |
| 402 | iso_pu_bacteria | 2920760137 | 2920763487 | 426 |
| 403 | iso_pu_bacteria | 2921201388 | 2921207032 | 426 |
| 404 | iso_pu_bacteria | 2921208531 | 2921212228 | 426 |
| 405 | iso_pu_bacteria | 2921237296 | 2921242014 | 426 |
| 406 | iso_pu_bacteria | 2921244191 | 2921248910 | 426 |
| 407 | iso_pu_bacteria | 2921250672 | 2921257249 | 426 |
| 408 | iso_pu_bacteria | 2921257292 | 2921260928 | 426 |
| 409 | iso_pu_bacteria | 2921263974 | 2921266387 | 426 |
| 410 | iso_pu_bacteria | 2921282425 | 2921288504 | 426 |
| 411 | iso_pu_bacteria | 2921289301 | 2921294443 | 426 |
| 412 | iso_pu_bacteria | 2921296804 | 2921302837 | 426 |
| 413 | iso_pu_bacteria | 2922130491 | 2922137066 | 426 |
| 414 | iso_pu_bacteria | 2922158528 | 2922161052 | 426 |
| 415 | iso_pu_bacteria | 2922185730 | 2922187164 | 426 |
| 416 | iso_pu_bacteria | 2924144063 | 2924149818 | 426 |
| 417 | iso_pu_bacteria | 2924150972 | 2924156595 | 426 |
| 418 | iso_pu_bacteria | 2924158325 | 2924163403 | 426 |
| 419 | iso_pu_bacteria | 2924165586 | 2924170423 | 426 |
| 420 | iso_pu_bacteria | 2924172951 | 2924177706 | 426 |
| 421 | iso_pu_bacteria | 2924179722 | 2924183560 | 426 |
| 422 | iso_pu_bacteria | 2924186466 | 2924190796 | 426 |
| 423 | iso_pu_bacteria | 2924193448 | 2924199067 | 426 |
| 424 | iso_pu_bacteria | 2924200457 | 2924205599 | 426 |
| 425 | iso_pu_bacteria | 2924207177 | 2924209141 | 426 |
| 426 | iso_pu_bacteria | 2924214083 | 2924216527 | 426 |
| 427 | iso_pu_bacteria | 2924221636 | 2924228339 | 426 |
| 428 | iso_pu_bacteria | 2924228884 | 2924232827 | 426 |
| 429 | iso_pu_bacteria | 2924718760 | 2924722953 | 426 |
| 430 | iso_pu_bacteria | 2924741084 | 2924744348 | 426 |
| 431 | iso_pu_bacteria | 2924762789 | 2924768377 | 426 |
| 432 | iso_pu_bacteria | 2924776078 | 2924777784 | 426 |
| 433 | iso_pu_bacteria | 2924784321 | 2924791269 | 426 |
| 434 | iso_pu_bacteria | 2936367885 | 2936370237 | 426 |
| 435 | iso_pu_bacteria | 2936375103 | 2936377909 | 426 |
| 436 | iso_pu_bacteria | 2936381700 | 2936384104 | 426 |
| 437 | iso_pu_bacteria | 2936996657 | 2936997840 | 426 |
| 438 | iso_pu_bacteria | 2937002841 | 2937007629 | 426 |
| 439 | iso_pu_bacteria | 2937009748 | 2937014877 | 426 |
| 440 | iso_pu_bacteria | 2937016420 | 2937022379 | 426 |
| 441 | iso_pu_bacteria | 2937023124 | 2937023297 | 426 |
| 442 | iso_pu_bacteria | 2937029754 | 2937034619 | 426 |
| 443 | iso_pu_bacteria | 2937036028 | 2937041220 | 426 |
| 444 | iso_pu_bacteria | 2937042894 | 2937045973 | 426 |
| 445 | iso_pu_bacteria | 2937049772 | 2937051814 | 426 |
| 446 | iso_pu_bacteria | 2937056579 | 2937062655 | 426 |
| 447 | iso_pu_bacteria | 2937063883 | 2937068355 | 426 |
| 448 | iso_pu_bacteria | 2937071275 | 2937074828 | 426 |
| 449 | iso_pu_bacteria | 2937078374 | 2937078831 | 426 |
| 450 | iso_pu_bacteria | 2937084907 | 2937086625 | 426 |
| 451 | iso_pu_bacteria | 2937091812 | 2937095221 | 426 |
| 452 | iso_pu_bacteria | 2937098957 | 2937104411 | 426 |
| 453 | iso_pu_bacteria | 2937106411 | 2937112423 | 426 |
| 454 | iso_pu_bacteria | 2937113482 | 2937119551 | 426 |
| 455 | iso_pu_bacteria | 2937119839 | 2937126111 | 426 |
| 456 | iso_pu_bacteria | 2937126314 | 2937131534 | 426 |
| 457 | iso_pu_bacteria | 2937813078 | 2937815403 | 426 |
| 458 | iso_pu_bacteria | 2937822353 | 2937825862 | 426 |
| 459 | iso_pu_bacteria | 2937836603 | 2937837117 | 426 |
| 460 | iso_pu_bacteria | 2937843397 | 2937845985 | 426 |
| 461 | iso_pu_bacteria | 2937848649 | 2937851090 | 426 |
| 462 | iso_pu_bacteria | 2937861824 | 2937867466 | 426 |
| 463 | iso_pu_bacteria | 2937877337 | 2937881591 | 426 |
| 464 | iso_pu_bacteria | 2937891427 | 2937892944 | 426 |
| 465 | iso_pu_bacteria | 2937972304 | 2937976826 | 426 |
| 466 | iso_pu_bacteria | 2937980651 | 2937986413 | 426 |
| 467 | iso_pu_bacteria | 2937994558 | 2938000500 | 426 |
| 468 | iso_pu_bacteria | 2941499720 | 2941500811 | 426 |
| 469 | iso_pu_bacteria | 2957375807 | 2957382147 | 426 |
| 470 | iso_pu_bacteria | 2957382221 | 2957388597 | 426 |
| 471 | iso_pu_bacteria | 2957388812 | 2957393976 | 426 |
| 472 | iso_pu_bacteria | 2957395598 | 2957399094 | 426 |
| 473 | iso_pu_bacteria | 2957402308 | 2957403355 | 426 |
| 474 | iso_pu_bacteria | 2957408893 | 2957412023 | 426 |
| 475 | iso_pu_bacteria | 2957415311 | 2957418125 | 426 |
| 476 | iso_pu_bacteria | 2957430029 | 2957434082 | 426 |
| 477 | iso_pu_bacteria | 2957437181 | 2957442548 | 426 |
| 478 | iso_pu_bacteria | 2957443900 | 2957447218 | 426 |
| 479 | iso_pu_bacteria | 2957450854 | 2957455251 | 426 |
| 480 | iso_pu_bacteria | 2957457609 | 2957462732 | 426 |
| 481 | iso_pu_bacteria | 2957464669 | 2957466224 | 426 |
| 482 | iso_pu_bacteria | 2957471148 | 2957472155 | 426 |
| 483 | iso_pu_bacteria | 2957478035 | 2957479693 | 426 |
| 484 | iso_pu_bacteria | 2957484790 | 2957484910 | 426 |
| 485 | iso_pu_bacteria | 2957491536 | 2957496125 | 426 |
| 486 | iso_pu_bacteria | 2957498199 | 2957500588 | 426 |
| 487 | iso_pu_bacteria | 2957505466 | 2957508204 | 426 |
| 488 | iso_pu_bacteria | 2958034702 | 2958037984 | 426 |
| 489 | iso_pu_bacteria | 2958041894 | 2958042166 | 426 |
| 490 | iso_pu_bacteria | 2958041894 | 2958049298 | 426 |
| 491 | iso_pu_bacteria | 2958064165 | 2958066576 | 426 |
| 492 | iso_pu_bacteria | 2958071322 | 2958076460 | 426 |
| 493 | iso_pu_bacteria | 2958084443 | 2958088721 | 426 |
| 494 | iso_pu_bacteria | 2958092219 | 2958095319 | 426 |
| 495 | iso_pu_bacteria | 2958100919 | 2958102419 | 426 |
| 496 | iso_pu_bacteria | 2958108152 | 2958113560 | 426 |
| 497 | iso_pu_bacteria | 2958115193 | 2958119824 | 426 |
| 498 | iso_pu_bacteria | 2958130278 | 2958131981 | 426 |
| 499 | iso_pu_bacteria | 2958144490 | 2958151069 | 426 |
| 500 | iso_pu_bacteria | 2958165035 | 2958171157 | 426 |
| 501 | iso_pu_bacteria | 2958172287 | 2958174945 | 426 |
| 502 | iso_pu_bacteria | 2958179912 | 2958181784 | 426 |
| 503 | iso_pu_bacteria | 2960584000 | 2960589364 | 426 |
| 504 | iso_pu_bacteria | 2960591022 | 2960594676 | 426 |
| 505 | iso_pu_bacteria | 2960597568 | 2960603471 | 426 |
| 506 | iso_pu_bacteria | 2960603979 | 2960608780 | 426 |
| 507 | iso_pu_bacteria | 2960610863 | 2960614395 | 426 |
| 508 | iso_pu_bacteria | 2960617483 | 2960621606 | 426 |
| 509 | iso_pu_bacteria | 2960624210 | 2960628900 | 426 |
| 510 | iso_pu_bacteria | 2960631154 | 2960637547 | 426 |
| 511 | iso_pu_bacteria | 2960637947 | 2960645030 | 426 |
| 512 | iso_pu_bacteria | 2960645483 | 2960648006 | 426 |
| 513 | iso_pu_bacteria | 2960652885 | 2960658383 | 426 |
| 514 | iso_pu_bacteria | 2960660292 | 2960660502 | 426 |
| 515 | iso_pu_bacteria | 2960667422 | 2960672263 | 426 |
| 516 | iso_pu_bacteria | 2960674078 | 2960677211 | 426 |
| 517 | iso_pu_bacteria | 2960680706 | 2960686521 | 426 |
| 518 | iso_pu_bacteria | 2960687367 | 2960690376 | 426 |
| 519 | iso_pu_bacteria | 2960693952 | 2960698914 | 426 |
| 520 | iso_pu_bacteria | 2961077736 | 2961079628 | 426 |
| 521 | iso_pu_bacteria | 2961114664 | 2961120600 | 426 |
| 522 | iso_pu_bacteria | 2961127735 | 2961136265 | 426 |
| 523 | iso_pu_bacteria | 2961163497 | 2961169586 | 426 |
| 524 | iso_pu_bacteria | 2961170736 | 2961176908 | 426 |
| 525 | iso_pu_bacteria | 2961183825 | 2961187900 | 426 |
| 526 | iso_pu_bacteria | 2963644680 | 2963650996 | 426 |
| 527 | iso_pu_bacteria | 2964607997 | 2964610199 | 426 |
| 528 | iso_pu_bacteria | 2964615318 | 2964618927 | 426 |
| 529 | iso_pu_bacteria | 2964621998 | 2964627982 | 426 |
| 530 | iso_pu_bacteria | 2964628898 | 2964632714 | 426 |
| 531 | iso_pu_bacteria | 2964636051 | 2964639036 | 426 |
| 532 | iso_pu_bacteria | 2964643177 | 2964649304 | 426 |
| 533 | iso_pu_bacteria | 2964649959 | 2964650241 | 426 |
| 534 | iso_pu_bacteria | 2964656573 | 2964661157 | 426 |
| 535 | iso_pu_bacteria | 2964663802 | 2964668172 | 426 |
| 536 | iso_pu_bacteria | 2964670856 | 2964677324 | 426 |
| 537 | iso_pu_bacteria | 2964678106 | 2964683382 | 426 |
| 538 | iso_pu_bacteria | 2964685014 | 2964690611 | 426 |
| 539 | iso_pu_bacteria | 2964691889 | 2964694700 | 426 |
| 540 | iso_pu_bacteria | 2964698721 | 2964700570 | 426 |
| 541 | iso_pu_bacteria | 2964705432 | 2964709885 | 426 |
| 542 | iso_pu_bacteria | 2964712639 | 2964717307 | 426 |
| 543 | iso_pu_bacteria | 2964719344 | 2964722969 | 426 |
| 544 | iso_pu_bacteria | 2965018300 | 2965024074 | 426 |
| 545 | iso_pu_bacteria | 2965062239 | 2965067683 | 426 |
| 546 | iso_pu_bacteria | 2967664464 | 2967671509 | 426 |
| 547 | iso_pu_bacteria | 2967671571 | 2967675357 | 426 |
| 548 | iso_pu_bacteria | 2967678726 | 2967684794 | 426 |
| 549 | iso_pu_bacteria | 2967686174 | 2967691435 | 426 |
| 550 | iso_pu_bacteria | 2967693043 | 2967694979 | 426 |
| 551 | iso_pu_bacteria | 2967699805 | 2967704130 | 426 |
| 552 | iso_pu_bacteria | 2967706974 | 2967712160 | 426 |
| 553 | iso_pu_bacteria | 2967714385 | 2967714573 | 426 |
| 554 | iso_pu_bacteria | 2967721400 | 2967722552 | 426 |
| 555 | iso_pu_bacteria | 2967728569 | 2967730468 | 426 |
| 556 | iso_pu_bacteria | 2967735183 | 2967739323 | 426 |
| 557 | iso_pu_bacteria | 2967742019 | 2967745641 | 426 |
| 558 | iso_pu_bacteria | 2967748971 | 2967754962 | 426 |
| 559 | iso_pu_bacteria | 2967755722 | 2967759328 | 426 |
| 560 | iso_pu_bacteria | 2967762386 | 2967766480 | 426 |
