F494048

General Info

Members Datasets Scaffolds Average Seq Length
1449 514 1432 95

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10922718|Ga0206353_109227184
Length 120
Sequence MSAKRSWRRLNFLSRTEVDVAKVALINREQKRRDTVKKFAAKRAELLAVINNFKASPEERVTARQKLQSLPRNASPTRLRNRCALTGRPRGVFRKFGLGRNKLREIAMRGEIPGVVKASW

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
3 2643221613 Oerskovia sp. Root22 Isolate Unclassified
4 2643221721 Oerskovia sp. Root918 Isolate Unclassified
5 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
6 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
7 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
8 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
9 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
10 2808606394 Promicromonospora sp. C35 Isolate Unclassified
11 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
12 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
13 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
14 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
15 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
16 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
79 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
133 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
135 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
136 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
137 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
142 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
143 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
163 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
239 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
240 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
241 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
242 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
243 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
244 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
248 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
249 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
250 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
251 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
252 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
253 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
254 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
255 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
256 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
257 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
258 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
261 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
262 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
263 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
267 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
268 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
269 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
270 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
271 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
274 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
275 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
276 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
277 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
278 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
281 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
282 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
283 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
284 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
285 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
286 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
287 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
288 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
293 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
294 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
295 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
296 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
299 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
300 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
301 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
302 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
303 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
304 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
305 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
306 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
307 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
308 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
309 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
310 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
311 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
312 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
314 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
315 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
316 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
317 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
318 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
319 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
320 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
321 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
322 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
323 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
324 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
325 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
328 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
331 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
332 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
333 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
334 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
335 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
336 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
337 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
338 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
339 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
340 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
341 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
342 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
343 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
344 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
345 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
346 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
347 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
348 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
349 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
350 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
353 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
354 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
355 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
356 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
357 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
358 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
359 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
360 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
361 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
362 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
363 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
364 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
365 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
366 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
367 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
368 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
369 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
370 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
381 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
382 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
385 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
393 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
394 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
415 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
416 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
418 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
442 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
443 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
448 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
449 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
450 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
453 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
454 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
455 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
456 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
457 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
458 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
459 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
462 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
463 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
464 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
465 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
466 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
467 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
468 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
471 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
472 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
473 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
474 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
475 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
476 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
477 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
478 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
479 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
480 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
481 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
482 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
485 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
486 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
489 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
490 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
491 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
492 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
493 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
494 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
495 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
496 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
497 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
498 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
502 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
503 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
504 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
505 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
506 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
507 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
513 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
514 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 1.45
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0
Rhizoplane 2.48
Rhizosphere 86.47
Stem 0
Stem Tuber 0.07
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001539 3300001915 Bacteria 6534
2 JGI24740J21852_10004196 3300001979 Bacteria 6224
3 JGI24740J21852_10034505 3300001979 Unclassified 1594
4 JGI24737J22298_10126222 3300001990 Bacteria 756
5 JGI24735J21928_10000083 3300002067 Bacteria 36242
6 rootH1_10286273 3300003323 Bacteria 1431
7 Ga0058863_11971832 3300004799 Bacteria 3216
8 Ga0058862_10110798 3300004803 Bacteria 5483
9 Ga0058862_12728945 3300004803 Bacteria 607
10 Ga0065704_10211023 3300005289 Bacteria 1109
11 Ga0065712_10032246 3300005290 Bacteria 1236
12 Ga0065715_10687863 3300005293 Bacteria 659
13 Ga0065707_10554872 3300005295 Bacteria 718
14 Ga0065707_10742430 3300005295 Bacteria 622
15 Ga0070658_10000012 3300005327 Bacteria 277871
16 Ga0070658_10000015 3300005327 Bacteria 230579
17 Ga0070658_10000118 3300005327 Bacteria 71171
18 Ga0070658_10001050 3300005327 Bacteria 23600
19 Ga0070658_10013418 3300005327 Bacteria 6575
20 Ga0070658_10026903 3300005327 Bacteria 4618
21 Ga0070658_10457586 3300005327 Bacteria 1100
22 Ga0070658_11424826 3300005327 Bacteria 601
23 Ga0070676_10000822 3300005328 Bacteria 15354
24 Ga0070676_10147148 3300005328 Bacteria 1505
25 Ga0070676_10459818 3300005328 Bacteria 896
26 Ga0070683_100000450 3300005329 Bacteria 28685
27 Ga0070683_100005670 3300005329 Bacteria 10424
28 Ga0070683_100053815 3300005329 Bacteria 3730
29 Ga0070683_100103418 3300005329 Bacteria 2684
30 Ga0070683_100175681 3300005329 Bacteria 2033
31 Ga0070683_100374788 3300005329 Bacteria 1356
32 Ga0070683_100509232 3300005329 Bacteria 1150
33 Ga0070683_101596493 3300005329 Bacteria 627
34 Ga0070683_102314359 3300005329 Unclassified 515
35 Ga0070690_100010582 3300005330 Bacteria 5373
36 Ga0070690_100017999 3300005330 Bacteria 4260
37 Ga0070690_100085186 3300005330 Bacteria 2073
38 Ga0070670_100303793 3300005331 Unclassified 1396
39 Ga0070670_100634924 3300005331 Bacteria 957
40 Ga0070670_101347777 3300005331 Bacteria 654
41 Ga0068869_100000239 3300005334 Bacteria 28911
42 Ga0068869_100002849 3300005334 Bacteria 10479
43 Ga0068869_100288562 3300005334 Bacteria 1321
44 Ga0068869_100421488 3300005334 Bacteria 1101
45 Ga0070666_10041378 3300005335 Bacteria 3079
46 Ga0070666_10119177 3300005335 Bacteria 1829
47 Ga0070666_10343483 3300005335 Bacteria 1067
48 Ga0070666_10568010 3300005335 Bacteria 826
49 Ga0070666_11073963 3300005335 Bacteria 598
50 Ga0070680_100000672 3300005336 Bacteria 23772
51 Ga0070680_100038367 3300005336 Bacteria 3874
52 Ga0070680_100149390 3300005336 Bacteria 1961
53 Ga0070680_100316508 3300005336 Bacteria 1324
54 Ga0070680_101703993 3300005336 Bacteria 546
55 Ga0070682_100232877 3300005337 Bacteria 1318
56 Ga0070682_100402999 3300005337 Bacteria 1035
57 Ga0070682_100863385 3300005337 Unclassified 740
58 Ga0070682_101111607 3300005337 Unclassified 662
59 Ga0070682_101677233 3300005337 Bacteria 551
60 Ga0068868_100110068 3300005338 Bacteria 2237
61 Ga0068868_100277744 3300005338 Bacteria 1417
62 Ga0070660_100000176 3300005339 Bacteria 42222
63 Ga0070660_100002817 3300005339 Bacteria 11964
64 Ga0070660_100008505 3300005339 Bacteria 7181
65 Ga0070660_100029132 3300005339 Bacteria 4135
66 Ga0070660_100426131 3300005339 Bacteria 1099
67 Ga0070689_100003982 3300005340 Bacteria 9925
68 Ga0070689_100010970 3300005340 Bacteria 6476
69 Ga0070689_101762510 3300005340 Bacteria 564
70 Ga0070691_10037648 3300005341 Bacteria 2283
71 Ga0070691_10082496 3300005341 Bacteria 1576
72 Ga0070691_10187215 3300005341 Bacteria 1081
73 Ga0070691_10497255 3300005341 Bacteria 704
74 Ga0070691_10998864 3300005341 Bacteria 522
75 Ga0070687_100514328 3300005343 Bacteria 808
76 Ga0070687_100854927 3300005343 Bacteria 649
77 Ga0070687_100910603 3300005343 Bacteria 631
78 Ga0070661_100130867 3300005344 Bacteria 1884
79 Ga0070661_100900332 3300005344 Bacteria 730
80 Ga0070692_10026456 3300005345 Bacteria 2868
81 Ga0070692_11092894 3300005345 Bacteria 563
82 Ga0070668_101351262 3300005347 Bacteria 649
83 Ga0070669_100665908 3300005353 Bacteria 877
84 Ga0070669_100707179 3300005353 Bacteria 851
85 Ga0070669_101785717 3300005353 Unclassified 536
86 Ga0070675_100125842 3300005354 Bacteria 2180
87 Ga0070675_101433649 3300005354 Bacteria 637
88 Ga0070675_101494068 3300005354 Bacteria 623
89 Ga0070671_100000001 3300005355 Bacteria 1228151
90 Ga0070671_100035416 3300005355 Bacteria 4136
91 Ga0070671_100133678 3300005355 Bacteria 2090
92 Ga0070671_100226312 3300005355 Bacteria 1587
93 Ga0070671_100777476 3300005355 Bacteria 833
94 Ga0070671_101060315 3300005355 Unclassified 711
95 Ga0070674_100004150 3300005356 Bacteria 8229
96 Ga0070674_100014629 3300005356 Bacteria 4881
97 Ga0070674_100044487 3300005356 Bacteria 3027
98 Ga0070674_100061550 3300005356 Bacteria 2620
99 Ga0070674_100191276 3300005356 Bacteria 1574
100 Ga0070673_100000306 3300005364 Bacteria 25711
101 Ga0070673_100085073 3300005364 Bacteria 2574
102 Ga0070688_100002345 3300005365 Bacteria 9550
103 Ga0070659_100000215 3300005366 Bacteria 44375
104 Ga0070659_100096145 3300005366 Bacteria 2379
105 Ga0070659_100199395 3300005366 Bacteria 1647
106 Ga0070659_101770959 3300005366 Bacteria 553
107 Ga0070667_100000001 3300005367 Bacteria 1108638
108 Ga0070667_100004521 3300005367 Bacteria 11712
109 Ga0070667_100225186 3300005367 Bacteria 1670
110 Ga0070709_10019345 3300005434 Bacteria 3934
111 Ga0070714_100000778 3300005435 Bacteria 22615
112 Ga0070714_100127912 3300005435 Bacteria 2267
113 Ga0070713_100000028 3300005436 Bacteria 93227
114 Ga0070713_100741052 3300005436 Bacteria 940
115 Ga0070713_100797064 3300005436 Bacteria 905
116 Ga0070713_101107328 3300005436 Bacteria 765
117 Ga0070710_10000430 3300005437 Bacteria 19665
118 Ga0070710_10043307 3300005437 Bacteria 2492
119 Ga0070710_10684253 3300005437 Bacteria 722
120 Ga0070710_11052535 3300005437 Unclassified 595
121 Ga0070701_10004910 3300005438 Bacteria 5473
122 Ga0070701_10042135 3300005438 Bacteria 2329
123 Ga0070701_10088809 3300005438 Bacteria 1689
124 Ga0070711_100008240 3300005439 Bacteria 6376
125 Ga0070711_100788194 3300005439 Bacteria 805
126 Ga0070711_101624119 3300005439 Bacteria 565
127 Ga0070705_100139886 3300005440 Bacteria 1592
128 Ga0070705_100376505 3300005440 Bacteria 1043
129 Ga0070700_100022163 3300005441 Bacteria 3701
130 Ga0070700_100283345 3300005441 Bacteria 1202
131 Ga0070700_100294450 3300005441 Bacteria 1182
132 Ga0070700_101581130 3300005441 Bacteria 560
133 Ga0070700_101616892 3300005441 Bacteria 554
134 Ga0070700_101791338 3300005441 Bacteria 529
135 Ga0070694_100103515 3300005444 Bacteria 2017
136 Ga0070694_100170239 3300005444 Bacteria 1604
137 Ga0070694_100645100 3300005444 Bacteria 856
138 Ga0070708_100069490 3300005445 Bacteria 3167
139 Ga0070708_100327113 3300005445 Bacteria 1444
140 Ga0070708_101895666 3300005445 Bacteria 552
141 Ga0070663_100085826 3300005455 Bacteria 2323
142 Ga0070678_100000168 3300005456 Bacteria 28067
143 Ga0070678_100016595 3300005456 Bacteria 4716
144 Ga0070678_100032057 3300005456 Bacteria 3633
145 Ga0070678_100138031 3300005456 Bacteria 1947
146 Ga0070678_100586520 3300005456 Bacteria 994
147 Ga0070662_100268460 3300005457 Bacteria 1377
148 Ga0070681_10002189 3300005458 Bacteria 17788
149 Ga0070681_10084187 3300005458 Bacteria 3133
150 Ga0070681_10094055 3300005458 Bacteria 2946
151 Ga0070681_10419962 3300005458 Bacteria 1249
152 Ga0070681_10439726 3300005458 Bacteria 1216
153 Ga0068867_100020156 3300005459 Bacteria 4751
154 Ga0068867_100384049 3300005459 Bacteria 1180
155 Ga0068867_100415565 3300005459 Bacteria 1138
156 Ga0070685_10000188 3300005466 Bacteria 41401
157 Ga0070685_10002659 3300005466 Bacteria 9153
158 Ga0070685_10007961 3300005466 Bacteria 5432
159 Ga0070685_11496398 3300005466 Bacteria 520
160 Ga0070706_100018649 3300005467 Bacteria 6397
161 Ga0070706_100047586 3300005467 Bacteria 3957
162 Ga0070706_100250396 3300005467 Bacteria 1654
163 Ga0070706_100367139 3300005467 Bacteria 1341
164 Ga0070706_100826259 3300005467 Bacteria 857
165 Ga0070707_100025860 3300005468 Bacteria 5572
166 Ga0070707_100045940 3300005468 Bacteria 4179
167 Ga0070707_100410844 3300005468 Bacteria 1314
168 Ga0070707_101437982 3300005468 Bacteria 656
169 Ga0070698_100010119 3300005471 Bacteria 10073
170 Ga0070698_100051877 3300005471 Bacteria 4176
171 Ga0070698_101320062 3300005471 Bacteria 672
172 Ga0070698_101334219 3300005471 Bacteria 668
173 Ga0070699_100011946 3300005518 Bacteria 7495
174 Ga0070699_100043286 3300005518 Bacteria 3897
175 Ga0070699_100085613 3300005518 Bacteria 2750
176 Ga0070699_101600800 3300005518 Bacteria 597
177 Ga0070679_100003967 3300005530 Bacteria 13627
178 Ga0070679_100005719 3300005530 Bacteria 11528
179 Ga0070679_100014538 3300005530 Bacteria 7561
180 Ga0070679_100021502 3300005530 Bacteria 6299
181 Ga0070679_100023544 3300005530 Bacteria 6029
182 Ga0070679_100024441 3300005530 Bacteria 5920
183 Ga0070679_100052255 3300005530 Bacteria 4071
184 Ga0070679_100077724 3300005530 Bacteria 3308
185 Ga0070679_100083398 3300005530 Bacteria 3185
186 Ga0070679_100231961 3300005530 Unclassified 1805
187 Ga0070679_100268287 3300005530 Bacteria 1661
188 Ga0070679_100301518 3300005530 Bacteria 1553
189 Ga0070679_100771831 3300005530 Bacteria 904
190 Ga0070679_100852103 3300005530 Bacteria 855
191 Ga0070679_101122339 3300005530 Bacteria 731
192 Ga0070679_101467208 3300005530 Bacteria 629
193 Ga0070679_101557783 3300005530 Unclassified 608
194 Ga0070679_101711619 3300005530 Bacteria 577
195 Ga0070684_100001744 3300005535 Bacteria 15831
196 Ga0070684_100002149 3300005535 Bacteria 14547
197 Ga0070684_100159000 3300005535 Bacteria 2049
198 Ga0070684_100439426 3300005535 Bacteria 1205
199 Ga0070684_100907488 3300005535 Bacteria 825
200 Ga0070697_100018681 3300005536 Bacteria 5469
201 Ga0070697_100158062 3300005536 Bacteria 1914
202 Ga0070697_101089830 3300005536 Bacteria 711