| 561 | iso_pu_bacteria | 2967769361 | 2967774642 | 426 |
| 562 | iso_pu_bacteria | 2967775926 | 2967782554 | 426 |
| 563 | iso_pu_bacteria | 2967996073 | 2968000989 | 426 |
| 564 | iso_pu_bacteria | 2968003550 | 2968007042 | 426 |
| 565 | iso_pu_bacteria | 2968016561 | 2968021470 | 426 |
| 566 | iso_pu_bacteria | 2968083720 | 2968085712 | 426 |
| 567 | iso_pu_bacteria | 2968091066 | 2968093078 | 426 |
| 568 | iso_pu_bacteria | 2968097103 | 2968102716 | 426 |
| 569 | iso_pu_bacteria | 2968110612 | 2968111909 | 426 |
| 570 | iso_pu_bacteria | 2968117919 | 2968120257 | 426 |
| 571 | iso_pu_bacteria | 2968128360 | 2968130450 | 426 |
| 572 | iso_pu_bacteria | 2968171901 | 2968177990 | 426 |
| 573 | iso_pu_bacteria | 2970019648 | 2970022866 | 426 |
| 574 | iso_pu_bacteria | 2970026789 | 2970030489 | 426 |
| 575 | iso_pu_bacteria | 2970033650 | 2970037035 | 426 |
| 576 | iso_pu_bacteria | 2970040964 | 2970041190 | 426 |
| 577 | iso_pu_bacteria | 2970047711 | 2970052810 | 426 |
| 578 | iso_pu_bacteria | 2970054988 | 2970056767 | 426 |
| 579 | iso_pu_bacteria | 2970061556 | 2970067896 | 426 |
| 580 | iso_pu_bacteria | 2970068827 | 2970073931 | 426 |
| 581 | iso_pu_bacteria | 2970076120 | 2970081698 | 426 |
| 582 | iso_pu_bacteria | 2970082768 | 2970088460 | 426 |
| 583 | iso_pu_bacteria | 2970088815 | 2970091377 | 426 |
| 584 | iso_pu_bacteria | 2970095765 | 2970101995 | 426 |
| 585 | iso_pu_bacteria | 2970102677 | 2970105908 | 426 |
| 586 | iso_pu_bacteria | 2970109326 | 2970115681 | 426 |
| 587 | iso_pu_bacteria | 2970116247 | 2970117547 | 426 |
| 588 | iso_pu_bacteria | 2970122695 | 2970124301 | 426 |
| 589 | iso_pu_bacteria | 2970129317 | 2970131477 | 426 |
| 590 | iso_pu_bacteria | 2970136068 | 2970136684 | 426 |
| 591 | iso_pu_bacteria | 2970143518 | 2970147676 | 426 |
| 592 | iso_pu_bacteria | 2970149975 | 2970151795 | 426 |
| 593 | iso_pu_bacteria | 2970156795 | 2970163349 | 426 |
| 594 | iso_pu_bacteria | 2970164137 | 2970170027 | 426 |
| 595 | iso_pu_bacteria | 2970170962 | 2970175749 | 426 |
| 596 | iso_pu_bacteria | 2970177841 | 2970181989 | 426 |
| 597 | iso_pu_bacteria | 2970184632 | 2970189218 | 426 |
| 598 | iso_pu_bacteria | 2970191845 | 2970196635 | 426 |
| 599 | iso_pu_bacteria | 2970469710 | 2970476574 | 426 |
| 600 | iso_pu_bacteria | 2970489779 | 2970494309 | 426 |
| 601 | iso_pu_bacteria | 2970503327 | 2970509580 | 426 |
| 602 | iso_pu_bacteria | 2970510686 | 2970513466 | 426 |
| 603 | iso_pu_bacteria | 2970532167 | 2970538960 | 426 |
| 604 | iso_pu_bacteria | 2970554993 | 2970560822 | 426 |
| 605 | iso_pu_bacteria | 2970593180 | 2970596817 | 426 |
| 606 | iso_pu_bacteria | 2970619444 | 2970620417 | 426 |
| 607 | iso_pu_bacteria | 2970627176 | 2970632161 | 426 |
| 608 | iso_pu_bacteria | 2977516862 | 2977519998 | 426 |
| 609 | iso_pu_bacteria | 2977523885 | 2977528403 | 426 |
| 610 | iso_pu_bacteria | 2977530762 | 2977535771 | 426 |
| 611 | iso_pu_bacteria | 2977537788 | 2977543876 | 426 |
| 612 | iso_pu_bacteria | 2977544691 | 2977549555 | 426 |
| 613 | iso_pu_bacteria | 2977551784 | 2977553587 | 426 |
| 614 | iso_pu_bacteria | 2977558990 | 2977564805 | 426 |
| 615 | iso_pu_bacteria | 2977565890 | 2977571811 | 426 |
| 616 | iso_pu_bacteria | 2977572785 | 2977574602 | 426 |
| 617 | iso_pu_bacteria | 2977579622 | 2977584514 | 426 |
| 618 | iso_pu_bacteria | 2977821940 | 2977824190 | 426 |
| 619 | iso_pu_bacteria | 2977828996 | 2977834425 | 426 |
| 620 | iso_pu_bacteria | 2977843712 | 2977846631 | 426 |
| 621 | iso_pu_bacteria | 2977851361 | 2977857549 | 426 |
| 622 | iso_pu_bacteria | 2977864932 | 2977868487 | 426 |
| 623 | iso_pu_bacteria | 2977898635 | 2977900011 | 426 |
| 624 | iso_pu_bacteria | 2977922695 | 2977923428 | 426 |
| 625 | iso_pu_bacteria | 2977942078 | 2977949663 | 426 |
| 626 | iso_pu_bacteria | 2977971508 | 2977980260 | 426 |
| 627 | iso_pu_bacteria | 2977986579 | 2977992332 | 426 |
| 628 | iso_pu_bacteria | 2979710463 | 2979713811 | 426 |
| 629 | iso_pu_bacteria | 2979742915 | 2979748952 | 426 |
| 630 | iso_pu_bacteria | 2979772303 | 2979774507 | 426 |
| 631 | iso_pu_bacteria | 2979779861 | 2979780980 | 426 |
| 632 | iso_pu_bacteria | 2979808191 | 2979814368 | 426 |
| 633 | iso_pu_bacteria | 2987636660 | 2987642405 | 426 |
| 634 | iso_pu_bacteria | 2987652177 | 2987653732 | 426 |
| 635 | iso_pu_bacteria | 2987659509 | 2987665727 | 426 |
| 636 | iso_pu_bacteria | 2987666974 | 2987668010 | 426 |
| 637 | iso_pu_bacteria | 2996310559 | 2996315912 | 426 |
| 638 | iso_pu_bacteria | 2996341866 | 2996347001 | 426 |
| 639 | iso_pu_bacteria | 2996348954 | 2996356297 | 426 |
| 640 | iso_pu_bacteria | 2996386984 | 2996390861 | 426 |
| 641 | iso_pu_bacteria | 2996893221 | 2996896920 | 426 |
| 642 | iso_pu_bacteria | 3000135777 | 3000138012 | 426 |
| 643 | iso_pu_bacteria | 3003930520 | 3003931856 | 426 |
| 644 | iso_pu_bacteria | 3004167301 | 3004172383 | 426 |
| 645 | iso_pu_bacteria | 3004188549 | 3004194776 | 426 |
| 646 | iso_pu_bacteria | 3004203850 | 3004210487 | 426 |
| 647 | iso_pu_bacteria | 3004211236 | 3004212732 | 426 |
| 648 | iso_pu_bacteria | 3004218560 | 3004221422 | 426 |
| 649 | iso_pu_bacteria | 3004232784 | 3004238258 | 426 |
| 650 | iso_pu_bacteria | 3004248173 | 3004250832 | 426 |
| 651 | iso_pu_bacteria | 3004275668 | 3004282601 | 426 |
| 652 | iso_pu_bacteria | 3004289098 | 3004295462 | 426 |
| 653 | iso_pu_bacteria | 3004334049 | 3004338232 | 426 |
| 654 | iso_pu_bacteria | 3005416602 | 3005416795 | 426 |
| 655 | iso_pu_bacteria | 3005445848 | 3005451363 | 426 |
| 656 | iso_pu_bacteria | 637000159 | 637077794 | 426 |
| 657 | iso_pu_bacteria | 643692032 | 643824450 | 426 |
| 658 | iso_pu_bacteria | 648276728 | 648738526 | 426 |
| 659 | iso_pu_bacteria | 8003992118 | 8003992357 | 426 |
| 660 | iso_pu_bacteria | 8003999396 | 8003999686 | 426 |
| 661 | iso_pu_bacteria | 8004312739 | 8004320168 | 426 |
| 662 | iso_pu_bacteria | 8004374579 | 8004376629 | 426 |
| 663 | iso_pu_bacteria | 8004387939 | 8004390315 | 426 |
| 664 | iso_pu_bacteria | 8004445564 | 8004446200 | 426 |
| 665 | iso_pu_bacteria | 8004633249 | 8004635683 | 426 |
| 666 | iso_pu_bacteria | 8004640170 | 8004647078 | 426 |
| 667 | iso_pu_bacteria | 8004703790 | 8004707408 | 426 |
| 668 | iso_pu_bacteria | 8004714634 | 8004716379 | 426 |
| 669 | iso_pu_bacteria | 8004727605 | 8004734887 | 426 |
| 670 | iso_pu_bacteria | 8005289223 | 8005289268 | 426 |
| 671 | iso_pu_bacteria | 8005314921 | 8005320558 | 426 |
| 672 | iso_pu_bacteria | 8005376324 | 8005381918 | 426 |
| 673 | iso_pu_bacteria | 8005382845 | 8005388793 | 426 |
| 674 | iso_pu_bacteria | 8005395548 | 8005397595 | 426 |
| 675 | iso_pu_bacteria | 8005688590 | 8005689485 | 426 |
| 676 | iso_pu_bacteria | 8018127388 | 8018130402 | 426 |
| 677 | iso_pu_bacteria | 8024501048 | 8024505629 | 426 |
| 678 | iso_pu_bacteria | 8049293176 | 8049293383 | 426 |
| 679 | iso_pu_bacteria | 8056382006 | 8056383565 | 426 |
| 680 | 3300005293 | Ga0065715_10002994 | Ga0065715_100029943 | 427 |
| 681 | 3300005468 | Ga0070707_100060644 | Ga0070707_1000606443 | 427 |
| 682 | 3300005545 | Ga0070695_100004821 | Ga0070695_1000048215 | 427 |
| 683 | 3300005546 | Ga0070696_100020844 | Ga0070696_1000208443 | 427 |
| 684 | 3300005617 | Ga0068859_100000668 | Ga0068859_1000006686 | 427 |
| 685 | 3300005844 | Ga0068862_100125365 | Ga0068862_1001253652 | 427 |
| 686 | 3300006931 | Ga0097620_100000668 | Ga0097620_1000006686 | 427 |
| 687 | 3300042015 | Ga0439462_0006603 | Ga0439462_0006603_1334_2617 | 427 |
| 688 | 3300050515 | nmdc:mga0a205_138747_c1 | nmdc:mga0a205_138747_c1_322_1605 | 427 |
| 689 | iso_pu_bacteria | 2508501050 | 2508729199 | 427 |
| 690 | iso_pu_bacteria | 2508501114 | 2509078009 | 427 |
| 691 | iso_pu_bacteria | 2599185352 | 2600191359 | 427 |
| 692 | iso_pu_bacteria | 2643221557 | 2643806193 | 427 |
| 693 | iso_pu_bacteria | 2643221563 | 2643832745 | 427 |
| 694 | iso_pu_bacteria | 2643221608 | 2644053460 | 427 |
| 695 | iso_pu_bacteria | 2643221610 | 2644070203 | 427 |
| 696 | iso_pu_bacteria | 2643221618 | 2644103339 | 427 |
| 697 | iso_pu_bacteria | 2643221626 | 2644144278 | 427 |
| 698 | iso_pu_bacteria | 2643221655 | 2644306269 | 427 |
| 699 | iso_pu_bacteria | 2643221659 | 2644330518 | 427 |
| 700 | iso_pu_bacteria | 2643221668 | 2644377455 | 427 |
| 701 | iso_pu_bacteria | 2643221675 | 2644420965 | 427 |
| 702 | iso_pu_bacteria | 2643221680 | 2644454488 | 427 |
| 703 | iso_pu_bacteria | 2643221689 | 2644496850 | 427 |
| 704 | iso_pu_bacteria | 2643221698 | 2644542735 | 427 |
| 705 | iso_pu_bacteria | 2643221712 | 2644611880 | 427 |
| 706 | iso_pu_bacteria | 2643221723 | 2644671871 | 427 |
| 707 | iso_pu_bacteria | 2643221726 | 2644692426 | 427 |
| 708 | iso_pu_bacteria | 2773857925 | 2774871506 | 427 |
| 709 | iso_pu_bacteria | 2775506901 | 2776258853 | 427 |
| 710 | iso_pu_bacteria | 2835312727 | 2835312838 | 427 |
| 711 | iso_pu_bacteria | 2844163670 | 2844165153 | 427 |
| 712 | iso_pu_bacteria | 2882456835 | 2882459405 | 427 |
| 713 | iso_pu_bacteria | 2894232714 | 2894237114 | 427 |
| 714 | iso_pu_bacteria | 2920822456 | 2920823277 | 427 |
| 715 | 3300003187 | JGI25151J46595_10011278 | JGI25151J46595_100112783 | 428 |
| 716 | 3300005331 | Ga0070670_100000001 | Ga0070670_100000001431 | 428 |
| 717 | 3300005331 | Ga0070670_100128254 | Ga0070670_1001282542 | 428 |
| 718 | 3300005333 | Ga0070677_10066304 | Ga0070677_100663041 | 428 |
| 719 | 3300005335 | Ga0070666_10008433 | Ga0070666_100084332 | 428 |
| 720 | 3300005353 | Ga0070669_100003348 | Ga0070669_1000033484 | 428 |
| 721 | 3300005355 | Ga0070671_100000008 | Ga0070671_100000008157 | 428 |
| 722 | 3300005365 | Ga0070688_100014320 | Ga0070688_1000143202 | 428 |
| 723 | 3300005367 | Ga0070667_100000023 | Ga0070667_10000002317 | 428 |
| 724 | 3300005466 | Ga0070685_10000007 | Ga0070685_1000000744 | 428 |
| 725 | 3300005548 | Ga0070665_100107192 | Ga0070665_1001071922 | 428 |
| 726 | 3300005617 | Ga0068859_100017106 | Ga0068859_1000171065 | 428 |
| 727 | 3300005618 | Ga0068864_100000012 | Ga0068864_10000001271 | 428 |
| 728 | 3300005719 | Ga0068861_100025828 | Ga0068861_1000258282 | 428 |
| 729 | 3300005841 | Ga0068863_100089215 | Ga0068863_1000892154 | 428 |
| 730 | 3300005842 | Ga0068858_100026415 | Ga0068858_1000264152 | 428 |
| 731 | 3300005843 | Ga0068860_100001934 | Ga0068860_10000193416 | 428 |
| 732 | 3300005844 | Ga0068862_100024291 | Ga0068862_1000242912 | 428 |
| 733 | 3300006042 | Ga0075368_10059850 | Ga0075368_100598502 | 428 |
| 734 | 3300006048 | Ga0075363_100073249 | Ga0075363_1000732492 | 428 |
| 735 | 3300006051 | Ga0075364_10029947 | Ga0075364_100299472 | 428 |
| 736 | 3300006195 | Ga0075366_10053164 | Ga0075366_100531642 | 428 |
| 737 | 3300006195 | Ga0075366_10062662 | Ga0075366_100626622 | 428 |
| 738 | 3300006237 | Ga0097621_100154976 | Ga0097621_1001549762 | 428 |
| 739 | 3300006353 | Ga0075370_10026675 | Ga0075370_100266752 | 428 |
| 740 | 3300006931 | Ga0097620_100017106 | Ga0097620_1000171065 | 428 |
| 741 | 3300009174 | Ga0105241_10064936 | Ga0105241_100649361 | 428 |
| 742 | 3300009553 | Ga0105249_10011832 | Ga0105249_100118324 | 428 |
| 743 | 3300010375 | Ga0105239_10119301 | Ga0105239_101193012 | 428 |
| 744 | 3300014325 | Ga0163163_10000436 | Ga0163163_1000043628 | 428 |
| 745 | 3300014325 | Ga0163163_10087176 | Ga0163163_100871762 | 428 |
| 746 | 3300014325 | Ga0163163_10204098 | Ga0163163_102040982 | 428 |
| 747 | 3300025294 | Ga0209025_1000044 | Ga0209025_100004489 | 428 |
| 748 | 3300025893 | Ga0207682_10059892 | Ga0207682_100598921 | 428 |
| 749 | 3300025911 | Ga0207654_10073132 | Ga0207654_100731321 | 428 |
| 750 | 3300025923 | Ga0207681_10001769 | Ga0207681_100017699 | 428 |
| 751 | 3300025925 | Ga0207650_10000002 | Ga0207650_100000021106 | 428 |
| 752 | 3300025925 | Ga0207650_10093386 | Ga0207650_100933862 | 428 |
| 753 | 3300025931 | Ga0207644_10000019 | Ga0207644_10000019159 | 428 |
| 754 | 3300025941 | Ga0207711_10003845 | Ga0207711_100038455 | 428 |
| 755 | 3300025942 | Ga0207689_10037772 | Ga0207689_100377722 | 428 |
| 756 | 3300025960 | Ga0207651_10018310 | Ga0207651_100183102 | 428 |
| 757 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001249 | 428 |
| 758 | 3300026088 | Ga0207641_10070522 | Ga0207641_100705224 | 428 |
| 759 | 3300026088 | Ga0207641_10072330 | Ga0207641_100723302 | 428 |
| 760 | 3300026095 | Ga0207676_10000001 | Ga0207676_100000011106 | 428 |
| 761 | 3300026118 | Ga0207675_100031090 | Ga0207675_1000310902 | 428 |
| 762 | 3300028379 | Ga0268266_10009418 | Ga0268266_100094185 | 428 |
| 763 | 3300028380 | Ga0268265_10000436 | Ga0268265_1000043631 | 428 |
| 764 | 3300028381 | Ga0268264_10000061 | Ga0268264_10000061245 | 428 |
| 765 | 3300031911 | Ga0307412_10127381 | Ga0307412_101273811 | 428 |
| 766 | 3300042133 | Ga0450896_005054 | Ga0450896_005054_65_1366 | 428 |
| 767 | 3300048928 | Ga0496125_0038719 | Ga0496125_0038719_2077_3372 | 428 |
| 768 | 3300049587 | Ga0501071_0016463 | Ga0501071_0016463_2866_4176 | 428 |
| 769 | 3300049743 | Ga0501081_0026182 | Ga0501081_0026182_1018_2328 | 428 |
| 770 | 3300050491 | nmdc:mga00v17_23585_c1 | nmdc:mga00v17_23585_c1_986_2287 | 428 |
| 771 | 3300050493 | nmdc:mga0k408_61113_c1 | nmdc:mga0k408_61113_c1_153_1454 | 428 |
| 772 | 3300050496 | nmdc:mga07m45_28522_c1 | nmdc:mga07m45_28522_c1_453_1754 | 428 |
| 773 | 3300053116 | Ga0500592_012512 | Ga0500592_012512_39_1325 | 428 |
| 774 | iso_pu_bacteria | 2513237094 | 2513639516 | 428 |
| 775 | iso_pu_bacteria | 2513237104 | 2513721414 | 428 |
| 776 | iso_pu_bacteria | 2844315083 | 2844319556 | 428 |
| 777 | iso_pu_bacteria | 2903727486 | 2903734493 | 428 |
| 778 | iso_pu_bacteria | 2906602504 | 2906609288 | 428 |
| 779 | iso_pu_bacteria | 2932794094 | 2932795551 | 428 |
| 780 | iso_pu_bacteria | 2932801729 | 2932807853 | 428 |
| 781 | iso_pu_bacteria | 2935883170 | 2935886030 | 428 |
| 782 | iso_pu_bacteria | 2941531003 | 2941534932 | 428 |
| 783 | iso_pu_bacteria | 8019648815 | 8019659183 | 428 |
| 784 | iso_pu_bacteria | 8056967851 | 8056968549 | 428 |
| 785 | 3300009094 | Ga0111539_10102811 | Ga0111539_101028112 | 429 |
| 786 | 3300010375 | Ga0105239_10115790 | Ga0105239_101157903 | 429 |
| 787 | 3300014326 | Ga0157380_10101542 | Ga0157380_101015422 | 429 |
| 788 | 3300014968 | Ga0157379_10031766 | Ga0157379_100317662 | 429 |
| 789 | 3300028786 | Ga0307517_10065943 | Ga0307517_100659431 | 429 |
| 790 | 3300028794 | Ga0307515_10010448 | Ga0307515_100104483 | 429 |
| 791 | 3300031649 | Ga0307514_10001271 | Ga0307514_1000127110 | 429 |
| 792 | 3300031824 | Ga0307413_10144382 | Ga0307413_101443821 | 429 |
| 793 | 3300032004 | Ga0307414_10013742 | Ga0307414_100137422 | 429 |
| 794 | 3300032004 | Ga0307414_10084921 | Ga0307414_100849212 | 429 |
| 795 | 3300035695 | Ga0373927_0000141 | Ga0373927_0000141_18907_20196 | 429 |
| 796 | 3300037068 | Ga0373925_0002260 | Ga0373925_0002260_7452_8741 | 429 |
| 797 | 3300037068 | Ga0373925_0037538 | Ga0373925_0037538_1433_2722 | 429 |
| 798 | 3300037471 | Ga0395905_0001489 | Ga0395905_0001489_10640_11929 | 429 |
| 799 | 3300037471 | Ga0395905_0023190 | Ga0395905_0023190_3811_5100 | 429 |
| 800 | 3300041999 | Ga0439433_0011253 | Ga0439433_0011253_580_1869 | 429 |
| 801 | 3300042876 | Ga0451577_0003794 | Ga0451577_0003794_6518_7807 | 429 |
| 802 | 3300044712 | Ga0453684_0126776 | Ga0453684_0126776_130_1419 | 429 |
| 803 | 3300046452 | Ga0495617_000377 | Ga0495617_000377_10347_11636 | 429 |
| 804 | 3300046460 | Ga0495638_0033066 | Ga0495638_0033066_1176_2465 | 429 |
| 805 | 3300046471 | Ga0495650_0000184 | Ga0495650_0000184_126275_127564 | 429 |
| 806 | 3300046471 | Ga0495650_0000240 | Ga0495650_0000240_32155_33444 | 429 |
| 807 | 3300046491 | Ga0495584_0001561 | Ga0495584_0001561_9613_10902 | 429 |
| 808 | 3300046523 | Ga0495644_0000287 | Ga0495644_0000287_11679_12968 | 429 |
| 809 | 3300046538 | Ga0495609_0000866 | Ga0495609_0000866_11065_12354 | 429 |
| 810 | 3300046615 | Ga0495656_0002526 | Ga0495656_0002526_123_1412 | 429 |
| 811 | 3300046616 | Ga0495668_0002028 | Ga0495668_0002028_14866_16155 | 429 |
| 812 | 3300046648 | Ga0495611_0000347 | Ga0495611_0000347_10260_11549 | 429 |
| 813 | 3300046692 | Ga0495671_0000926 | Ga0495671_0000926_10189_11478 | 429 |
| 814 | 3300047445 | Ga0495677_0000287 | Ga0495677_0000287_10479_11768 | 429 |
| 815 | 3300048910 | Ga0496107_0172183 | Ga0496107_0172183_190_1479 | 429 |
| 816 | 3300048920 | Ga0496117_0000434 | Ga0496117_0000434_16037_17326 | 429 |
| 817 | 3300048925 | Ga0496122_0001470 | Ga0496122_0001470_5939_7228 | 429 |
| 818 | 3300048926 | Ga0496123_0000018 | Ga0496123_0000018_321233_322522 | 429 |
| 819 | 3300048927 | Ga0496124_0022230 | Ga0496124_0022230_360_1649 | 429 |
| 820 | 3300048927 | Ga0496124_0198544 | Ga0496124_0198544_51_1355 | 429 |
| 821 | 3300048928 | Ga0496125_0000215 | Ga0496125_0000215_98427_99716 | 429 |
| 822 | 3300048928 | Ga0496125_0000318 | Ga0496125_0000318_33937_35241 | 429 |
| 823 | 3300049460 | Ga0495682_0000291 | Ga0495682_0000291_12662_13951 | 429 |
| 824 | 3300049571 | Ga0501034_0000807 | Ga0501034_0000807_9398_10687 | 429 |
| 825 | 3300049571 | Ga0501034_0260860 | Ga0501034_0260860_278_1567 | 429 |
| 826 | 3300049572 | Ga0501036_0076433 | Ga0501036_0076433_1267_2556 | 429 |
| 827 | 3300049585 | Ga0501069_0046654 | Ga0501069_0046654_714_2003 | 429 |
| 828 | 3300049822 | Ga0501035_0169841 | Ga0501035_0169841_318_1607 | 429 |
| 829 | 3300049824 | Ga0501045_0199936 | Ga0501045_0199936_119_1408 | 429 |
| 830 | 3300050490 | nmdc:mga03n38_52311_c1 | nmdc:mga03n38_52311_c1_214_1503 | 429 |
| 831 | 3300050494 | nmdc:mga06z11_3482_c1 | nmdc:mga06z11_3482_c1_1569_2858 | 429 |
| 832 | 3300053136 | Ga0500559_0004615 | Ga0500559_0004615_872_2161 | 429 |
| 833 | 3300053156 | Ga0500622_0007254 | Ga0500622_0007254_4566_5855 | 429 |
| 834 | 3300053161 | Ga0500634_0003106 | Ga0500634_0003106_1668_2957 | 429 |
| 835 | 3300002741 | JGI25157J39369_1001297 | JGI25157J39369_10012979 | 430 |
| 836 | 3300002773 | JGI25152J39213_1002620 | JGI25152J39213_10026204 | 430 |
| 837 | 3300002773 | JGI25152J39213_1003646 | JGI25152J39213_10036462 | 430 |
| 838 | 3300003214 | JGI25165J46597_1000037 | JGI25165J46597_1000037247 | 430 |
| 839 | 3300003214 | JGI25165J46597_1001939 | JGI25165J46597_10019394 | 430 |
| 840 | 3300003215 | JGI25153J46596_10021365 | JGI25153J46596_100213653 | 430 |
| 841 | 3300003762 | Ga0055542_1000403 | Ga0055542_100040326 | 430 |
| 842 | 3300003771 | Ga0055526_1002818 | Ga0055526_10028183 | 430 |