203 Ga0068853_100179945 3300005539 Bacteria 1917
204 Ga0068853_100202551 3300005539 Bacteria 1806
205 Ga0068853_100447060 3300005539 Bacteria 1215
206 Ga0070672_100055954 3300005543 Bacteria 3092
207 Ga0070672_100361662 3300005543 Bacteria 1239
208 Ga0070672_101131026 3300005543 Bacteria 696
209 Ga0070672_101643846 3300005543 Bacteria 577
210 Ga0070686_100000984 3300005544 Bacteria 16449
211 Ga0070686_100018275 3300005544 Bacteria 4111
212 Ga0070686_100100808 3300005544 Bacteria 1951
213 Ga0070686_100309276 3300005544 Bacteria 1175
214 Ga0070686_100482156 3300005544 Bacteria 959
215 Ga0070695_100058601 3300005545 Bacteria 2490
216 Ga0070695_100177189 3300005545 Bacteria 1508
217 Ga0070695_101677620 3300005545 Bacteria 531
218 Ga0070696_100030255 3300005546 Bacteria 3706
219 Ga0070696_100134021 3300005546 Bacteria 1805
220 Ga0070696_100194163 3300005546 Bacteria 1512
221 Ga0070696_100717074 3300005546 Bacteria 816
222 Ga0070696_100878728 3300005546 Bacteria 742
223 Ga0070693_100025656 3300005547 Bacteria 3173
224 Ga0070693_100095941 3300005547 Bacteria 1797
225 Ga0070665_100029414 3300005548 Bacteria 5529
226 Ga0070665_100096550 3300005548 Bacteria 2960
227 Ga0070665_100171863 3300005548 Bacteria 2168
228 Ga0070665_100181226 3300005548 Bacteria 2107
229 Ga0070665_100339080 3300005548 Bacteria 1508
230 Ga0070704_100001908 3300005549 Bacteria 11506
231 Ga0070704_100011835 3300005549 Bacteria 5368
232 Ga0068855_100000003 3300005563 Bacteria 589862
233 Ga0068855_100000168 3300005563 Bacteria 83242
234 Ga0068855_100004673 3300005563 Bacteria 16726
235 Ga0068855_100020905 3300005563 Bacteria 7848
236 Ga0068855_100042627 3300005563 Bacteria 5377
237 Ga0068855_100044376 3300005563 Bacteria 5261
238 Ga0068855_100122011 3300005563 Bacteria 2982
239 Ga0068855_100631942 3300005563 Bacteria 1152
240 Ga0068855_100699930 3300005563 Bacteria 1084
241 Ga0068855_100787163 3300005563 Bacteria 1012
242 Ga0068855_101057751 3300005563 Bacteria 850
243 Ga0068855_101095095 3300005563 Bacteria 833
244 Ga0068855_101243012 3300005563 Unclassified 773
245 Ga0070664_100364069 3300005564 Bacteria 1317
246 Ga0070664_100434554 3300005564 Bacteria 1203
247 Ga0070664_100580627 3300005564 Bacteria 1038
248 Ga0068857_100000124 3300005577 Bacteria 46368
249 Ga0068857_100406048 3300005577 Bacteria 1268
250 Ga0068857_100564509 3300005577 Bacteria 1073
251 Ga0068857_100724108 3300005577 Bacteria 946
252 Ga0068857_100939564 3300005577 Bacteria 830
253 Ga0068857_101413968 3300005577 Bacteria 677
254 Ga0068854_100519470 3300005578 Bacteria 1005
255 Ga0068854_100683221 3300005578 Bacteria 884
256 Ga0068856_100000001 3300005614 Bacteria 565602
257 Ga0068856_100001486 3300005614 Bacteria 24509
258 Ga0068856_100001797 3300005614 Bacteria 22390
259 Ga0068856_100048231 3300005614 Bacteria 4196
260 Ga0068856_100229169 3300005614 Bacteria 1873
261 Ga0068856_100598667 3300005614 Bacteria 1123
262 Ga0068856_100628871 3300005614 Bacteria 1094
263 Ga0068856_101067250 3300005614 Bacteria 825
264 Ga0070702_100014621 3300005615 Bacteria 3986
265 Ga0070702_100021262 3300005615 Bacteria 3411
266 Ga0068852_100491118 3300005616 Bacteria 1221
267 Ga0068859_100006170 3300005617 Bacteria 12179
268 Ga0068859_100089269 3300005617 Bacteria 3132
269 Ga0068859_100323620 3300005617 Bacteria 1636
270 Ga0068859_100540753 3300005617 Bacteria 1260
271 Ga0068859_101600921 3300005617 Bacteria 719
272 Ga0068864_100003967 3300005618 Bacteria 12179
273 Ga0068864_100114654 3300005618 Bacteria 2403
274 Ga0068864_102673988 3300005618 Bacteria 505
275 Ga0068866_10002726 3300005718 Bacteria 7282
276 Ga0068866_10003079 3300005718 Bacteria 6876
277 Ga0068866_10100047 3300005718 Bacteria 1598
278 Ga0068861_100008199 3300005719 Bacteria 7186
279 Ga0068861_100126218 3300005719 Bacteria 2070
280 Ga0068861_100131548 3300005719 Bacteria 2031
281 Ga0068861_101025908 3300005719 Bacteria 789
282 Ga0068851_10156813 3300005834 Bacteria 1248
283 Ga0068870_10009891 3300005840 Bacteria 4355
284 Ga0068870_10078377 3300005840 Bacteria 1820
285 Ga0068870_10111576 3300005840 Bacteria 1562
286 Ga0068863_100002985 3300005841 Bacteria 16732
287 Ga0068863_100022347 3300005841 Bacteria 6040
288 Ga0068863_100046276 3300005841 Bacteria 4129
289 Ga0068863_100102476 3300005841 Bacteria 2722
290 Ga0068863_100612467 3300005841 Unclassified 1078
291 Ga0068863_100820175 3300005841 Unclassified 928
292 Ga0068858_100013226 3300005842 Bacteria 7776
293 Ga0068858_100014524 3300005842 Bacteria 7419
294 Ga0068858_100017672 3300005842 Bacteria 6684
295 Ga0068860_100019846 3300005843 Bacteria 6518
296 Ga0068860_100111708 3300005843 Bacteria 2613
297 Ga0068860_100233894 3300005843 Bacteria 1786
298 Ga0068860_100299450 3300005843 Bacteria 1575
299 Ga0068860_100488011 3300005843 Bacteria 1228
300 Ga0068860_101077953 3300005843 Bacteria 822
301 Ga0068860_101098337 3300005843 Bacteria 815
302 Ga0068860_101153711 3300005843 Bacteria 795
303 Ga0068862_100015629 3300005844 Bacteria 6304
304 Ga0068862_100142453 3300005844 Bacteria 2129
305 Ga0068862_102596470 3300005844 Bacteria 518
306 Ga0081455_10000003 3300005937 Bacteria 367763
307 Ga0081539_10001876 3300005985 Bacteria 32944
308 Ga0070717_10062928 3300006028 Bacteria 3078
309 Ga0070717_11107508 3300006028 Bacteria 721
310 Ga0075365_10000658 3300006038 Bacteria 13797
311 Ga0075365_10013015 3300006038 Bacteria 4962
312 Ga0075365_10055135 3300006038 Bacteria 2638
313 Ga0075365_10056400 3300006038 Bacteria 2611
314 Ga0075365_10332614 3300006038 Bacteria 1070
315 Ga0075365_10452922 3300006038 Bacteria 906
316 Ga0075368_10000103 3300006042 Bacteria 21865
317 Ga0075363_100000006 3300006048 Bacteria 47292
318 Ga0075363_100031526 3300006048 Bacteria 2749
319 Ga0075364_10000255 3300006051 Bacteria 25673
320 Ga0075364_10000985 3300006051 Bacteria 15065
321 Ga0075364_10005139 3300006051 Bacteria 7588
322 Ga0075364_10008153 3300006051 Bacteria 6252
323 Ga0075364_10008868 3300006051 Bacteria 6021
324 Ga0075364_10056142 3300006051 Bacteria 2578
325 Ga0075364_10117401 3300006051 Bacteria 1779
326 Ga0075364_11172525 3300006051 Unclassified 521
327 Ga0075432_10098869 3300006058 Bacteria 1076
328 Ga0070715_10201379 3300006163 Bacteria 1012
329 Ga0070716_100014982 3300006173 Bacteria 3978
330 Ga0070716_100148286 3300006173 Bacteria 1506
331 Ga0070712_100296952 3300006175 Bacteria 1306
332 Ga0070712_100645686 3300006175 Bacteria 899
333 Ga0070712_101990388 3300006175 Bacteria 509
334 Ga0075362_10000049 3300006177 Bacteria 39227
335 Ga0075362_10023272 3300006177 Bacteria 2619
336 Ga0075367_10000021 3300006178 Bacteria 33969
337 Ga0075367_10017509 3300006178 Bacteria 3934
338 Ga0075367_10749599 3300006178 Bacteria 621
339 Ga0075369_10000003 3300006186 Bacteria 205269
340 Ga0075369_10000057 3300006186 Bacteria 28832
341 Ga0075369_10077510 3300006186 Unclassified 1470
342 Ga0075369_10128549 3300006186 Bacteria 1150
343 Ga0075366_10000001 3300006195 Bacteria 569172
344 Ga0075366_10000065 3300006195 Bacteria 39633
345 Ga0075366_10000147 3300006195 Bacteria 29801
346 Ga0075366_10001116 3300006195 Bacteria 13216
347 Ga0075366_10026067 3300006195 Bacteria 3421
348 Ga0075366_10027187 3300006195 Bacteria 3356
349 Ga0075366_10174399 3300006195 Bacteria 1305
350 Ga0075366_10214500 3300006195 Bacteria 1172
351 Ga0097621_100006235 3300006237 Bacteria 8460
352 Ga0097621_100062852 3300006237 Bacteria 3050
353 Ga0097621_100107511 3300006237 Bacteria 2354
354 Ga0097621_100154914 3300006237 Bacteria 1966
355 Ga0097621_100548254 3300006237 Bacteria 1052
356 Ga0075370_10006085 3300006353 Bacteria 6048
357 Ga0075370_10116654 3300006353 Bacteria 1552
358 Ga0075370_10606716 3300006353 Unclassified 663
359 Ga0075370_10714798 3300006353 Unclassified 609
360 Ga0068871_100003989 3300006358 Bacteria 10207
361 Ga0068871_100038968 3300006358 Bacteria 3800
362 Ga0075428_100003149 3300006844 Bacteria 18020
363 Ga0075430_100046838 3300006846 Bacteria 3651
364 Ga0075430_100055797 3300006846 Bacteria 3322
365 Ga0075431_101175299 3300006847 Bacteria 730
366 Ga0075433_10024313 3300006852 Bacteria 5111
367 Ga0075433_10288718 3300006852 Bacteria 1453
368 Ga0075434_100015561 3300006871 Bacteria 7300
369 Ga0075434_100194623 3300006871 Bacteria 2048
370 Ga0075434_100316589 3300006871 Bacteria 1581
371 Ga0075434_101519547 3300006871 Bacteria 679
372 Ga0068865_100005809 3300006881 Bacteria 7502
373 Ga0068865_100028985 3300006881 Bacteria 3668
374 Ga0068865_100394857 3300006881 Bacteria 1131
375 Ga0075436_100048771 3300006914 Bacteria 2922
376 Ga0075436_100164914 3300006914 Bacteria 1563
377 Ga0075436_100268172 3300006914 Bacteria 1219
378 Ga0097620_100006169 3300006931 Bacteria 12179
379 Ga0097620_100089272 3300006931 Bacteria 3132
380 Ga0097620_100323614 3300006931 Bacteria 1636
381 Ga0097620_100540784 3300006931 Bacteria 1260
382 Ga0097620_101600051 3300006931 Bacteria 719
383 Ga0075435_100050036 3300007076 Bacteria 3362
384 Ga0075435_100336262 3300007076 Bacteria 1294
385 Ga0075435_100368822 3300007076 Bacteria 1232
386 Ga0075435_101706836 3300007076 Bacteria 553
387 Ga0099794_10238362 3300007265 Bacteria 937
388 Ga0099794_10416593 3300007265 Bacteria 702
389 Ga0105240_10000003 3300009093 Bacteria 1183681
390 Ga0105240_10034455 3300009093 Bacteria 6530
391 Ga0105240_10040725 3300009093 Bacteria 5938
392 Ga0105240_10302319 3300009093 Bacteria 1830
393 Ga0105240_10312692 3300009093 Bacteria 1793
394 Ga0105240_10482858 3300009093 Bacteria 1381
395 Ga0111539_10027480 3300009094 Bacteria 6949
396 Ga0111539_11877758 3300009094 Bacteria 695
397 Ga0105245_10000001 3300009098 Bacteria 939270
398 Ga0105245_10004395 3300009098 Bacteria 12469
399 Ga0105245_10004821 3300009098 Bacteria 11893
400 Ga0105245_10010103 3300009098 Bacteria 8220
401 Ga0105245_10060520 3300009098 Bacteria 3410
402 Ga0105245_10351023 3300009098 Bacteria 1462
403 Ga0105245_10394322 3300009098 Bacteria 1382
404 Ga0105245_10462980 3300009098 Bacteria 1278
405 Ga0105245_11705662 3300009098 Bacteria 682
406 Ga0105247_10063726 3300009101 Bacteria 2289
407 Ga0114129_10070335 3300009147 Bacteria 4880
408 Ga0105243_10000001 3300009148 Bacteria 1156578
409 Ga0105243_10008999 3300009148 Bacteria 7631
410 Ga0105243_10010600 3300009148 Bacteria 6997
411 Ga0105243_10226682 3300009148 Bacteria 1655
412 Ga0105243_10493181 3300009148 Bacteria 1159
413 Ga0105243_10541819 3300009148 Bacteria 1110
414 Ga0105243_11060138 3300009148 Bacteria 817
415 Ga0105241_10000003 3300009174 Bacteria 839043
416 Ga0105241_10011078 3300009174 Bacteria 6617
417 Ga0105241_10188510 3300009174 Bacteria 1715
418 Ga0105241_10610663 3300009174 Bacteria 986
419 Ga0105241_11032330 3300009174 Bacteria 771
420 Ga0105241_11235668 3300009174 Unclassified 709
421 Ga0105241_12027947 3300009174 Bacteria 567
422 Ga0105241_12382610 3300009174 Bacteria 528
423 Ga0105241_12643660 3300009174 Unclassified 505
424 Ga0105242_10000011 3300009176 Bacteria 149791
425 Ga0105242_10007562 3300009176 Bacteria 8364
426 Ga0105242_10009973 3300009176 Bacteria 7273
427 Ga0105242_10013678 3300009176 Bacteria 6277
428 Ga0105242_10298770 3300009176 Bacteria 1469
429 Ga0105242_10565124 3300009176 Bacteria 1093
430 Ga0105242_11337195 3300009176 Bacteria 742
431 Ga0105242_12562015 3300009176 Bacteria 559
432 Ga0105248_10010314 3300009177 Bacteria 10284
433 Ga0105248_10094322 3300009177 Bacteria 3370
434 Ga0105248_10113808 3300009177 Bacteria 3051
435 Ga0105248_10167563 3300009177 Bacteria 2476
436 Ga0105248_11675979 3300009177 Bacteria 721
437 Ga0105237_10472790 3300009545 Bacteria 1259
438 Ga0105237_10631440 3300009545 Bacteria 1078
439 Ga0105237_10828063 3300009545 Bacteria 932
440 Ga0105237_11326470 3300009545 Bacteria 726
441 Ga0105237_11420833 3300009545 Bacteria 700
442 Ga0105237_11574530 3300009545 Bacteria 664
443 Ga0105237_11592915 3300009545 Bacteria 660
444 Ga0105237_11706766 3300009545 Bacteria 637
445 Ga0105238_10000579 3300009551 Bacteria 38459
446 Ga0105238_10124575 3300009551 Bacteria 2556
447 Ga0105238_10231710 3300009551 Bacteria 1823
448 Ga0105238_10237507 3300009551 Bacteria 1800
449 Ga0105238_11236590 3300009551 Bacteria 772
450 Ga0105238_11326845 3300009551 Bacteria 746
451 Ga0105238_12020090 3300009551 Bacteria 610
452 Ga0105238_12305224 3300009551 Bacteria 573
453 Ga0105238_12309822 3300009551 Unclassified 573
454 Ga0105238_12338051 3300009551 Bacteria 570
455 Ga0105238_12453133 3300009551 Bacteria 557
456 Ga0105249_10002379 3300009553 Bacteria 16319
457 Ga0105249_10256697 3300009553 Bacteria 1735
458 Ga0105249_10432368 3300009553 Bacteria 1352
459 Ga0105249_10759437 3300009553 Bacteria 1032
460 Ga0105249_13073428 3300009553 Bacteria 536
461 Ga0105033_105305 3300009986 Bacteria 1107
462 Ga0105033_119600 3300009986 Bacteria 614
463 Ga0105030_102571 3300009987 Bacteria 1574
464 Ga0105028_100084 3300009993 Bacteria 9852
465 Ga0105239_10032725 3300010375 Bacteria 5713
466 Ga0105239_10075342 3300010375 Bacteria 3710
467 Ga0105239_10138559 3300010375 Bacteria 2710
468 Ga0105239_10482126 3300010375 Bacteria 1409
469 Ga0105239_10959267 3300010375 Bacteria 982
470 Ga0105239_11707210 3300010375 Bacteria 729
471 Ga0105239_12338703 3300010375 Bacteria 622
472 Ga0105239_13146168 3300010375 Bacteria 538
473 Ga0105246_10153679 3300011119 Bacteria 1745
474 Ga0105246_10496388 3300011119 Bacteria 1036
475 Ga0105246_10497338 3300011119 Bacteria 1035
476 Ga0157373_10000583 3300013100 Bacteria 28402
477 Ga0157373_10085939 3300013100 Bacteria 2217
478 Ga0157373_10264006 3300013100 Bacteria 1218
479 Ga0157373_10300554 3300013100 Bacteria 1139
480 Ga0157373_11353663 3300013100 Bacteria 540
481 Ga0157371_10000176 3300013102 Bacteria 93047
482 Ga0157371_10204330 3300013102 Bacteria 1417
483 Ga0157371_10350013 3300013102 Bacteria 1075
484 Ga0157370_10022524 3300013104 Bacteria 6268
485 Ga0157370_10126444 3300013104 Bacteria 2386
486 Ga0157370_10253314 3300013104 Bacteria 1628
487 Ga0157370_11103071 3300013104 Bacteria 717
488 Ga0157370_11159277 3300013104 Bacteria 698
489 Ga0157369_10003258 3300013105 Bacteria 19325
490 Ga0157369_10059996 3300013105 Bacteria 4103
491 Ga0157369_10066496 3300013105 Bacteria 3877
492 Ga0157369_10138227 3300013105 Bacteria 2579
493 Ga0157369_10290843 3300013105 Bacteria 1701
494 Ga0157369_11133067 3300013105 Bacteria 799
495 Ga0157374_10000565 3300013296 Bacteria 32833
496 Ga0157374_10001076 3300013296 Bacteria 23646
497 Ga0157374_10001882 3300013296 Bacteria 17636
498 Ga0157374_10025334 3300013296 Bacteria 5324
499 Ga0157374_10044228 3300013296 Bacteria 4116
500 Ga0157374_10129323 3300013296 Bacteria 2443
501 Ga0157374_10157731 3300013296 Bacteria 2209
502 Ga0157374_10594354 3300013296 Bacteria 1116
503 Ga0157374_10604295 3300013296 Bacteria 1107
504 Ga0157374_11083976 3300013296 Bacteria 821
505 Ga0157374_11918021 3300013296 Bacteria 618
506 Ga0157378_10010736 3300013297 Bacteria 8006
507 Ga0157378_10021639 3300013297 Bacteria 5655
508 Ga0157378_10058507 3300013297 Bacteria 3437
509 Ga0157378_10165606 3300013297 Bacteria 2070
510 Ga0157378_10214933 3300013297 Bacteria 1825
511 Ga0157378_10374383 3300013297 Bacteria 1397
512 Ga0157378_11384493 3300013297 Bacteria 746
513 Ga0157378_11860215 3300013297 Bacteria 651
514 Ga0163162_10060008 3300013306 Bacteria 3837
515 Ga0163162_10684810 3300013306 Bacteria 1148
516 Ga0163162_11437546 3300013306 Bacteria 785
517 Ga0157372_10000670 3300013307 Bacteria 37704
518 Ga0157372_10002726 3300013307 Bacteria 19106
519 Ga0157372_10687980 3300013307 Bacteria 1190
520 Ga0157372_11086663 3300013307 Bacteria 926
521 Ga0157372_11135780 3300013307 Unclassified 904
522 Ga0157375_10039139 3300013308 Bacteria 4560
523 Ga0157375_10042447 3300013308 Bacteria 4402
524 Ga0157375_10237882 3300013308 Bacteria 1980
525 Ga0157375_10287657 3300013308 Bacteria 1807
526 Ga0157375_11211781 3300013308 Bacteria 886
527 Ga0157514_121480 3300013874 Bacteria 989
528 Ga0163163_10000689 3300014325 Bacteria 28712
529 Ga0163163_10317037 3300014325 Bacteria 1613
530 Ga0163163_10417887 3300014325 Bacteria 1400
531 Ga0163163_12431835 3300014325 Unclassified 582
532 Ga0157380_10117219 3300014326 Bacteria 2249
533 Ga0157380_10198410 3300014326 Bacteria 1778
534 Ga0157380_13064895 3300014326 Unclassified 533
535 Ga0157377_10015248 3300014745 Bacteria 3927
536 Ga0157377_10056857 3300014745 Bacteria 2223
537 Ga0157377_11591526 3300014745 Bacteria 523
538 Ga0157379_10029119 3300014968 Bacteria 4912
539 Ga0157379_10030185 3300014968 Bacteria 4823
540 Ga0157379_10062576 3300014968 Bacteria 3328
541 Ga0157379_10103915 3300014968 Bacteria 2549
542 Ga0157379_12271110 3300014968 Bacteria 540
543 Ga0157376_10000001 3300014969 Bacteria 842910
544 Ga0157376_10110927 3300014969 Bacteria 2414
545 Ga0157376_10673519 3300014969 Bacteria 1037
546 Ga0157376_10874119 3300014969 Bacteria 916
547 Ga0157376_11657185 3300014969 Bacteria 674
548 Ga0157376_12791261 3300014969 Bacteria 528
549 Ga0163161_10121656 3300017792 Bacteria 1962
550 Ga0163161_10504241 3300017792 Bacteria 986
551 Ga0206355_1195425 3300020076 Bacteria 670
552 Ga0206355_1665954 3300020076 Bacteria 537
553 Ga0206353_10244075 3300020082 Bacteria 827
554 Ga0206353_10922718 3300020082 Bacteria 1860
555 Ga0154015_1346800 3300020610 Bacteria 930
556 Ga0213872_10001745 3300021361 Bacteria 13647
557 Ga0213875_10151352 3300021388 Bacteria 1087
558 Ga0207656_10172742 3300025321 Bacteria 1034
559 Ga0207682_10153778 3300025893 Bacteria 1039
560 Ga0207692_10000677 3300025898 Bacteria 12030
561 Ga0207692_10474147 3300025898 Bacteria 791
562 Ga0207692_11037077 3300025898 Bacteria 542
563 Ga0207642_10011396 3300025899 Bacteria 3170
564 Ga0207642_10068490 3300025899 Bacteria 1679
565 Ga0207710_10123466 3300025900 Bacteria 1238
566 Ga0207680_10010180 3300025903 Bacteria 4694
567 Ga0207680_10372310 3300025903 Bacteria 1006
568 Ga0207680_10435656 3300025903 Bacteria 929
569 Ga0207680_10870306 3300025903 Unclassified 646
570 Ga0207680_11122379 3300025903 Bacteria 562
571 Ga0207647_10008577 3300025904 Bacteria 7315
572 Ga0207647_10625569 3300025904 Bacteria 592
573 Ga0207685_10022094 3300025905 Bacteria 2144
574 Ga0207699_10042494 3300025906 Bacteria 2634
575 Ga0207699_10432796 3300025906 Bacteria 941
576 Ga0207645_10005044 3300025907 Bacteria 9671
577 Ga0207645_10143075 3300025907 Bacteria 1559
578 Ga0207645_10282193 3300025907 Bacteria 1103
579 Ga0207643_10014781 3300025908 Bacteria 4245
580 Ga0207643_10022628 3300025908 Bacteria 3462
581 Ga0207643_10856592 3300025908 Bacteria 589
582 Ga0207705_10000011 3300025909 Bacteria 517768
583 Ga0207705_10000038 3300025909 Bacteria 193812
584 Ga0207705_10000167 3300025909 Bacteria 71284
585 Ga0207705_10006171 3300025909 Bacteria 8914
586 Ga0207705_10007444 3300025909 Bacteria 8051
587 Ga0207705_10019143 3300025909 Bacteria 4897
588 Ga0207705_10525686 3300025909 Bacteria 919
589 Ga0207684_10046614 3300025910 Bacteria 3677
590 Ga0207684_10209286 3300025910 Bacteria 1682
591 Ga0207684_10568375 3300025910 Bacteria 969
592 Ga0207654_10000002 3300025911 Bacteria 1460142
593 Ga0207654_10053235 3300025911 Bacteria 2336
594 Ga0207654_10116489 3300025911 Bacteria 1671
595 Ga0207654_10711922 3300025911 Bacteria 722
596 Ga0207654_10949269 3300025911 Bacteria 624
597 Ga0207707_10003287 3300025912 Bacteria 14366
598 Ga0207707_10072140 3300025912 Bacteria 3010
599 Ga0207707_10144644 3300025912 Bacteria 2078
600 Ga0207707_10227503 3300025912 Bacteria 1623
601 Ga0207707_10306010 3300025912 Bacteria 1374
602 Ga0207707_10690226 3300025912 Bacteria 858
603 Ga0207695_10000005 3300025913 Bacteria 1196715
604 Ga0207695_10051029 3300025913 Bacteria 4346
605 Ga0207695_10096000 3300025913 Bacteria 2967
606 Ga0207695_10209706 3300025913 Bacteria 1859
607 Ga0207695_10223098 3300025913 Bacteria 1791
608 Ga0207695_10731065 3300025913 Bacteria 870
609 Ga0207671_10066252 3300025914 Bacteria 2688
610 Ga0207671_10274153 3300025914 Bacteria 1330
611 Ga0207671_10583590 3300025914 Bacteria 891
612 Ga0207671_10884974 3300025914 Unclassified 706
613 Ga0207671_11603295 3300025914 Unclassified 500
614 Ga0207693_10292792 3300025915 Bacteria 1276
615 Ga0207693_10293235 3300025915 Bacteria 1275
616 Ga0207693_11302437 3300025915 Bacteria 543
617 Ga0207663_10024879 3300025916 Bacteria 3453
618 Ga0207663_10540116 3300025916 Bacteria 910
619 Ga0207660_10000748 3300025917 Bacteria 21610
620 Ga0207660_10031712 3300025917 Bacteria 3643
621 Ga0207660_10143092 3300025917 Bacteria 1830
622 Ga0207660_10807668 3300025917 Bacteria 765
623 Ga0207660_11128405 3300025917 Unclassified 639
624 Ga0207660_11520174 3300025917 Bacteria 541
625 Ga0207660_11522996 3300025917 Bacteria 540
626 Ga0207662_10183113 3300025918 Bacteria 1349
627 Ga0207662_10415489 3300025918 Bacteria 914
628 Ga0207662_10657989 3300025918 Bacteria 732
629 Ga0207662_10748147 3300025918 Bacteria 687
630 Ga0207662_11342533 3300025918 Bacteria 508
631 Ga0207662_11376819 3300025918 Bacteria 501
632 Ga0207657_10000280 3300025919 Bacteria 54274
633 Ga0207657_10000804 3300025919 Bacteria 33189
634 Ga0207657_10006928 3300025919 Bacteria 11684
635 Ga0207657_10016230 3300025919 Bacteria 7187
636 Ga0207657_10488203 3300025919 Bacteria 965
637 Ga0207649_10576597 3300025920 Bacteria 863
638 Ga0207649_10950836 3300025920 Unclassified 675
639 Ga0207649_11197753 3300025920 Bacteria 600
640 Ga0207652_10007578 3300025921 Bacteria 8740
641 Ga0207652_10008454 3300025921 Bacteria 8282
642 Ga0207652_10013911 3300025921 Bacteria 6514
643 Ga0207652_10017326 3300025921 Bacteria 5895
644 Ga0207652_10047579 3300025921 Bacteria 3664
645 Ga0207652_10056559 3300025921 Bacteria 3377
646 Ga0207652_10130422 3300025921 Bacteria 2242
647 Ga0207652_10194495 3300025921 Bacteria 1824
648 Ga0207652_10296884 3300025921 Bacteria 1458
649 Ga0207652_10968734 3300025921 Bacteria 749
650 Ga0207652_10979782 3300025921 Bacteria 744
651 Ga0207652_10997420 3300025921 Bacteria 736
652 Ga0207652_10998260 3300025921 Bacteria 736
653 Ga0207652_11136868 3300025921 Bacteria 682
654 Ga0207646_10004914 3300025922 Bacteria 14301
655 Ga0207646_10188618 3300025922 Bacteria 1862
656 Ga0207646_10298443 3300025922 Bacteria 1456
657 Ga0207646_10543196 3300025922 Bacteria 1045
658 Ga0207681_10044851 3300025923 Bacteria 2965
659 Ga0207681_11525745 3300025923 Bacteria 560
660 Ga0207694_10000232 3300025924 Bacteria 53672
661 Ga0207694_10297488 3300025924 Bacteria 1328
662 Ga0207694_10369919 3300025924 Bacteria 1189
663 Ga0207694_10471729 3300025924 Bacteria 1049
664 Ga0207694_10905252 3300025924 Bacteria 746
665 Ga0207694_11515029 3300025924 Bacteria 566
666 Ga0207650_10051370 3300025925 Bacteria 3051
667 Ga0207650_10183495 3300025925 Bacteria 1669
668 Ga0207659_10154532 3300025926 Bacteria 1795
669 Ga0207659_10369763 3300025926 Bacteria 1193
670 Ga0207659_10400232 3300025926 Bacteria 1148
671 Ga0207687_10000030 3300025927 Bacteria 155548
672 Ga0207687_10000318 3300025927 Bacteria 32809
673 Ga0207687_10008644 3300025927 Bacteria 6655
674 Ga0207687_10015188 3300025927 Bacteria 5046
675 Ga0207687_10026767 3300025927 Bacteria 3864
676 Ga0207687_10257708 3300025927 Bacteria 1389
677 Ga0207687_10343208 3300025927 Bacteria 1215
678 Ga0207687_10985624 3300025927 Bacteria 723
679 Ga0207700_10000077 3300025928 Bacteria 60197
680 Ga0207700_10003616 3300025928 Bacteria 9010
681 Ga0207700_10905879 3300025928 Bacteria 789
682 Ga0207664_10003229 3300025929 Bacteria 10836
683 Ga0207664_10014803 3300025929 Bacteria 5646
684 Ga0207644_10000001 3300025931 Bacteria 1243214
685 Ga0207644_10003510 3300025931 Bacteria 10149
686 Ga0207644_10020573 3300025931 Bacteria 4488
687 Ga0207644_10106804 3300025931 Bacteria 2111
688 Ga0207644_10564013 3300025931 Bacteria 943
689 Ga0207690_10000521 3300025932 Bacteria 24993
690 Ga0207690_10163984 3300025932 Bacteria 1659
691 Ga0207690_10226334 3300025932 Bacteria 1434
692 Ga0207706_10068780 3300025933 Bacteria 3115
693 Ga0207686_10000001 3300025934 Bacteria 1169580
694 Ga0207686_10000521 3300025934 Bacteria 24900
695 Ga0207686_10005025 3300025934 Bacteria 7120
696 Ga0207686_10015693 3300025934 Bacteria 4240
697 Ga0207686_10088578 3300025934 Bacteria 2038
698 Ga0207686_10188335 3300025934 Bacteria 1469
699 Ga0207709_10000002 3300025935 Bacteria 1171536
700 Ga0207709_10006627 3300025935 Bacteria 6498
701 Ga0207709_10008424 3300025935 Bacteria 5703
702 Ga0207709_10256442 3300025935 Bacteria 1280
703 Ga0207709_11293062 3300025935 Bacteria 603
704 Ga0207670_10035982 3300025936 Bacteria 3216
705 Ga0207670_10657956 3300025936 Bacteria 864
706 Ga0207670_11367464 3300025936 Bacteria 601
707 Ga0207669_10027599 3300025937 Bacteria 3111
708 Ga0207669_10040466 3300025937 Bacteria 2704
709 Ga0207669_10142350 3300025937 Bacteria 1667
710 Ga0207704_10018134 3300025938 Bacteria 3667
711 Ga0207704_10390402 3300025938 Bacteria 1095
712 Ga0207704_11968198 3300025938 Unclassified 503
713 Ga0207665_10133250 3300025939 Bacteria 1766
714 Ga0207665_10163137 3300025939 Bacteria 1604
715 Ga0207665_10168544 3300025939 Bacteria 1580
716 Ga0207691_10054461 3300025940 Bacteria 3648
717 Ga0207691_10126313 3300025940 Bacteria 2263
718 Ga0207691_11229119 3300025940 Bacteria 620
719 Ga0207711_10007779 3300025941 Bacteria 8957
720 Ga0207711_10028146 3300025941 Bacteria 4727
721 Ga0207711_10112488 3300025941 Bacteria 2423
722 Ga0207711_10230905 3300025941 Bacteria 1694
723 Ga0207711_11305411 3300025941 Bacteria 668
724 Ga0207689_10000292 3300025942 Bacteria 45545
725 Ga0207689_10000370 3300025942 Bacteria 42422
726 Ga0207689_10017314 3300025942 Bacteria 6099
727 Ga0207689_10371921 3300025942 Bacteria 1189
728 Ga0207661_10000021 3300025944 Bacteria 205381
729 Ga0207661_10002824 3300025944 Bacteria 11992
730 Ga0207661_10084193 3300025944 Bacteria 2633
731 Ga0207661_10159071 3300025944 Bacteria 1959
732 Ga0207661_10253160 3300025944 Bacteria 1566
733 Ga0207661_10441959 3300025944 Unclassified 1184
734 Ga0207661_10854015 3300025944 Bacteria 838
735 Ga0207661_11104487 3300025944 Bacteria 730
736 Ga0207661_11995849 3300025944 Unclassified 526
737 Ga0207679_10303101 3300025945 Bacteria 1378
738 Ga0207679_10447699 3300025945 Bacteria 1145
739 Ga0207679_10876936 3300025945 Bacteria 820
740 Ga0207667_10000008 3300025949 Bacteria 625138
741 Ga0207667_10000299 3300025949 Bacteria 68595
742 Ga0207667_10000339 3300025949 Bacteria 64087
743 Ga0207667_10023417 3300025949 Bacteria 6800
744 Ga0207667_10087215 3300025949 Bacteria 3229
745 Ga0207667_10431219 3300025949 Bacteria 1341
746 Ga0207667_10631152 3300025949 Bacteria 1078
747 Ga0207667_10649009 3300025949 Bacteria 1061
748 Ga0207667_10740028 3300025949 Bacteria 983
749 Ga0207667_11287606 3300025949 Unclassified 708
750 Ga0207667_11305912 3300025949 Bacteria 702
751 Ga0207667_11369619 3300025949 Bacteria 682
752 Ga0207651_10000203 3300025960 Bacteria 25844
753 Ga0207651_10038713 3300025960 Bacteria 3136
754 Ga0207651_10054318 3300025960 Bacteria 2744
755 Ga0207712_10001459 3300025961 Bacteria 16136
756 Ga0207712_10015338 3300025961 Bacteria 4940
757 Ga0207712_10280366 3300025961 Bacteria 1360
758 Ga0207712_11950706 3300025961 Bacteria 526
759 Ga0207668_10621333 3300025972 Bacteria 943
760 Ga0207640_10609573 3300025981 Bacteria 925
761 Ga0207640_11690498 3300025981 Bacteria 571
762 Ga0207658_10000003 3300025986 Bacteria 1151934
763 Ga0207658_10002651 3300025986 Bacteria 12966
764 Ga0207658_11081093 3300025986 Bacteria 732
765 Ga0207658_11510997 3300025986 Bacteria 614
766 Ga0207677_10001880 3300026023 Bacteria 11094
767 Ga0207677_12129978 3300026023 Bacteria 522
768 Ga0207703_10000517 3300026035 Bacteria 39928
769 Ga0207703_10043986 3300026035 Bacteria 3587
770 Ga0207703_10283662 3300026035 Bacteria 1505
771 Ga0207703_11786449 3300026035 Unclassified 591
772 Ga0207639_10502283 3300026041 Bacteria 1108
773 Ga0207639_11190245 3300026041 Bacteria 715
774 Ga0207639_11677116 3300026041 Bacteria 596
775 Ga0207639_11891464 3300026041 Unclassified 558
776 Ga0207678_10049262 3300026067 Bacteria 3641
777 Ga0207678_10171922 3300026067 Bacteria 1850
778 Ga0207708_10004151 3300026075 Bacteria 10655
779 Ga0207708_10109455 3300026075 Bacteria 2144
780 Ga0207702_10000001 3300026078 Bacteria 895738
781 Ga0207702_10001268 3300026078 Bacteria 25374
782 Ga0207702_10003219 3300026078 Bacteria 15080
783 Ga0207702_10023468 3300026078 Bacteria 5117
784 Ga0207702_10184378 3300026078 Bacteria 1924
785 Ga0207702_10213107 3300026078 Bacteria 1797
786 Ga0207702_10402809 3300026078 Bacteria 1320
787 Ga0207702_10644031 3300026078 Bacteria 1042
788 Ga0207702_11003924 3300026078 Bacteria 828
789 Ga0207702_11058965 3300026078 Bacteria 805
790 Ga0207641_10002453 3300026088 Bacteria 17140
791 Ga0207641_10016989 3300026088 Bacteria 5958
792 Ga0207641_10074503 3300026088 Bacteria 2928
793 Ga0207641_10080247 3300026088 Bacteria 2830
794 Ga0207641_11243983 3300026088 Bacteria 744
795 Ga0207648_10055064 3300026089 Bacteria 3473
796 Ga0207648_10063803 3300026089 Bacteria 3210
797 Ga0207648_10067573 3300026089 Bacteria 3116
798 Ga0207648_10190278 3300026089 Bacteria 1818
799 Ga0207648_10390358 3300026089 Bacteria 1260
800 Ga0207648_10415731 3300026089 Bacteria 1220
801 Ga0207676_10000167 3300026095 Bacteria 57507
802 Ga0207674_10000001 3300026116 Bacteria 616581
803 Ga0207674_10005648 3300026116 Bacteria 14829
804 Ga0207674_10513650 3300026116 Bacteria 1157
805 Ga0207674_10928517 3300026116 Bacteria 839
806 Ga0207674_11454072 3300026116 Bacteria 655
807 Ga0207674_12144067 3300026116 Unclassified 522
808 Ga0207674_12162519 3300026116 Bacteria 520
809 Ga0207674_12293146 3300026116 Bacteria 502
810 Ga0207675_100013573 3300026118 Bacteria 7605
811 Ga0207675_100059255 3300026118 Bacteria 3573
812 Ga0207675_100204893 3300026118 Bacteria 1895
813 Ga0207675_100848329 3300026118 Bacteria 928
814 Ga0207675_100955207 3300026118 Bacteria 875
815 Ga0207675_102023718 3300026118 Bacteria 593
816 Ga0207683_10000965 3300026121 Bacteria 26325
817 Ga0207683_10002331 3300026121 Bacteria 16657
818 Ga0207683_10041485 3300026121 Bacteria 4018
819 Ga0207683_10046413 3300026121 Bacteria 3801
820 Ga0207683_10375895 3300026121 Bacteria 1306
821 Ga0207698_10233471 3300026142 Bacteria 1671
822 Ga0207698_10657098 3300026142 Bacteria 1039
823 Ga0207698_11663835 3300026142 Bacteria 654
824 Ga0209998_10096500 3300027717 Bacteria 729
825 Ga0209813_10000009 3300027866 Bacteria 102315
826 Ga0207428_10396859 3300027907 Bacteria 1010
827 Ga0268266_10003734 3300028379 Bacteria 14969
828 Ga0268266_10034899 3300028379 Bacteria 4278
829 Ga0268266_10103455 3300028379 Bacteria 2513
830 Ga0268266_10313573 3300028379 Bacteria 1466
831 Ga0268266_10659292 3300028379 Bacteria 1007
832 Ga0268265_10188685 3300028380 Bacteria 1778
833 Ga0268265_10220988 3300028380 Bacteria 1657
834 Ga0268264_10044828 3300028381 Bacteria 3670
835 Ga0268264_10103423 3300028381 Bacteria 2480
836 Ga0268264_10121832 3300028381 Bacteria 2299
837 Ga0268264_10144907 3300028381 Bacteria 2122
838 Ga0268264_10305734 3300028381 Bacteria 1498
839 Ga0268264_11483023 3300028381 Bacteria 689
840 Ga0268264_11655216 3300028381 Unclassified 650
841 Ga0268264_11988178 3300028381 Bacteria 591
842 Ga0268264_12700054 3300028381 Bacteria 500
843 Ga0265337_1000001 3300028556 Bacteria 140973
844 Ga0265337_1058922 3300028556 Bacteria 1066
845 Ga0265337_1065250 3300028556 Bacteria 1004
846 Ga0265337_1071695 3300028556 Unclassified 951
847 Ga0265326_10005024 3300028558 Bacteria 4190
848 Ga0265326_10018388 3300028558 Bacteria 2012
849 Ga0265326_10071393 3300028558 Bacteria 981
850 Ga0265319_1179800 3300028563 Bacteria 652
851 Ga0265334_10000049 3300028573 Bacteria 89091
852 Ga0265334_10000114 3300028573 Bacteria 52821
853 Ga0265334_10046542 3300028573 Unclassified 1676
854 Ga0265334_10115392 3300028573 Bacteria 962
855 Ga0265334_10127792 3300028573 Bacteria 906
856 Ga0265318_10111693 3300028577 Bacteria 1005
857 Ga0265322_10009918 3300028654 Bacteria 2762
858 Ga0265322_10038325 3300028654 Bacteria 1364
859 Ga0265322_10123932 3300028654 Bacteria 736
860 Ga0265336_10000618 3300028666 Bacteria 19547
861 Ga0265336_10135916 3300028666 Unclassified 731
862 Ga0265336_10171602 3300028666 Bacteria 645
863 Ga0307515_10370836 3300028794 Bacteria 1068
864 Ga0265338_10000003 3300028800 Bacteria 733923
865 Ga0265338_10000052 3300028800 Bacteria 209239
866 Ga0265338_10000054 3300028800 Bacteria 207383
867 Ga0265338_10000217 3300028800 Bacteria 106453
868 Ga0265338_10000366 3300028800 Bacteria 81024
869 Ga0265338_10000543 3300028800 Bacteria 66162
870 Ga0265338_10003025 3300028800 Bacteria 24237
871 Ga0265338_10009585 3300028800 Bacteria 11511
872 Ga0265338_10017457 3300028800 Bacteria 7732
873 Ga0265338_10035997 3300028800 Bacteria 4746
874 Ga0265338_10085544 3300028800 Bacteria 2628
875 Ga0265338_10091843 3300028800 Bacteria 2506
876 Ga0265338_10099324 3300028800 Bacteria 2378
877 Ga0265338_10205341 3300028800 Unclassified 1483
878 Ga0265338_10490193 3300028800 Unclassified 866
879 Ga0265338_10649072 3300028800 Unclassified 731
880 Ga0265338_10687104 3300028800 Unclassified 707
881 Ga0265338_11072257 3300028800 Bacteria 543
882 Ga0265324_10000002 3300029957 Bacteria 382754
883 Ga0265324_10000500 3300029957 Bacteria 27131
884 Ga0265324_10002972 3300029957 Bacteria 8295
885 Ga0265324_10022661 3300029957 Bacteria 2243
886 Ga0265324_10050377 3300029957 Bacteria 1431
887 Ga0316177_1067570 3300030731 Bacteria 897
888 Ga0316176_1027075 3300030732 Bacteria 5585
889 Ga0316176_1094613 3300030732 Bacteria 2595
890 Ga0314311_1142517 3300030733 Bacteria 4898
891 Ga0314311_1158944 3300030733 Bacteria 1907
892 Ga0314311_1192370 3300030733 Bacteria 1826
893 Ga0314311_1244055 3300030733 Bacteria 2784
894 Ga0316179_1102296 3300030734 Bacteria 1086
895 Ga0316178_1025775 3300030735 Bacteria 1317
896 Ga0316180_1111768 3300030736 Bacteria 945
897 Ga0316180_1156767 3300030736 Bacteria 1294
898 Ga0316183_1139050 3300030742 Bacteria 640
899 Ga0316181_1237823 3300030744 Bacteria 917
900 Ga0316182_1292599 3300030745 Bacteria 1400
901 Ga0265332_10312940 3300031238 Unclassified 648
902 Ga0265320_10115375 3300031240 Bacteria 1228
903 Ga0265325_10001662 3300031241 Bacteria 15453
904 Ga0265340_10000521 3300031247 Bacteria 21203
905 Ga0265339_10015627 3300031249 Bacteria 4546
906 Ga0265339_10286876 3300031249 Unclassified 788
907 Ga0265331_10000050 3300031250 Bacteria 181286
908 Ga0265331_10008042 3300031250 Bacteria 6028
909 Ga0265331_10019045 3300031250 Bacteria 3548
910 Ga0265331_10300793 3300031250 Bacteria 719
911 Ga0265331_10415547 3300031250 Bacteria 603
912 Ga0265327_10000109 3300031251 Bacteria 181275
913 Ga0265327_10009306 3300031251 Bacteria 7110
914 Ga0265327_10010524 3300031251 Bacteria 6491
915 Ga0265327_10034073 3300031251 Unclassified 2830
916 Ga0265327_10106909 3300031251 Bacteria 1342
917 Ga0265327_10114436 3300031251 Bacteria 1285
918 Ga0265327_10116624 3300031251 Bacteria 1270
919 Ga0265327_10237053 3300031251 Bacteria 816
920 Ga0265327_10282438 3300031251 Unclassified 733
921 Ga0265316_10061349 3300031344 Bacteria 2921
922 Ga0265316_10104449 3300031344 Bacteria 2150
923 Ga0265316_10148230 3300031344 Bacteria 1759
924 Ga0265316_10178367 3300031344 Bacteria 1582
925 Ga0265316_10263153 3300031344 Bacteria 1264
926 Ga0265316_10413648 3300031344 Bacteria 970
927 Ga0265316_10446833 3300031344 Bacteria 927
928 Ga0265316_10962904 3300031344 Unclassified 595
929 Ga0307513_10942323 3300031456 Bacteria 572
930 Ga0307509_10463409 3300031507 Bacteria 959
931 Ga0307408_100293872 3300031548 Bacteria 1358
932 Ga0265313_10054666 3300031595 Bacteria 1895
933 Ga0265313_10060644 3300031595 Bacteria 1773
934 Ga0307508_10771347 3300031616 Bacteria 576
935 Ga0316575_10003983 3300031665 Bacteria 5170
936 Ga0316575_10180482 3300031665 Bacteria 876
937 Ga0316579_10000952 3300031691 Bacteria 10118
938 Ga0265314_10001521 3300031711 Bacteria 25613
939 Ga0265314_10055535 3300031711 Bacteria 2733
940 Ga0265314_10075317 3300031711 Bacteria 2246
941 Ga0265314_10075432 3300031711 Bacteria 2243
942 Ga0265314_10138110 3300031711 Bacteria 1511
943 Ga0265342_10056065 3300031712 Bacteria 2337
944 Ga0265342_10059252 3300031712 Bacteria 2262
945 Ga0316576_10004152 3300031727 Bacteria 8640
946 Ga0316576_10039521 3300031727 Bacteria 3387
947 Ga0316576_10400550 3300031727 Bacteria 1017
948 Ga0316578_10116230 3300031728 Bacteria 1607
949 Ga0316578_10177126 3300031728 Bacteria 1285
950 Ga0316578_10201448 3300031728 Bacteria 1198
951 Ga0307516_10307900 3300031730 Bacteria 1258
952 Ga0307405_10718617 3300031731 Bacteria 829
953 Ga0316577_10141437 3300031733 Bacteria 1356
954 Ga0316577_10876293 3300031733 Bacteria 509
955 Ga0316577_10903634 3300031733 Bacteria 500
956 Ga0307413_10365835 3300031824 Bacteria 1118
957 Ga0307407_11446865 3300031903 Bacteria 542
958 Ga0307416_103365274 3300032002 Bacteria 535
959 Ga0307414_11252104 3300032004 Bacteria 688
960 Ga0307411_10434820 3300032005 Bacteria 1093
961 Ga0307415_100217593 3300032126 Bacteria 1529
962 Ga0316583_10002208 3300032133 Bacteria 6709
963 Ga0316583_10032677 3300032133 Bacteria 1849
964 Ga0316585_10110045 3300032137 Bacteria 905
965 Ga0316580_10073625 3300032139 Bacteria 1046
966 Ga0316593_10000192 3300032168 Bacteria 9387
967 Ga0316593_10005887 3300032168 Bacteria 3272
968 Ga0316593_10014395 3300032168 Bacteria 2358
969 Ga0316593_10125998 3300032168 Bacteria 922
970 Ga0316586_1007742 3300033527 Bacteria 1573
971 Ga0316587_1014693 3300033529 Bacteria 1293
972 Ga0316596_1077721 3300033541 Bacteria 891
973 Ga0373948_0047199 3300034817 Bacteria 917
974 Ga0373934_0001385 3300035086 Bacteria 8836
975 Ga0373944_0004129 3300035089 Bacteria 3772
976 Ga0373951_0060477 3300035091 Bacteria 948
977 Ga0373923_0003643 3300035111 Bacteria 4979
978 Ga0373923_0487143 3300035111 Bacteria 600
979 Ga0373936_0134195 3300035113 Bacteria 1065
980 Ga0373939_0394411 3300035114 Bacteria 572
981 Ga0373941_0116157 3300035115 Bacteria 949
982 Ga0373945_0152160 3300035116 Bacteria 938
983 Ga0373945_0430186 3300035116 Bacteria 582
984 Ga0373953_0003257 3300035117 Bacteria 5032
985 Ga0373954_0010327 3300035118 Bacteria 4119
986 Ga0373954_0341443 3300035118 Bacteria 739
987 Ga0373954_0420246 3300035118 Bacteria 661
988 Ga0373956_0184605 3300035119 Bacteria 986
989 Ga0373956_0221180 3300035119 Bacteria 899
990 Ga0373956_0509410 3300035119 Bacteria 574
991 Ga0373957_0018186 3300035120 Bacteria 2457
992 Ga0373957_0320900 3300035120 Bacteria 659
993 Ga0373960_0031594 3300035121 Bacteria 1482
994 Ga0373943_0039852 3300035170 Bacteria 2265
995 Ga0373943_0141017 3300035170 Bacteria 1298
996 Ga0373943_0917103 3300035170 Bacteria 524
997 Ga0373946_0187961 3300035171 Bacteria 983
998 Ga0373955_0008568 3300035172 Bacteria 4754
999 Ga0373955_0082639 3300035172 Bacteria 1818
1000 Ga0316574_0000624 3300035398 Bacteria 14789
1001 Ga0316574_0028540 3300035398 Bacteria 3366
1002 Ga0316574_0371676 3300035398 Bacteria 903
1003 Ga0316574_0445870 3300035398 Bacteria 811
1004 Ga0373924_0000835 3300035410 Bacteria 9645
1005 Ga0373924_0005225 3300035410 Bacteria 4585
1006 Ga0373924_0102692 3300035410 Bacteria 1231
1007 Ga0373931_0217568 3300035691 Bacteria 1149
1008 Ga0373931_0285379 3300035691 Bacteria 1015
1009 Ga0373935_0057224 3300035692 Bacteria 2487
1010 Ga0373935_0110058 3300035692 Bacteria 1827
1011 Ga0373935_0288115 3300035692 Bacteria 1158
1012 Ga0373935_0366602 3300035692 Bacteria 1029
1013 Ga0373935_0479919 3300035692 Bacteria 901
1014 Ga0373927_0031676 3300035695 Bacteria 3445
1015 Ga0373927_0034603 3300035695 Bacteria 3286
1016 Ga0373927_0144358 3300035695 Bacteria 1557
1017 Ga0373933_0235585 3300035724 Bacteria 1177
1018 Ga0373947_0180653 3300035725 Bacteria 1373
1019 Ga0373947_0418832 3300035725 Bacteria 905
1020 Ga0373947_0621701 3300035725 Bacteria 736
1021 Ga0373947_1143924 3300035725 Bacteria 530
1022 Ga0373937_0065847 3300036401 Bacteria 3336
1023 Ga0373937_0388613 3300036401 Bacteria 1323
1024 Ga0373937_0568946 3300036401 Bacteria 1076
1025 Ga0316582_0002553 3300036647 Bacteria 8612
1026 Ga0316582_0226216 3300036647 Bacteria 1280
1027 Ga0316582_0667790 3300036647 Bacteria 714
1028 Ga0316584_0047720 3300036712 Bacteria 3199
1029 Ga0316584_0103190 3300036712 Bacteria 2135
1030 Ga0373925_0044970 3300037068 Bacteria 3279
1031 Ga0373925_0058172 3300037068 Bacteria 2898
1032 Ga0373925_0063911 3300037068 Bacteria 2769
1033 Ga0373925_0391982 3300037068 Bacteria 1132
1034 Ga0373925_1257303 3300037068 Bacteria 608
1035 Ga0395899_0003098 3300037312 Bacteria 13233
1036 Ga0395899_0058565 3300037312 Bacteria 2841
1037 Ga0395899_0253422 3300037312 Bacteria 1207
1038 Ga0395899_0747026 3300037312 Bacteria 609
1039 Ga0395900_0001412 3300037418 Bacteria 28734
1040 Ga0395900_0003612 3300037418 Bacteria 16623
1041 Ga0395900_0007425 3300037418 Bacteria 11327
1042 Ga0395900_0083127 3300037418 Bacteria 3290
1043 Ga0395900_0230270 3300037418 Bacteria 1864
1044 Ga0395900_0254362 3300037418 Bacteria 1756
1045 Ga0395900_0291831 3300037418 Unclassified 1619
1046 Ga0395900_1596364 3300037418 Bacteria 564
1047 Ga0395898_0002536 3300037466 Bacteria 21416
1048 Ga0395898_0022692 3300037466 Bacteria 6353
1049 Ga0395898_0043059 3300037466 Bacteria 4449
1050 Ga0395898_0129171 3300037466 Bacteria 2421
1051 Ga0395898_0334575 3300037466 Bacteria 1444
1052 Ga0395898_1066782 3300037466 Unclassified 742
1053 Ga0395905_0000238 3300037471 Bacteria 83164
1054 Ga0395905_0008237 3300037471 Bacteria 10294
1055 Ga0395905_0039862 3300037471 Bacteria 4407
1056 Ga0395905_0572892 3300037471 Bacteria 1030
1057 Ga0395905_1051475 3300037471 Bacteria 717
1058 Ga0316581_0001079 3300037588 Bacteria 5893
1059 Ga0436364_0155867 3300037853 Bacteria 1296
1060 Ga0395901_0008414 3300038443 Bacteria 10428
1061 Ga0395901_0069107 3300038443 Bacteria 3678
1062 Ga0395901_0421595 3300038443 Bacteria 1368
1063 Ga0395901_0503058 3300038443 Bacteria 1233
1064 Ga0395901_2056643 3300038443 Bacteria 517
1065 Ga0242420_027369 3300038996 Bacteria 1044
1066 Ga0436360_1155810 3300039438 Bacteria 644
1067 Ga0436361_0050017 3300039447 Bacteria 26618
1068 Ga0436361_0639184 3300039447 Bacteria 525
1069 Ga0436361_0718323 3300039447 Bacteria 1148
1070 Ga0451800_0118075 3300041459 Unclassified 898
1071 Ga0451800_0640511 3300041459 Bacteria 514
1072 Ga0451807_1349481 3300041486 Bacteria 2952
1073 Ga0451851_1235575 3300041507 Unclassified 646
1074 Ga0451855_0198077 3300041511 Bacteria 563
1075 Ga0451853_2112008 3300041512 Bacteria 632
1076 Ga0439431_0052111 3300041997 Bacteria 1063
1077 Ga0439448_0133959 3300042005 Bacteria 855
1078 Ga0439432_230863 3300042006 Bacteria 533
1079 Ga0451577_0044456 3300042876 Bacteria 3976
1080 Ga0451577_0064949 3300042876 Bacteria 3254