| 843 | 3300003775 | Ga0055524_1000061 | Ga0055524_100006146 | 430 |
| 844 | 3300003775 | Ga0055524_1006013 | Ga0055524_10060132 | 430 |
| 845 | 3300005262 | Ga0065165_1003834 | Ga0065165_10038345 | 430 |
| 846 | 3300005336 | Ga0070680_100036315 | Ga0070680_1000363151 | 430 |
| 847 | 3300005339 | Ga0070660_100007853 | Ga0070660_1000078538 | 430 |
| 848 | 3300005365 | Ga0070688_100050573 | Ga0070688_1000505732 | 430 |
| 849 | 3300005438 | Ga0070701_10074240 | Ga0070701_100742402 | 430 |
| 850 | 3300005467 | Ga0070706_100009688 | Ga0070706_1000096882 | 430 |
| 851 | 3300005518 | Ga0070699_100195352 | Ga0070699_1001953522 | 430 |
| 852 | 3300005539 | Ga0068853_100002303 | Ga0068853_10000230318 | 430 |
| 853 | 3300005539 | Ga0068853_100025799 | Ga0068853_1000257992 | 430 |
| 854 | 3300005548 | Ga0070665_100007908 | Ga0070665_10000790811 | 430 |
| 855 | 3300005549 | Ga0070704_100044646 | Ga0070704_1000446462 | 430 |
| 856 | 3300005563 | Ga0068855_100013608 | Ga0068855_1000136084 | 430 |
| 857 | 3300005563 | Ga0068855_100095697 | Ga0068855_1000956972 | 430 |
| 858 | 3300005617 | Ga0068859_100063413 | Ga0068859_1000634132 | 430 |
| 859 | 3300005618 | Ga0068864_100081545 | Ga0068864_1000815452 | 430 |
| 860 | 3300005719 | Ga0068861_100164950 | Ga0068861_1001649502 | 430 |
| 861 | 3300005842 | Ga0068858_100325902 | Ga0068858_1003259021 | 430 |
| 862 | 3300005844 | Ga0068862_100076106 | Ga0068862_1000761062 | 430 |
| 863 | 3300006038 | Ga0075365_10055948 | Ga0075365_100559482 | 430 |
| 864 | 3300006038 | Ga0075365_10087006 | Ga0075365_100870062 | 430 |
| 865 | 3300006178 | Ga0075367_10048240 | Ga0075367_100482402 | 430 |
| 866 | 3300006852 | Ga0075433_10206822 | Ga0075433_102068222 | 430 |
| 867 | 3300006871 | Ga0075434_100129087 | Ga0075434_1001290872 | 430 |
| 868 | 3300006931 | Ga0097620_100063413 | Ga0097620_1000634132 | 430 |
| 869 | 3300006946 | Ga0079104_1000093 | Ga0079104_100009389 | 430 |
| 870 | 3300006946 | Ga0079104_1002731 | Ga0079104_10027316 | 430 |
| 871 | 3300006946 | Ga0079104_1005856 | Ga0079104_10058562 | 430 |
| 872 | 3300009094 | Ga0111539_10004626 | Ga0111539_100046264 | 430 |
| 873 | 3300009147 | Ga0114129_10049278 | Ga0114129_100492783 | 430 |
| 874 | 3300009147 | Ga0114129_10062012 | Ga0114129_100620123 | 430 |
| 875 | 3300009147 | Ga0114129_10092285 | Ga0114129_100922851 | 430 |
| 876 | 3300009147 | Ga0114129_10282551 | Ga0114129_102825512 | 430 |
| 877 | 3300009174 | Ga0105241_10280166 | Ga0105241_102801661 | 430 |
| 878 | 3300009545 | Ga0105237_10161736 | Ga0105237_101617362 | 430 |
| 879 | 3300009551 | Ga0105238_10013092 | Ga0105238_100130922 | 430 |
| 880 | 3300009553 | Ga0105249_10189362 | Ga0105249_101893622 | 430 |
| 881 | 3300010375 | Ga0105239_10048669 | Ga0105239_100486692 | 430 |
| 882 | 3300010375 | Ga0105239_10090435 | Ga0105239_100904352 | 430 |
| 883 | 3300011119 | Ga0105246_10000071 | Ga0105246_1000007127 | 430 |
| 884 | 3300013100 | Ga0157373_10002597 | Ga0157373_100025972 | 430 |
| 885 | 3300013105 | Ga0157369_10107931 | Ga0157369_101079312 | 430 |
| 886 | 3300014326 | Ga0157380_10010159 | Ga0157380_100101595 | 430 |
| 887 | 3300014326 | Ga0157380_10013232 | Ga0157380_100132322 | 430 |
| 888 | 3300014497 | Ga0182008_10015167 | Ga0182008_100151672 | 430 |
| 889 | 3300021321 | Ga0214542_1000011 | Ga0214542_100001151 | 430 |
| 890 | 3300021321 | Ga0214542_1008060 | Ga0214542_100806014 | 430 |
| 891 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004450 | 430 |
| 892 | 3300021327 | Ga0214543_1000259 | Ga0214543_100025950 | 430 |
| 893 | 3300021441 | Ga0213871_10004950 | Ga0213871_100049502 | 430 |
| 894 | 3300022739 | Ga0228711_1000019 | Ga0228711_100001996 | 430 |
| 895 | 3300022740 | Ga0228710_1000022 | Ga0228710_100002296 | 430 |
| 896 | 3300025245 | Ga0207425_1000736 | Ga0207425_10007363 | 430 |
| 897 | 3300025253 | Ga0209677_103007 | Ga0209677_1030074 | 430 |
| 898 | 3300025254 | Ga0209148_1000266 | Ga0209148_100026613 | 430 |
| 899 | 3300025254 | Ga0209148_1009957 | Ga0209148_10099571 | 430 |
| 900 | 3300025258 | Ga0209129_1000113 | Ga0209129_1000113106 | 430 |
| 901 | 3300025258 | Ga0209129_1002521 | Ga0209129_10025217 | 430 |
| 902 | 3300025261 | Ga0209233_1000102 | Ga0209233_1000102247 | 430 |
| 903 | 3300025261 | Ga0209233_1000201 | Ga0209233_100020185 | 430 |
| 904 | 3300025272 | Ga0209455_1000234 | Ga0209455_100023463 | 430 |
| 905 | 3300025273 | Ga0209673_1003797 | Ga0209673_10037974 | 430 |
| 906 | 3300025295 | Ga0209564_1000186 | Ga0209564_1000186106 | 430 |
| 907 | 3300025297 | Ga0209758_1000172 | Ga0209758_1000172106 | 430 |
| 908 | 3300025297 | Ga0209758_1003660 | Ga0209758_10036606 | 430 |
| 909 | 3300025297 | Ga0209758_1015042 | Ga0209758_10150422 | 430 |
| 910 | 3300025298 | Ga0209050_1000489 | Ga0209050_100048939 | 430 |
| 911 | 3300025299 | Ga0209256_1000030 | Ga0209256_100003046 | 430 |
| 912 | 3300025303 | Ga0209051_1025463 | Ga0209051_10254633 | 430 |
| 913 | 3300025908 | Ga0207643_10039937 | Ga0207643_100399372 | 430 |
| 914 | 3300025909 | Ga0207705_10148970 | Ga0207705_101489701 | 430 |
| 915 | 3300025910 | Ga0207684_10094752 | Ga0207684_100947522 | 430 |
| 916 | 3300025914 | Ga0207671_10001797 | Ga0207671_1000179711 | 430 |
| 917 | 3300025924 | Ga0207694_10003165 | Ga0207694_100031656 | 430 |
| 918 | 3300025933 | Ga0207706_10001920 | Ga0207706_100019206 | 430 |
| 919 | 3300025942 | Ga0207689_10139500 | Ga0207689_101395002 | 430 |
| 920 | 3300025949 | Ga0207667_10009181 | Ga0207667_100091817 | 430 |
| 921 | 3300025949 | Ga0207667_10063348 | Ga0207667_100633483 | 430 |
| 922 | 3300026041 | Ga0207639_10002007 | Ga0207639_1000200718 | 430 |
| 923 | 3300026041 | Ga0207639_10025773 | Ga0207639_100257732 | 430 |
| 924 | 3300026118 | Ga0207675_100180377 | Ga0207675_1001803772 | 430 |
| 925 | 3300027111 | Ga0209281_1000084 | Ga0209281_1000084197 | 430 |
| 926 | 3300027111 | Ga0209281_1000200 | Ga0209281_100020076 | 430 |
| 927 | 3300027111 | Ga0209281_1000227 | Ga0209281_1000227102 | 430 |
| 928 | 3300027666 | Ga0209282_1000042 | Ga0209282_1000042102 | 430 |
| 929 | 3300028379 | Ga0268266_10001081 | Ga0268266_100010812 | 430 |
| 930 | 3300028380 | Ga0268265_10045156 | Ga0268265_100451563 | 430 |
| 931 | 3300028786 | Ga0307517_10040568 | Ga0307517_100405683 | 430 |
| 932 | 3300028794 | Ga0307515_10000123 | Ga0307515_10000123136 | 430 |
| 933 | 3300028794 | Ga0307515_10006687 | Ga0307515_100066874 | 430 |
| 934 | 3300028794 | Ga0307515_10006795 | Ga0307515_1000679516 | 430 |
| 935 | 3300028794 | Ga0307515_10042388 | Ga0307515_100423882 | 430 |
| 936 | 3300028794 | Ga0307515_10186638 | Ga0307515_101866382 | 430 |
| 937 | 3300030522 | Ga0307512_10034667 | Ga0307512_100346672 | 430 |
| 938 | 3300031456 | Ga0307513_10095926 | Ga0307513_100959263 | 430 |
| 939 | 3300031507 | Ga0307509_10033967 | Ga0307509_100339672 | 430 |
| 940 | 3300031548 | Ga0307408_100074110 | Ga0307408_1000741102 | 430 |
| 941 | 3300031616 | Ga0307508_10000640 | Ga0307508_100006408 | 430 |
| 942 | 3300031649 | Ga0307514_10019042 | Ga0307514_100190423 | 430 |
| 943 | 3300031727 | Ga0316576_10003425 | Ga0316576_100034257 | 430 |
| 944 | 3300031728 | Ga0316578_10111996 | Ga0316578_101119962 | 430 |
| 945 | 3300031730 | Ga0307516_10033117 | Ga0307516_100331173 | 430 |
| 946 | 3300031911 | Ga0307412_10010376 | Ga0307412_100103762 | 430 |
| 947 | 3300031911 | Ga0307412_10099922 | Ga0307412_100999222 | 430 |
| 948 | 3300031967 | Ga0315914_1000009 | Ga0315914_100000925 | 430 |
| 949 | 3300033180 | Ga0307510_10065641 | Ga0307510_100656413 | 430 |
| 950 | 3300033430 | Ga0315913_1000015 | Ga0315913_1000015102 | 430 |
| 951 | 3300033464 | Ga0315915_1000013 | Ga0315915_1000013163 | 430 |
| 952 | 3300035398 | Ga0316574_0063443 | Ga0316574_0063443_866_2158 | 430 |
| 953 | 3300036647 | Ga0316582_0006931 | Ga0316582_0006931_856_2148 | 430 |
| 954 | 3300036647 | Ga0316582_0178748 | Ga0316582_0178748_46_1338 | 430 |
| 955 | 3300038443 | Ga0395901_0004559 | Ga0395901_0004559_5875_7167 | 430 |
| 956 | 3300039438 | Ga0436360_1140827 | Ga0436360_1140827_1580_2872 | 430 |
| 957 | 3300039447 | Ga0436361_0276468 | Ga0436361_0276468_411_1703 | 430 |
| 958 | 3300041413 | Ga0439465_0029187 | Ga0439465_0029187_381_1673 | 430 |
| 959 | 3300042007 | Ga0439449_0009998 | Ga0439449_0009998_202_1494 | 430 |
| 960 | 3300042121 | Ga0450919_000188 | Ga0450919_000188_4396_5688 | 430 |
| 961 | 3300046460 | Ga0495638_0002960 | Ga0495638_0002960_3683_4975 | 430 |
| 962 | 3300046460 | Ga0495638_0042772 | Ga0495638_0042772_339_1631 | 430 |
| 963 | 3300046512 | Ga0495610_0009062 | Ga0495610_0009062_3000_4292 | 430 |
| 964 | 3300046519 | Ga0495632_0003595 | Ga0495632_0003595_9052_10344 | 430 |
| 965 | 3300046519 | Ga0495632_0015652 | Ga0495632_0015652_414_1706 | 430 |
| 966 | 3300046660 | Ga0495625_0000990 | Ga0495625_0000990_17353_18645 | 430 |
| 967 | 3300047472 | Ga0495686_0040964 | Ga0495686_0040964_1470_2762 | 430 |
| 968 | 3300048905 | Ga0496102_0105810 | Ga0496102_0105810_1312_2604 | 430 |
| 969 | 3300048907 | Ga0496104_0030153 | Ga0496104_0030153_118_1416 | 430 |
| 970 | 3300048909 | Ga0496106_0000980 | Ga0496106_0000980_17733_19025 | 430 |
| 971 | 3300048914 | Ga0496111_0199515 | Ga0496111_0199515_115_1407 | 430 |