1081 Ga0451577_0420337 3300042876 Bacteria 1214
1082 Ga0451577_0608581 3300042876 Bacteria 991
1083 Ga0451577_0929866 3300042876 Bacteria 782
1084 Ga0466969_0002476 3300044656 Bacteria 9861
1085 Ga0466972_0028528 3300044658 Bacteria 2752
1086 Ga0453683_0030079 3300044673 Bacteria 3434
1087 Ga0466965_0009915 3300044683 Bacteria 4431
1088 Ga0466965_0015196 3300044683 Bacteria 3656
1089 Ga0466965_0849677 3300044683 Bacteria 530
1090 Ga0466966_0117105 3300044684 Bacteria 1639
1091 Ga0466963_1236540 3300044694 Bacteria 524
1092 Ga0453684_0000989 3300044712 Bacteria 92793
1093 Ga0453684_0065104 3300044712 Bacteria 4650
1094 Ga0453684_0177715 3300044712 Bacteria 2502
1095 Ga0453684_0692456 3300044712 Bacteria 1108
1096 Ga0453684_1181452 3300044712 Bacteria 804
1097 Ga0453684_1766408 3300044712 Bacteria 630
1098 Ga0453684_1798289 3300044712 Bacteria 623
1099 Ga0466968_0187929 3300044735 Bacteria 963
1100 Ga0466970_0186437 3300044765 Bacteria 1152
1101 Ga0466970_0229101 3300044765 Bacteria 1038
1102 Ga0466970_0238164 3300044765 Bacteria 1018
1103 Ga0466957_0962489 3300044842 Bacteria 612
1104 Ga0466960_0154991 3300044901 Bacteria 1226
1105 Ga0466959_0013856 3300045049 Bacteria 5855
1106 Ga0451576_0002065 3300045051 Bacteria 31530
1107 Ga0451576_0010036 3300045051 Bacteria 10905
1108 Ga0451576_0060875 3300045051 Bacteria 3937
1109 Ga0451576_0069932 3300045051 Bacteria 3653
1110 Ga0451576_0374709 3300045051 Bacteria 1491
1111 Ga0451576_0892687 3300045051 Bacteria 933
1112 Ga0451576_0995167 3300045051 Bacteria 879
1113 Ga0451576_1973837 3300045051 Bacteria 601
1114 Ga0451576_2301714 3300045051 Bacteria 552
1115 Ga0466967_1716616 3300045976 Bacteria 625
1116 Ga0466967_1954204 3300045976 Bacteria 583
1117 Ga0495627_047044 3300046453 Bacteria 1309
1118 Ga0495592_0494464 3300046454 Bacteria 760
1119 Ga0495603_0095784 3300046455 Bacteria 1734
1120 Ga0495629_0008006 3300046459 Bacteria 7777
1121 Ga0495629_0087873 3300046459 Bacteria 2168
1122 Ga0495641_0112411 3300046461 Bacteria 1215
1123 Ga0495651_0075629 3300046462 Bacteria 2553
1124 Ga0495580_0024838 3300046472 Bacteria 4382
1125 Ga0495580_0050998 3300046472 Bacteria 2925
1126 Ga0495580_0087842 3300046472 Bacteria 2165
1127 Ga0495580_0477228 3300046472 Bacteria 834
1128 Ga0495582_0005514 3300046473 Bacteria 7048
1129 Ga0495582_0093504 3300046473 Bacteria 1678
1130 Ga0495639_0016200 3300046475 Bacteria 3234
1131 Ga0495662_0333812 3300046476 Bacteria 745
1132 Ga0495664_0083745 3300046477 Bacteria 1914
1133 Ga0495583_0018179 3300046506 Bacteria 3707
1134 Ga0495628_0203969 3300046516 Bacteria 1489
1135 Ga0495632_0454162 3300046519 Unclassified 556
1136 Ga0495666_0019131 3300046526 Bacteria 3402
1137 Ga0495666_0385723 3300046526 Bacteria 630
1138 Ga0495665_0012732 3300046531 Bacteria 4551
1139 Ga0495665_0393199 3300046531 Bacteria 703
1140 Ga0495586_0390632 3300046535 Bacteria 800
1141 Ga0495587_0107233 3300046536 Bacteria 1606
1142 Ga0495609_0074311 3300046538 Bacteria 1491
1143 Ga0495645_0044382 3300046543 Bacteria 3242
1144 Ga0495622_0000035 3300046557 Bacteria 122963
1145 Ga0495622_0306889 3300046557 Bacteria 691
1146 Ga0495667_0103714 3300046559 Bacteria 1839
1147 Ga0495668_0766092 3300046616 Bacteria 534
1148 Ga0495634_0082715 3300046642 Bacteria 2097
1149 Ga0495634_0768214 3300046642 Bacteria 551
1150 Ga0495611_0122748 3300046648 Bacteria 1211
1151 Ga0495635_0028671 3300046663 Bacteria 3869
1152 Ga0495635_0880300 3300046663 Bacteria 574
1153 Ga0495635_0997884 3300046663 Bacteria 533
1154 Ga0495588_0000116 3300046674 Bacteria 135919
1155 Ga0495588_0146739 3300046674 Bacteria 1247
1156 Ga0495657_0163529 3300046675 Bacteria 1376
1157 Ga0495657_0296422 3300046675 Bacteria 965
1158 Ga0495599_0424504 3300046678 Bacteria 789
1159 Ga0495623_0328187 3300046679 Bacteria 838
1160 Ga0495658_0001981 3300046683 Bacteria 10438
1161 Ga0495658_0004803 3300046683 Bacteria 6626
1162 Ga0495658_0726466 3300046683 Unclassified 636
1163 Ga0495658_0777569 3300046683 Bacteria 613
1164 Ga0495613_0007458 3300046689 Bacteria 8147
1165 Ga0495671_0080213 3300046692 Bacteria 1599
1166 Ga0495671_0276630 3300046692 Bacteria 809
1167 Ga0495649_0000182 3300046694 Bacteria 54760
1168 Ga0495600_0006859 3300046809 Bacteria 6945
1169 Ga0495600_0073547 3300046809 Bacteria 2232
1170 Ga0495581_0002892 3300047315 Bacteria 9824
1171 Ga0495604_0124498 3300047317 Bacteria 1861
1172 Ga0495674_0205458 3300047319 Bacteria 1633
1173 Ga0495672_0000016 3300047320 Bacteria 500601
1174 Ga0495672_0178980 3300047320 Bacteria 1075
1175 Ga0495672_0220012 3300047320 Bacteria 938
1176 Ga0495672_0418254 3300047320 Unclassified 610
1177 Ga0495676_0595134 3300047321 Unclassified 720
1178 Ga0495675_0049040 3300047444 Bacteria 2685
1179 Ga0495677_0216334 3300047445 Bacteria 746
1180 Ga0495681_0027011 3300047470 Bacteria 2977
1181 Ga0495681_0232862 3300047470 Bacteria 734
1182 Ga0495684_0086399 3300047471 Bacteria 2377
1183 Ga0495593_0036034 3300047673 Bacteria 2684
1184 Ga0495602_0271531 3300048088 Bacteria 1253
1185 Ga0495602_0377579 3300048088 Bacteria 1016
1186 Ga0495614_0034982 3300048089 Bacteria 2159
1187 Ga0495614_0084538 3300048089 Bacteria 1377
1188 Ga0496100_0135185 3300048903 Bacteria 1741
1189 Ga0496100_0157178 3300048903 Bacteria 1627
1190 Ga0496100_0163979 3300048903 Bacteria 1595
1191 Ga0496101_0130394 3300048904 Bacteria 1909
1192 Ga0496101_0606236 3300048904 Unclassified 866
1193 Ga0496102_0024884 3300048905 Bacteria 5324
1194 Ga0496104_0015885 3300048907 Bacteria 6831
1195 Ga0496104_0284051 3300048907 Bacteria 1568
1196 Ga0496104_0716034 3300048907 Bacteria 908
1197 Ga0496105_0097194 3300048908 Bacteria 2432
1198 Ga0496105_0719108 3300048908 Bacteria 765
1199 Ga0496106_0081553 3300048909 Bacteria 2485
1200 Ga0496107_0289122 3300048910 Bacteria 1220
1201 Ga0496107_0714590 3300048910 Bacteria 736
1202 Ga0496107_0758955 3300048910 Bacteria 711
1203 Ga0496108_0091599 3300048911 Bacteria 2584
1204 Ga0496108_0380138 3300048911 Bacteria 1233
1205 Ga0496108_1230186 3300048911 Bacteria 632
1206 Ga0496108_1522713 3300048911 Bacteria 556
1207 Ga0496109_0022741 3300048912 Bacteria 5554
1208 Ga0496109_1953823 3300048912 Bacteria 519
1209 Ga0496110_1142387 3300048913 Bacteria 687
1210 Ga0496112_0002149 3300048915 Bacteria 15656
1211 Ga0496112_0022409 3300048915 Bacteria 6020
1212 Ga0496112_0483582 3300048915 Bacteria 1174
1213 Ga0496112_0608066 3300048915 Bacteria 1025
1214 Ga0496113_0112570 3300048916 Bacteria 2120
1215 Ga0496113_0114796 3300048916 Bacteria 2100
1216 Ga0496113_1476942 3300048916 Bacteria 525
1217 Ga0496114_0014567 3300048917 Bacteria 6317
1218 Ga0496114_0117322 3300048917 Bacteria 2286
1219 Ga0496114_1172215 3300048917 Bacteria 654
1220 Ga0496115_0209364 3300048918 Bacteria 1610
1221 Ga0496125_0438035 3300048928 Bacteria 752
1222 Ga0496126_0110593 3300048929 Bacteria 2393
1223 Ga0501305_026105 3300049161 Bacteria 889
1224 Ga0501298_011845 3300049521 Bacteria 1521
1225 Ga0501299_012331 3300049522 Bacteria 1457
1226 Ga0501031_0004386 3300049568 Bacteria 9142
1227 Ga0501031_0545012 3300049568 Bacteria 747
1228 Ga0501032_0000394 3300049569 Bacteria 36017
1229 Ga0501033_0020233 3300049570 Bacteria 5031
1230 Ga0501034_0020539 3300049571 Bacteria 6745
1231 Ga0501034_0324359 3300049571 Bacteria 1472
1232 Ga0501034_1204950 3300049571 Unclassified 636
1233 Ga0501034_1265307 3300049571 Bacteria 615
1234 Ga0501036_0006553 3300049572 Bacteria 9458
1235 Ga0501036_0041349 3300049572 Bacteria 3901
1236 Ga0501036_0058031 3300049572 Bacteria 3279
1237 Ga0501037_0000133 3300049573 Bacteria 69741
1238 Ga0501037_0172677 3300049573 Bacteria 1536
1239 Ga0501037_0254096 3300049573 Bacteria 1229
1240 Ga0501037_0271907 3300049573 Unclassified 1182
1241 Ga0501038_0023933 3300049574 Bacteria 5454
1242 Ga0501038_0200854 3300049574 Bacteria 1600
1243 Ga0501039_0033552 3300049575 Bacteria 3958
1244 Ga0501039_0602411 3300049575 Bacteria 861
1245 Ga0501040_0067749 3300049576 Bacteria 2460
1246 Ga0501041_0003344 3300049577 Bacteria 9229
1247 Ga0501042_0009869 3300049578 Bacteria 6379
1248 Ga0501042_0279825 3300049578 Bacteria 1205
1249 Ga0501043_0000404 3300049579 Bacteria 38801
1250 Ga0501046_0000038 3300049580 Bacteria 159193
1251 Ga0501046_0179631 3300049580 Bacteria 1583
1252 Ga0501047_0006066 3300049581 Bacteria 11360
1253 Ga0501047_1050570 3300049581 Bacteria 628
1254 Ga0501048_0000033 3300049582 Bacteria 64896
1255 Ga0501048_0426138 3300049582 Bacteria 949
1256 Ga0501048_0590393 3300049582 Bacteria 797
1257 Ga0501067_0376346 3300049583 Bacteria 792
1258 Ga0501068_0320666 3300049584 Bacteria 993
1259 Ga0501069_0338998 3300049585 Bacteria 885
1260 Ga0501069_0621482 3300049585 Bacteria 649
1261 Ga0501070_0035569 3300049586 Bacteria 4161
1262 Ga0501070_0044881 3300049586 Bacteria 3676
1263 Ga0501070_0079948 3300049586 Bacteria 2705
1264 Ga0501070_0330131 3300049586 Bacteria 1240
1265 Ga0501070_0427853 3300049586 Bacteria 1069
1266 Ga0501071_0102836 3300049587 Bacteria 2107
1267 Ga0501071_0114002 3300049587 Bacteria 1999
1268 Ga0501071_1056501 3300049587 Bacteria 627
1269 Ga0501071_1170168 3300049587 Bacteria 594
1270 Ga0501072_0327339 3300049588 Bacteria 1217
1271 Ga0501073_0012572 3300049589 Bacteria 6177
1272 Ga0501073_0038822 3300049589 Bacteria 3376
1273 Ga0501073_0125551 3300049589 Unclassified 1779
1274 Ga0501073_0198652 3300049589 Bacteria 1387
1275 Ga0501073_0713056 3300049589 Bacteria 692
1276 Ga0501074_0018349 3300049590 Bacteria 5081
1277 Ga0501074_0775032 3300049590 Bacteria 676
1278 Ga0501074_1151784 3300049590 Bacteria 544
1279 Ga0501075_0003793 3300049591 Bacteria 10167
1280 Ga0501075_0290534 3300049591 Bacteria 1245
1281 Ga0501076_0000663 3300049592 Bacteria 22052
1282 Ga0501076_0046380 3300049592 Bacteria 3434
1283 Ga0501077_0049998 3300049593 Bacteria 2657
1284 Ga0501077_0209868 3300049593 Bacteria 1237
1285 Ga0501079_0015785 3300049741 Bacteria 5770
1286 Ga0501079_0160362 3300049741 Bacteria 1754
1287 Ga0501079_0508395 3300049741 Bacteria 947
1288 Ga0501080_0001402 3300049742 Bacteria 20194
1289 Ga0501080_0005999 3300049742 Bacteria 10889
1290 Ga0501080_0028144 3300049742 Bacteria 5226
1291 Ga0501080_0030200 3300049742 Bacteria 5049
1292 Ga0501080_0588692 3300049742 Bacteria 988
1293 Ga0501081_0014826 3300049743 Bacteria 5143
1294 Ga0501083_0014244 3300049744 Bacteria 5563
1295 Ga0501083_0026580 3300049744 Bacteria 4000
1296 Ga0501083_0143087 3300049744 Bacteria 1566
1297 Ga0501276_001027 3300049773 Bacteria 1816
1298 Ga0501035_0000562 3300049822 Bacteria 41104
1299 Ga0501035_0263579 3300049822 Bacteria 1460
1300 Ga0501044_0028311 3300049823 Bacteria 5914
1301 Ga0501045_0003651 3300049824 Bacteria 10578
1302 Ga0501045_0089934 3300049824 Bacteria 2268
1303 nmdc:mga03683_66_c2 3300050489 Bacteria 39227
1304 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
1305 nmdc:mga03n38_78327_c1 3300050490 Bacteria 1547
1306 nmdc:mga00v17_1041970_c1 3300050491 Unclassified 514
1307 nmdc:mga00v17_145_c1 3300050491 Bacteria 23071
1308 nmdc:mga00v17_196366_c1 3300050491 Bacteria 1304
1309 nmdc:mga00v17_33755_c1 3300050491 Bacteria 3034
1310 nmdc:mga00v17_420686_c1 3300050491 Bacteria 868
1311 nmdc:mga00v17_6642_c1 3300050491 Bacteria 6143
1312 nmdc:mga00v17_67056_c1 3300050491 Bacteria 2217
1313 nmdc:mga00v17_857_c1 3300050491 Bacteria 16451
1314 nmdc:mga00v17_9991_c1 3300050491 Bacteria 3385
1315 nmdc:mga0yw44_100296_c1 3300050492 Bacteria 1843
1316 nmdc:mga0yw44_192268_c1 3300050492 Unclassified 1346
1317 nmdc:mga0yw44_24_c1 3300050492 Bacteria 63201
1318 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
1319 nmdc:mga0yw44_391363_c1 3300050492 Bacteria 939
1320 nmdc:mga0yw44_6972_c1 3300050492 Bacteria 5518
1321 nmdc:mga0k408_142831_c1 3300050493 Bacteria 1424
1322 nmdc:mga0k408_144_c1 3300050493 Bacteria 36305
1323 nmdc:mga0k408_1480_c1 3300050493 Bacteria 12680
1324 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
1325 nmdc:mga0k408_165086_c1 3300050493 Bacteria 1319
1326 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
1327 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
1328 nmdc:mga0k408_6815_c1 3300050493 Bacteria 6090
1329 nmdc:mga0k408_78109_c1 3300050493 Bacteria 1104
1330 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
1331 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
1332 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
1333 nmdc:mga07m45_2913_c1 3300050496 Bacteria 8113
1334 nmdc:mga07m45_303921_c1 3300050496 Bacteria 928
1335 nmdc:mga07m45_353018_c1 3300050496 Bacteria 854
1336 nmdc:mga07m45_494652_c1 3300050496 Unclassified 708
1337 nmdc:mga07m45_647256_c1 3300050496 Unclassified 609
1338 nmdc:mga07m45_72126_c1 3300050496 Bacteria 1965
1339 nmdc:mga05p37_167955_c1 3300050507 Bacteria 2677
1340 nmdc:mga0qj67_29906_c1 3300050509 Bacteria 4234
1341 nmdc:mga0qj67_48239_c1 3300050509 Bacteria 3364
1342 nmdc:mga08y16_21258_c1 3300050511 Bacteria 6852
1343 nmdc:mga0n895_111604_c1 3300050512 Bacteria 2750
1344 nmdc:mga0n895_1812005_c1 3300050512 Bacteria 571
1345 nmdc:mga0n895_259430_c1 3300050512 Bacteria 1764
1346 nmdc:mga0n895_71889_c1 3300050512 Bacteria 3431
1347 nmdc:mga0n895_944918_c1 3300050512 Bacteria 846
1348 nmdc:mga0rr50_1501726_c1 3300050513 Bacteria 570
1349 nmdc:mga0rr50_302106_c1 3300050513 Bacteria 1339
1350 nmdc:mga0rr50_32159_c1 3300050513 Bacteria 3735
1351 nmdc:mga0rr50_34673_c1 3300050513 Bacteria 3616
1352 nmdc:mga08x19_141689_c1 3300050514 Bacteria 1624
1353 nmdc:mga08x19_52009_c1 3300050514 Bacteria 2633
1354 nmdc:mga08x19_65848_c1 3300050514 Bacteria 2354
1355 nmdc:mga0a205_28754_c1 3300050515 Bacteria 5316
1356 nmdc:mga0a205_858248_c1 3300050515 Bacteria 755
1357 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
1358 nmdc:mga0sz30_30554_c1 3300050516 Bacteria 2225
1359 nmdc:mga0sz30_460715_c1 3300050516 Bacteria 571
1360 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
1361 nmdc:mga0sz30_96240_c1 3300050516 Bacteria 584
1362 Ga0495601_0498313 3300053077 Bacteria 786
1363 Ga0495612_0049342 3300053078 Bacteria 1727
1364 Ga0500610_0000001 3300053079 Bacteria 185468
1365 Ga0500610_0024857 3300053079 Bacteria 2981
1366 Ga0500610_0160911 3300053079 Bacteria 1117
1367 Ga0495655_0065643 3300053083 Bacteria 1002
1368 Ga0495619_0004860 3300053085 Bacteria 8527
1369 Ga0495619_0012469 3300053085 Bacteria 5354
1370 Ga0500643_000010 3300053087 Bacteria 408084
1371 Ga0500643_000038 3300053087 Bacteria 178974
1372 Ga0500643_007309 3300053087 Bacteria 4482
1373 Ga0500644_0000365 3300053088 Bacteria 22175
1374 Ga0500644_0000636 3300053088 Bacteria 13080
1375 Ga0500644_0001805 3300053088 Bacteria 5534
1376 Ga0500644_0019854 3300053088 Bacteria 1989
1377 Ga0500646_0000823 3300053090 Bacteria 8581
1378 Ga0500583_0000067 3300053092 Bacteria 64775
1379 Ga0500583_0002599 3300053092 Bacteria 5470
1380 Ga0500583_0015393 3300053092 Bacteria 3024
1381 Ga0500583_0069456 3300053092 Bacteria 1682
1382 Ga0500651_0000416 3300053093 Bacteria 22899
1383 Ga0500566_0000001 3300053094 Bacteria 1101031
1384 Ga0500650_0000001 3300053098 Bacteria 818797
1385 Ga0500555_000001 3300053103 Bacteria 1353713
1386 Ga0500555_000002 3300053103 Bacteria 1314346
1387 Ga0500555_007840 3300053103 Bacteria 3037
1388 Ga0500555_022461 3300053103 Bacteria 1812
1389 Ga0500556_0000829 3300053104 Bacteria 17806
1390 Ga0500562_000002 3300053108 Bacteria 977234
1391 Ga0500562_004964 3300053108 Bacteria 3353
1392 Ga0500594_0000001 3300053118 Bacteria 1178472
1393 Ga0500594_0000139 3300053118 Bacteria 20048
1394 Ga0500614_000001 3300053123 Bacteria 1274484
1395 Ga0500614_002410 3300053123 Bacteria 4177
1396 Ga0500614_014092 3300053123 Bacteria 1765
1397 Ga0500628_000006 3300053129 Bacteria 154858
1398 Ga0500628_001507 3300053129 Bacteria 3984
1399 Ga0500642_0002538 3300053130 Bacteria 5379
1400 Ga0500652_000084 3300053131 Bacteria 39562
1401 Ga0500655_001993 3300053133 Bacteria 3793
1402 Ga0500559_0015490 3300053136 Bacteria 3219
1403 Ga0500561_0000001 3300053137 Bacteria 957685
1404 Ga0500568_0011040 3300053139 Bacteria 4207
1405 Ga0500568_0014440 3300053139 Bacteria 3566
1406 Ga0500568_0066436 3300053139 Bacteria 1387
1407 Ga0500574_083757 3300053141 Bacteria 942
1408 Ga0500577_0000514 3300053142 Bacteria 9995
1409 Ga0500577_0021093 3300053142 Bacteria 2142
1410 Ga0500579_016957 3300053143 Bacteria 4707
1411 Ga0500589_000008 3300053147 Bacteria 137145
1412 Ga0500589_099901 3300053147 Unclassified 1262
1413 Ga0500600_0114189 3300053149 Bacteria 1403
1414 Ga0500603_138389 3300053150 Bacteria 748
1415 Ga0500604_0010658 3300053151 Unclassified 2462
1416 Ga0500616_0000005 3300053153 Bacteria 961725
1417 Ga0500622_0000002 3300053156 Bacteria 646442
1418 Ga0500633_0014746 3300053160 Bacteria 2225
1419 Ga0500649_000014 3300053722 Bacteria 56198
1420 Ga0500570_000045 3300053724 Bacteria 31120
1421 Ga0500611_008584 3300053727 Bacteria 1586
1422 Ga0500611_009762 3300053727 Bacteria 1532
1423 Ga0501084_0018257 3300054114 Bacteria 5841
1424 Ga0501084_0502704 3300054114 Bacteria 1024
1425 Ga0587083_0181080 3300059505 Bacteria 590
1426 Ga0587085_104013 3300059506 Bacteria 603
1427 Ga0587109_016406 3300059624 Bacteria 1269
1428 Ga0587071_052725 3300060344 Bacteria 845
1429 Ga0587111_0042374 3300060346 Bacteria 975
1430 Ga0501082_0008910 3300060353 Bacteria 8656
1431 Ga0501082_0226637 3300060353 Bacteria 1626
1432 Ga0530510_0006785 3300061734 Bacteria 7977

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031727 Ga0316576_10039521 Ga0316576_100395214 79
2 3300031728 Ga0316578_10177126 Ga0316578_101771262 79
3 3300031733 Ga0316577_10876293 Ga0316577_108762932 79
4 3300032139 Ga0316580_10073625 Ga0316580_100736252 79
5 3300036712 Ga0316584_0103190 Ga0316584_0103190_979_1281 79
6 3300009093 Ga0105240_10302319 Ga0105240_103023193 84
7 3300009545 Ga0105237_11574530 Ga0105237_115745302 84
8 3300010375 Ga0105239_10959267 Ga0105239_109592672 84
9 3300025914 Ga0207671_11603295 Ga0207671_116032951 84
10 3300035724 Ga0373933_0235585 Ga0373933_0235585_667_957 84
11 3300005437 Ga0070710_10000430 Ga0070710_1000043011 85
12 3300005439 Ga0070711_100788194 Ga0070711_1007881943 85
13 3300025898 Ga0207692_10000677 Ga0207692_100006778 85
14 3300025916 Ga0207663_10540116 Ga0207663_105401163 85
15 3300030732 Ga0316176_1027075 Ga0316176_102707511 85
16 3300030733 Ga0314311_1142517 Ga0314311_11425177 85
17 3300030733 Ga0314311_1192370 Ga0314311_11923705 85
18 3300030736 Ga0316180_1111768 Ga0316180_11117681 85
19 3300030745 Ga0316182_1292599 Ga0316182_12925994 85
20 3300031507 Ga0307509_10463409 Ga0307509_104634093 85
21 3300044658 Ga0466972_0028528 Ga0466972_0028528_893_1186 85
22 3300044683 Ga0466965_0009915 Ga0466965_0009915_3856_4149 85
23 3300044683 Ga0466965_0015196 Ga0466965_0015196_225_518 85
24 3300044683 Ga0466965_0849677 Ga0466965_0849677_101_394 85
25 3300044735 Ga0466968_0187929 Ga0466968_0187929_528_821 85
26 3300044901 Ga0466960_0154991 Ga0466960_0154991_263_556 85
27 3300049583 Ga0501067_0376346 Ga0501067_0376346_64_357 85
28 iso_pu_bacteria 2526164512 2526214044 85
29 iso_pu_bacteria 2547132103 2547375772 85
30 iso_pu_bacteria 2643221613 2644081279 85
31 iso_pu_bacteria 2643221721 2644663410 85
32 iso_pu_bacteria 2738541272 2738698222 85
33 iso_pu_bacteria 2738543027 2739326538 85
34 iso_pu_bacteria 2739367654 2739604614 85
35 iso_pu_bacteria 2758568522 2760308356 85
36 iso_pu_bacteria 2758568621 2760622999 85
37 iso_pu_bacteria 2808606394 2809027781 85
38 iso_pu_bacteria 2835188231 2835189038 85
39 iso_pu_bacteria 2843690924 2843691335 85
40 iso_pu_bacteria 2846033681 2846034383 85
41 iso_pu_bacteria 2846037992 2846041874 85
42 iso_pu_bacteria 2855020534 2855020888 85
43 iso_pu_bacteria 2935890801 2935892323 85
44 iso_pu_bacteria 8056579771 8056581958 85
45 3300004799 Ga0058863_11971832 Ga0058863_119718326 88
46 3300004803 Ga0058862_12728945 Ga0058862_127289452 88
47 3300020076 Ga0206355_1195425 Ga0206355_11954252 88
48 3300001915 JGI24741J21665_1001539 JGI24741J21665_100153912 89
49 3300001979 JGI24740J21852_10004196 JGI24740J21852_100041965 89
50 3300001979 JGI24740J21852_10034505 JGI24740J21852_100345052 89
51 3300001990 JGI24737J22298_10126222 JGI24737J22298_101262222 89
52 3300002067 JGI24735J21928_10000083 JGI24735J21928_1000008326 89
53 3300003323 rootH1_10286273 rootH1_102862732 89
54 3300004803 Ga0058862_10110798 Ga0058862_101107988 89
55 3300005289 Ga0065704_10211023 Ga0065704_102110232 89
56 3300005290 Ga0065712_10032246 Ga0065712_100322461 89
57 3300005293 Ga0065715_10687863 Ga0065715_106878632 89
58 3300005295 Ga0065707_10554872 Ga0065707_105548722 89
59 3300005295 Ga0065707_10742430 Ga0065707_107424302 89
60 3300005327 Ga0070658_10000012 Ga0070658_10000012244 89
61 3300005327 Ga0070658_10000015 Ga0070658_1000001524 89
62 3300005327 Ga0070658_10000118 Ga0070658_100001186 89
63 3300005327 Ga0070658_10001050 Ga0070658_1000105027 89
64 3300005327 Ga0070658_10013418 Ga0070658_100134184 89
65 3300005327 Ga0070658_10026903 Ga0070658_100269037 89
66 3300005327 Ga0070658_10457586 Ga0070658_104575862 89
67 3300005327 Ga0070658_11424826 Ga0070658_114248262 89
68 3300005328 Ga0070676_10000822 Ga0070676_1000082214 89
69 3300005328 Ga0070676_10147148 Ga0070676_101471483 89
70 3300005328 Ga0070676_10459818 Ga0070676_104598182 89
71 3300005329 Ga0070683_100000450 Ga0070683_10000045014 89