| 972 | 3300048915 | Ga0496112_0004020 | Ga0496112_0004020_1110_2402 | 430 |
| 973 | 3300048917 | Ga0496114_0004364 | Ga0496114_0004364_6486_7778 | 430 |
| 974 | 3300048917 | Ga0496114_0090051 | Ga0496114_0090051_1187_2485 | 430 |
| 975 | 3300048920 | Ga0496117_0002639 | Ga0496117_0002639_3040_4332 | 430 |
| 976 | 3300048922 | Ga0496119_0013173 | Ga0496119_0013173_1636_2928 | 430 |
| 977 | 3300048923 | Ga0496120_0001446 | Ga0496120_0001446_15152_16444 | 430 |
| 978 | 3300048925 | Ga0496122_0000137 | Ga0496122_0000137_77607_78899 | 430 |
| 979 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_89641_90933 | 430 |
| 980 | 3300048929 | Ga0496126_0080068 | Ga0496126_0080068_39_1388 | 430 |
| 981 | 3300049571 | Ga0501034_0070465 | Ga0501034_0070465_1387_2679 | 430 |
| 982 | 3300049571 | Ga0501034_0202866 | Ga0501034_0202866_462_1754 | 430 |
| 983 | 3300049592 | Ga0501076_0057722 | Ga0501076_0057722_326_1618 | 430 |
| 984 | 3300049742 | Ga0501080_0093028 | Ga0501080_0093028_413_1705 | 430 |
| 985 | 3300050492 | nmdc:mga0yw44_6756_c1 | nmdc:mga0yw44_6756_c1_3818_5110 | 430 |
| 986 | 3300050507 | nmdc:mga05p37_15503_c1 | nmdc:mga05p37_15503_c1_5955_7250 | 430 |
| 987 | 3300050507 | nmdc:mga05p37_49098_c1 | nmdc:mga05p37_49098_c1_3803_5095 | 430 |
| 988 | 3300050510 | nmdc:mga06r32_94733_c1 | nmdc:mga06r32_94733_c1_1583_2878 | 430 |
| 989 | 3300050511 | nmdc:mga08y16_53155_c1 | nmdc:mga08y16_53155_c1_2645_3937 | 430 |
| 990 | 3300050512 | nmdc:mga0n895_128986_c1 | nmdc:mga0n895_128986_c1_312_1604 | 430 |
| 991 | 3300050515 | nmdc:mga0a205_203908_c1 | nmdc:mga0a205_203908_c1_313_1605 | 430 |
| 992 | 3300050515 | nmdc:mga0a205_263127_c1 | nmdc:mga0a205_263127_c1_228_1520 | 430 |
| 993 | 3300050515 | nmdc:mga0a205_40160_c1 | nmdc:mga0a205_40160_c1_342_1634 | 430 |
| 994 | 3300053088 | Ga0500644_0045479 | Ga0500644_0045479_127_1419 | 430 |
| 995 | 3300053103 | Ga0500555_007872 | Ga0500555_007872_85_1377 | 430 |
| 996 | 3300053131 | Ga0500652_000611 | Ga0500652_000611_9461_10753 | 430 |
| 997 | 3300053142 | Ga0500577_0002449 | Ga0500577_0002449_1763_3055 | 430 |
| 998 | 3300053153 | Ga0500616_0000902 | Ga0500616_0000902_29908_31200 | 430 |
| 999 | 3300053155 | Ga0500620_020810 | Ga0500620_020810_590_1882 | 430 |
| 1000 | 3300053156 | Ga0500622_0000146 | Ga0500622_0000146_47631_48923 | 430 |
| 1001 | 3300053158 | Ga0500627_0058474 | Ga0500627_0058474_115_1407 | 430 |
| 1002 | 3300053739 | Ga0500587_001814 | Ga0500587_001814_235_1527 | 430 |
| 1003 | 3300002987 | JGI25159J45721_1000003 | JGI25159J45721_1000003253 | 431 |
| 1004 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003434 | 431 |
| 1005 | 3300003374 | JGI25161J50226_1001593 | JGI25161J50226_10015934 | 431 |
| 1006 | 3300003771 | Ga0055526_1012650 | Ga0055526_10126502 | 431 |
| 1007 | 3300003775 | Ga0055524_1000789 | Ga0055524_100078919 | 431 |
| 1008 | 3300003781 | Ga0055536_1002760 | Ga0055536_100276015 | 431 |
| 1009 | 3300004625 | Ga0055543_1000158 | Ga0055543_100015824 | 431 |
| 1010 | 3300005262 | Ga0065165_1000084 | Ga0065165_1000084110 | 431 |
| 1011 | 3300005295 | Ga0065707_10114068 | Ga0065707_101140682 | 431 |
| 1012 | 3300005330 | Ga0070690_100003582 | Ga0070690_1000035823 | 431 |
| 1013 | 3300005331 | Ga0070670_100058327 | Ga0070670_1000583272 | 431 |
| 1014 | 3300005335 | Ga0070666_10022918 | Ga0070666_100229183 | 431 |
| 1015 | 3300005336 | Ga0070680_100124089 | Ga0070680_1001240892 | 431 |
| 1016 | 3300005340 | Ga0070689_100017803 | Ga0070689_1000178033 | 431 |
| 1017 | 3300005340 | Ga0070689_100027792 | Ga0070689_1000277924 | 431 |
| 1018 | 3300005343 | Ga0070687_100103610 | Ga0070687_1001036101 | 431 |
| 1019 | 3300005347 | Ga0070668_100077261 | Ga0070668_1000772612 | 431 |
| 1020 | 3300005354 | Ga0070675_100019228 | Ga0070675_1000192282 | 431 |
| 1021 | 3300005354 | Ga0070675_100032654 | Ga0070675_1000326543 | 431 |
| 1022 | 3300005356 | Ga0070674_100034401 | Ga0070674_1000344012 | 431 |
| 1023 | 3300005364 | Ga0070673_100011286 | Ga0070673_1000112864 | 431 |
| 1024 | 3300005367 | Ga0070667_100000116 | Ga0070667_10000011667 | 431 |
| 1025 | 3300005367 | Ga0070667_100084988 | Ga0070667_1000849883 | 431 |
| 1026 | 3300005367 | Ga0070667_100247865 | Ga0070667_1002478652 | 431 |
| 1027 | 3300005440 | Ga0070705_100040575 | Ga0070705_1000405752 | 431 |
| 1028 | 3300005445 | Ga0070708_100052938 | Ga0070708_1000529383 | 431 |
| 1029 | 3300005456 | Ga0070678_100036939 | Ga0070678_1000369392 | 431 |
| 1030 | 3300005456 | Ga0070678_100115763 | Ga0070678_1001157632 | 431 |
| 1031 | 3300005458 | Ga0070681_10000808 | Ga0070681_100008083 | 431 |
| 1032 | 3300005466 | Ga0070685_10068977 | Ga0070685_100689772 | 431 |
| 1033 | 3300005467 | Ga0070706_100015675 | Ga0070706_1000156753 | 431 |
| 1034 | 3300005467 | Ga0070706_100216805 | Ga0070706_1002168052 | 431 |
| 1035 | 3300005468 | Ga0070707_100006029 | Ga0070707_1000060297 | 431 |
| 1036 | 3300005471 | Ga0070698_100004345 | Ga0070698_1000043457 | 431 |
| 1037 | 3300005536 | Ga0070697_100006577 | Ga0070697_1000065775 | 431 |
| 1038 | 3300005543 | Ga0070672_100012851 | Ga0070672_1000128515 | 431 |
| 1039 | 3300005543 | Ga0070672_100271197 | Ga0070672_1002711971 | 431 |
| 1040 | 3300005548 | Ga0070665_100017258 | Ga0070665_1000172588 | 431 |
| 1041 | 3300005548 | Ga0070665_100238851 | Ga0070665_1002388512 | 431 |
| 1042 | 3300005564 | Ga0070664_100022513 | Ga0070664_1000225132 | 431 |
| 1043 | 3300005614 | Ga0068856_100030133 | Ga0068856_1000301335 | 431 |
| 1044 | 3300005615 | Ga0070702_100002988 | Ga0070702_1000029884 | 431 |
| 1045 | 3300005617 | Ga0068859_100006383 | Ga0068859_1000063835 | 431 |
| 1046 | 3300005617 | Ga0068859_100017495 | Ga0068859_1000174954 | 431 |
| 1047 | 3300005617 | Ga0068859_100074880 | Ga0068859_1000748802 | 431 |
| 1048 | 3300005617 | Ga0068859_100238140 | Ga0068859_1002381402 | 431 |
| 1049 | 3300005719 | Ga0068861_100007061 | Ga0068861_1000070612 | 431 |
| 1050 | 3300005840 | Ga0068870_10002937 | Ga0068870_100029373 | 431 |
| 1051 | 3300005841 | Ga0068863_100041004 | Ga0068863_1000410044 | 431 |
| 1052 | 3300005841 | Ga0068863_100252924 | Ga0068863_1002529242 | 431 |
| 1053 | 3300005842 | Ga0068858_100041035 | Ga0068858_1000410352 | 431 |
| 1054 | 3300005842 | Ga0068858_100185801 | Ga0068858_1001858012 | 431 |
| 1055 | 3300005843 | Ga0068860_100000179 | Ga0068860_10000017941 | 431 |
| 1056 | 3300005843 | Ga0068860_100000928 | Ga0068860_1000009284 | 431 |
| 1057 | 3300005843 | Ga0068860_100004331 | Ga0068860_10000433113 | 431 |
| 1058 | 3300005843 | Ga0068860_100064120 | Ga0068860_1000641203 | 431 |
| 1059 | 3300005843 | Ga0068860_100090703 | Ga0068860_1000907032 | 431 |
| 1060 | 3300005844 | Ga0068862_100000023 | Ga0068862_100000023121 | 431 |
| 1061 | 3300005844 | Ga0068862_100020342 | Ga0068862_1000203423 | 431 |
| 1062 | 3300005937 | Ga0081455_10003635 | Ga0081455_100036356 | 431 |
| 1063 | 3300005981 | Ga0081538_10009289 | Ga0081538_100092894 | 431 |
| 1064 | 3300005983 | Ga0081540_1042137 | Ga0081540_10421372 | 431 |
| 1065 | 3300006178 | Ga0075367_10101414 | Ga0075367_101014142 | 431 |
| 1066 | 3300006237 | Ga0097621_100008990 | Ga0097621_1000089903 | 431 |
| 1067 | 3300006358 | Ga0068871_100048649 | Ga0068871_1000486492 | 431 |
| 1068 | 3300006358 | Ga0068871_100121143 | Ga0068871_1001211432 | 431 |
| 1069 | 3300006931 | Ga0097620_100006383 | Ga0097620_1000063835 | 431 |
| 1070 | 3300006931 | Ga0097620_100017496 | Ga0097620_1000174964 | 431 |
| 1071 | 3300006931 | Ga0097620_100074883 | Ga0097620_1000748832 | 431 |
| 1072 | 3300006931 | Ga0097620_100238152 | Ga0097620_1002381522 | 431 |
| 1073 | 3300007265 | Ga0099794_10000291 | Ga0099794_1000029115 | 431 |
| 1074 | 3300009094 | Ga0111539_10000050 | Ga0111539_10000050103 | 431 |
| 1075 | 3300009101 | Ga0105247_10007589 | Ga0105247_100075894 | 431 |
| 1076 | 3300009147 | Ga0114129_10270891 | Ga0114129_102708912 | 431 |
| 1077 | 3300009148 | Ga0105243_10101570 | Ga0105243_101015703 | 431 |
| 1078 | 3300009177 | Ga0105248_10045650 | Ga0105248_100456502 | 431 |
| 1079 | 3300009551 | Ga0105238_10015087 | Ga0105238_100150873 | 431 |
| 1080 | 3300009553 | Ga0105249_10000004 | Ga0105249_10000004249 | 431 |
| 1081 | 3300013249 | Ga0171463_1001 | Ga0171463_1001788 | 431 |
| 1082 | 3300013296 | Ga0157374_10103653 | Ga0157374_101036532 | 431 |
| 1083 | 3300014325 | Ga0163163_10015631 | Ga0163163_100156312 | 431 |
| 1084 | 3300014325 | Ga0163163_10020521 | Ga0163163_100205212 | 431 |
| 1085 | 3300014325 | Ga0163163_10063306 | Ga0163163_100633064 | 431 |
| 1086 | 3300014325 | Ga0163163_10173783 | Ga0163163_101737832 | 431 |
| 1087 | 3300014326 | Ga0157380_10006982 | Ga0157380_100069825 | 431 |
| 1088 | 3300014326 | Ga0157380_10008405 | Ga0157380_100084056 | 431 |
| 1089 | 3300014326 | Ga0157380_10028179 | Ga0157380_100281792 | 431 |
| 1090 | 3300014968 | Ga0157379_10043503 | Ga0157379_100435032 | 431 |
| 1091 | 3300015684 | Ga0183365_10137 | Ga0183365_101372 | 431 |
| 1092 | 3300015690 | Ga0183363_1032 | Ga0183363_103246 | 431 |
| 1093 | 3300025250 | Ga0209026_1000013 | Ga0209026_100001330 | 431 |
| 1094 | 3300025253 | Ga0209677_100643 | Ga0209677_10064314 | 431 |
| 1095 | 3300025254 | Ga0209148_1011910 | Ga0209148_10119101 | 431 |
| 1096 | 3300025256 | Ga0209759_1000149 | Ga0209759_100014970 | 431 |
| 1097 | 3300025261 | Ga0209233_1003536 | Ga0209233_10035362 | 431 |
| 1098 | 3300025261 | Ga0209233_1003653 | Ga0209233_10036532 | 431 |
| 1099 | 3300025272 | Ga0209455_1004746 | Ga0209455_10047462 | 431 |
| 1100 | 3300025284 | Ga0209130_1000005 | Ga0209130_100000542 | 431 |
| 1101 | 3300025292 | Ga0209676_1000097 | Ga0209676_1000097212 | 431 |
| 1102 | 3300025292 | Ga0209676_1008514 | Ga0209676_10085144 | 431 |
| 1103 | 3300025294 | Ga0209025_1000295 | Ga0209025_100029567 | 431 |
| 1104 | 3300025295 | Ga0209564_1000093 | Ga0209564_100009345 | 431 |
| 1105 | 3300025298 | Ga0209050_1004684 | Ga0209050_10046842 | 431 |
| 1106 | 3300025299 | Ga0209256_1000027 | Ga0209256_1000027377 | 431 |
| 1107 | 3300025299 | Ga0209256_1002044 | Ga0209256_100204413 | 431 |
| 1108 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015557 | 431 |
| 1109 | 3300025304 | Ga0209257_1010078 | Ga0209257_10100782 | 431 |
| 1110 | 3300025893 | Ga0207682_10008562 | Ga0207682_100085622 | 431 |
| 1111 | 3300025893 | Ga0207682_10054532 | Ga0207682_100545321 | 431 |
| 1112 | 3300025900 | Ga0207710_10010227 | Ga0207710_100102272 | 431 |
| 1113 | 3300025900 | Ga0207710_10015559 | Ga0207710_100155592 | 431 |
| 1114 | 3300025901 | Ga0207688_10054327 | Ga0207688_100543272 | 431 |
| 1115 | 3300025907 | Ga0207645_10131458 | Ga0207645_101314582 | 431 |
| 1116 | 3300025908 | Ga0207643_10004683 | Ga0207643_100046833 | 431 |
| 1117 | 3300025910 | Ga0207684_10045941 | Ga0207684_100459412 | 431 |
| 1118 | 3300025912 | Ga0207707_10006417 | Ga0207707_100064174 | 431 |
| 1119 | 3300025917 | Ga0207660_10096169 | Ga0207660_100961692 | 431 |
| 1120 | 3300025923 | Ga0207681_10002874 | Ga0207681_100028744 | 431 |
| 1121 | 3300025926 | Ga0207659_10185954 | Ga0207659_101859541 | 431 |
| 1122 | 3300025931 | Ga0207644_10005864 | Ga0207644_100058643 | 431 |
| 1123 | 3300025933 | Ga0207706_10087741 | Ga0207706_100877412 | 431 |
| 1124 | 3300025933 | Ga0207706_10147100 | Ga0207706_101471002 | 431 |
| 1125 | 3300025936 | Ga0207670_10004621 | Ga0207670_100046214 | 431 |
| 1126 | 3300025938 | Ga0207704_10049131 | Ga0207704_100491312 | 431 |
| 1127 | 3300025940 | Ga0207691_10026129 | Ga0207691_100261293 | 431 |
| 1128 | 3300025940 | Ga0207691_10083656 | Ga0207691_100836562 | 431 |
| 1129 | 3300025940 | Ga0207691_10091002 | Ga0207691_100910022 | 431 |
| 1130 | 3300025949 | Ga0207667_10417946 | Ga0207667_104179461 | 431 |
| 1131 | 3300025960 | Ga0207651_10131574 | Ga0207651_101315741 | 431 |
| 1132 | 3300025961 | Ga0207712_10000008 | Ga0207712_10000008380 | 431 |
| 1133 | 3300025986 | Ga0207658_10000566 | Ga0207658_100005666 | 431 |
| 1134 | 3300025986 | Ga0207658_10293016 | Ga0207658_102930161 | 431 |
| 1135 | 3300026035 | Ga0207703_10139946 | Ga0207703_101399462 | 431 |
| 1136 | 3300026035 | Ga0207703_10168821 | Ga0207703_101688212 | 431 |
| 1137 | 3300026075 | Ga0207708_10027499 | Ga0207708_100274992 | 431 |
| 1138 | 3300026075 | Ga0207708_10063572 | Ga0207708_100635722 | 431 |
| 1139 | 3300026088 | Ga0207641_10290615 | Ga0207641_102906152 | 431 |
| 1140 | 3300026089 | Ga0207648_10089361 | Ga0207648_100893612 | 431 |
| 1141 | 3300026118 | Ga0207675_100001206 | Ga0207675_1000012068 | 431 |
| 1142 | 3300026118 | Ga0207675_100002146 | Ga0207675_1000021469 | 431 |
| 1143 | 3300026118 | Ga0207675_100006135 | Ga0207675_1000061358 | 431 |
| 1144 | 3300026118 | Ga0207675_100038809 | Ga0207675_1000388092 | 431 |
| 1145 | 3300026121 | Ga0207683_10016248 | Ga0207683_100162484 | 431 |
| 1146 | 3300026121 | Ga0207683_10082422 | Ga0207683_100824222 | 431 |
| 1147 | 3300027671 | Ga0209588_1002309 | Ga0209588_10023091 | 431 |
| 1148 | 3300027907 | Ga0207428_10000937 | Ga0207428_1000093728 | 431 |
| 1149 | 3300028379 | Ga0268266_10026439 | Ga0268266_100264392 | 431 |
| 1150 | 3300028379 | Ga0268266_10044635 | Ga0268266_100446354 | 431 |
| 1151 | 3300028380 | Ga0268265_10000035 | Ga0268265_10000035115 | 431 |
| 1152 | 3300028381 | Ga0268264_10000153 | Ga0268264_10000153108 | 431 |
| 1153 | 3300028381 | Ga0268264_10002586 | Ga0268264_1000258614 | 431 |
| 1154 | 3300028381 | Ga0268264_10003066 | Ga0268264_1000306613 | 431 |
| 1155 | 3300028381 | Ga0268264_10056606 | Ga0268264_100566063 | 431 |
| 1156 | 3300028794 | Ga0307515_10001309 | Ga0307515_1000130930 | 431 |
| 1157 | 3300028800 | Ga0265338_10023127 | Ga0265338_100231272 | 431 |
| 1158 | 3300030521 | Ga0307511_10000541 | Ga0307511_1000054127 | 431 |
| 1159 | 3300030744 | Ga0316181_1183610 | Ga0316181_11836103 | 431 |
| 1160 | 3300031241 | Ga0265325_10048230 | Ga0265325_100482302 | 431 |
| 1161 | 3300031344 | Ga0265316_10013079 | Ga0265316_100130795 | 431 |
| 1162 | 3300031456 | Ga0307513_10002506 | Ga0307513_100025066 | 431 |
| 1163 | 3300031456 | Ga0307513_10012786 | Ga0307513_100127864 | 431 |
| 1164 | 3300031456 | Ga0307513_10015322 | Ga0307513_100153222 | 431 |
| 1165 | 3300031507 | Ga0307509_10000333 | Ga0307509_1000033344 | 431 |
| 1166 | 3300031507 | Ga0307509_10022078 | Ga0307509_100220783 | 431 |
| 1167 | 3300031507 | Ga0307509_10036877 | Ga0307509_100368773 | 431 |
| 1168 | 3300031548 | Ga0307408_100022215 | Ga0307408_1000222153 | 431 |
| 1169 | 3300031616 | Ga0307508_10000727 | Ga0307508_1000072729 | 431 |
| 1170 | 3300031711 | Ga0265314_10058516 | Ga0265314_100585162 | 431 |
| 1171 | 3300031712 | Ga0265342_10076793 | Ga0265342_100767932 | 431 |
| 1172 | 3300031731 | Ga0307405_10010158 | Ga0307405_100101582 | 431 |
| 1173 | 3300031824 | Ga0307413_10030431 | Ga0307413_100304311 | 431 |
| 1174 | 3300031824 | Ga0307413_10117523 | Ga0307413_101175231 | 431 |
| 1175 | 3300031852 | Ga0307410_10041291 | Ga0307410_100412912 | 431 |
| 1176 | 3300031903 | Ga0307407_10025776 | Ga0307407_100257762 | 431 |
| 1177 | 3300031911 | Ga0307412_10106108 | Ga0307412_101061082 | 431 |
| 1178 | 3300031995 | Ga0307409_100000814 | Ga0307409_10000081410 | 431 |
| 1179 | 3300031995 | Ga0307409_100039573 | Ga0307409_1000395731 | 431 |
| 1180 | 3300031995 | Ga0307409_100154027 | Ga0307409_1001540272 | 431 |
| 1181 | 3300032002 | Ga0307416_100021865 | Ga0307416_1000218652 | 431 |
| 1182 | 3300032005 | Ga0307411_10001811 | Ga0307411_100018114 | 431 |
| 1183 | 3300032005 | Ga0307411_10003000 | Ga0307411_100030002 | 431 |
| 1184 | 3300033180 | Ga0307510_10000023 | Ga0307510_10000023123 | 431 |
| 1185 | 3300033180 | Ga0307510_10007145 | Ga0307510_100071452 | 431 |
| 1186 | 3300033180 | Ga0307510_10104077 | Ga0307510_101040772 | 431 |
| 1187 | 3300036401 | Ga0373937_0253682 | Ga0373937_0253682_267_1565 | 431 |
| 1188 | 3300037471 | Ga0395905_0000091 | Ga0395905_0000091_105483_106799 | 431 |
| 1189 | 3300041451 | Ga0451791_1040051 | Ga0451791_1040051_931_2229 | 431 |
| 1190 | 3300041486 | Ga0451807_0254012 | Ga0451807_0254012_532_1830 | 431 |
| 1191 | 3300042438 | Ga0439459_0015402 | Ga0439459_0015402_69_1367 | 431 |
| 1192 | 3300044656 | Ga0466969_0000198 | Ga0466969_0000198_12942_14258 | 431 |
| 1193 | 3300044684 | Ga0466966_0004454 | Ga0466966_0004454_4847_6163 | 431 |
| 1194 | 3300044693 | Ga0466961_0008979 | Ga0466961_0008979_1228_2544 | 431 |
| 1195 | 3300044693 | Ga0466961_0035887 | Ga0466961_0035887_1153_2469 | 431 |
| 1196 | 3300044719 | Ga0466971_0007674 | Ga0466971_0007674_2271_3587 | 431 |
| 1197 | 3300044765 | Ga0466970_0012562 | Ga0466970_0012562_2984_4300 | 431 |
| 1198 | 3300044842 | Ga0466957_0050523 | Ga0466957_0050523_686_2002 | 431 |
| 1199 | 3300045836 | Ga0466958_0014422 | Ga0466958_0014422_2785_4101 | 431 |
| 1200 | 3300046460 | Ga0495638_0003111 | Ga0495638_0003111_4361_5665 | 431 |
| 1201 | 3300046460 | Ga0495638_0032266 | Ga0495638_0032266_298_1644 | 431 |
| 1202 | 3300046463 | Ga0495653_0000009 | Ga0495653_0000009_252286_253581 | 431 |
| 1203 | 3300046507 | Ga0495606_0004320 | Ga0495606_0004320_2154_3449 | 431 |
| 1204 | 3300046512 | Ga0495610_0024493 | Ga0495610_0024493_636_1931 | 431 |
| 1205 | 3300046513 | Ga0495616_0005415 | Ga0495616_0005415_1990_3288 | 431 |
| 1206 | 3300046530 | Ga0495654_0062965 | Ga0495654_0062965_428_1723 | 431 |
| 1207 | 3300046615 | Ga0495656_0022562 | Ga0495656_0022562_967_2265 | 431 |
| 1208 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_343602_344897 | 431 |
| 1209 | 3300046616 | Ga0495668_0044664 | Ga0495668_0044664_250_1548 | 431 |
| 1210 | 3300046660 | Ga0495625_0025679 | Ga0495625_0025679_2542_3840 | 431 |
| 1211 | 3300046660 | Ga0495625_0037357 | Ga0495625_0037357_757_2055 | 431 |
| 1212 | 3300046694 | Ga0495649_0022211 | Ga0495649_0022211_1196_2500 | 431 |
| 1213 | 3300047470 | Ga0495681_0034048 | Ga0495681_0034048_248_1546 | 431 |
| 1214 | 3300048904 | Ga0496101_0099942 | Ga0496101_0099942_607_1902 | 431 |
| 1215 | 3300048905 | Ga0496102_0109711 | Ga0496102_0109711_1076_2413 | 431 |
| 1216 | 3300048924 | Ga0496121_0018849 | Ga0496121_0018849_4271_5584 | 431 |
| 1217 | 3300048924 | Ga0496121_0052320 | Ga0496121_0052320_1844_3139 | 431 |
| 1218 | 3300048927 | Ga0496124_0192186 | Ga0496124_0192186_66_1361 | 431 |
| 1219 | 3300049571 | Ga0501034_0123694 | Ga0501034_0123694_995_2296 | 431 |
| 1220 | 3300049573 | Ga0501037_0057199 | Ga0501037_0057199_552_1853 | 431 |
| 1221 | 3300049580 | Ga0501046_0013179 | Ga0501046_0013179_3733_5034 | 431 |