72 3300005329 Ga0070683_100005670 Ga0070683_10000567014 89
73 3300005329 Ga0070683_100053815 Ga0070683_1000538153 89
74 3300005329 Ga0070683_100103418 Ga0070683_1001034185 89
75 3300005329 Ga0070683_100175681 Ga0070683_1001756814 89
76 3300005329 Ga0070683_100374788 Ga0070683_1003747881 89
77 3300005329 Ga0070683_100509232 Ga0070683_1005092323 89
78 3300005329 Ga0070683_101596493 Ga0070683_1015964932 89
79 3300005329 Ga0070683_102314359 Ga0070683_1023143592 89
80 3300005330 Ga0070690_100010582 Ga0070690_1000105827 89
81 3300005330 Ga0070690_100017999 Ga0070690_1000179996 89
82 3300005330 Ga0070690_100085186 Ga0070690_1000851863 89
83 3300005331 Ga0070670_100303793 Ga0070670_1003037933 89
84 3300005331 Ga0070670_100634924 Ga0070670_1006349242 89
85 3300005331 Ga0070670_101347777 Ga0070670_1013477772 89
86 3300005334 Ga0068869_100000239 Ga0068869_10000023927 89
87 3300005334 Ga0068869_100002849 Ga0068869_10000284915 89
88 3300005334 Ga0068869_100288562 Ga0068869_1002885622 89
89 3300005334 Ga0068869_100421488 Ga0068869_1004214883 89
90 3300005335 Ga0070666_10041378 Ga0070666_100413782 89
91 3300005335 Ga0070666_10119177 Ga0070666_101191773 89
92 3300005335 Ga0070666_10343483 Ga0070666_103434832 89
93 3300005335 Ga0070666_10568010 Ga0070666_105680102 89
94 3300005335 Ga0070666_11073963 Ga0070666_110739631 89
95 3300005336 Ga0070680_100000672 Ga0070680_10000067229 89
96 3300005336 Ga0070680_100038367 Ga0070680_1000383678 89
97 3300005336 Ga0070680_100149390 Ga0070680_1001493902 89
98 3300005336 Ga0070680_100316508 Ga0070680_1003165082 89
99 3300005336 Ga0070680_101703993 Ga0070680_1017039932 89
100 3300005337 Ga0070682_100232877 Ga0070682_1002328772 89
101 3300005337 Ga0070682_100402999 Ga0070682_1004029993 89
102 3300005337 Ga0070682_100863385 Ga0070682_1008633851 89
103 3300005337 Ga0070682_101111607 Ga0070682_1011116072 89
104 3300005337 Ga0070682_101677233 Ga0070682_1016772331 89
105 3300005338 Ga0068868_100110068 Ga0068868_1001100682 89
106 3300005338 Ga0068868_100277744 Ga0068868_1002777441 89
107 3300005339 Ga0070660_100000176 Ga0070660_10000017626 89
108 3300005339 Ga0070660_100002817 Ga0070660_1000028178 89
109 3300005339 Ga0070660_100008505 Ga0070660_10000850510 89
110 3300005339 Ga0070660_100029132 Ga0070660_1000291322 89
111 3300005339 Ga0070660_100426131 Ga0070660_1004261312 89
112 3300005340 Ga0070689_100003982 Ga0070689_1000039827 89
113 3300005340 Ga0070689_100010970 Ga0070689_1000109708 89
114 3300005340 Ga0070689_101762510 Ga0070689_1017625101 89
115 3300005341 Ga0070691_10037648 Ga0070691_100376484 89
116 3300005341 Ga0070691_10082496 Ga0070691_100824962 89
117 3300005341 Ga0070691_10187215 Ga0070691_101872152 89
118 3300005341 Ga0070691_10497255 Ga0070691_104972551 89
119 3300005341 Ga0070691_10998864 Ga0070691_109988641 89
120 3300005343 Ga0070687_100514328 Ga0070687_1005143282 89
121 3300005343 Ga0070687_100854927 Ga0070687_1008549273 89
122 3300005343 Ga0070687_100910603 Ga0070687_1009106031 89
123 3300005344 Ga0070661_100130867 Ga0070661_1001308673 89
124 3300005344 Ga0070661_100900332 Ga0070661_1009003322 89
125 3300005345 Ga0070692_10026456 Ga0070692_100264563 89
126 3300005345 Ga0070692_11092894 Ga0070692_110928941 89
127 3300005347 Ga0070668_101351262 Ga0070668_1013512622 89
128 3300005353 Ga0070669_100665908 Ga0070669_1006659082 89
129 3300005353 Ga0070669_100707179 Ga0070669_1007071792 89
130 3300005353 Ga0070669_101785717 Ga0070669_1017857172 89
131 3300005354 Ga0070675_100125842 Ga0070675_1001258424 89
132 3300005354 Ga0070675_101433649 Ga0070675_1014336491 89
133 3300005354 Ga0070675_101494068 Ga0070675_1014940681 89
134 3300005355 Ga0070671_100000001 Ga0070671_100000001461 89
135 3300005355 Ga0070671_100035416 Ga0070671_1000354166 89
136 3300005355 Ga0070671_100133678 Ga0070671_1001336783 89
137 3300005355 Ga0070671_100226312 Ga0070671_1002263123 89
138 3300005355 Ga0070671_100777476 Ga0070671_1007774762 89
139 3300005355 Ga0070671_101060315 Ga0070671_1010603152 89
140 3300005356 Ga0070674_100004150 Ga0070674_1000041509 89
141 3300005356 Ga0070674_100014629 Ga0070674_1000146292 89
142 3300005356 Ga0070674_100044487 Ga0070674_1000444873 89
143 3300005356 Ga0070674_100061550 Ga0070674_1000615502 89
144 3300005356 Ga0070674_100191276 Ga0070674_1001912763 89
145 3300005364 Ga0070673_100000306 Ga0070673_10000030630 89
146 3300005364 Ga0070673_100085073 Ga0070673_1000850733 89
147 3300005365 Ga0070688_100002345 Ga0070688_10000234515 89
148 3300005366 Ga0070659_100000215 Ga0070659_10000021527 89
149 3300005366 Ga0070659_100096145 Ga0070659_1000961452 89
150 3300005366 Ga0070659_100199395 Ga0070659_1001993952 89
151 3300005366 Ga0070659_101770959 Ga0070659_1017709592 89
152 3300005367 Ga0070667_100000001 Ga0070667_100000001801 89
153 3300005367 Ga0070667_100004521 Ga0070667_1000045216 89
154 3300005367 Ga0070667_100225186 Ga0070667_1002251863 89
155 3300005434 Ga0070709_10019345 Ga0070709_100193455 89
156 3300005435 Ga0070714_100000778 Ga0070714_10000077815 89
157 3300005435 Ga0070714_100127912 Ga0070714_1001279125 89
158 3300005436 Ga0070713_100000028 Ga0070713_10000002826 89
159 3300005436 Ga0070713_100741052 Ga0070713_1007410522 89
160 3300005436 Ga0070713_100797064 Ga0070713_1007970642 89
161 3300005436 Ga0070713_101107328 Ga0070713_1011073281 89
162 3300005437 Ga0070710_10043307 Ga0070710_100433073 89
163 3300005437 Ga0070710_10684253 Ga0070710_106842531 89
164 3300005437 Ga0070710_11052535 Ga0070710_110525351 89
165 3300005438 Ga0070701_10004910 Ga0070701_100049108 89
166 3300005438 Ga0070701_10042135 Ga0070701_100421354 89
167 3300005438 Ga0070701_10088809 Ga0070701_100888094 89
168 3300005439 Ga0070711_100008240 Ga0070711_10000824011 89
169 3300005439 Ga0070711_101624119 Ga0070711_1016241192 89
170 3300005440 Ga0070705_100139886 Ga0070705_1001398864 89
171 3300005440 Ga0070705_100376505 Ga0070705_1003765052 89
172 3300005441 Ga0070700_100022163 Ga0070700_1000221635 89
173 3300005441 Ga0070700_100283345 Ga0070700_1002833452 89
174 3300005441 Ga0070700_100294450 Ga0070700_1002944502 89
175 3300005441 Ga0070700_101581130 Ga0070700_1015811302 89
176 3300005441 Ga0070700_101616892 Ga0070700_1016168921 89
177 3300005441 Ga0070700_101791338 Ga0070700_1017913382 89
178 3300005444 Ga0070694_100103515 Ga0070694_1001035155 89
179 3300005444 Ga0070694_100170239 Ga0070694_1001702392 89
180 3300005444 Ga0070694_100645100 Ga0070694_1006451002 89
181 3300005445 Ga0070708_100069490 Ga0070708_1000694906 89
182 3300005445 Ga0070708_100327113 Ga0070708_1003271133 89
183 3300005445 Ga0070708_101895666 Ga0070708_1018956661 89
184 3300005455 Ga0070663_100085826 Ga0070663_1000858265 89
185 3300005456 Ga0070678_100000168 Ga0070678_10000016834 89
186 3300005456 Ga0070678_100016595 Ga0070678_1000165953 89
187 3300005456 Ga0070678_100032057 Ga0070678_1000320573 89
188 3300005456 Ga0070678_100138031 Ga0070678_1001380313 89
189 3300005456 Ga0070678_100586520 Ga0070678_1005865202 89
190 3300005457 Ga0070662_100268460 Ga0070662_1002684603 89
191 3300005458 Ga0070681_10002189 Ga0070681_1000218910 89
192 3300005458 Ga0070681_10084187 Ga0070681_100841873 89
193 3300005458 Ga0070681_10094055 Ga0070681_100940552 89
194 3300005458 Ga0070681_10419962 Ga0070681_104199623 89
195 3300005458 Ga0070681_10439726 Ga0070681_104397263 89
196 3300005459 Ga0068867_100020156 Ga0068867_10002015611 89
197 3300005459 Ga0068867_100384049 Ga0068867_1003840492 89
198 3300005459 Ga0068867_100415565 Ga0068867_1004155653 89
199 3300005466 Ga0070685_10000188 Ga0070685_1000018849 89
200 3300005466 Ga0070685_10002659 Ga0070685_100026592 89
201 3300005466 Ga0070685_10007961 Ga0070685_100079612 89
202 3300005466 Ga0070685_11496398 Ga0070685_114963982 89
203 3300005467 Ga0070706_100018649 Ga0070706_10001864911 89
204 3300005467 Ga0070706_100047586 Ga0070706_1000475862 89
205 3300005467 Ga0070706_100250396 Ga0070706_1002503963 89
206 3300005467 Ga0070706_100367139 Ga0070706_1003671391 89
207 3300005467 Ga0070706_100826259 Ga0070706_1008262592 89
208 3300005468 Ga0070707_100025860 Ga0070707_1000258607 89
209 3300005468 Ga0070707_100045940 Ga0070707_1000459404 89
210 3300005468 Ga0070707_100410844 Ga0070707_1004108443 89
211 3300005468 Ga0070707_101437982 Ga0070707_1014379822 89
212 3300005471 Ga0070698_100010119 Ga0070698_10001011918 89
213 3300005471 Ga0070698_100051877 Ga0070698_1000518778 89
214 3300005471 Ga0070698_101320062 Ga0070698_1013200621 89
215 3300005471 Ga0070698_101334219 Ga0070698_1013342191 89
216 3300005518 Ga0070699_100011946 Ga0070699_1000119462 89
217 3300005518 Ga0070699_100043286 Ga0070699_1000432862 89
218 3300005518 Ga0070699_100085613 Ga0070699_1000856134 89
219 3300005518 Ga0070699_101600800 Ga0070699_1016008001 89
220 3300005530 Ga0070679_100003967 Ga0070679_10000396712 89
221 3300005530 Ga0070679_100005719 Ga0070679_10000571915 89
222 3300005530 Ga0070679_100014538 Ga0070679_1000145387 89
223 3300005530 Ga0070679_100021502 Ga0070679_1000215029 89
224 3300005530 Ga0070679_100023544 Ga0070679_1000235443 89
225 3300005530 Ga0070679_100024441 Ga0070679_1000244419 89
226 3300005530 Ga0070679_100052255 Ga0070679_1000522557 89
227 3300005530 Ga0070679_100077724 Ga0070679_1000777243 89
228 3300005530 Ga0070679_100083398 Ga0070679_1000833982 89
229 3300005530 Ga0070679_100231961 Ga0070679_1002319612 89
230 3300005530 Ga0070679_100268287 Ga0070679_1002682873 89
231 3300005530 Ga0070679_100301518 Ga0070679_1003015182 89
232 3300005530 Ga0070679_100771831 Ga0070679_1007718312 89
233 3300005530 Ga0070679_100852103 Ga0070679_1008521032 89
234 3300005530 Ga0070679_101122339 Ga0070679_1011223392 89
235 3300005530 Ga0070679_101467208 Ga0070679_1014672082 89
236 3300005530 Ga0070679_101557783 Ga0070679_1015577832 89
237 3300005530 Ga0070679_101711619 Ga0070679_1017116191 89
238 3300005535 Ga0070684_100001744 Ga0070684_1000017442 89
239 3300005535 Ga0070684_100002149 Ga0070684_10000214914 89
240 3300005535 Ga0070684_100159000 Ga0070684_1001590003 89
241 3300005535 Ga0070684_100439426 Ga0070684_1004394263 89
242 3300005535 Ga0070684_100907488 Ga0070684_1009074882 89
243 3300005536 Ga0070697_100018681 Ga0070697_1000186818 89
244 3300005536 Ga0070697_100158062 Ga0070697_1001580623 89
245 3300005536 Ga0070697_101089830 Ga0070697_1010898301 89
246 3300005539 Ga0068853_100179945 Ga0068853_1001799453 89
247 3300005539 Ga0068853_100202551 Ga0068853_1002025513 89
248 3300005539 Ga0068853_100447060 Ga0068853_1004470601 89
249 3300005543 Ga0070672_100055954 Ga0070672_1000559548 89
250 3300005543 Ga0070672_100361662 Ga0070672_1003616623 89
251 3300005543 Ga0070672_101131026 Ga0070672_1011310262 89
252 3300005543 Ga0070672_101643846 Ga0070672_1016438461 89
253 3300005544 Ga0070686_100000984 Ga0070686_1000009843 89
254 3300005544 Ga0070686_100018275 Ga0070686_1000182752 89
255 3300005544 Ga0070686_100100808 Ga0070686_1001008083 89
256 3300005544 Ga0070686_100309276 Ga0070686_1003092763 89
257 3300005544 Ga0070686_100482156 Ga0070686_1004821563 89
258 3300005545 Ga0070695_100058601 Ga0070695_1000586012 89
259 3300005545 Ga0070695_100177189 Ga0070695_1001771893 89
260 3300005545 Ga0070695_101677620 Ga0070695_1016776201 89
261 3300005546 Ga0070696_100030255 Ga0070696_1000302555 89
262 3300005546 Ga0070696_100134021 Ga0070696_1001340213 89
263 3300005546 Ga0070696_100194163 Ga0070696_1001941634 89
264 3300005546 Ga0070696_100717074 Ga0070696_1007170742 89
265 3300005546 Ga0070696_100878728 Ga0070696_1008787282 89
266 3300005547 Ga0070693_100025656 Ga0070693_1000256565 89
267 3300005547 Ga0070693_100095941 Ga0070693_1000959412 89
268 3300005548 Ga0070665_100029414 Ga0070665_1000294147 89
269 3300005548 Ga0070665_100096550 Ga0070665_1000965504 89
270 3300005548 Ga0070665_100171863 Ga0070665_1001718632 89
271 3300005548 Ga0070665_100181226 Ga0070665_1001812265 89
272 3300005548 Ga0070665_100339080 Ga0070665_1003390802 89
273 3300005549 Ga0070704_100001908 Ga0070704_10000190816 89
274 3300005549 Ga0070704_100011835 Ga0070704_10001183511 89
275 3300005563 Ga0068855_100000003 Ga0068855_100000003146 89
276 3300005563 Ga0068855_100000168 Ga0068855_10000016880 89
277 3300005563 Ga0068855_100004673 Ga0068855_1000046738 89
278 3300005563 Ga0068855_100020905 Ga0068855_1000209057 89
279 3300005563 Ga0068855_100042627 Ga0068855_1000426272 89
280 3300005563 Ga0068855_100044376 Ga0068855_1000443768 89
281 3300005563 Ga0068855_100122011 Ga0068855_1001220114 89
282 3300005563 Ga0068855_100631942 Ga0068855_1006319422 89
283 3300005563 Ga0068855_100699930 Ga0068855_1006999302 89
284 3300005563 Ga0068855_100787163 Ga0068855_1007871632 89
285 3300005563 Ga0068855_101057751 Ga0068855_1010577512 89
286 3300005563 Ga0068855_101095095 Ga0068855_1010950952 89
287 3300005563 Ga0068855_101243012 Ga0068855_1012430122 89
288 3300005564 Ga0070664_100364069 Ga0070664_1003640693 89
289 3300005564 Ga0070664_100434554 Ga0070664_1004345543 89
290 3300005564 Ga0070664_100580627 Ga0070664_1005806273 89
291 3300005577 Ga0068857_100000124 Ga0068857_10000012431 89
292 3300005577 Ga0068857_100406048 Ga0068857_1004060483 89
293 3300005577 Ga0068857_100564509 Ga0068857_1005645092 89
294 3300005577 Ga0068857_100724108 Ga0068857_1007241082 89
295 3300005577 Ga0068857_100939564 Ga0068857_1009395642 89
296 3300005577 Ga0068857_101413968 Ga0068857_1014139682 89
297 3300005578 Ga0068854_100519470 Ga0068854_1005194701 89
298 3300005578 Ga0068854_100683221 Ga0068854_1006832212 89
299 3300005614 Ga0068856_100000001 Ga0068856_100000001295 89
300 3300005614 Ga0068856_100001486 Ga0068856_10000148632 89
301 3300005614 Ga0068856_100001797 Ga0068856_10000179731 89
302 3300005614 Ga0068856_100048231 Ga0068856_1000482312 89
303 3300005614 Ga0068856_100229169 Ga0068856_1002291695 89
304 3300005614 Ga0068856_100598667 Ga0068856_1005986673 89
305 3300005614 Ga0068856_100628871 Ga0068856_1006288712 89
306 3300005614 Ga0068856_101067250 Ga0068856_1010672502 89
307 3300005615 Ga0070702_100014621 Ga0070702_1000146218 89
308 3300005615 Ga0070702_100021262 Ga0070702_1000212625 89
309 3300005616 Ga0068852_100491118 Ga0068852_1004911182 89
310 3300005617 Ga0068859_100006170 Ga0068859_10000617016 89
311 3300005617 Ga0068859_100089269 Ga0068859_1000892693 89
312 3300005617 Ga0068859_100323620 Ga0068859_1003236201 89
313 3300005617 Ga0068859_100540753 Ga0068859_1005407532 89
314 3300005617 Ga0068859_101600921 Ga0068859_1016009212 89
315 3300005618 Ga0068864_100003967 Ga0068864_10000396716 89
316 3300005618 Ga0068864_100114654 Ga0068864_1001146542 89
317 3300005618 Ga0068864_102673988 Ga0068864_1026739881 89
318 3300005718 Ga0068866_10002726 Ga0068866_1000272614 89
319 3300005718 Ga0068866_10003079 Ga0068866_1000307911 89
320 3300005718 Ga0068866_10100047 Ga0068866_101000473 89
321 3300005719 Ga0068861_100008199 Ga0068861_10000819911 89
322 3300005719 Ga0068861_100126218 Ga0068861_1001262185 89
323 3300005719 Ga0068861_100131548 Ga0068861_1001315482 89
324 3300005719 Ga0068861_101025908 Ga0068861_1010259082 89
325 3300005834 Ga0068851_10156813 Ga0068851_101568132 89
326 3300005840 Ga0068870_10009891 Ga0068870_100098915 89
327 3300005840 Ga0068870_10078377 Ga0068870_100783774 89
328 3300005840 Ga0068870_10111576 Ga0068870_101115762 89
329 3300005841 Ga0068863_100002985 Ga0068863_10000298527 89
330 3300005841 Ga0068863_100022347 Ga0068863_1000223475 89
331 3300005841 Ga0068863_100046276 Ga0068863_1000462762 89
332 3300005841 Ga0068863_100102476 Ga0068863_1001024762 89
333 3300005841 Ga0068863_100612467 Ga0068863_1006124672 89
334 3300005841 Ga0068863_100820175 Ga0068863_1008201751 89
335 3300005842 Ga0068858_100013226 Ga0068858_1000132263 89
336 3300005842 Ga0068858_100014524 Ga0068858_1000145246 89
337 3300005842 Ga0068858_100017672 Ga0068858_1000176728 89
338 3300005843 Ga0068860_100019846 Ga0068860_1000198468 89
339 3300005843 Ga0068860_100111708 Ga0068860_1001117084 89
340 3300005843 Ga0068860_100233894 Ga0068860_1002338942 89
341 3300005843 Ga0068860_100299450 Ga0068860_1002994502 89
342 3300005843 Ga0068860_100488011 Ga0068860_1004880112 89
343 3300005843 Ga0068860_101077953 Ga0068860_1010779532 89
344 3300005843 Ga0068860_101098337 Ga0068860_1010983371 89
345 3300005843 Ga0068860_101153711 Ga0068860_1011537112 89
346 3300005844 Ga0068862_100015629 Ga0068862_1000156298 89
347 3300005844 Ga0068862_100142453 Ga0068862_1001424533 89
348 3300005844 Ga0068862_102596470 Ga0068862_1025964702 89
349 3300005937 Ga0081455_10000003 Ga0081455_10000003281 89
350 3300005985 Ga0081539_10001876 Ga0081539_1000187624 89
351 3300006028 Ga0070717_10062928 Ga0070717_100629285 89
352 3300006028 Ga0070717_11107508 Ga0070717_111075082 89
353 3300006038 Ga0075365_10000658 Ga0075365_100006585 89
354 3300006038 Ga0075365_10013015 Ga0075365_100130159 89
355 3300006038 Ga0075365_10055135 Ga0075365_100551356 89
356 3300006038 Ga0075365_10056400 Ga0075365_100564005 89
357 3300006038 Ga0075365_10332614 Ga0075365_103326142 89
358 3300006038 Ga0075365_10452922 Ga0075365_104529222 89
359 3300006042 Ga0075368_10000103 Ga0075368_100001038 89
360 3300006048 Ga0075363_100000006 Ga0075363_10000000621 89
361 3300006048 Ga0075363_100031526 Ga0075363_1000315263 89
362 3300006051 Ga0075364_10000255 Ga0075364_1000025525 89
363 3300006051 Ga0075364_10000985 Ga0075364_1000098518 89
364 3300006051 Ga0075364_10005139 Ga0075364_1000513914 89
365 3300006051 Ga0075364_10008153 Ga0075364_100081539 89
366 3300006051 Ga0075364_10008868 Ga0075364_100088682 89
367 3300006051 Ga0075364_10056142 Ga0075364_100561427 89
368 3300006051 Ga0075364_10117401 Ga0075364_101174012 89
369 3300006051 Ga0075364_11172525 Ga0075364_111725252 89
370 3300006058 Ga0075432_10098869 Ga0075432_100988693 89
371 3300006163 Ga0070715_10201379 Ga0070715_102013792 89
372 3300006173 Ga0070716_100014982 Ga0070716_1000149826 89
373 3300006173 Ga0070716_100148286 Ga0070716_1001482862 89
374 3300006175 Ga0070712_100296952 Ga0070712_1002969521 89
375 3300006175 Ga0070712_100645686 Ga0070712_1006456862 89
376 3300006175 Ga0070712_101990388 Ga0070712_1019903881 89
377 3300006177 Ga0075362_10000049 Ga0075362_1000004947 89
378 3300006177 Ga0075362_10023272 Ga0075362_100232727 89
379 3300006178 Ga0075367_10000021 Ga0075367_1000002139 89
380 3300006178 Ga0075367_10017509 Ga0075367_100175095 89
381 3300006178 Ga0075367_10749599 Ga0075367_107495992 89
382 3300006186 Ga0075369_10000003 Ga0075369_10000003236 89
383 3300006186 Ga0075369_10000057 Ga0075369_1000005742 89
384 3300006186 Ga0075369_10077510 Ga0075369_100775101 89
385 3300006186 Ga0075369_10128549 Ga0075369_101285492 89
386 3300006195 Ga0075366_10000001 Ga0075366_10000001368 89
387 3300006195 Ga0075366_10000065 Ga0075366_1000006542 89
388 3300006195 Ga0075366_10000147 Ga0075366_1000014719 89
389 3300006195 Ga0075366_10001116 Ga0075366_1000111615 89
390 3300006195 Ga0075366_10026067 Ga0075366_100260676 89
391 3300006195 Ga0075366_10027187 Ga0075366_100271874 89
392 3300006195 Ga0075366_10174399 Ga0075366_101743992 89
393 3300006195 Ga0075366_10214500 Ga0075366_102145002 89
394 3300006237 Ga0097621_100006235 Ga0097621_10000623515 89
395 3300006237 Ga0097621_100062852 Ga0097621_1000628524 89
396 3300006237 Ga0097621_100107511 Ga0097621_1001075116 89
397 3300006237 Ga0097621_100154914 Ga0097621_1001549143 89
398 3300006237 Ga0097621_100548254 Ga0097621_1005482542 89
399 3300006353 Ga0075370_10006085 Ga0075370_100060858 89
400 3300006353 Ga0075370_10116654 Ga0075370_101166541 89
401 3300006353 Ga0075370_10606716 Ga0075370_106067161 89
402 3300006353 Ga0075370_10714798 Ga0075370_107147982 89
403 3300006358 Ga0068871_100003989 Ga0068871_1000039893 89
404 3300006358 Ga0068871_100038968 Ga0068871_1000389683 89
405 3300006844 Ga0075428_100003149 Ga0075428_10000314923 89
406 3300006846 Ga0075430_100046838 Ga0075430_1000468387 89
407 3300006846 Ga0075430_100055797 Ga0075430_1000557976 89
408 3300006847 Ga0075431_101175299 Ga0075431_1011752992 89
409 3300006852 Ga0075433_10024313 Ga0075433_100243136 89
410 3300006852 Ga0075433_10288718 Ga0075433_102887183 89
411 3300006871 Ga0075434_100015561 Ga0075434_1000155617 89
412 3300006871 Ga0075434_100194623 Ga0075434_1001946235 89
413 3300006871 Ga0075434_100316589 Ga0075434_1003165892 89
414 3300006871 Ga0075434_101519547 Ga0075434_1015195472 89
415 3300006881 Ga0068865_100005809 Ga0068865_10000580916 89
416 3300006881 Ga0068865_100028985 Ga0068865_1000289853 89
417 3300006881 Ga0068865_100394857 Ga0068865_1003948572 89
418 3300006914 Ga0075436_100048771 Ga0075436_1000487712 89
419 3300006914 Ga0075436_100164914 Ga0075436_1001649144 89
420 3300006914 Ga0075436_100268172 Ga0075436_1002681722 89
421 3300006931 Ga0097620_100006169 Ga0097620_10000616916 89
422 3300006931 Ga0097620_100089272 Ga0097620_1000892723 89
423 3300006931 Ga0097620_100323614 Ga0097620_1003236144 89
424 3300006931 Ga0097620_100540784 Ga0097620_1005407844 89
425 3300006931 Ga0097620_101600051 Ga0097620_1016000511 89
426 3300007076 Ga0075435_100050036 Ga0075435_1000500366 89
427 3300007076 Ga0075435_100336262 Ga0075435_1003362622 89
428 3300007076 Ga0075435_100368822 Ga0075435_1003688222 89
429 3300007076 Ga0075435_101706836 Ga0075435_1017068362 89
430 3300007265 Ga0099794_10238362 Ga0099794_102383622 89
431 3300007265 Ga0099794_10416593 Ga0099794_104165932 89
432 3300009093 Ga0105240_10000003 Ga0105240_10000003849 89
433 3300009093 Ga0105240_10034455 Ga0105240_100344553 89
434 3300009093 Ga0105240_10040725 Ga0105240_1004072513 89
435 3300009093 Ga0105240_10312692 Ga0105240_103126922 89
436 3300009093 Ga0105240_10482858 Ga0105240_104828584 89
437 3300009094 Ga0111539_10027480 Ga0111539_100274808 89
438 3300009094 Ga0111539_11877758 Ga0111539_118777582 89
439 3300009098 Ga0105245_10000001 Ga0105245_10000001330 89
440 3300009098 Ga0105245_10004395 Ga0105245_1000439513 89
441 3300009098 Ga0105245_10004821 Ga0105245_100048214 89
442 3300009098 Ga0105245_10010103 Ga0105245_1001010316 89
443 3300009098 Ga0105245_10060520 Ga0105245_100605203 89
444 3300009098 Ga0105245_10351023 Ga0105245_103510232 89
445 3300009098 Ga0105245_10394322 Ga0105245_103943222 89
446 3300009098 Ga0105245_10462980 Ga0105245_104629802 89
447 3300009098 Ga0105245_11705662 Ga0105245_117056622 89
448 3300009101 Ga0105247_10063726 Ga0105247_100637263 89
449 3300009147 Ga0114129_10070335 Ga0114129_100703358 89
450 3300009148 Ga0105243_10000001 Ga0105243_10000001442 89
451 3300009148 Ga0105243_10008999 Ga0105243_1000899911 89
452 3300009148 Ga0105243_10010600 Ga0105243_100106006 89
453 3300009148 Ga0105243_10226682 Ga0105243_102266822 89
454 3300009148 Ga0105243_10493181 Ga0105243_104931811 89
455 3300009148 Ga0105243_10541819 Ga0105243_105418193 89
456 3300009148 Ga0105243_11060138 Ga0105243_110601382 89
457 3300009174 Ga0105241_10000003 Ga0105241_10000003157 89
458 3300009174 Ga0105241_10011078 Ga0105241_100110782 89
459 3300009174 Ga0105241_10188510 Ga0105241_101885102 89
460 3300009174 Ga0105241_10610663 Ga0105241_106106633 89
461 3300009174 Ga0105241_11032330 Ga0105241_110323302 89
462 3300009174 Ga0105241_11235668 Ga0105241_112356681 89
463 3300009174 Ga0105241_12027947 Ga0105241_120279472 89
464 3300009174 Ga0105241_12382610 Ga0105241_123826102 89
465 3300009174 Ga0105241_12643660 Ga0105241_126436602 89
466 3300009176 Ga0105242_10000011 Ga0105242_100000119 89
467 3300009176 Ga0105242_10007562 Ga0105242_1000756210 89
468 3300009176 Ga0105242_10009973 Ga0105242_100099736 89
469 3300009176 Ga0105242_10013678 Ga0105242_100136788 89
470 3300009176 Ga0105242_10298770 Ga0105242_102987702 89
471 3300009176 Ga0105242_10565124 Ga0105242_105651242 89
472 3300009176 Ga0105242_11337195 Ga0105242_113371952 89
473 3300009176 Ga0105242_12562015 Ga0105242_125620152 89
474 3300009177 Ga0105248_10010314 Ga0105248_1001031415 89
475 3300009177 Ga0105248_10094322 Ga0105248_100943227 89
476 3300009177 Ga0105248_10113808 Ga0105248_101138085 89
477 3300009177 Ga0105248_10167563 Ga0105248_101675634 89
478 3300009177 Ga0105248_11675979 Ga0105248_116759792 89
479 3300009545 Ga0105237_10472790 Ga0105237_104727903 89
480 3300009545 Ga0105237_10631440 Ga0105237_106314402 89
481 3300009545 Ga0105237_10828063 Ga0105237_108280632 89
482 3300009545 Ga0105237_11326470 Ga0105237_113264702 89
483 3300009545 Ga0105237_11420833 Ga0105237_114208332 89
484 3300009545 Ga0105237_11592915 Ga0105237_115929151 89
485 3300009545 Ga0105237_11706766 Ga0105237_117067661 89
486 3300009551 Ga0105238_10000579 Ga0105238_1000057936 89
487 3300009551 Ga0105238_10124575 Ga0105238_101245751 89
488 3300009551 Ga0105238_10231710 Ga0105238_102317103 89
489 3300009551 Ga0105238_10237507 Ga0105238_102375073 89
490 3300009551 Ga0105238_11236590 Ga0105238_112365902 89
491 3300009551 Ga0105238_11326845 Ga0105238_113268452 89
492 3300009551 Ga0105238_12020090 Ga0105238_120200902 89
493 3300009551 Ga0105238_12305224 Ga0105238_123052242 89
494 3300009551 Ga0105238_12309822 Ga0105238_123098221 89
495 3300009551 Ga0105238_12338051 Ga0105238_123380511 89
496 3300009551 Ga0105238_12453133 Ga0105238_124531331 89
497 3300009553 Ga0105249_10002379 Ga0105249_1000237914 89
498 3300009553 Ga0105249_10256697 Ga0105249_102566972 89
499 3300009553 Ga0105249_10432368 Ga0105249_104323683 89
500 3300009553 Ga0105249_10759437 Ga0105249_107594372 89
501 3300009553 Ga0105249_13073428 Ga0105249_130734282 89
502 3300009986 Ga0105033_105305 Ga0105033_1053053 89
503 3300009986 Ga0105033_119600 Ga0105033_1196002 89
504 3300009987 Ga0105030_102571 Ga0105030_1025711 89
505 3300009993 Ga0105028_100084 Ga0105028_10008410 89
506 3300010375 Ga0105239_10032725 Ga0105239_1003272510 89
507 3300010375 Ga0105239_10075342 Ga0105239_100753428 89
508 3300010375 Ga0105239_10138559 Ga0105239_101385597 89
509 3300010375 Ga0105239_10482126 Ga0105239_104821261 89
510 3300010375 Ga0105239_11707210 Ga0105239_117072102 89
511 3300010375 Ga0105239_12338703 Ga0105239_123387031 89
512 3300010375 Ga0105239_13146168 Ga0105239_131461682 89
513 3300011119 Ga0105246_10153679 Ga0105246_101536792 89
514 3300011119 Ga0105246_10496388 Ga0105246_104963882 89
515 3300011119 Ga0105246_10497338 Ga0105246_104973382 89
516 3300013100 Ga0157373_10000583 Ga0157373_100005839 89
517 3300013100 Ga0157373_10085939 Ga0157373_100859394 89
518 3300013100 Ga0157373_10264006 Ga0157373_102640063 89
519 3300013100 Ga0157373_10300554 Ga0157373_103005543 89
520 3300013100 Ga0157373_11353663 Ga0157373_113536632 89
521 3300013102 Ga0157371_10000176 Ga0157371_1000017624 89
522 3300013102 Ga0157371_10204330 Ga0157371_102043302 89
523 3300013102 Ga0157371_10350013 Ga0157371_103500132 89
524 3300013104 Ga0157370_10022524 Ga0157370_1002252413 89
525 3300013104 Ga0157370_10126444 Ga0157370_101264444 89
526 3300013104 Ga0157370_10253314 Ga0157370_102533143 89
527 3300013104 Ga0157370_11103071 Ga0157370_111030711 89
528 3300013104 Ga0157370_11159277 Ga0157370_111592772 89
529 3300013105 Ga0157369_10003258 Ga0157369_1000325819 89
530 3300013105 Ga0157369_10059996 Ga0157369_100599967 89
531 3300013105 Ga0157369_10066496 Ga0157369_100664968 89
532 3300013105 Ga0157369_10138227 Ga0157369_101382273 89
533 3300013105 Ga0157369_10290843 Ga0157369_102908433 89
534 3300013105 Ga0157369_11133067 Ga0157369_111330672 89
535 3300013296 Ga0157374_10000565 Ga0157374_1000056516 89
536 3300013296 Ga0157374_10001076 Ga0157374_1000107634 89
537 3300013296 Ga0157374_10001882 Ga0157374_1000188216 89
538 3300013296 Ga0157374_10025334 Ga0157374_100253343 89
539 3300013296 Ga0157374_10044228 Ga0157374_100442287 89
540 3300013296 Ga0157374_10129323 Ga0157374_101293237 89
541 3300013296 Ga0157374_10157731 Ga0157374_101577317 89
542 3300013296 Ga0157374_10594354 Ga0157374_105943543 89
543 3300013296 Ga0157374_10604295 Ga0157374_106042952 89
544 3300013296 Ga0157374_11083976 Ga0157374_110839762 89
545 3300013296 Ga0157374_11918021 Ga0157374_119180212 89
546 3300013297 Ga0157378_10010736 Ga0157378_1001073614 89
547 3300013297 Ga0157378_10021639 Ga0157378_100216393 89
548 3300013297 Ga0157378_10058507 Ga0157378_100585073 89
549 3300013297 Ga0157378_10165606 Ga0157378_101656063 89
550 3300013297 Ga0157378_10214933 Ga0157378_102149334 89
551 3300013297 Ga0157378_10374383 Ga0157378_103743832 89
552 3300013297 Ga0157378_11384493 Ga0157378_113844932 89
553 3300013297 Ga0157378_11860215 Ga0157378_118602152 89
554 3300013306 Ga0163162_10060008 Ga0163162_100600084 89
555 3300013306 Ga0163162_10684810 Ga0163162_106848102 89
556 3300013306 Ga0163162_11437546 Ga0163162_114375462 89
557 3300013307 Ga0157372_10000670 Ga0157372_1000067039 89
558 3300013307 Ga0157372_10002726 Ga0157372_1000272622 89
559 3300013307 Ga0157372_10687980 Ga0157372_106879802 89
560 3300013307 Ga0157372_11086663 Ga0157372_110866632 89
561 3300013307 Ga0157372_11135780 Ga0157372_111357802 89
562 3300013308 Ga0157375_10039139 Ga0157375_100391398 89
563 3300013308 Ga0157375_10042447 Ga0157375_1004244711 89
564 3300013308 Ga0157375_10237882 Ga0157375_102378823 89
565 3300013308 Ga0157375_10287657 Ga0157375_102876572 89
566 3300013308 Ga0157375_11211781 Ga0157375_112117812 89
567 3300013874 Ga0157514_121480 Ga0157514_1214803 89
568 3300014325 Ga0163163_10000689 Ga0163163_1000068930 89
569 3300014325 Ga0163163_10317037 Ga0163163_103170372 89
570 3300014325 Ga0163163_10417887 Ga0163163_104178873 89
571 3300014325 Ga0163163_12431835 Ga0163163_124318352 89
572 3300014326 Ga0157380_10117219 Ga0157380_101172192 89
573 3300014326 Ga0157380_10198410 Ga0157380_101984103 89
574 3300014326 Ga0157380_13064895 Ga0157380_130648952 89
575 3300014745 Ga0157377_10015248 Ga0157377_100152483 89
576 3300014745 Ga0157377_10056857 Ga0157377_100568573 89
577 3300014745 Ga0157377_11591526 Ga0157377_115915261 89
578 3300014968 Ga0157379_10029119 Ga0157379_1002911910 89
579 3300014968 Ga0157379_10030185 Ga0157379_100301857 89
580 3300014968 Ga0157379_10062576 Ga0157379_100625762 89
581 3300014968 Ga0157379_10103915 Ga0157379_101039152 89
582 3300014968 Ga0157379_12271110 Ga0157379_122711102 89
583 3300014969 Ga0157376_10000001 Ga0157376_1000000183 89
584 3300014969 Ga0157376_10110927 Ga0157376_101109273 89
585 3300014969 Ga0157376_10673519 Ga0157376_106735192 89
586 3300014969 Ga0157376_10874119 Ga0157376_108741192 89
587 3300014969 Ga0157376_11657185 Ga0157376_116571852 89
588 3300014969 Ga0157376_12791261 Ga0157376_127912612 89
589 3300017792 Ga0163161_10121656 Ga0163161_101216562 89
590 3300017792 Ga0163161_10504241 Ga0163161_105042412 89
591 3300020076 Ga0206355_1665954 Ga0206355_16659542 89
592 3300020082 Ga0206353_10244075 Ga0206353_102440751 89
593 3300020082 Ga0206353_10922718 Ga0206353_109227184 89
594 3300020610 Ga0154015_1346800 Ga0154015_13468003 89
595 3300021361 Ga0213872_10001745 Ga0213872_1000174512 89
596 3300021388 Ga0213875_10151352 Ga0213875_101513522 89
597 3300025321 Ga0207656_10172742 Ga0207656_101727421 89
598 3300025893 Ga0207682_10153778 Ga0207682_101537783 89
599 3300025898 Ga0207692_10474147 Ga0207692_104741471 89
600 3300025898 Ga0207692_11037077 Ga0207692_110370771 89
601 3300025899 Ga0207642_10011396 Ga0207642_100113965 89
602 3300025899 Ga0207642_10068490 Ga0207642_100684904 89
603 3300025900 Ga0207710_10123466 Ga0207710_101234662 89
604 3300025903 Ga0207680_10010180 Ga0207680_100101804 89
605 3300025903 Ga0207680_10372310 Ga0207680_103723102 89
606 3300025903 Ga0207680_10435656 Ga0207680_104356562 89
607 3300025903 Ga0207680_10870306 Ga0207680_108703062 89
608 3300025903 Ga0207680_11122379 Ga0207680_111223791 89
609 3300025904 Ga0207647_10008577 Ga0207647_1000857710 89
610 3300025904 Ga0207647_10625569 Ga0207647_106255692 89
611 3300025905 Ga0207685_10022094 Ga0207685_100220945 89
612 3300025906 Ga0207699_10042494 Ga0207699_100424942 89
613 3300025906 Ga0207699_10432796 Ga0207699_104327961 89
614 3300025907 Ga0207645_10005044 Ga0207645_1000504416 89
615 3300025907 Ga0207645_10143075 Ga0207645_101430753 89
616 3300025907 Ga0207645_10282193 Ga0207645_102821932 89
617 3300025908 Ga0207643_10014781 Ga0207643_100147818 89
618 3300025908 Ga0207643_10022628 Ga0207643_100226288 89
619 3300025908 Ga0207643_10856592 Ga0207643_108565921 89
620 3300025909 Ga0207705_10000011 Ga0207705_10000011322 89
621 3300025909 Ga0207705_10000038 Ga0207705_10000038210 89
622 3300025909 Ga0207705_10000167 Ga0207705_1000016783 89
623 3300025909 Ga0207705_10006171 Ga0207705_1000617118 89
624 3300025909 Ga0207705_10007444 Ga0207705_100074441 89
625 3300025909 Ga0207705_10019143 Ga0207705_100191437 89
626 3300025909 Ga0207705_10525686 Ga0207705_105256862 89
627 3300025910 Ga0207684_10046614 Ga0207684_100466143 89
628 3300025910 Ga0207684_10209286 Ga0207684_102092863 89
629 3300025910 Ga0207684_10568375 Ga0207684_105683752 89
630 3300025911 Ga0207654_10000002 Ga0207654_100000021052 89
631 3300025911 Ga0207654_10053235 Ga0207654_100532355 89
632 3300025911 Ga0207654_10116489 Ga0207654_101164892 89
633 3300025911 Ga0207654_10711922 Ga0207654_107119222 89
634 3300025911 Ga0207654_10949269 Ga0207654_109492692 89
635 3300025912 Ga0207707_10003287 Ga0207707_1000328710 89
636 3300025912 Ga0207707_10072140 Ga0207707_100721403 89
637 3300025912 Ga0207707_10144644 Ga0207707_101446444 89
638 3300025912 Ga0207707_10227503 Ga0207707_102275033 89
639 3300025912 Ga0207707_10306010 Ga0207707_103060103 89
640 3300025912 Ga0207707_10690226 Ga0207707_106902262 89
641 3300025913 Ga0207695_10000005 Ga0207695_10000005859 89
642 3300025913 Ga0207695_10051029 Ga0207695_100510292 89
643 3300025913 Ga0207695_10096000 Ga0207695_100960004 89
644 3300025913 Ga0207695_10209706 Ga0207695_102097063 89
645 3300025913 Ga0207695_10223098 Ga0207695_102230985 89
646 3300025913 Ga0207695_10731065 Ga0207695_107310652 89
647 3300025914 Ga0207671_10066252 Ga0207671_100662524 89
648 3300025914 Ga0207671_10274153 Ga0207671_102741532 89
649 3300025914 Ga0207671_10583590 Ga0207671_105835902 89
650 3300025914 Ga0207671_10884974 Ga0207671_108849743 89
651 3300025915 Ga0207693_10292792 Ga0207693_102927923 89
652 3300025915 Ga0207693_10293235 Ga0207693_102932353 89
653 3300025915 Ga0207693_11302437 Ga0207693_113024372 89
654 3300025916 Ga0207663_10024879 Ga0207663_100248793 89
655 3300025917 Ga0207660_10000748 Ga0207660_1000074823 89
656 3300025917 Ga0207660_10031712 Ga0207660_100317128 89
657 3300025917 Ga0207660_10143092 Ga0207660_101430922 89
658 3300025917 Ga0207660_10807668 Ga0207660_108076682 89
659 3300025917 Ga0207660_11128405 Ga0207660_111284052 89
660 3300025917 Ga0207660_11520174 Ga0207660_115201742 89
661 3300025917 Ga0207660_11522996 Ga0207660_115229962 89
662 3300025918 Ga0207662_10183113 Ga0207662_101831133 89
663 3300025918 Ga0207662_10415489 Ga0207662_104154892 89
664 3300025918 Ga0207662_10657989 Ga0207662_106579892 89
665 3300025918 Ga0207662_10748147 Ga0207662_107481472 89
666 3300025918 Ga0207662_11342533 Ga0207662_113425332 89
667 3300025918 Ga0207662_11376819 Ga0207662_113768191 89
668 3300025919 Ga0207657_10000280 Ga0207657_100002804 89
669 3300025919 Ga0207657_10000804 Ga0207657_1000080433 89
670 3300025919 Ga0207657_10006928 Ga0207657_1000692819 89
671 3300025919 Ga0207657_10016230 Ga0207657_1001623010 89
672 3300025919 Ga0207657_10488203 Ga0207657_104882032 89
673 3300025920 Ga0207649_10576597 Ga0207649_105765972 89
674 3300025920 Ga0207649_10950836 Ga0207649_109508361 89
675 3300025920 Ga0207649_11197753 Ga0207649_111977532 89
676 3300025921 Ga0207652_10007578 Ga0207652_1000757818 89
677 3300025921 Ga0207652_10008454 Ga0207652_1000845418 89
678 3300025921 Ga0207652_10013911 Ga0207652_100139117 89
679 3300025921 Ga0207652_10017326 Ga0207652_100173267 89
680 3300025921 Ga0207652_10047579 Ga0207652_100475797 89
681 3300025921 Ga0207652_10056559 Ga0207652_100565593 89
682 3300025921 Ga0207652_10130422 Ga0207652_101304223 89
683 3300025921 Ga0207652_10194495 Ga0207652_101944952 89
684 3300025921 Ga0207652_10296884 Ga0207652_102968842 89
685 3300025921 Ga0207652_10968734 Ga0207652_109687341 89
686 3300025921 Ga0207652_10979782 Ga0207652_109797822 89
687 3300025921 Ga0207652_10997420 Ga0207652_109974202 89
688 3300025921 Ga0207652_10998260 Ga0207652_109982602 89
689 3300025921 Ga0207652_11136868 Ga0207652_111368682 89
690 3300025922 Ga0207646_10004914 Ga0207646_1000491417 89
691 3300025922 Ga0207646_10188618 Ga0207646_101886183 89
692 3300025922 Ga0207646_10298443 Ga0207646_102984432 89
693 3300025922 Ga0207646_10543196 Ga0207646_105431962 89
694 3300025923 Ga0207681_10044851 Ga0207681_100448518 89
695 3300025923 Ga0207681_11525745 Ga0207681_115257452 89
696 3300025924 Ga0207694_10000232 Ga0207694_1000023245 89
697 3300025924 Ga0207694_10297488 Ga0207694_102974883 89
698 3300025924 Ga0207694_10369919 Ga0207694_103699193 89
699 3300025924 Ga0207694_10471729 Ga0207694_104717293 89
700 3300025924 Ga0207694_10905252 Ga0207694_109052522 89
701 3300025924 Ga0207694_11515029 Ga0207694_115150291 89
702 3300025925 Ga0207650_10051370 Ga0207650_100513703 89
703 3300025925 Ga0207650_10183495 Ga0207650_101834954 89
704 3300025926 Ga0207659_10154532 Ga0207659_101545324 89
705 3300025926 Ga0207659_10369763 Ga0207659_103697632 89
706 3300025926 Ga0207659_10400232 Ga0207659_104002322 89
707 3300025927 Ga0207687_10000030 Ga0207687_10000030108 89
708 3300025927 Ga0207687_10000318 Ga0207687_1000031833 89
709 3300025927 Ga0207687_10008644 Ga0207687_100086443 89
710 3300025927 Ga0207687_10015188 Ga0207687_1001518810 89
711 3300025927 Ga0207687_10026767 Ga0207687_100267678 89
712 3300025927 Ga0207687_10257708 Ga0207687_102577082 89
713 3300025927 Ga0207687_10343208 Ga0207687_103432081 89
714 3300025927 Ga0207687_10985624 Ga0207687_109856242 89
715 3300025928 Ga0207700_10000077 Ga0207700_1000007752 89
716 3300025928 Ga0207700_10003616 Ga0207700_1000361613 89
717 3300025928 Ga0207700_10905879 Ga0207700_109058792 89
718 3300025929 Ga0207664_10003229 Ga0207664_100032296 89
719 3300025929 Ga0207664_10014803 Ga0207664_1001480312 89
720 3300025931 Ga0207644_10000001 Ga0207644_10000001975 89
721 3300025931 Ga0207644_10003510 Ga0207644_100035108 89
722 3300025931 Ga0207644_10020573 Ga0207644_100205734 89
723 3300025931 Ga0207644_10106804 Ga0207644_101068043 89
724 3300025931 Ga0207644_10564013 Ga0207644_105640133 89
725 3300025932 Ga0207690_10000521 Ga0207690_1000052123 89
726 3300025932 Ga0207690_10163984 Ga0207690_101639843 89
727 3300025932 Ga0207690_10226334 Ga0207690_102263344 89
728 3300025933 Ga0207706_10068780 Ga0207706_100687804 89
729 3300025934 Ga0207686_10000001 Ga0207686_10000001700 89
730 3300025934 Ga0207686_10000521 Ga0207686_1000052116 89
731 3300025934 Ga0207686_10005025 Ga0207686_1000502510 89
732 3300025934 Ga0207686_10015693 Ga0207686_100156935 89
733 3300025934 Ga0207686_10088578 Ga0207686_100885784 89
734 3300025934 Ga0207686_10188335 Ga0207686_101883352 89
735 3300025935 Ga0207709_10000002 Ga0207709_10000002818 89
736 3300025935 Ga0207709_10006627 Ga0207709_100066275 89
737 3300025935 Ga0207709_10008424 Ga0207709_1000842411 89
738 3300025935 Ga0207709_10256442 Ga0207709_102564422 89
739 3300025935 Ga0207709_11293062 Ga0207709_112930622 89
740 3300025936 Ga0207670_10035982 Ga0207670_100359826 89
741 3300025936 Ga0207670_10657956 Ga0207670_106579561 89
742 3300025936 Ga0207670_11367464 Ga0207670_113674642 89
743 3300025937 Ga0207669_10027599 Ga0207669_100275996 89
744 3300025937 Ga0207669_10040466 Ga0207669_100404667 89
745 3300025937 Ga0207669_10142350 Ga0207669_101423503 89
746 3300025938 Ga0207704_10018134 Ga0207704_100181348 89
747 3300025938 Ga0207704_10390402 Ga0207704_103904021 89
748 3300025938 Ga0207704_11968198 Ga0207704_119681981 89
749 3300025939 Ga0207665_10133250 Ga0207665_101332503 89
750 3300025939 Ga0207665_10163137 Ga0207665_101631374 89
751 3300025939 Ga0207665_10168544 Ga0207665_101685441 89
752 3300025940 Ga0207691_10054461 Ga0207691_100544617 89
753 3300025940 Ga0207691_10126313 Ga0207691_101263133 89
754 3300025940 Ga0207691_11229119 Ga0207691_112291192 89
755 3300025941 Ga0207711_10007779 Ga0207711_1000777916 89
756 3300025941 Ga0207711_10028146 Ga0207711_100281465 89
757 3300025941 Ga0207711_10112488 Ga0207711_101124884 89
758 3300025941 Ga0207711_10230905 Ga0207711_102309052 89
759 3300025941 Ga0207711_11305411 Ga0207711_113054112 89
760 3300025942 Ga0207689_10000292 Ga0207689_1000029241 89
761 3300025942 Ga0207689_10000370 Ga0207689_1000037016 89
762 3300025942 Ga0207689_10017314 Ga0207689_1001731411 89
763 3300025942 Ga0207689_10371921 Ga0207689_103719213 89
764 3300025944 Ga0207661_10000021 Ga0207661_10000021176 89
765 3300025944 Ga0207661_10002824 Ga0207661_1000282414 89
766 3300025944 Ga0207661_10084193 Ga0207661_100841934 89
767 3300025944 Ga0207661_10159071 Ga0207661_101590712 89
768 3300025944 Ga0207661_10253160 Ga0207661_102531603 89
769 3300025944 Ga0207661_10441959 Ga0207661_104419591 89
770 3300025944 Ga0207661_10854015 Ga0207661_108540152 89
771 3300025944 Ga0207661_11104487 Ga0207661_111044871 89
772 3300025944 Ga0207661_11995849 Ga0207661_119958492 89
773 3300025945 Ga0207679_10303101 Ga0207679_103031013 89
774 3300025945 Ga0207679_10447699 Ga0207679_104476991 89
775 3300025945 Ga0207679_10876936 Ga0207679_108769362 89
776 3300025949 Ga0207667_10000008 Ga0207667_10000008145 89
777 3300025949 Ga0207667_10000299 Ga0207667_1000029910 89
778 3300025949 Ga0207667_10000339 Ga0207667_1000033928 89
779 3300025949 Ga0207667_10023417 Ga0207667_100234177 89
780 3300025949 Ga0207667_10087215 Ga0207667_100872156 89
781 3300025949 Ga0207667_10431219 Ga0207667_104312192 89
782 3300025949 Ga0207667_10631152 Ga0207667_106311522 89
783 3300025949 Ga0207667_10649009 Ga0207667_106490093 89
784 3300025949 Ga0207667_10740028 Ga0207667_107400282 89
785 3300025949 Ga0207667_11287606 Ga0207667_112876062 89
786 3300025949 Ga0207667_11305912 Ga0207667_113059122 89
787 3300025949 Ga0207667_11369619 Ga0207667_113696192 89
788 3300025960 Ga0207651_10000203 Ga0207651_1000020330 89
789 3300025960 Ga0207651_10038713 Ga0207651_100387132 89
790 3300025960 Ga0207651_10054318 Ga0207651_100543183 89
791 3300025961 Ga0207712_10001459 Ga0207712_1000145918 89
792 3300025961 Ga0207712_10015338 Ga0207712_1001533811 89
793 3300025961 Ga0207712_10280366 Ga0207712_102803663 89
794 3300025961 Ga0207712_11950706 Ga0207712_119507062 89
795 3300025972 Ga0207668_10621333 Ga0207668_106213332 89
796 3300025981 Ga0207640_10609573 Ga0207640_106095732 89
797 3300025981 Ga0207640_11690498 Ga0207640_116904982 89
798 3300025986 Ga0207658_10000003 Ga0207658_10000003578 89
799 3300025986 Ga0207658_10002651 Ga0207658_1000265110 89
800 3300025986 Ga0207658_11081093 Ga0207658_110810932 89
801 3300025986 Ga0207658_11510997 Ga0207658_115109972 89
802 3300026023 Ga0207677_10001880 Ga0207677_100018808 89