| 1222 | 3300049581 | Ga0501047_0033253 | Ga0501047_0033253_3399_4700 | 431 |
| 1223 | 3300049583 | Ga0501067_0033911 | Ga0501067_0033911_494_1792 | 431 |
| 1224 | 3300049589 | Ga0501073_0001736 | Ga0501073_0001736_10320_11618 | 431 |
| 1225 | 3300049593 | Ga0501077_0027847 | Ga0501077_0027847_27_1325 | 431 |
| 1226 | 3300049741 | Ga0501079_0010367 | Ga0501079_0010367_1515_2813 | 431 |
| 1227 | 3300049742 | Ga0501080_0000921 | Ga0501080_0000921_12405_13703 | 431 |
| 1228 | 3300049742 | Ga0501080_0298596 | Ga0501080_0298596_87_1385 | 431 |
| 1229 | 3300049744 | Ga0501083_0007148 | Ga0501083_0007148_3352_4650 | 431 |
| 1230 | 3300049822 | Ga0501035_0000263 | Ga0501035_0000263_11120_12496 | 431 |
| 1231 | 3300049822 | Ga0501035_0017062 | Ga0501035_0017062_2124_3440 | 431 |
| 1232 | 3300049823 | Ga0501044_0059852 | Ga0501044_0059852_2324_3625 | 431 |
| 1233 | 3300050494 | nmdc:mga06z11_56445_c1 | nmdc:mga06z11_56445_c1_406_1704 | 431 |
| 1234 | 3300050507 | nmdc:mga05p37_152813_c1 | nmdc:mga05p37_152813_c1_875_2170 | 431 |
| 1235 | 3300050511 | nmdc:mga08y16_33_c1 | nmdc:mga08y16_33_c1_310_1605 | 431 |
| 1236 | 3300053086 | Ga0500578_0001295 | Ga0500578_0001295_22146_23459 | 431 |
| 1237 | 3300053087 | Ga0500643_000173 | Ga0500643_000173_22561_23856 | 431 |
| 1238 | 3300053091 | Ga0500647_0010667 | Ga0500647_0010667_1046_2341 | 431 |
| 1239 | 3300053094 | Ga0500566_0000353 | Ga0500566_0000353_1359_2654 | 431 |
| 1240 | 3300053095 | Ga0500640_000097 | Ga0500640_000097_4775_6070 | 431 |
| 1241 | 3300053111 | Ga0500572_000165 | Ga0500572_000165_5864_7159 | 431 |
| 1242 | 3300053122 | Ga0500608_003613 | Ga0500608_003613_329_1624 | 431 |
| 1243 | 3300053123 | Ga0500614_001090 | Ga0500614_001090_776_2071 | 431 |
| 1244 | 3300053136 | Ga0500559_0003511 | Ga0500559_0003511_524_1819 | 431 |
| 1245 | 3300053150 | Ga0500603_001328 | Ga0500603_001328_668_1963 | 431 |
| 1246 | 3300053158 | Ga0500627_0000002 | Ga0500627_0000002_68302_69597 | 431 |
| 1247 | 3300053159 | Ga0500630_001600 | Ga0500630_001600_5701_6996 | 431 |
| 1248 | 3300053162 | Ga0500638_009701 | Ga0500638_009701_1837_3132 | 431 |
| 1249 | 3300053163 | Ga0500639_000023 | Ga0500639_000023_76800_78095 | 431 |
| 1250 | 3300053177 | Ga0500636_0029297 | Ga0500636_0029297_1567_2862 | 431 |
| 1251 | 3300053177 | Ga0500636_0029703 | Ga0500636_0029703_420_1715 | 431 |
| 1252 | 3300053178 | Ga0500637_0036213 | Ga0500637_0036213_1050_2345 | 431 |
| 1253 | 3300054114 | Ga0501084_0012130 | Ga0501084_0012130_4260_5558 | 431 |
| 1254 | 3300061719 | Ga0466962_0000986 | Ga0466962_0000986_1597_2913 | 431 |
| 1255 | iso_pu_bacteria | 2739367756 | 2739790981 | 431 |
| 1256 | 3300005289 | Ga0065704_10101196 | Ga0065704_101011962 | 432 |
| 1257 | 3300005290 | Ga0065712_10077146 | Ga0065712_100771463 | 432 |
| 1258 | 3300005295 | Ga0065707_10004904 | Ga0065707_100049042 | 432 |
| 1259 | 3300005330 | Ga0070690_100009128 | Ga0070690_1000091282 | 432 |
| 1260 | 3300005331 | Ga0070670_100011486 | Ga0070670_1000114862 | 432 |
| 1261 | 3300005331 | Ga0070670_100232100 | Ga0070670_1002321002 | 432 |
| 1262 | 3300005333 | Ga0070677_10052188 | Ga0070677_100521882 | 432 |
| 1263 | 3300005335 | Ga0070666_10008240 | Ga0070666_100082402 | 432 |
| 1264 | 3300005336 | Ga0070680_100129635 | Ga0070680_1001296351 | 432 |
| 1265 | 3300005336 | Ga0070680_100260627 | Ga0070680_1002606271 | 432 |
| 1266 | 3300005338 | Ga0068868_100025316 | Ga0068868_1000253163 | 432 |
| 1267 | 3300005347 | Ga0070668_100077888 | Ga0070668_1000778882 | 432 |
| 1268 | 3300005353 | Ga0070669_100005889 | Ga0070669_1000058894 | 432 |
| 1269 | 3300005354 | Ga0070675_100017449 | Ga0070675_1000174494 | 432 |
| 1270 | 3300005355 | Ga0070671_100036107 | Ga0070671_1000361073 | 432 |
| 1271 | 3300005367 | Ga0070667_100043273 | Ga0070667_1000432732 | 432 |
| 1272 | 3300005437 | Ga0070710_10001104 | Ga0070710_100011044 | 432 |
| 1273 | 3300005456 | Ga0070678_100031951 | Ga0070678_1000319512 | 432 |
| 1274 | 3300005458 | Ga0070681_10025626 | Ga0070681_100256262 | 432 |
| 1275 | 3300005459 | Ga0068867_100041560 | Ga0068867_1000415602 | 432 |
| 1276 | 3300005468 | Ga0070707_100002461 | Ga0070707_10000246112 | 432 |
| 1277 | 3300005471 | Ga0070698_100001987 | Ga0070698_1000019879 | 432 |
| 1278 | 3300005518 | Ga0070699_100039132 | Ga0070699_1000391322 | 432 |
| 1279 | 3300005535 | Ga0070684_100076965 | Ga0070684_1000769652 | 432 |
| 1280 | 3300005539 | Ga0068853_100238424 | Ga0068853_1002384242 | 432 |
| 1281 | 3300005544 | Ga0070686_100095608 | Ga0070686_1000956082 | 432 |
| 1282 | 3300005563 | Ga0068855_100035817 | Ga0068855_1000358175 | 432 |
| 1283 | 3300005564 | Ga0070664_100033055 | Ga0070664_1000330554 | 432 |
| 1284 | 3300005564 | Ga0070664_100037216 | Ga0070664_1000372162 | 432 |
| 1285 | 3300005577 | Ga0068857_100034814 | Ga0068857_1000348142 | 432 |
| 1286 | 3300005578 | Ga0068854_100020014 | Ga0068854_1000200142 | 432 |
| 1287 | 3300005578 | Ga0068854_100037222 | Ga0068854_1000372222 | 432 |
| 1288 | 3300005616 | Ga0068852_100002040 | Ga0068852_1000020402 | 432 |
| 1289 | 3300005616 | Ga0068852_100069392 | Ga0068852_1000693923 | 432 |
| 1290 | 3300005617 | Ga0068859_100051193 | Ga0068859_1000511933 | 432 |
| 1291 | 3300005618 | Ga0068864_100005239 | Ga0068864_1000052394 | 432 |
| 1292 | 3300005618 | Ga0068864_100014954 | Ga0068864_1000149542 | 432 |
| 1293 | 3300005834 | Ga0068851_10031070 | Ga0068851_100310702 | 432 |
| 1294 | 3300005841 | Ga0068863_100008263 | Ga0068863_1000082632 | 432 |
| 1295 | 3300005841 | Ga0068863_100037293 | Ga0068863_1000372934 | 432 |
| 1296 | 3300005842 | Ga0068858_100049389 | Ga0068858_1000493892 | 432 |
| 1297 | 3300005842 | Ga0068858_100183098 | Ga0068858_1001830982 | 432 |
| 1298 | 3300005842 | Ga0068858_100262419 | Ga0068858_1002624191 | 432 |
| 1299 | 3300005843 | Ga0068860_100032404 | Ga0068860_1000324043 | 432 |
| 1300 | 3300005844 | Ga0068862_100115327 | Ga0068862_1001153272 | 432 |
| 1301 | 3300006195 | Ga0075366_10111357 | Ga0075366_101113572 | 432 |
| 1302 | 3300006237 | Ga0097621_100026654 | Ga0097621_1000266542 | 432 |
| 1303 | 3300006237 | Ga0097621_100044981 | Ga0097621_1000449812 | 432 |
| 1304 | 3300006358 | Ga0068871_100025223 | Ga0068871_1000252232 | 432 |
| 1305 | 3300006358 | Ga0068871_100040634 | Ga0068871_1000406343 | 432 |
| 1306 | 3300006844 | Ga0075428_100000060 | Ga0075428_10000006061 | 432 |
| 1307 | 3300006871 | Ga0075434_100325279 | Ga0075434_1003252792 | 432 |
| 1308 | 3300006881 | Ga0068865_100055560 | Ga0068865_1000555602 | 432 |
| 1309 | 3300006931 | Ga0097620_100051192 | Ga0097620_1000511923 | 432 |
| 1310 | 3300009093 | Ga0105240_10010945 | Ga0105240_1001094511 | 432 |
| 1311 | 3300009093 | Ga0105240_10136790 | Ga0105240_101367902 | 432 |
| 1312 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002729 | 432 |
| 1313 | 3300009094 | Ga0111539_10109105 | Ga0111539_101091052 | 432 |
| 1314 | 3300009098 | Ga0105245_10012954 | Ga0105245_100129542 | 432 |
| 1315 | 3300009101 | Ga0105247_10015183 | Ga0105247_100151832 | 432 |
| 1316 | 3300009101 | Ga0105247_10025927 | Ga0105247_100259271 | 432 |
| 1317 | 3300009147 | Ga0114129_10038907 | Ga0114129_100389072 | 432 |
| 1318 | 3300009147 | Ga0114129_10099497 | Ga0114129_100994972 | 432 |
| 1319 | 3300009174 | Ga0105241_10108804 | Ga0105241_101088042 | 432 |
| 1320 | 3300009176 | Ga0105242_10009081 | Ga0105242_100090814 | 432 |
| 1321 | 3300009176 | Ga0105242_10014725 | Ga0105242_100147254 | 432 |
| 1322 | 3300009177 | Ga0105248_10300329 | Ga0105248_103003292 | 432 |
| 1323 | 3300009545 | Ga0105237_10003125 | Ga0105237_1000312513 | 432 |
| 1324 | 3300009545 | Ga0105237_10007526 | Ga0105237_100075262 | 432 |
| 1325 | 3300009545 | Ga0105237_10063666 | Ga0105237_100636661 | 432 |
| 1326 | 3300009545 | Ga0105237_10071599 | Ga0105237_100715992 | 432 |
| 1327 | 3300009545 | Ga0105237_10085691 | Ga0105237_100856912 | 432 |
| 1328 | 3300009553 | Ga0105249_10017322 | Ga0105249_100173225 | 432 |
| 1329 | 3300009553 | Ga0105249_10094769 | Ga0105249_100947692 | 432 |
| 1330 | 3300009553 | Ga0105249_10140229 | Ga0105249_101402292 | 432 |
| 1331 | 3300010375 | Ga0105239_10043547 | Ga0105239_100435472 | 432 |
| 1332 | 3300013100 | Ga0157373_10010988 | Ga0157373_100109883 | 432 |
| 1333 | 3300013100 | Ga0157373_10055873 | Ga0157373_100558732 | 432 |
| 1334 | 3300013105 | Ga0157369_10085402 | Ga0157369_100854022 | 432 |
| 1335 | 3300013296 | Ga0157374_10031258 | Ga0157374_100312583 | 432 |
| 1336 | 3300013297 | Ga0157378_10023318 | Ga0157378_100233184 | 432 |
| 1337 | 3300013306 | Ga0163162_10009664 | Ga0163162_100096643 | 432 |
| 1338 | 3300013306 | Ga0163162_10135162 | Ga0163162_101351621 | 432 |
| 1339 | 3300013307 | Ga0157372_10308227 | Ga0157372_103082272 | 432 |
| 1340 | 3300013308 | Ga0157375_10006167 | Ga0157375_100061676 | 432 |
| 1341 | 3300013308 | Ga0157375_10081203 | Ga0157375_100812032 | 432 |
| 1342 | 3300013308 | Ga0157375_10084021 | Ga0157375_100840212 | 432 |
| 1343 | 3300014325 | Ga0163163_10018136 | Ga0163163_100181362 | 432 |
| 1344 | 3300014325 | Ga0163163_10033994 | Ga0163163_100339942 | 432 |
| 1345 | 3300014326 | Ga0157380_10000514 | Ga0157380_1000051413 | 432 |
| 1346 | 3300014326 | Ga0157380_10024587 | Ga0157380_100245872 | 432 |
| 1347 | 3300014326 | Ga0157380_10162018 | Ga0157380_101620181 | 432 |