803 3300026023 Ga0207677_12129978 Ga0207677_121299781 89
804 3300026035 Ga0207703_10000517 Ga0207703_1000051716 89
805 3300026035 Ga0207703_10043986 Ga0207703_100439862 89
806 3300026035 Ga0207703_10283662 Ga0207703_102836624 89
807 3300026035 Ga0207703_11786449 Ga0207703_117864492 89
808 3300026041 Ga0207639_10502283 Ga0207639_105022832 89
809 3300026041 Ga0207639_11190245 Ga0207639_111902451 89
810 3300026041 Ga0207639_11677116 Ga0207639_116771162 89
811 3300026041 Ga0207639_11891464 Ga0207639_118914641 89
812 3300026067 Ga0207678_10049262 Ga0207678_100492627 89
813 3300026067 Ga0207678_10171922 Ga0207678_101719222 89
814 3300026075 Ga0207708_10004151 Ga0207708_1000415116 89
815 3300026075 Ga0207708_10109455 Ga0207708_101094552 89
816 3300026078 Ga0207702_10000001 Ga0207702_10000001844 89
817 3300026078 Ga0207702_10001268 Ga0207702_1000126833 89
818 3300026078 Ga0207702_10003219 Ga0207702_1000321920 89
819 3300026078 Ga0207702_10023468 Ga0207702_1002346811 89
820 3300026078 Ga0207702_10184378 Ga0207702_101843785 89
821 3300026078 Ga0207702_10213107 Ga0207702_102131072 89
822 3300026078 Ga0207702_10402809 Ga0207702_104028092 89
823 3300026078 Ga0207702_10644031 Ga0207702_106440312 89
824 3300026078 Ga0207702_11003924 Ga0207702_110039242 89
825 3300026078 Ga0207702_11058965 Ga0207702_110589652 89
826 3300026088 Ga0207641_10002453 Ga0207641_1000245320 89
827 3300026088 Ga0207641_10016989 Ga0207641_100169897 89
828 3300026088 Ga0207641_10074503 Ga0207641_100745037 89
829 3300026088 Ga0207641_10080247 Ga0207641_100802476 89
830 3300026088 Ga0207641_11243983 Ga0207641_112439832 89
831 3300026089 Ga0207648_10055064 Ga0207648_100550642 89
832 3300026089 Ga0207648_10063803 Ga0207648_100638032 89
833 3300026089 Ga0207648_10067573 Ga0207648_100675737 89
834 3300026089 Ga0207648_10190278 Ga0207648_101902783 89
835 3300026089 Ga0207648_10390358 Ga0207648_103903584 89
836 3300026089 Ga0207648_10415731 Ga0207648_104157312 89
837 3300026095 Ga0207676_10000167 Ga0207676_1000016729 89
838 3300026116 Ga0207674_10000001 Ga0207674_10000001395 89
839 3300026116 Ga0207674_10005648 Ga0207674_1000564811 89
840 3300026116 Ga0207674_10513650 Ga0207674_105136503 89
841 3300026116 Ga0207674_10928517 Ga0207674_109285173 89
842 3300026116 Ga0207674_11454072 Ga0207674_114540722 89
843 3300026116 Ga0207674_12144067 Ga0207674_121440671 89
844 3300026116 Ga0207674_12162519 Ga0207674_121625191 89
845 3300026116 Ga0207674_12293146 Ga0207674_122931462 89
846 3300026118 Ga0207675_100013573 Ga0207675_1000135733 89
847 3300026118 Ga0207675_100059255 Ga0207675_1000592557 89
848 3300026118 Ga0207675_100204893 Ga0207675_1002048935 89
849 3300026118 Ga0207675_100848329 Ga0207675_1008483292 89
850 3300026118 Ga0207675_100955207 Ga0207675_1009552072 89
851 3300026118 Ga0207675_102023718 Ga0207675_1020237182 89
852 3300026121 Ga0207683_10000965 Ga0207683_1000096530 89
853 3300026121 Ga0207683_10002331 Ga0207683_100023312 89
854 3300026121 Ga0207683_10041485 Ga0207683_100414858 89
855 3300026121 Ga0207683_10046413 Ga0207683_100464138 89
856 3300026121 Ga0207683_10375895 Ga0207683_103758952 89
857 3300026142 Ga0207698_10233471 Ga0207698_102334712 89
858 3300026142 Ga0207698_10657098 Ga0207698_106570982 89
859 3300026142 Ga0207698_11663835 Ga0207698_116638352 89
860 3300027717 Ga0209998_10096500 Ga0209998_100965001 89
861 3300027866 Ga0209813_10000009 Ga0209813_1000000936 89
862 3300027907 Ga0207428_10396859 Ga0207428_103968591 89
863 3300028379 Ga0268266_10003734 Ga0268266_1000373411 89
864 3300028379 Ga0268266_10034899 Ga0268266_100348994 89
865 3300028379 Ga0268266_10103455 Ga0268266_101034555 89
866 3300028379 Ga0268266_10313573 Ga0268266_103135733 89
867 3300028379 Ga0268266_10659292 Ga0268266_106592923 89
868 3300028380 Ga0268265_10188685 Ga0268265_101886854 89
869 3300028380 Ga0268265_10220988 Ga0268265_102209883 89
870 3300028381 Ga0268264_10044828 Ga0268264_100448288 89
871 3300028381 Ga0268264_10103423 Ga0268264_101034232 89
872 3300028381 Ga0268264_10121832 Ga0268264_101218323 89
873 3300028381 Ga0268264_10144907 Ga0268264_101449072 89
874 3300028381 Ga0268264_10305734 Ga0268264_103057342 89
875 3300028381 Ga0268264_11483023 Ga0268264_114830232 89
876 3300028381 Ga0268264_11655216 Ga0268264_116552162 89
877 3300028381 Ga0268264_11988178 Ga0268264_119881782 89
878 3300028381 Ga0268264_12700054 Ga0268264_127000542 89
879 3300028556 Ga0265337_1000001 Ga0265337_100000183 89
880 3300028556 Ga0265337_1058922 Ga0265337_10589223 89
881 3300028556 Ga0265337_1065250 Ga0265337_10652502 89
882 3300028556 Ga0265337_1071695 Ga0265337_10716952 89
883 3300028558 Ga0265326_10005024 Ga0265326_100050241 89
884 3300028558 Ga0265326_10018388 Ga0265326_100183882 89
885 3300028558 Ga0265326_10071393 Ga0265326_100713932 89
886 3300028563 Ga0265319_1179800 Ga0265319_11798001 89
887 3300028573 Ga0265334_10000049 Ga0265334_1000004919 89
888 3300028573 Ga0265334_10000114 Ga0265334_1000011427 89
889 3300028573 Ga0265334_10046542 Ga0265334_100465424 89
890 3300028573 Ga0265334_10115392 Ga0265334_101153922 89
891 3300028573 Ga0265334_10127792 Ga0265334_101277922 89
892 3300028577 Ga0265318_10111693 Ga0265318_101116931 89
893 3300028654 Ga0265322_10009918 Ga0265322_100099186 89
894 3300028654 Ga0265322_10038325 Ga0265322_100383251 89
895 3300028654 Ga0265322_10123932 Ga0265322_101239322 89
896 3300028666 Ga0265336_10000618 Ga0265336_1000061816 89
897 3300028666 Ga0265336_10135916 Ga0265336_101359161 89
898 3300028666 Ga0265336_10171602 Ga0265336_101716022 89
899 3300028794 Ga0307515_10370836 Ga0307515_103708362 89
900 3300028800 Ga0265338_10000003 Ga0265338_10000003498 89
901 3300028800 Ga0265338_10000052 Ga0265338_1000005260 89
902 3300028800 Ga0265338_10000054 Ga0265338_10000054142 89
903 3300028800 Ga0265338_10000217 Ga0265338_10000217111 89
904 3300028800 Ga0265338_10000366 Ga0265338_1000036636 89
905 3300028800 Ga0265338_10000543 Ga0265338_1000054342 89
906 3300028800 Ga0265338_10003025 Ga0265338_100030255 89
907 3300028800 Ga0265338_10009585 Ga0265338_1000958516 89
908 3300028800 Ga0265338_10017457 Ga0265338_100174577 89
909 3300028800 Ga0265338_10035997 Ga0265338_100359975 89
910 3300028800 Ga0265338_10085544 Ga0265338_100855445 89
911 3300028800 Ga0265338_10091843 Ga0265338_100918435 89
912 3300028800 Ga0265338_10099324 Ga0265338_100993246 89
913 3300028800 Ga0265338_10205341 Ga0265338_102053412 89
914 3300028800 Ga0265338_10490193 Ga0265338_104901932 89
915 3300028800 Ga0265338_10649072 Ga0265338_106490721 89
916 3300028800 Ga0265338_10687104 Ga0265338_106871041 89
917 3300028800 Ga0265338_11072257 Ga0265338_110722572 89
918 3300029957 Ga0265324_10000002 Ga0265324_1000000279 89
919 3300029957 Ga0265324_10000500 Ga0265324_1000050030 89
920 3300029957 Ga0265324_10002972 Ga0265324_100029724 89
921 3300029957 Ga0265324_10022661 Ga0265324_100226612 89
922 3300029957 Ga0265324_10050377 Ga0265324_100503772 89
923 3300030731 Ga0316177_1067570 Ga0316177_10675703 89
924 3300030732 Ga0316176_1094613 Ga0316176_10946136 89
925 3300030733 Ga0314311_1158944 Ga0314311_11589445 89
926 3300030733 Ga0314311_1244055 Ga0314311_12440556 89
927 3300030734 Ga0316179_1102296 Ga0316179_11022963 89
928 3300030735 Ga0316178_1025775 Ga0316178_10257752 89
929 3300030736 Ga0316180_1156767 Ga0316180_11567672 89
930 3300030742 Ga0316183_1139050 Ga0316183_11390502 89
931 3300030744 Ga0316181_1237823 Ga0316181_12378233 89
932 3300031238 Ga0265332_10312940 Ga0265332_103129402 89
933 3300031240 Ga0265320_10115375 Ga0265320_101153753 89
934 3300031241 Ga0265325_10001662 Ga0265325_100016627 89
935 3300031247 Ga0265340_10000521 Ga0265340_1000052111 89
936 3300031249 Ga0265339_10015627 Ga0265339_100156278 89
937 3300031249 Ga0265339_10286876 Ga0265339_102868762 89
938 3300031250 Ga0265331_10000050 Ga0265331_10000050127 89
939 3300031250 Ga0265331_10008042 Ga0265331_100080425 89
940 3300031250 Ga0265331_10019045 Ga0265331_100190451 89
941 3300031250 Ga0265331_10300793 Ga0265331_103007932 89
942 3300031250 Ga0265331_10415547 Ga0265331_104155472 89
943 3300031251 Ga0265327_10000109 Ga0265327_1000010998 89
944 3300031251 Ga0265327_10009306 Ga0265327_100093068 89
945 3300031251 Ga0265327_10010524 Ga0265327_100105243 89
946 3300031251 Ga0265327_10034073 Ga0265327_100340737 89
947 3300031251 Ga0265327_10106909 Ga0265327_101069093 89
948 3300031251 Ga0265327_10114436 Ga0265327_101144362 89
949 3300031251 Ga0265327_10116624 Ga0265327_101166242 89
950 3300031251 Ga0265327_10237053 Ga0265327_102370531 89
951 3300031251 Ga0265327_10282438 Ga0265327_102824382 89
952 3300031344 Ga0265316_10061349 Ga0265316_100613498 89
953 3300031344 Ga0265316_10104449 Ga0265316_101044494 89
954 3300031344 Ga0265316_10148230 Ga0265316_101482304 89
955 3300031344 Ga0265316_10178367 Ga0265316_101783672 89
956 3300031344 Ga0265316_10263153 Ga0265316_102631532 89
957 3300031344 Ga0265316_10413648 Ga0265316_104136481 89
958 3300031344 Ga0265316_10446833 Ga0265316_104468333 89
959 3300031344 Ga0265316_10962904 Ga0265316_109629042 89
960 3300031456 Ga0307513_10942323 Ga0307513_109423231 89
961 3300031548 Ga0307408_100293872 Ga0307408_1002938723 89
962 3300031595 Ga0265313_10054666 Ga0265313_100546664 89
963 3300031595 Ga0265313_10060644 Ga0265313_100606442 89
964 3300031616 Ga0307508_10771347 Ga0307508_107713471 89
965 3300031665 Ga0316575_10003983 Ga0316575_100039835 89
966 3300031665 Ga0316575_10180482 Ga0316575_101804822 89
967 3300031691 Ga0316579_10000952 Ga0316579_100009528 89
968 3300031711 Ga0265314_10001521 Ga0265314_1000152116 89
969 3300031711 Ga0265314_10055535 Ga0265314_100555358 89
970 3300031711 Ga0265314_10075317 Ga0265314_100753171 89
971 3300031711 Ga0265314_10075432 Ga0265314_100754322 89
972 3300031711 Ga0265314_10138110 Ga0265314_101381103 89
973 3300031712 Ga0265342_10056065 Ga0265342_100560656 89
974 3300031712 Ga0265342_10059252 Ga0265342_100592523 89
975 3300031727 Ga0316576_10004152 Ga0316576_100041522 89
976 3300031727 Ga0316576_10400550 Ga0316576_104005502 89
977 3300031728 Ga0316578_10116230 Ga0316578_101162302 89
978 3300031728 Ga0316578_10201448 Ga0316578_102014482 89
979 3300031730 Ga0307516_10307900 Ga0307516_103079002 89
980 3300031731 Ga0307405_10718617 Ga0307405_107186172 89
981 3300031733 Ga0316577_10141437 Ga0316577_101414372 89
982 3300031733 Ga0316577_10903634 Ga0316577_109036341 89
983 3300031824 Ga0307413_10365835 Ga0307413_103658351 89
984 3300031903 Ga0307407_11446865 Ga0307407_114468651 89
985 3300032002 Ga0307416_103365274 Ga0307416_1033652741 89
986 3300032004 Ga0307414_11252104 Ga0307414_112521042 89
987 3300032005 Ga0307411_10434820 Ga0307411_104348203 89
988 3300032126 Ga0307415_100217593 Ga0307415_1002175933 89
989 3300032133 Ga0316583_10002208 Ga0316583_100022084 89
990 3300032133 Ga0316583_10032677 Ga0316583_100326772 89
991 3300032137 Ga0316585_10110045 Ga0316585_101100452 89
992 3300032168 Ga0316593_10000192 Ga0316593_1000019214 89
993 3300032168 Ga0316593_10005887 Ga0316593_100058871 89
994 3300032168 Ga0316593_10014395 Ga0316593_100143955 89
995 3300032168 Ga0316593_10125998 Ga0316593_101259982 89
996 3300033527 Ga0316586_1007742 Ga0316586_10077423 89
997 3300033529 Ga0316587_1014693 Ga0316587_10146931 89
998 3300033541 Ga0316596_1077721 Ga0316596_10777212 89
999 3300034817 Ga0373948_0047199 Ga0373948_0047199_433_738 89
1000 3300035086 Ga0373934_0001385 Ga0373934_0001385_846_1151 89
1001 3300035089 Ga0373944_0004129 Ga0373944_0004129_2693_2998 89
1002 3300035091 Ga0373951_0060477 Ga0373951_0060477_255_560 89
1003 3300035111 Ga0373923_0003643 Ga0373923_0003643_3475_3780 89
1004 3300035111 Ga0373923_0487143 Ga0373923_0487143_181_486 89
1005 3300035113 Ga0373936_0134195 Ga0373936_0134195_127_432 89
1006 3300035114 Ga0373939_0394411 Ga0373939_0394411_249_554 89
1007 3300035115 Ga0373941_0116157 Ga0373941_0116157_383_688 89
1008 3300035116 Ga0373945_0152160 Ga0373945_0152160_424_729 89
1009 3300035116 Ga0373945_0430186 Ga0373945_0430186_108_413 89
1010 3300035117 Ga0373953_0003257 Ga0373953_0003257_391_696 89
1011 3300035118 Ga0373954_0010327 Ga0373954_0010327_72_377 89
1012 3300035118 Ga0373954_0341443 Ga0373954_0341443_72_377 89
1013 3300035118 Ga0373954_0420246 Ga0373954_0420246_75_380 89
1014 3300035119 Ga0373956_0184605 Ga0373956_0184605_401_706 89
1015 3300035119 Ga0373956_0221180 Ga0373956_0221180_266_571 89
1016 3300035119 Ga0373956_0509410 Ga0373956_0509410_246_551 89
1017 3300035120 Ga0373957_0018186 Ga0373957_0018186_1793_2098 89
1018 3300035120 Ga0373957_0320900 Ga0373957_0320900_276_581 89
1019 3300035121 Ga0373960_0031594 Ga0373960_0031594_645_950 89
1020 3300035170 Ga0373943_0039852 Ga0373943_0039852_1889_2194 89
1021 3300035170 Ga0373943_0141017 Ga0373943_0141017_640_945 89
1022 3300035170 Ga0373943_0917103 Ga0373943_0917103_55_360 89
1023 3300035171 Ga0373946_0187961 Ga0373946_0187961_451_756 89
1024 3300035172 Ga0373955_0008568 Ga0373955_0008568_578_883 89
1025 3300035172 Ga0373955_0082639 Ga0373955_0082639_69_374 89
1026 3300035398 Ga0316574_0000624 Ga0316574_0000624_8686_8991 89
1027 3300035398 Ga0316574_0028540 Ga0316574_0028540_1545_1850 89
1028 3300035398 Ga0316574_0371676 Ga0316574_0371676_208_510 89
1029 3300035398 Ga0316574_0445870 Ga0316574_0445870_14_319 89
1030 3300035410 Ga0373924_0000835 Ga0373924_0000835_1354_1659 89
1031 3300035410 Ga0373924_0005225 Ga0373924_0005225_1565_1870 89
1032 3300035410 Ga0373924_0102692 Ga0373924_0102692_820_1125 89
1033 3300035691 Ga0373931_0217568 Ga0373931_0217568_178_483 89
1034 3300035691 Ga0373931_0285379 Ga0373931_0285379_405_710 89
1035 3300035692 Ga0373935_0057224 Ga0373935_0057224_1788_2093 89
1036 3300035692 Ga0373935_0110058 Ga0373935_0110058_461_766 89
1037 3300035692 Ga0373935_0288115 Ga0373935_0288115_520_825 89
1038 3300035692 Ga0373935_0366602 Ga0373935_0366602_351_656 89
1039 3300035692 Ga0373935_0479919 Ga0373935_0479919_262_567 89
1040 3300035695 Ga0373927_0031676 Ga0373927_0031676_2736_3041 89
1041 3300035695 Ga0373927_0034603 Ga0373927_0034603_1383_1688 89
1042 3300035695 Ga0373927_0144358 Ga0373927_0144358_1224_1529 89
1043 3300035725 Ga0373947_0180653 Ga0373947_0180653_154_459 89
1044 3300035725 Ga0373947_0418832 Ga0373947_0418832_328_633 89
1045 3300035725 Ga0373947_0621701 Ga0373947_0621701_97_402 89
1046 3300035725 Ga0373947_1143924 Ga0373947_1143924_159_464 89
1047 3300036401 Ga0373937_0065847 Ga0373937_0065847_1491_1796 89
1048 3300036401 Ga0373937_0388613 Ga0373937_0388613_386_691 89
1049 3300036401 Ga0373937_0568946 Ga0373937_0568946_540_845 89
1050 3300036647 Ga0316582_0002553 Ga0316582_0002553_1334_1639 89
1051 3300036647 Ga0316582_0226216 Ga0316582_0226216_872_1177 89
1052 3300036647 Ga0316582_0667790 Ga0316582_0667790_43_348 89
1053 3300036712 Ga0316584_0047720 Ga0316584_0047720_940_1245 89
1054 3300037068 Ga0373925_0044970 Ga0373925_0044970_2387_2692 89
1055 3300037068 Ga0373925_0058172 Ga0373925_0058172_2260_2565 89
1056 3300037068 Ga0373925_0063911 Ga0373925_0063911_2435_2740 89
1057 3300037068 Ga0373925_0391982 Ga0373925_0391982_514_819 89
1058 3300037068 Ga0373925_1257303 Ga0373925_1257303_122_427 89
1059 3300037312 Ga0395899_0003098 Ga0395899_0003098_11283_11552 89
1060 3300037312 Ga0395899_0058565 Ga0395899_0058565_700_969 89
1061 3300037312 Ga0395899_0253422 Ga0395899_0253422_443_712 89
1062 3300037312 Ga0395899_0747026 Ga0395899_0747026_41_310 89
1063 3300037418 Ga0395900_0001412 Ga0395900_0001412_22721_22990 89
1064 3300037418 Ga0395900_0003612 Ga0395900_0003612_12466_12735 89
1065 3300037418 Ga0395900_0007425 Ga0395900_0007425_10616_10885 89
1066 3300037418 Ga0395900_0083127 Ga0395900_0083127_2594_2863 89
1067 3300037418 Ga0395900_0230270 Ga0395900_0230270_1181_1450 89
1068 3300037418 Ga0395900_0254362 Ga0395900_0254362_125_394 89
1069 3300037418 Ga0395900_0291831 Ga0395900_0291831_1028_1297 89
1070 3300037418 Ga0395900_1596364 Ga0395900_1596364_95_364 89
1071 3300037466 Ga0395898_0002536 Ga0395898_0002536_11329_11598 89
1072 3300037466 Ga0395898_0022692 Ga0395898_0022692_5868_6137 89
1073 3300037466 Ga0395898_0043059 Ga0395898_0043059_3265_3534 89
1074 3300037466 Ga0395898_0129171 Ga0395898_0129171_1787_2089 89
1075 3300037466 Ga0395898_0334575 Ga0395898_0334575_1002_1271 89
1076 3300037466 Ga0395898_1066782 Ga0395898_1066782_70_339 89
1077 3300037471 Ga0395905_0000238 Ga0395905_0000238_75779_76048 89
1078 3300037471 Ga0395905_0008237 Ga0395905_0008237_8663_8932 89
1079 3300037471 Ga0395905_0039862 Ga0395905_0039862_468_737 89
1080 3300037471 Ga0395905_0572892 Ga0395905_0572892_152_421 89
1081 3300037471 Ga0395905_1051475 Ga0395905_1051475_249_551 89
1082 3300037588 Ga0316581_0001079 Ga0316581_0001079_2437_2742 89
1083 3300037853 Ga0436364_0155867 Ga0436364_0155867_386_691 89
1084 3300038443 Ga0395901_0008414 Ga0395901_0008414_5689_5958 89
1085 3300038443 Ga0395901_0069107 Ga0395901_0069107_478_747 89
1086 3300038443 Ga0395901_0421595 Ga0395901_0421595_691_960 89
1087 3300038443 Ga0395901_0503058 Ga0395901_0503058_84_353 89
1088 3300038443 Ga0395901_2056643 Ga0395901_2056643_135_437 89
1089 3300038996 Ga0242420_027369 Ga0242420_027369_448_873 89
1090 3300039438 Ga0436360_1155810 Ga0436360_1155810_272_577 89
1091 3300039447 Ga0436361_0050017 Ga0436361_0050017_19486_19791 89
1092 3300039447 Ga0436361_0639184 Ga0436361_0639184_91_396 89
1093 3300039447 Ga0436361_0718323 Ga0436361_0718323_193_498 89
1094 3300041459 Ga0451800_0118075 Ga0451800_0118075_593_862 89
1095 3300041459 Ga0451800_0640511 Ga0451800_0640511_200_469 89
1096 3300041486 Ga0451807_1349481 Ga0451807_1349481_2197_2466 89
1097 3300041507 Ga0451851_1235575 Ga0451851_1235575_99_368 89
1098 3300041511 Ga0451855_0198077 Ga0451855_0198077_28_333 89
1099 3300041512 Ga0451853_2112008 Ga0451853_2112008_206_511 89
1100 3300041997 Ga0439431_0052111 Ga0439431_0052111_427_696 89
1101 3300042005 Ga0439448_0133959 Ga0439448_0133959_175_480 89
1102 3300042006 Ga0439432_230863 Ga0439432_230863_51_320 89
1103 3300042876 Ga0451577_0044456 Ga0451577_0044456_1706_2011 89
1104 3300042876 Ga0451577_0064949 Ga0451577_0064949_2603_2908 89
1105 3300042876 Ga0451577_0420337 Ga0451577_0420337_776_1081 89
1106 3300042876 Ga0451577_0608581 Ga0451577_0608581_162_467 89
1107 3300042876 Ga0451577_0929866 Ga0451577_0929866_236_541 89
1108 3300044656 Ga0466969_0002476 Ga0466969_0002476_2557_2862 89
1109 3300044673 Ga0453683_0030079 Ga0453683_0030079_1875_2180 89
1110 3300044684 Ga0466966_0117105 Ga0466966_0117105_129_434 89
1111 3300044694 Ga0466963_1236540 Ga0466963_1236540_82_351 89
1112 3300044712 Ga0453684_0000989 Ga0453684_0000989_85882_86187 89
1113 3300044712 Ga0453684_0065104 Ga0453684_0065104_43_348 89
1114 3300044712 Ga0453684_0177715 Ga0453684_0177715_1770_2075 89
1115 3300044712 Ga0453684_0692456 Ga0453684_0692456_420_725 89
1116 3300044712 Ga0453684_1181452 Ga0453684_1181452_466_771 89
1117 3300044712 Ga0453684_1766408 Ga0453684_1766408_60_365 89
1118 3300044712 Ga0453684_1798289 Ga0453684_1798289_203_508 89
1119 3300044765 Ga0466970_0186437 Ga0466970_0186437_599_904 89
1120 3300044765 Ga0466970_0229101 Ga0466970_0229101_98_403 89
1121 3300044765 Ga0466970_0238164 Ga0466970_0238164_80_349 89
1122 3300044842 Ga0466957_0962489 Ga0466957_0962489_225_530 89
1123 3300045049 Ga0466959_0013856 Ga0466959_0013856_71_376 89
1124 3300045051 Ga0451576_0002065 Ga0451576_0002065_154_456 89
1125 3300045051 Ga0451576_0010036 Ga0451576_0010036_5536_5841 89
1126 3300045051 Ga0451576_0060875 Ga0451576_0060875_77_379 89
1127 3300045051 Ga0451576_0069932 Ga0451576_0069932_3047_3352 89
1128 3300045051 Ga0451576_0374709 Ga0451576_0374709_142_444 89
1129 3300045051 Ga0451576_0892687 Ga0451576_0892687_216_521 89
1130 3300045051 Ga0451576_0995167 Ga0451576_0995167_524_829 89
1131 3300045051 Ga0451576_1973837 Ga0451576_1973837_103_405 89
1132 3300045051 Ga0451576_2301714 Ga0451576_2301714_49_354 89
1133 3300045976 Ga0466967_1716616 Ga0466967_1716616_213_482 89
1134 3300045976 Ga0466967_1954204 Ga0466967_1954204_179_448 89
1135 3300046453 Ga0495627_047044 Ga0495627_047044_946_1251 89
1136 3300046454 Ga0495592_0494464 Ga0495592_0494464_180_485 89
1137 3300046455 Ga0495603_0095784 Ga0495603_0095784_1114_1419 89
1138 3300046459 Ga0495629_0008006 Ga0495629_0008006_723_992 89
1139 3300046459 Ga0495629_0087873 Ga0495629_0087873_1823_2128 89
1140 3300046461 Ga0495641_0112411 Ga0495641_0112411_566_835 89
1141 3300046462 Ga0495651_0075629 Ga0495651_0075629_1760_2065 89
1142 3300046472 Ga0495580_0024838 Ga0495580_0024838_2791_3096 89
1143 3300046472 Ga0495580_0050998 Ga0495580_0050998_1288_1593 89
1144 3300046472 Ga0495580_0087842 Ga0495580_0087842_1495_1800 89
1145 3300046472 Ga0495580_0477228 Ga0495580_0477228_443_748 89
1146 3300046473 Ga0495582_0005514 Ga0495582_0005514_5049_5354 89
1147 3300046473 Ga0495582_0093504 Ga0495582_0093504_1262_1531 89
1148 3300046475 Ga0495639_0016200 Ga0495639_0016200_524_829 89
1149 3300046476 Ga0495662_0333812 Ga0495662_0333812_369_674 89
1150 3300046477 Ga0495664_0083745 Ga0495664_0083745_1111_1416 89
1151 3300046506 Ga0495583_0018179 Ga0495583_0018179_1136_1405 89
1152 3300046516 Ga0495628_0203969 Ga0495628_0203969_320_625 89
1153 3300046519 Ga0495632_0454162 Ga0495632_0454162_75_344 89
1154 3300046526 Ga0495666_0019131 Ga0495666_0019131_2627_2932 89
1155 3300046526 Ga0495666_0385723 Ga0495666_0385723_20_325 89
1156 3300046531 Ga0495665_0012732 Ga0495665_0012732_4068_4373 89
1157 3300046531 Ga0495665_0393199 Ga0495665_0393199_220_525 89
1158 3300046535 Ga0495586_0390632 Ga0495586_0390632_422_727 89
1159 3300046536 Ga0495587_0107233 Ga0495587_0107233_602_907 89
1160 3300046538 Ga0495609_0074311 Ga0495609_0074311_63_332 89
1161 3300046543 Ga0495645_0044382 Ga0495645_0044382_1930_2235 89
1162 3300046557 Ga0495622_0000035 Ga0495622_0000035_33318_33587 89
1163 3300046557 Ga0495622_0306889 Ga0495622_0306889_114_419 89
1164 3300046559 Ga0495667_0103714 Ga0495667_0103714_178_483 89
1165 3300046616 Ga0495668_0766092 Ga0495668_0766092_94_399 89
1166 3300046642 Ga0495634_0082715 Ga0495634_0082715_1100_1405 89
1167 3300046642 Ga0495634_0768214 Ga0495634_0768214_184_453 89
1168 3300046648 Ga0495611_0122748 Ga0495611_0122748_836_1105 89
1169 3300046663 Ga0495635_0028671 Ga0495635_0028671_313_618 89
1170 3300046663 Ga0495635_0880300 Ga0495635_0880300_210_515 89
1171 3300046663 Ga0495635_0997884 Ga0495635_0997884_80_349 89
1172 3300046674 Ga0495588_0000116 Ga0495588_0000116_23805_24074 89
1173 3300046674 Ga0495588_0146739 Ga0495588_0146739_601_906 89
1174 3300046675 Ga0495657_0163529 Ga0495657_0163529_477_782 89
1175 3300046675 Ga0495657_0296422 Ga0495657_0296422_468_773 89
1176 3300046678 Ga0495599_0424504 Ga0495599_0424504_376_681 89
1177 3300046679 Ga0495623_0328187 Ga0495623_0328187_194_499 89
1178 3300046683 Ga0495658_0001981 Ga0495658_0001981_2460_2729 89
1179 3300046683 Ga0495658_0004803 Ga0495658_0004803_4068_4373 89
1180 3300046683 Ga0495658_0726466 Ga0495658_0726466_317_586 89
1181 3300046683 Ga0495658_0777569 Ga0495658_0777569_115_384 89
1182 3300046689 Ga0495613_0007458 Ga0495613_0007458_2323_2628 89
1183 3300046692 Ga0495671_0080213 Ga0495671_0080213_925_1194 89
1184 3300046692 Ga0495671_0276630 Ga0495671_0276630_261_530 89
1185 3300046694 Ga0495649_0000182 Ga0495649_0000182_11129_11398 89
1186 3300046809 Ga0495600_0006859 Ga0495600_0006859_337_606 89
1187 3300046809 Ga0495600_0073547 Ga0495600_0073547_1135_1440 89
1188 3300047315 Ga0495581_0002892 Ga0495581_0002892_6848_7153 89
1189 3300047317 Ga0495604_0124498 Ga0495604_0124498_514_819 89
1190 3300047319 Ga0495674_0205458 Ga0495674_0205458_1014_1319 89
1191 3300047320 Ga0495672_0000016 Ga0495672_0000016_36767_37036 89
1192 3300047320 Ga0495672_0178980 Ga0495672_0178980_31_300 89
1193 3300047320 Ga0495672_0220012 Ga0495672_0220012_457_726 89
1194 3300047320 Ga0495672_0418254 Ga0495672_0418254_187_456 89
1195 3300047321 Ga0495676_0595134 Ga0495676_0595134_226_495 89
1196 3300047444 Ga0495675_0049040 Ga0495675_0049040_283_588 89
1197 3300047445 Ga0495677_0216334 Ga0495677_0216334_367_636 89
1198 3300047470 Ga0495681_0027011 Ga0495681_0027011_1070_1375 89
1199 3300047470 Ga0495681_0232862 Ga0495681_0232862_301_570 89
1200 3300047471 Ga0495684_0086399 Ga0495684_0086399_888_1193 89
1201 3300047673 Ga0495593_0036034 Ga0495593_0036034_233_538 89
1202 3300048088 Ga0495602_0271531 Ga0495602_0271531_590_895 89
1203 3300048088 Ga0495602_0377579 Ga0495602_0377579_104_373 89
1204 3300048089 Ga0495614_0034982 Ga0495614_0034982_70_375 89
1205 3300048089 Ga0495614_0084538 Ga0495614_0084538_982_1251 89
1206 3300048903 Ga0496100_0135185 Ga0496100_0135185_1089_1394 89
1207 3300048903 Ga0496100_0157178 Ga0496100_0157178_1085_1390 89
1208 3300048903 Ga0496100_0163979 Ga0496100_0163979_465_734 89
1209 3300048904 Ga0496101_0130394 Ga0496101_0130394_736_1041 89
1210 3300048904 Ga0496101_0606236 Ga0496101_0606236_117_386 89
1211 3300048905 Ga0496102_0024884 Ga0496102_0024884_478_783 89
1212 3300048907 Ga0496104_0015885 Ga0496104_0015885_1190_1495 89
1213 3300048907 Ga0496104_0284051 Ga0496104_0284051_135_404 89
1214 3300048907 Ga0496104_0716034 Ga0496104_0716034_401_670 89
1215 3300048908 Ga0496105_0097194 Ga0496105_0097194_929_1234 89
1216 3300048908 Ga0496105_0719108 Ga0496105_0719108_342_611 89
1217 3300048909 Ga0496106_0081553 Ga0496106_0081553_1108_1413 89
1218 3300048910 Ga0496107_0289122 Ga0496107_0289122_185_490 89
1219 3300048910 Ga0496107_0714590 Ga0496107_0714590_360_665 89
1220 3300048910 Ga0496107_0758955 Ga0496107_0758955_72_377 89
1221 3300048911 Ga0496108_0091599 Ga0496108_0091599_2232_2537 89
1222 3300048911 Ga0496108_0380138 Ga0496108_0380138_113_418 89
1223 3300048911 Ga0496108_1230186 Ga0496108_1230186_189_494 89
1224 3300048911 Ga0496108_1522713 Ga0496108_1522713_76_345 89
1225 3300048912 Ga0496109_0022741 Ga0496109_0022741_2624_2929 89
1226 3300048912 Ga0496109_1953823 Ga0496109_1953823_150_455 89
1227 3300048913 Ga0496110_1142387 Ga0496110_1142387_121_426 89
1228 3300048915 Ga0496112_0002149 Ga0496112_0002149_8401_8670 89
1229 3300048915 Ga0496112_0022409 Ga0496112_0022409_2625_2930 89
1230 3300048915 Ga0496112_0483582 Ga0496112_0483582_196_501 89
1231 3300048915 Ga0496112_0608066 Ga0496112_0608066_408_677 89
1232 3300048916 Ga0496113_0112570 Ga0496113_0112570_654_959 89
1233 3300048916 Ga0496113_0114796 Ga0496113_0114796_329_634 89
1234 3300048916 Ga0496113_1476942 Ga0496113_1476942_52_321 89
1235 3300048917 Ga0496114_0014567 Ga0496114_0014567_2308_2613 89
1236 3300048917 Ga0496114_0117322 Ga0496114_0117322_160_465 89
1237 3300048917 Ga0496114_1172215 Ga0496114_1172215_232_537 89
1238 3300048918 Ga0496115_0209364 Ga0496115_0209364_301_606 89
1239 3300048928 Ga0496125_0438035 Ga0496125_0438035_227_496 89
1240 3300048929 Ga0496126_0110593 Ga0496126_0110593_605_874 89
1241 3300049161 Ga0501305_026105 Ga0501305_026105_34_339 89
1242 3300049521 Ga0501298_011845 Ga0501298_011845_400_705 89
1243 3300049522 Ga0501299_012331 Ga0501299_012331_971_1240 89
1244 3300049568 Ga0501031_0004386 Ga0501031_0004386_750_1019 89
1245 3300049568 Ga0501031_0545012 Ga0501031_0545012_278_583 89
1246 3300049569 Ga0501032_0000394 Ga0501032_0000394_1649_1918 89
1247 3300049570 Ga0501033_0020233 Ga0501033_0020233_4139_4444 89
1248 3300049571 Ga0501034_0020539 Ga0501034_0020539_2028_2297 89
1249 3300049571 Ga0501034_0324359 Ga0501034_0324359_656_925 89
1250 3300049571 Ga0501034_1204950 Ga0501034_1204950_285_554 89
1251 3300049571 Ga0501034_1265307 Ga0501034_1265307_28_297 89
1252 3300049572 Ga0501036_0006553 Ga0501036_0006553_6534_6839 89
1253 3300049572 Ga0501036_0041349 Ga0501036_0041349_1535_1840 89
1254 3300049572 Ga0501036_0058031 Ga0501036_0058031_392_661 89
1255 3300049573 Ga0501037_0000133 Ga0501037_0000133_36215_36484 89
1256 3300049573 Ga0501037_0172677 Ga0501037_0172677_987_1292 89
1257 3300049573 Ga0501037_0254096 Ga0501037_0254096_397_666 89
1258 3300049573 Ga0501037_0271907 Ga0501037_0271907_270_539 89
1259 3300049574 Ga0501038_0023933 Ga0501038_0023933_3377_3646 89
1260 3300049574 Ga0501038_0200854 Ga0501038_0200854_1012_1317 89
1261 3300049575 Ga0501039_0033552 Ga0501039_0033552_3132_3437 89
1262 3300049575 Ga0501039_0602411 Ga0501039_0602411_347_616 89
1263 3300049576 Ga0501040_0067749 Ga0501040_0067749_2056_2361 89
1264 3300049577 Ga0501041_0003344 Ga0501041_0003344_5120_5425 89
1265 3300049578 Ga0501042_0009869 Ga0501042_0009869_3264_3569 89
1266 3300049578 Ga0501042_0279825 Ga0501042_0279825_169_438 89
1267 3300049579 Ga0501043_0000404 Ga0501043_0000404_35384_35653 89
1268 3300049580 Ga0501046_0000038 Ga0501046_0000038_113705_113974 89
1269 3300049580 Ga0501046_0179631 Ga0501046_0179631_220_525 89
1270 3300049581 Ga0501047_0006066 Ga0501047_0006066_5684_5953 89
1271 3300049581 Ga0501047_1050570 Ga0501047_1050570_123_392 89
1272 3300049582 Ga0501048_0000033 Ga0501048_0000033_50589_50858 89
1273 3300049582 Ga0501048_0426138 Ga0501048_0426138_603_872 89
1274 3300049582 Ga0501048_0590393 Ga0501048_0590393_473_778 89
1275 3300049584 Ga0501068_0320666 Ga0501068_0320666_313_618 89
1276 3300049585 Ga0501069_0338998 Ga0501069_0338998_533_802 89
1277 3300049585 Ga0501069_0621482 Ga0501069_0621482_156_461 89
1278 3300049586 Ga0501070_0035569 Ga0501070_0035569_526_831 89
1279 3300049586 Ga0501070_0044881 Ga0501070_0044881_2353_2658 89
1280 3300049586 Ga0501070_0079948 Ga0501070_0079948_837_1106 89
1281 3300049586 Ga0501070_0330131 Ga0501070_0330131_487_756 89
1282 3300049586 Ga0501070_0427853 Ga0501070_0427853_35_304 89
1283 3300049587 Ga0501071_0102836 Ga0501071_0102836_107_412 89
1284 3300049587 Ga0501071_0114002 Ga0501071_0114002_389_694 89
1285 3300049587 Ga0501071_1056501 Ga0501071_1056501_136_405 89
1286 3300049587 Ga0501071_1170168 Ga0501071_1170168_163_468 89
1287 3300049588 Ga0501072_0327339 Ga0501072_0327339_408_713 89
1288 3300049589 Ga0501073_0012572 Ga0501073_0012572_2923_3192 89
1289 3300049589 Ga0501073_0038822 Ga0501073_0038822_641_946 89
1290 3300049589 Ga0501073_0125551 Ga0501073_0125551_225_494 89
1291 3300049589 Ga0501073_0198652 Ga0501073_0198652_301_606 89
1292 3300049589 Ga0501073_0713056 Ga0501073_0713056_361_630 89
1293 3300049590 Ga0501074_0018349 Ga0501074_0018349_2163_2468 89
1294 3300049590 Ga0501074_0775032 Ga0501074_0775032_361_666 89
1295 3300049590 Ga0501074_1151784 Ga0501074_1151784_162_467 89
1296 3300049591 Ga0501075_0003793 Ga0501075_0003793_5315_5620 89
1297 3300049591 Ga0501075_0290534 Ga0501075_0290534_244_549 89
1298 3300049592 Ga0501076_0000663 Ga0501076_0000663_7512_7817 89
1299 3300049592 Ga0501076_0046380 Ga0501076_0046380_1990_2295 89
1300 3300049593 Ga0501077_0049998 Ga0501077_0049998_535_840 89
1301 3300049593 Ga0501077_0209868 Ga0501077_0209868_734_1039 89
1302 3300049741 Ga0501079_0015785 Ga0501079_0015785_3189_3494 89
1303 3300049741 Ga0501079_0160362 Ga0501079_0160362_930_1235 89
1304 3300049741 Ga0501079_0508395 Ga0501079_0508395_57_362 89
1305 3300049742 Ga0501080_0001402 Ga0501080_0001402_7175_7444 89
1306 3300049742 Ga0501080_0005999 Ga0501080_0005999_7304_7609 89
1307 3300049742 Ga0501080_0028144 Ga0501080_0028144_2595_2900 89
1308 3300049742 Ga0501080_0030200 Ga0501080_0030200_623_892 89
1309 3300049742 Ga0501080_0588692 Ga0501080_0588692_429_698 89
1310 3300049743 Ga0501081_0014826 Ga0501081_0014826_1295_1600 89
1311 3300049744 Ga0501083_0014244 Ga0501083_0014244_4531_4800 89
1312 3300049744 Ga0501083_0026580 Ga0501083_0026580_329_598 89
1313 3300049744 Ga0501083_0143087 Ga0501083_0143087_924_1229 89
1314 3300049773 Ga0501276_001027 Ga0501276_001027_1067_1336 89
1315 3300049822 Ga0501035_0000562 Ga0501035_0000562_39314_39583 89
1316 3300049822 Ga0501035_0263579 Ga0501035_0263579_736_1041 89
1317 3300049823 Ga0501044_0028311 Ga0501044_0028311_3344_3613 89
1318 3300049824 Ga0501045_0003651 Ga0501045_0003651_3314_3619 89
1319 3300049824 Ga0501045_0089934 Ga0501045_0089934_1439_1744 89
1320 3300050489 nmdc:mga03683_66_c2 nmdc:mga03683_66_c2_1315_1584 89
1321 3300050490 nmdc:mga03n38_19_c1 nmdc:mga03n38_19_c1_7938_8207 89
1322 3300050490 nmdc:mga03n38_78327_c1 nmdc:mga03n38_78327_c1_626_895 89
1323 3300050491 nmdc:mga00v17_1041970_c1 nmdc:mga00v17_1041970_c1_170_439 89
1324 3300050491 nmdc:mga00v17_145_c1 nmdc:mga00v17_145_c1_5484_5753 89
1325 3300050491 nmdc:mga00v17_196366_c1 nmdc:mga00v17_196366_c1_387_656 89
1326 3300050491 nmdc:mga00v17_33755_c1 nmdc:mga00v17_33755_c1_977_1246 89
1327 3300050491 nmdc:mga00v17_420686_c1 nmdc:mga00v17_420686_c1_23_292 89
1328 3300050491 nmdc:mga00v17_6642_c1 nmdc:mga00v17_6642_c1_2980_3249 89
1329 3300050491 nmdc:mga00v17_67056_c1 nmdc:mga00v17_67056_c1_733_1002 89
1330 3300050491 nmdc:mga00v17_857_c1 nmdc:mga00v17_857_c1_8155_8433 89
1331 3300050491 nmdc:mga00v17_9991_c1 nmdc:mga00v17_9991_c1_2618_2887 89
1332 3300050492 nmdc:mga0yw44_100296_c1 nmdc:mga0yw44_100296_c1_516_785 89
1333 3300050492 nmdc:mga0yw44_192268_c1 nmdc:mga0yw44_192268_c1_206_547 89
1334 3300050492 nmdc:mga0yw44_24_c1 nmdc:mga0yw44_24_c1_3450_3728 89
1335 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_297911_298180 89
1336 3300050492 nmdc:mga0yw44_391363_c1 nmdc:mga0yw44_391363_c1_258_527 89
1337 3300050492 nmdc:mga0yw44_6972_c1 nmdc:mga0yw44_6972_c1_4293_4562 89
1338 3300050493 nmdc:mga0k408_142831_c1 nmdc:mga0k408_142831_c1_521_790 89
1339 3300050493 nmdc:mga0k408_144_c1 nmdc:mga0k408_144_c1_3087_3356 89
1340 3300050493 nmdc:mga0k408_1480_c1 nmdc:mga0k408_1480_c1_7558_7827 89
1341 3300050493 nmdc:mga0k408_14_c3 nmdc:mga0k408_14_c3_33822_34091 89
1342 3300050493 nmdc:mga0k408_165086_c1 nmdc:mga0k408_165086_c1_396_665 89
1343 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_741754_742023 89
1344 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_60052_60321 89
1345 3300050493 nmdc:mga0k408_6815_c1 nmdc:mga0k408_6815_c1_441_710 89
1346 3300050493 nmdc:mga0k408_78109_c1 nmdc:mga0k408_78109_c1_587_892 89
1347 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_33076_33345 89
1348 3300050494 nmdc:mga06z11_53_c2 nmdc:mga06z11_53_c2_1939_2208 89
1349 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_33953_34222 89
1350 3300050496 nmdc:mga07m45_2913_c1 nmdc:mga07m45_2913_c1_1312_1581 89
1351 3300050496 nmdc:mga07m45_303921_c1 nmdc:mga07m45_303921_c1_487_756 89
1352 3300050496 nmdc:mga07m45_353018_c1 nmdc:mga07m45_353018_c1_68_373 89
1353 3300050496 nmdc:mga07m45_494652_c1 nmdc:mga07m45_494652_c1_365_634 89
1354 3300050496 nmdc:mga07m45_647256_c1 nmdc:mga07m45_647256_c1_314_583 89
1355 3300050496 nmdc:mga07m45_72126_c1 nmdc:mga07m45_72126_c1_1059_1328 89
1356 3300050507 nmdc:mga05p37_167955_c1 nmdc:mga05p37_167955_c1_1980_2285 89
1357 3300050509 nmdc:mga0qj67_29906_c1 nmdc:mga0qj67_29906_c1_1256_1525 89
1358 3300050509 nmdc:mga0qj67_48239_c1 nmdc:mga0qj67_48239_c1_2661_2930 89
1359 3300050511 nmdc:mga08y16_21258_c1 nmdc:mga08y16_21258_c1_4287_4556 89
1360 3300050512 nmdc:mga0n895_111604_c1 nmdc:mga0n895_111604_c1_1905_2210 89
1361 3300050512 nmdc:mga0n895_1812005_c1 nmdc:mga0n895_1812005_c1_77_382 89
1362 3300050512 nmdc:mga0n895_259430_c1 nmdc:mga0n895_259430_c1_580_885 89
1363 3300050512 nmdc:mga0n895_71889_c1 nmdc:mga0n895_71889_c1_2474_2779 89
1364 3300050512 nmdc:mga0n895_944918_c1 nmdc:mga0n895_944918_c1_377_682 89
1365 3300050513 nmdc:mga0rr50_1501726_c1 nmdc:mga0rr50_1501726_c1_89_394 89
1366 3300050513 nmdc:mga0rr50_302106_c1 nmdc:mga0rr50_302106_c1_255_560 89
1367 3300050513 nmdc:mga0rr50_32159_c1 nmdc:mga0rr50_32159_c1_725_1030 89
1368 3300050513 nmdc:mga0rr50_34673_c1 nmdc:mga0rr50_34673_c1_990_1295 89
1369 3300050514 nmdc:mga08x19_141689_c1 nmdc:mga08x19_141689_c1_1255_1560 89
1370 3300050514 nmdc:mga08x19_52009_c1 nmdc:mga08x19_52009_c1_842_1147 89
1371 3300050514 nmdc:mga08x19_65848_c1 nmdc:mga08x19_65848_c1_83_388 89
1372 3300050515 nmdc:mga0a205_28754_c1 nmdc:mga0a205_28754_c1_2289_2594 89
1373 3300050515 nmdc:mga0a205_858248_c1 nmdc:mga0a205_858248_c1_368_673 89
1374 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_316852_317121 89
1375 3300050516 nmdc:mga0sz30_30554_c1 nmdc:mga0sz30_30554_c1_945_1214 89
1376 3300050516 nmdc:mga0sz30_460715_c1 nmdc:mga0sz30_460715_c1_55_333 89
1377 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_107585_107854 89
1378 3300050516 nmdc:mga0sz30_96240_c1 nmdc:mga0sz30_96240_c1_184_453 89
1379 3300053077 Ga0495601_0498313 Ga0495601_0498313_55_360 89
1380 3300053078 Ga0495612_0049342 Ga0495612_0049342_771_1076 89
1381 3300053079 Ga0500610_0000001 Ga0500610_0000001_51630_51899 89
1382 3300053079 Ga0500610_0024857 Ga0500610_0024857_1870_2139 89
1383 3300053079 Ga0500610_0160911 Ga0500610_0160911_340_609 89
1384 3300053083 Ga0495655_0065643 Ga0495655_0065643_558_863 89
1385 3300053085 Ga0495619_0004860 Ga0495619_0004860_6313_6618 89
1386 3300053085 Ga0495619_0012469 Ga0495619_0012469_1210_1515 89
1387 3300053087 Ga0500643_000010 Ga0500643_000010_332817_333086 89
1388 3300053087 Ga0500643_000038 Ga0500643_000038_137285_137554 89
1389 3300053087 Ga0500643_007309 Ga0500643_007309_2251_2520 89
1390 3300053088 Ga0500644_0000365 Ga0500644_0000365_7547_7816 89
1391 3300053088 Ga0500644_0000636 Ga0500644_0000636_1882_2151 89
1392 3300053088 Ga0500644_0001805 Ga0500644_0001805_2303_2572 89
1393 3300053088 Ga0500644_0019854 Ga0500644_0019854_115_384 89
1394 3300053090 Ga0500646_0000823 Ga0500646_0000823_3149_3418 89
1395 3300053092 Ga0500583_0000067 Ga0500583_0000067_5498_5767 89
1396 3300053092 Ga0500583_0002599 Ga0500583_0002599_2412_2681 89
1397 3300053092 Ga0500583_0015393 Ga0500583_0015393_1423_1692 89
1398 3300053092 Ga0500583_0069456 Ga0500583_0069456_460_729 89
1399 3300053093 Ga0500651_0000416 Ga0500651_0000416_18380_18649 89
1400 3300053094 Ga0500566_0000001 Ga0500566_0000001_679636_679905 89
1401 3300053098 Ga0500650_0000001 Ga0500650_0000001_521647_521916 89
1402 3300053103 Ga0500555_000001 Ga0500555_000001_801435_801704 89
1403 3300053103 Ga0500555_000002 Ga0500555_000002_466950_467219 89
1404 3300053103 Ga0500555_007840 Ga0500555_007840_483_752 89
1405 3300053103 Ga0500555_022461 Ga0500555_022461_747_1016 89
1406 3300053104 Ga0500556_0000829 Ga0500556_0000829_14842_15111 89
1407 3300053108 Ga0500562_000002 Ga0500562_000002_941749_942018 89
1408 3300053108 Ga0500562_004964 Ga0500562_004964_2234_2503 89
1409 3300053118 Ga0500594_0000001 Ga0500594_0000001_5764_6033 89
1410 3300053118 Ga0500594_0000139 Ga0500594_0000139_6840_7109 89
1411 3300053123 Ga0500614_000001 Ga0500614_000001_226281_226550 89
1412 3300053123 Ga0500614_002410 Ga0500614_002410_1519_1788 89
1413 3300053123 Ga0500614_014092 Ga0500614_014092_201_470 89
1414 3300053129 Ga0500628_000006 Ga0500628_000006_142864_143133 89
1415 3300053129 Ga0500628_001507 Ga0500628_001507_2141_2410 89
1416 3300053130 Ga0500642_0002538 Ga0500642_0002538_3965_4234 89
1417 3300053131 Ga0500652_000084 Ga0500652_000084_25300_25569 89
1418 3300053133 Ga0500655_001993 Ga0500655_001993_1841_2110 89
1419 3300053136 Ga0500559_0015490 Ga0500559_0015490_127_396 89
1420 3300053137 Ga0500561_0000001 Ga0500561_0000001_529888_530157 89
1421 3300053139 Ga0500568_0011040 Ga0500568_0011040_2699_2968 89
1422 3300053139 Ga0500568_0014440 Ga0500568_0014440_1304_1573 89
1423 3300053139 Ga0500568_0066436 Ga0500568_0066436_58_327 89
1424 3300053141 Ga0500574_083757 Ga0500574_083757_128_397 89
1425 3300053142 Ga0500577_0000514 Ga0500577_0000514_4599_4868 89
1426 3300053142 Ga0500577_0021093 Ga0500577_0021093_1171_1440 89
1427 3300053143 Ga0500579_016957 Ga0500579_016957_1894_2163 89
1428 3300053147 Ga0500589_000008 Ga0500589_000008_31741_32010 89
1429 3300053147 Ga0500589_099901 Ga0500589_099901_740_1009 89
1430 3300053149 Ga0500600_0114189 Ga0500600_0114189_200_505 89
1431 3300053150 Ga0500603_138389 Ga0500603_138389_89_358 89
1432 3300053151 Ga0500604_0010658 Ga0500604_0010658_1918_2187 89
1433 3300053153 Ga0500616_0000005 Ga0500616_0000005_398686_398955 89
1434 3300053156 Ga0500622_0000002 Ga0500622_0000002_6724_7029 89
1435 3300053160 Ga0500633_0014746 Ga0500633_0014746_44_313 89
1436 3300053722 Ga0500649_000014 Ga0500649_000014_26665_26934 89
1437 3300053724 Ga0500570_000045 Ga0500570_000045_18826_19095 89
1438 3300053727 Ga0500611_008584 Ga0500611_008584_924_1193 89
1439 3300053727 Ga0500611_009762 Ga0500611_009762_649_918 89
1440 3300054114 Ga0501084_0018257 Ga0501084_0018257_3974_4279 89
1441 3300054114 Ga0501084_0502704 Ga0501084_0502704_699_1004 89
1442 3300059505 Ga0587083_0181080 Ga0587083_0181080_167_472 89
1443 3300059506 Ga0587085_104013 Ga0587085_104013_24_329 89
1444 3300059624 Ga0587109_016406 Ga0587109_016406_117_422 89
1445 3300060344 Ga0587071_052725 Ga0587071_052725_416_721 89
1446 3300060346 Ga0587111_0042374 Ga0587111_0042374_268_573 89
1447 3300060353 Ga0501082_0008910 Ga0501082_0008910_1206_1511 89
1448 3300060353 Ga0501082_0226637 Ga0501082_0226637_469_738 89
1449 3300061734 Ga0530510_0006785 Ga0530510_0006785_6972_7277 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00253

Ribosomal_S14

Ribosomal protein S14p/S29e

66

119

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aj3-assembly1.cif.gz_N structure of the small subunit of the mammalian mitoribosome 0.8592 7 89
8any-assembly1.cif.gz_AK human mitochondrial ribosome in complex with lrpprc, slirp, a-site, p-site, e-site trnas and mrna 0.8582 7 89
7a5g-assembly1.cif.gz_K6 structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna 0.8525 7 89
7nql-assembly1.cif.gz_AN 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.8513 7 89
7pnu-assembly1.cif.gz_K assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa inward conformation 0.849 7 89
ID Description Score Start End Superfamily
af_Q5AJZ7_16_105_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8768 6 79 1.10.287.1480
af_Q8IHZ0_73_161_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8747 1 77 1.10.287.1480
af_O42859_6_94_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8739 6 77 1.10.287.1480
af_Q2FYU5_1_89_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8606 1 89 1.10.287.1480
af_B2RYT4_28_118_1.10.287.1480 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8583 1 79 1.10.287.1480
ID Description Score Start End GO Terms
AF-W7Z851-F1-model_v4 deleted 0.9387 1 49
AF-A0A317ZBY6-F1-model_v4 Small ribosomal subunit protein uS14 0.9103 16 83 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A8B4HQ36-F1-model_v4 deleted 0.9082 1 89
AF-A0A7R9A0Z6-F1-model_v4 Uncharacterized protein 0.9062 1 80 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A7S2ZU28-F1-model_v4 Ribosomal protein S14 0.9052 10 84 GO:0003735
GO:0005763
GO:0006412

Feature Viewer

pLDDT pTM Quality
85.36 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map