| 1348 | 3300017792 | Ga0163161_10044606 | Ga0163161_100446062 | 432 |
| 1349 | 3300021384 | Ga0213876_10002813 | Ga0213876_100028134 | 432 |
| 1350 | 3300025254 | Ga0209148_1000474 | Ga0209148_100047419 | 432 |
| 1351 | 3300025272 | Ga0209455_1001414 | Ga0209455_10014144 | 432 |
| 1352 | 3300025898 | Ga0207692_10054139 | Ga0207692_100541392 | 432 |
| 1353 | 3300025906 | Ga0207699_10074917 | Ga0207699_100749172 | 432 |
| 1354 | 3300025912 | Ga0207707_10023883 | Ga0207707_100238834 | 432 |
| 1355 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008404 | 432 |
| 1356 | 3300025913 | Ga0207695_10113346 | Ga0207695_101133462 | 432 |
| 1357 | 3300025914 | Ga0207671_10062949 | Ga0207671_100629492 | 432 |
| 1358 | 3300025914 | Ga0207671_10070889 | Ga0207671_100708892 | 432 |
| 1359 | 3300025915 | Ga0207693_10041585 | Ga0207693_100415851 | 432 |
| 1360 | 3300025916 | Ga0207663_10069960 | Ga0207663_100699602 | 432 |
| 1361 | 3300025922 | Ga0207646_10000897 | Ga0207646_1000089727 | 432 |
| 1362 | 3300025924 | Ga0207694_10168470 | Ga0207694_101684702 | 432 |
| 1363 | 3300025929 | Ga0207664_10028123 | Ga0207664_100281234 | 432 |
| 1364 | 3300025931 | Ga0207644_10044518 | Ga0207644_100445182 | 432 |
| 1365 | 3300025934 | Ga0207686_10015421 | Ga0207686_100154212 | 432 |
| 1366 | 3300025938 | Ga0207704_10023768 | Ga0207704_100237682 | 432 |
| 1367 | 3300025940 | Ga0207691_10050920 | Ga0207691_100509202 | 432 |
| 1368 | 3300025940 | Ga0207691_10102332 | Ga0207691_101023322 | 432 |
| 1369 | 3300025941 | Ga0207711_10005157 | Ga0207711_100051572 | 432 |
| 1370 | 3300025941 | Ga0207711_10203326 | Ga0207711_102033262 | 432 |
| 1371 | 3300025945 | Ga0207679_10058560 | Ga0207679_100585602 | 432 |
| 1372 | 3300025961 | Ga0207712_10013011 | Ga0207712_100130112 | 432 |
| 1373 | 3300025961 | Ga0207712_10018934 | Ga0207712_100189342 | 432 |
| 1374 | 3300025981 | Ga0207640_10140741 | Ga0207640_101407412 | 432 |
| 1375 | 3300025986 | Ga0207658_10020522 | Ga0207658_100205222 | 432 |
| 1376 | 3300026035 | Ga0207703_10049252 | Ga0207703_100492523 | 432 |
| 1377 | 3300026041 | Ga0207639_10111072 | Ga0207639_101110722 | 432 |
| 1378 | 3300026088 | Ga0207641_10010982 | Ga0207641_100109825 | 432 |
| 1379 | 3300026088 | Ga0207641_10034514 | Ga0207641_100345143 | 432 |
| 1380 | 3300026088 | Ga0207641_10062192 | Ga0207641_100621922 | 432 |
| 1381 | 3300026089 | Ga0207648_10010770 | Ga0207648_100107706 | 432 |
| 1382 | 3300026095 | Ga0207676_10011127 | Ga0207676_100111274 | 432 |
| 1383 | 3300026116 | Ga0207674_10033670 | Ga0207674_100336701 | 432 |
| 1384 | 3300026121 | Ga0207683_10019417 | Ga0207683_100194172 | 432 |
| 1385 | 3300026142 | Ga0207698_10130633 | Ga0207698_101306332 | 432 |
| 1386 | 3300027907 | Ga0207428_10000026 | Ga0207428_1000002676 | 432 |
| 1387 | 3300028379 | Ga0268266_10068908 | Ga0268266_100689082 | 432 |
| 1388 | 3300028381 | Ga0268264_10020209 | Ga0268264_100202092 | 432 |
| 1389 | 3300032005 | Ga0307411_10046706 | Ga0307411_100467062 | 432 |
| 1390 | 3300032005 | Ga0307411_10157309 | Ga0307411_101573092 | 432 |
| 1391 | 3300033180 | Ga0307510_10071237 | Ga0307510_100712372 | 432 |
| 1392 | 3300039062 | Ga0400483_150886 | Ga0400483_150886_955_2262 | 432 |
| 1393 | 3300039437 | Ga0436365_0492506 | Ga0436365_0492506_3465_4763 | 432 |
| 1394 | 3300044694 | Ga0466963_0004084 | Ga0466963_0004084_3306_4604 | 432 |
| 1395 | 3300045976 | Ga0466967_0014366 | Ga0466967_0014366_376_1674 | 432 |
| 1396 | 3300046538 | Ga0495609_0083056 | Ga0495609_0083056_68_1366 | 432 |
| 1397 | 3300046543 | Ga0495645_0034890 | Ga0495645_0034890_982_2280 | 432 |
| 1398 | 3300046616 | Ga0495668_0008340 | Ga0495668_0008340_1936_3234 | 432 |
| 1399 | 3300047472 | Ga0495686_0040467 | Ga0495686_0040467_1284_2582 | 432 |
| 1400 | 3300048904 | Ga0496101_0100295 | Ga0496101_0100295_131_1429 | 432 |
| 1401 | 3300048907 | Ga0496104_0010257 | Ga0496104_0010257_5217_6515 | 432 |
| 1402 | 3300048908 | Ga0496105_0070919 | Ga0496105_0070919_213_1511 | 432 |
| 1403 | 3300048912 | Ga0496109_0031019 | Ga0496109_0031019_1987_3285 | 432 |
| 1404 | 3300048917 | Ga0496114_0027194 | Ga0496114_0027194_1783_3081 | 432 |
| 1405 | 3300048917 | Ga0496114_0167835 | Ga0496114_0167835_132_1430 | 432 |
| 1406 | 3300048929 | Ga0496126_0108498 | Ga0496126_0108498_977_2275 | 432 |
| 1407 | 3300049460 | Ga0495682_0033963 | Ga0495682_0033963_108_1406 | 432 |
| 1408 | 3300049570 | Ga0501033_0171860 | Ga0501033_0171860_31_1356 | 432 |
| 1409 | 3300049572 | Ga0501036_0133631 | Ga0501036_0133631_536_1834 | 432 |
| 1410 | 3300049577 | Ga0501041_0121754 | Ga0501041_0121754_293_1591 | 432 |
| 1411 | 3300049592 | Ga0501076_0037579 | Ga0501076_0037579_640_1938 | 432 |
| 1412 | 3300049593 | Ga0501077_0088836 | Ga0501077_0088836_282_1580 | 432 |
| 1413 | 3300049743 | Ga0501081_0127915 | Ga0501081_0127915_96_1394 | 432 |
| 1414 | 3300049824 | Ga0501045_0106666 | Ga0501045_0106666_740_2038 | 432 |
| 1415 | 3300050507 | nmdc:mga05p37_756_c1 | nmdc:mga05p37_756_c1_7546_8844 | 432 |
| 1416 | 3300050511 | nmdc:mga08y16_143302_c1 | nmdc:mga08y16_143302_c1_594_1892 | 432 |
| 1417 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_149568_150866 | 432 |
| 1418 | 3300050511 | nmdc:mga08y16_39329_c1 | nmdc:mga08y16_39329_c1_1298_2596 | 432 |
| 1419 | 3300050513 | nmdc:mga0rr50_125558_c1 | nmdc:mga0rr50_125558_c1_221_1519 | 432 |
| 1420 | 3300050515 | nmdc:mga0a205_65705_c1 | nmdc:mga0a205_65705_c1_1464_2762 | 432 |
| 1421 | 3300053153 | Ga0500616_0000554 | Ga0500616_0000554_23868_25166 | 432 |
| 1422 | 3300060353 | Ga0501082_0092288 | Ga0501082_0092288_1280_2578 | 432 |
| 1423 | 3300002074 | JGI24748J21848_1000012 | JGI24748J21848_100001246 | 433 |
| 1424 | 3300002239 | JGI24034J26672_10000003 | JGI24034J26672_10000003341 | 433 |
| 1425 | 3300002459 | JGI24751J29686_10000931 | JGI24751J29686_100009312 | 433 |
| 1426 | 3300005331 | Ga0070670_100000095 | Ga0070670_10000009520 | 433 |
| 1427 | 3300005518 | Ga0070699_100002830 | Ga0070699_1000028305 | 433 |
| 1428 | 3300005518 | Ga0070699_100202437 | Ga0070699_1002024372 | 433 |
| 1429 | 3300005544 | Ga0070686_100168088 | Ga0070686_1001680881 | 433 |
| 1430 | 3300005618 | Ga0068864_100028391 | Ga0068864_1000283912 | 433 |
| 1431 | 3300005842 | Ga0068858_100000277 | Ga0068858_10000027738 | 433 |
| 1432 | 3300006852 | Ga0075433_10085443 | Ga0075433_100854432 | 433 |
| 1433 | 3300006914 | Ga0075436_100000008 | Ga0075436_100000008212 | 433 |
| 1434 | 3300009094 | Ga0111539_10155248 | Ga0111539_101552482 | 433 |
| 1435 | 3300009101 | Ga0105247_10000003 | Ga0105247_10000003336 | 433 |
| 1436 | 3300009176 | Ga0105242_10037035 | Ga0105242_100370351 | 433 |
| 1437 | 3300014325 | Ga0163163_10000026 | Ga0163163_10000026107 | 433 |
| 1438 | 3300025223 | Ga0207672_1000445 | Ga0207672_10004453 | 433 |
| 1439 | 3300025900 | Ga0207710_10000001 | Ga0207710_10000001973 | 433 |
| 1440 | 3300025900 | Ga0207710_10027279 | Ga0207710_100272792 | 433 |
| 1441 | 3300025918 | Ga0207662_10003226 | Ga0207662_100032262 | 433 |
| 1442 | 3300025925 | Ga0207650_10000006 | Ga0207650_1000000643 | 433 |
| 1443 | 3300026035 | Ga0207703_10000080 | Ga0207703_1000008050 | 433 |
| 1444 | 3300026095 | Ga0207676_10020600 | Ga0207676_100206003 | 433 |
| 1445 | 3300026118 | Ga0207675_100104968 | Ga0207675_1001049682 | 433 |
| 1446 | 3300045051 | Ga0451576_0328538 | Ga0451576_0328538_185_1486 | 433 |
| 1447 | 3300050513 | nmdc:mga0rr50_555_c1 | nmdc:mga0rr50_555_c1_11717_13018 | 433 |
| 1448 | 3300050514 | nmdc:mga08x19_16_c1 | nmdc:mga08x19_16_c1_221923_223224 | 433 |
| 1449 | 3300050515 | nmdc:mga0a205_100102_c1 | nmdc:mga0a205_100102_c1_578_1879 | 433 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gjj-assembly1.cif.gz_B | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose | 0.9706 | 5 | 426 |
| 3m0v-assembly1.cif.gz_C | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329l in complex with l-rhamnose | 0.97 | 4 | 424 |
| 3m0y-assembly1.cif.gz_D | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose | 0.97 | 4 | 423 |
| 3iud-assembly1.cif.gz_C | cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase | 0.97 | 4 | 424 |
| 4gjj-assembly1.cif.gz_B | crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose | 0.9684 | 5 | 426 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m0vD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9694 | 4 | 424 | 3.20.20.150 |
| 3m0vD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9473 | 4 | 424 | 3.20.20.150 |
| 3ktcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8666 | 51 | 387 | 3.20.20.150 |
| 3ktcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8444 | 51 | 387 | 3.20.20.150 |
| 3uvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8102 | 26 | 421 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529HK39-F1-model_v4 | deleted | 0.9826 | 75 | 226 |
|
| AF-A0A3S2EWE7-F1-model_v4 | deleted | 0.9796 | 7 | 284 |
|
| AF-A0A1I7M7X5-F1-model_v4 | L-rhamnose isomerase / sugar isomerase | 0.9794 | 7 | 283 |
GO:0016853
|
| AF-A0A529L4P3-F1-model_v4 | Sugar isomerase | 0.9792 | 71 | 269 |
GO:0016853
|
| AF-A0A3S1SYS7-F1-model_v4 | Sugar isomerase | 0.9786 | 7 | 206 |
GO:0016853
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar