F494048
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1449 | 514 | 1432 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300020082|Ga0206353_10922718|Ga0206353_109227184 |
| Length | 120 |
| Sequence | MSAKRSWRRLNFLSRTEVDVAKVALINREQKRRDTVKKFAAKRAELLAVINNFKASPEERVTARQKLQSLPRNASPTRLRNRCALTGRPRGVFRKFGLGRNKLREIAMRGEIPGVVKASW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 3 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 4 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 5 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 6 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 7 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 8 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 9 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 10 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 11 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 12 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 13 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 14 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 15 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 16 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 142 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 143 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 163 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 240 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 243 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 249 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 250 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 251 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 252 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 253 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 254 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 255 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 256 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 257 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 258 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 259 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 260 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 261 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 262 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 264 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 265 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 266 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 267 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 268 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 269 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 270 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 271 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 275 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 276 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 277 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 280 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 281 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 282 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 283 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 284 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 285 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 286 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 287 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 288 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 293 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 295 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 297 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 299 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 301 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 304 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 305 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 307 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 310 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 311 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 312 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 313 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 314 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 316 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 318 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 319 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 320 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 321 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 322 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 323 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 324 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 325 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 326 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 327 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 328 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 333 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 334 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 335 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 336 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 337 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 338 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 339 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 340 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 341 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 342 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 343 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 344 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 345 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 346 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 347 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 348 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 349 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 350 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 351 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 352 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 353 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 403 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 404 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 405 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 406 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 407 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 415 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 416 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 418 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 419 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 450 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 455 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 457 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 458 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 461 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 475 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 477 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 478 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 479 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 480 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 481 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 482 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 486 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 487 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 489 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 490 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 491 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 493 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 494 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 496 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 497 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 498 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 502 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 505 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 506 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 508 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 509 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 510 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 511 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 512 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 514 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.38 |
| Metatranscriptomes | 1.45 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.39 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 86.47 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001539 | 3300001915 | Bacteria | 6534 |
| 2 | JGI24740J21852_10004196 | 3300001979 | Bacteria | 6224 |
| 3 | JGI24740J21852_10034505 | 3300001979 | Unclassified | 1594 |
| 4 | JGI24737J22298_10126222 | 3300001990 | Bacteria | 756 |
| 5 | JGI24735J21928_10000083 | 3300002067 | Bacteria | 36242 |
| 6 | rootH1_10286273 | 3300003323 | Bacteria | 1431 |
| 7 | Ga0058863_11971832 | 3300004799 | Bacteria | 3216 |
| 8 | Ga0058862_10110798 | 3300004803 | Bacteria | 5483 |
| 9 | Ga0058862_12728945 | 3300004803 | Bacteria | 607 |
| 10 | Ga0065704_10211023 | 3300005289 | Bacteria | 1109 |
| 11 | Ga0065712_10032246 | 3300005290 | Bacteria | 1236 |
| 12 | Ga0065715_10687863 | 3300005293 | Bacteria | 659 |
| 13 | Ga0065707_10554872 | 3300005295 | Bacteria | 718 |
| 14 | Ga0065707_10742430 | 3300005295 | Bacteria | 622 |
| 15 | Ga0070658_10000012 | 3300005327 | Bacteria | 277871 |
| 16 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 17 | Ga0070658_10000118 | 3300005327 | Bacteria | 71171 |
| 18 | Ga0070658_10001050 | 3300005327 | Bacteria | 23600 |
| 19 | Ga0070658_10013418 | 3300005327 | Bacteria | 6575 |
| 20 | Ga0070658_10026903 | 3300005327 | Bacteria | 4618 |
| 21 | Ga0070658_10457586 | 3300005327 | Bacteria | 1100 |
| 22 | Ga0070658_11424826 | 3300005327 | Bacteria | 601 |
| 23 | Ga0070676_10000822 | 3300005328 | Bacteria | 15354 |
| 24 | Ga0070676_10147148 | 3300005328 | Bacteria | 1505 |
| 25 | Ga0070676_10459818 | 3300005328 | Bacteria | 896 |
| 26 | Ga0070683_100000450 | 3300005329 | Bacteria | 28685 |
| 27 | Ga0070683_100005670 | 3300005329 | Bacteria | 10424 |
| 28 | Ga0070683_100053815 | 3300005329 | Bacteria | 3730 |
| 29 | Ga0070683_100103418 | 3300005329 | Bacteria | 2684 |
| 30 | Ga0070683_100175681 | 3300005329 | Bacteria | 2033 |
| 31 | Ga0070683_100374788 | 3300005329 | Bacteria | 1356 |
| 32 | Ga0070683_100509232 | 3300005329 | Bacteria | 1150 |
| 33 | Ga0070683_101596493 | 3300005329 | Bacteria | 627 |
| 34 | Ga0070683_102314359 | 3300005329 | Unclassified | 515 |
| 35 | Ga0070690_100010582 | 3300005330 | Bacteria | 5373 |
| 36 | Ga0070690_100017999 | 3300005330 | Bacteria | 4260 |
| 37 | Ga0070690_100085186 | 3300005330 | Bacteria | 2073 |
| 38 | Ga0070670_100303793 | 3300005331 | Unclassified | 1396 |
| 39 | Ga0070670_100634924 | 3300005331 | Bacteria | 957 |
| 40 | Ga0070670_101347777 | 3300005331 | Bacteria | 654 |
| 41 | Ga0068869_100000239 | 3300005334 | Bacteria | 28911 |
| 42 | Ga0068869_100002849 | 3300005334 | Bacteria | 10479 |
| 43 | Ga0068869_100288562 | 3300005334 | Bacteria | 1321 |
| 44 | Ga0068869_100421488 | 3300005334 | Bacteria | 1101 |
| 45 | Ga0070666_10041378 | 3300005335 | Bacteria | 3079 |
| 46 | Ga0070666_10119177 | 3300005335 | Bacteria | 1829 |
| 47 | Ga0070666_10343483 | 3300005335 | Bacteria | 1067 |
| 48 | Ga0070666_10568010 | 3300005335 | Bacteria | 826 |
| 49 | Ga0070666_11073963 | 3300005335 | Bacteria | 598 |
| 50 | Ga0070680_100000672 | 3300005336 | Bacteria | 23772 |
| 51 | Ga0070680_100038367 | 3300005336 | Bacteria | 3874 |
| 52 | Ga0070680_100149390 | 3300005336 | Bacteria | 1961 |
| 53 | Ga0070680_100316508 | 3300005336 | Bacteria | 1324 |
| 54 | Ga0070680_101703993 | 3300005336 | Bacteria | 546 |
| 55 | Ga0070682_100232877 | 3300005337 | Bacteria | 1318 |
| 56 | Ga0070682_100402999 | 3300005337 | Bacteria | 1035 |
| 57 | Ga0070682_100863385 | 3300005337 | Unclassified | 740 |
| 58 | Ga0070682_101111607 | 3300005337 | Unclassified | 662 |
| 59 | Ga0070682_101677233 | 3300005337 | Bacteria | 551 |
| 60 | Ga0068868_100110068 | 3300005338 | Bacteria | 2237 |
| 61 | Ga0068868_100277744 | 3300005338 | Bacteria | 1417 |
| 62 | Ga0070660_100000176 | 3300005339 | Bacteria | 42222 |
| 63 | Ga0070660_100002817 | 3300005339 | Bacteria | 11964 |
| 64 | Ga0070660_100008505 | 3300005339 | Bacteria | 7181 |
| 65 | Ga0070660_100029132 | 3300005339 | Bacteria | 4135 |
| 66 | Ga0070660_100426131 | 3300005339 | Bacteria | 1099 |
| 67 | Ga0070689_100003982 | 3300005340 | Bacteria | 9925 |
| 68 | Ga0070689_100010970 | 3300005340 | Bacteria | 6476 |
| 69 | Ga0070689_101762510 | 3300005340 | Bacteria | 564 |
| 70 | Ga0070691_10037648 | 3300005341 | Bacteria | 2283 |
| 71 | Ga0070691_10082496 | 3300005341 | Bacteria | 1576 |
| 72 | Ga0070691_10187215 | 3300005341 | Bacteria | 1081 |
| 73 | Ga0070691_10497255 | 3300005341 | Bacteria | 704 |
| 74 | Ga0070691_10998864 | 3300005341 | Bacteria | 522 |
| 75 | Ga0070687_100514328 | 3300005343 | Bacteria | 808 |
| 76 | Ga0070687_100854927 | 3300005343 | Bacteria | 649 |
| 77 | Ga0070687_100910603 | 3300005343 | Bacteria | 631 |
| 78 | Ga0070661_100130867 | 3300005344 | Bacteria | 1884 |
| 79 | Ga0070661_100900332 | 3300005344 | Bacteria | 730 |
| 80 | Ga0070692_10026456 | 3300005345 | Bacteria | 2868 |
| 81 | Ga0070692_11092894 | 3300005345 | Bacteria | 563 |
| 82 | Ga0070668_101351262 | 3300005347 | Bacteria | 649 |
| 83 | Ga0070669_100665908 | 3300005353 | Bacteria | 877 |
| 84 | Ga0070669_100707179 | 3300005353 | Bacteria | 851 |
| 85 | Ga0070669_101785717 | 3300005353 | Unclassified | 536 |
| 86 | Ga0070675_100125842 | 3300005354 | Bacteria | 2180 |
| 87 | Ga0070675_101433649 | 3300005354 | Bacteria | 637 |
| 88 | Ga0070675_101494068 | 3300005354 | Bacteria | 623 |
| 89 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 90 | Ga0070671_100035416 | 3300005355 | Bacteria | 4136 |
| 91 | Ga0070671_100133678 | 3300005355 | Bacteria | 2090 |
| 92 | Ga0070671_100226312 | 3300005355 | Bacteria | 1587 |
| 93 | Ga0070671_100777476 | 3300005355 | Bacteria | 833 |
| 94 | Ga0070671_101060315 | 3300005355 | Unclassified | 711 |
| 95 | Ga0070674_100004150 | 3300005356 | Bacteria | 8229 |
| 96 | Ga0070674_100014629 | 3300005356 | Bacteria | 4881 |
| 97 | Ga0070674_100044487 | 3300005356 | Bacteria | 3027 |
| 98 | Ga0070674_100061550 | 3300005356 | Bacteria | 2620 |
| 99 | Ga0070674_100191276 | 3300005356 | Bacteria | 1574 |
| 100 | Ga0070673_100000306 | 3300005364 | Bacteria | 25711 |
| 101 | Ga0070673_100085073 | 3300005364 | Bacteria | 2574 |
| 102 | Ga0070688_100002345 | 3300005365 | Bacteria | 9550 |
| 103 | Ga0070659_100000215 | 3300005366 | Bacteria | 44375 |
| 104 | Ga0070659_100096145 | 3300005366 | Bacteria | 2379 |
| 105 | Ga0070659_100199395 | 3300005366 | Bacteria | 1647 |
| 106 | Ga0070659_101770959 | 3300005366 | Bacteria | 553 |
| 107 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 108 | Ga0070667_100004521 | 3300005367 | Bacteria | 11712 |
| 109 | Ga0070667_100225186 | 3300005367 | Bacteria | 1670 |
| 110 | Ga0070709_10019345 | 3300005434 | Bacteria | 3934 |
| 111 | Ga0070714_100000778 | 3300005435 | Bacteria | 22615 |
| 112 | Ga0070714_100127912 | 3300005435 | Bacteria | 2267 |
| 113 | Ga0070713_100000028 | 3300005436 | Bacteria | 93227 |
| 114 | Ga0070713_100741052 | 3300005436 | Bacteria | 940 |
| 115 | Ga0070713_100797064 | 3300005436 | Bacteria | 905 |
| 116 | Ga0070713_101107328 | 3300005436 | Bacteria | 765 |
| 117 | Ga0070710_10000430 | 3300005437 | Bacteria | 19665 |
| 118 | Ga0070710_10043307 | 3300005437 | Bacteria | 2492 |
| 119 | Ga0070710_10684253 | 3300005437 | Bacteria | 722 |
| 120 | Ga0070710_11052535 | 3300005437 | Unclassified | 595 |
| 121 | Ga0070701_10004910 | 3300005438 | Bacteria | 5473 |
| 122 | Ga0070701_10042135 | 3300005438 | Bacteria | 2329 |
| 123 | Ga0070701_10088809 | 3300005438 | Bacteria | 1689 |
| 124 | Ga0070711_100008240 | 3300005439 | Bacteria | 6376 |
| 125 | Ga0070711_100788194 | 3300005439 | Bacteria | 805 |
| 126 | Ga0070711_101624119 | 3300005439 | Bacteria | 565 |
| 127 | Ga0070705_100139886 | 3300005440 | Bacteria | 1592 |
| 128 | Ga0070705_100376505 | 3300005440 | Bacteria | 1043 |
| 129 | Ga0070700_100022163 | 3300005441 | Bacteria | 3701 |
| 130 | Ga0070700_100283345 | 3300005441 | Bacteria | 1202 |
| 131 | Ga0070700_100294450 | 3300005441 | Bacteria | 1182 |
| 132 | Ga0070700_101581130 | 3300005441 | Bacteria | 560 |
| 133 | Ga0070700_101616892 | 3300005441 | Bacteria | 554 |
| 134 | Ga0070700_101791338 | 3300005441 | Bacteria | 529 |
| 135 | Ga0070694_100103515 | 3300005444 | Bacteria | 2017 |
| 136 | Ga0070694_100170239 | 3300005444 | Bacteria | 1604 |
| 137 | Ga0070694_100645100 | 3300005444 | Bacteria | 856 |
| 138 | Ga0070708_100069490 | 3300005445 | Bacteria | 3167 |
| 139 | Ga0070708_100327113 | 3300005445 | Bacteria | 1444 |
| 140 | Ga0070708_101895666 | 3300005445 | Bacteria | 552 |
| 141 | Ga0070663_100085826 | 3300005455 | Bacteria | 2323 |
| 142 | Ga0070678_100000168 | 3300005456 | Bacteria | 28067 |
| 143 | Ga0070678_100016595 | 3300005456 | Bacteria | 4716 |
| 144 | Ga0070678_100032057 | 3300005456 | Bacteria | 3633 |
| 145 | Ga0070678_100138031 | 3300005456 | Bacteria | 1947 |
| 146 | Ga0070678_100586520 | 3300005456 | Bacteria | 994 |
| 147 | Ga0070662_100268460 | 3300005457 | Bacteria | 1377 |
| 148 | Ga0070681_10002189 | 3300005458 | Bacteria | 17788 |
| 149 | Ga0070681_10084187 | 3300005458 | Bacteria | 3133 |
| 150 | Ga0070681_10094055 | 3300005458 | Bacteria | 2946 |
| 151 | Ga0070681_10419962 | 3300005458 | Bacteria | 1249 |
| 152 | Ga0070681_10439726 | 3300005458 | Bacteria | 1216 |
| 153 | Ga0068867_100020156 | 3300005459 | Bacteria | 4751 |
| 154 | Ga0068867_100384049 | 3300005459 | Bacteria | 1180 |
| 155 | Ga0068867_100415565 | 3300005459 | Bacteria | 1138 |
| 156 | Ga0070685_10000188 | 3300005466 | Bacteria | 41401 |
| 157 | Ga0070685_10002659 | 3300005466 | Bacteria | 9153 |
| 158 | Ga0070685_10007961 | 3300005466 | Bacteria | 5432 |
| 159 | Ga0070685_11496398 | 3300005466 | Bacteria | 520 |
| 160 | Ga0070706_100018649 | 3300005467 | Bacteria | 6397 |
| 161 | Ga0070706_100047586 | 3300005467 | Bacteria | 3957 |
| 162 | Ga0070706_100250396 | 3300005467 | Bacteria | 1654 |
| 163 | Ga0070706_100367139 | 3300005467 | Bacteria | 1341 |
| 164 | Ga0070706_100826259 | 3300005467 | Bacteria | 857 |
| 165 | Ga0070707_100025860 | 3300005468 | Bacteria | 5572 |
| 166 | Ga0070707_100045940 | 3300005468 | Bacteria | 4179 |
| 167 | Ga0070707_100410844 | 3300005468 | Bacteria | 1314 |
| 168 | Ga0070707_101437982 | 3300005468 | Bacteria | 656 |
| 169 | Ga0070698_100010119 | 3300005471 | Bacteria | 10073 |
| 170 | Ga0070698_100051877 | 3300005471 | Bacteria | 4176 |
| 171 | Ga0070698_101320062 | 3300005471 | Bacteria | 672 |
| 172 | Ga0070698_101334219 | 3300005471 | Bacteria | 668 |
| 173 | Ga0070699_100011946 | 3300005518 | Bacteria | 7495 |
| 174 | Ga0070699_100043286 | 3300005518 | Bacteria | 3897 |
| 175 | Ga0070699_100085613 | 3300005518 | Bacteria | 2750 |
| 176 | Ga0070699_101600800 | 3300005518 | Bacteria | 597 |
| 177 | Ga0070679_100003967 | 3300005530 | Bacteria | 13627 |
| 178 | Ga0070679_100005719 | 3300005530 | Bacteria | 11528 |
| 179 | Ga0070679_100014538 | 3300005530 | Bacteria | 7561 |
| 180 | Ga0070679_100021502 | 3300005530 | Bacteria | 6299 |
| 181 | Ga0070679_100023544 | 3300005530 | Bacteria | 6029 |
| 182 | Ga0070679_100024441 | 3300005530 | Bacteria | 5920 |
| 183 | Ga0070679_100052255 | 3300005530 | Bacteria | 4071 |
| 184 | Ga0070679_100077724 | 3300005530 | Bacteria | 3308 |
| 185 | Ga0070679_100083398 | 3300005530 | Bacteria | 3185 |
| 186 | Ga0070679_100231961 | 3300005530 | Unclassified | 1805 |
| 187 | Ga0070679_100268287 | 3300005530 | Bacteria | 1661 |
| 188 | Ga0070679_100301518 | 3300005530 | Bacteria | 1553 |
| 189 | Ga0070679_100771831 | 3300005530 | Bacteria | 904 |
| 190 | Ga0070679_100852103 | 3300005530 | Bacteria | 855 |
| 191 | Ga0070679_101122339 | 3300005530 | Bacteria | 731 |
| 192 | Ga0070679_101467208 | 3300005530 | Bacteria | 629 |
| 193 | Ga0070679_101557783 | 3300005530 | Unclassified | 608 |
| 194 | Ga0070679_101711619 | 3300005530 | Bacteria | 577 |
| 195 | Ga0070684_100001744 | 3300005535 | Bacteria | 15831 |
| 196 | Ga0070684_100002149 | 3300005535 | Bacteria | 14547 |
| 197 | Ga0070684_100159000 | 3300005535 | Bacteria | 2049 |
| 198 | Ga0070684_100439426 | 3300005535 | Bacteria | 1205 |
| 199 | Ga0070684_100907488 | 3300005535 | Bacteria | 825 |
| 200 | Ga0070697_100018681 | 3300005536 | Bacteria | 5469 |
| 201 | Ga0070697_100158062 | 3300005536 | Bacteria | 1914 |
| 202 | Ga0070697_101089830 | 3300005536 | Bacteria | 711 |
| 203 | Ga0068853_100179945 | 3300005539 | Bacteria | 1917 |
| 204 | Ga0068853_100202551 | 3300005539 | Bacteria | 1806 |
| 205 | Ga0068853_100447060 | 3300005539 | Bacteria | 1215 |
| 206 | Ga0070672_100055954 | 3300005543 | Bacteria | 3092 |
| 207 | Ga0070672_100361662 | 3300005543 | Bacteria | 1239 |
| 208 | Ga0070672_101131026 | 3300005543 | Bacteria | 696 |
| 209 | Ga0070672_101643846 | 3300005543 | Bacteria | 577 |
| 210 | Ga0070686_100000984 | 3300005544 | Bacteria | 16449 |
| 211 | Ga0070686_100018275 | 3300005544 | Bacteria | 4111 |
| 212 | Ga0070686_100100808 | 3300005544 | Bacteria | 1951 |
| 213 | Ga0070686_100309276 | 3300005544 | Bacteria | 1175 |
| 214 | Ga0070686_100482156 | 3300005544 | Bacteria | 959 |
| 215 | Ga0070695_100058601 | 3300005545 | Bacteria | 2490 |
| 216 | Ga0070695_100177189 | 3300005545 | Bacteria | 1508 |
| 217 | Ga0070695_101677620 | 3300005545 | Bacteria | 531 |
| 218 | Ga0070696_100030255 | 3300005546 | Bacteria | 3706 |
| 219 | Ga0070696_100134021 | 3300005546 | Bacteria | 1805 |
| 220 | Ga0070696_100194163 | 3300005546 | Bacteria | 1512 |
| 221 | Ga0070696_100717074 | 3300005546 | Bacteria | 816 |
| 222 | Ga0070696_100878728 | 3300005546 | Bacteria | 742 |
| 223 | Ga0070693_100025656 | 3300005547 | Bacteria | 3173 |
| 224 | Ga0070693_100095941 | 3300005547 | Bacteria | 1797 |
| 225 | Ga0070665_100029414 | 3300005548 | Bacteria | 5529 |
| 226 | Ga0070665_100096550 | 3300005548 | Bacteria | 2960 |
| 227 | Ga0070665_100171863 | 3300005548 | Bacteria | 2168 |
| 228 | Ga0070665_100181226 | 3300005548 | Bacteria | 2107 |
| 229 | Ga0070665_100339080 | 3300005548 | Bacteria | 1508 |
| 230 | Ga0070704_100001908 | 3300005549 | Bacteria | 11506 |
| 231 | Ga0070704_100011835 | 3300005549 | Bacteria | 5368 |
| 232 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 233 | Ga0068855_100000168 | 3300005563 | Bacteria | 83242 |
| 234 | Ga0068855_100004673 | 3300005563 | Bacteria | 16726 |
| 235 | Ga0068855_100020905 | 3300005563 | Bacteria | 7848 |
| 236 | Ga0068855_100042627 | 3300005563 | Bacteria | 5377 |
| 237 | Ga0068855_100044376 | 3300005563 | Bacteria | 5261 |
| 238 | Ga0068855_100122011 | 3300005563 | Bacteria | 2982 |
| 239 | Ga0068855_100631942 | 3300005563 | Bacteria | 1152 |
| 240 | Ga0068855_100699930 | 3300005563 | Bacteria | 1084 |
| 241 | Ga0068855_100787163 | 3300005563 | Bacteria | 1012 |
| 242 | Ga0068855_101057751 | 3300005563 | Bacteria | 850 |
| 243 | Ga0068855_101095095 | 3300005563 | Bacteria | 833 |
| 244 | Ga0068855_101243012 | 3300005563 | Unclassified | 773 |
| 245 | Ga0070664_100364069 | 3300005564 | Bacteria | 1317 |
| 246 | Ga0070664_100434554 | 3300005564 | Bacteria | 1203 |
| 247 | Ga0070664_100580627 | 3300005564 | Bacteria | 1038 |
| 248 | Ga0068857_100000124 | 3300005577 | Bacteria | 46368 |
| 249 | Ga0068857_100406048 | 3300005577 | Bacteria | 1268 |
| 250 | Ga0068857_100564509 | 3300005577 | Bacteria | 1073 |
| 251 | Ga0068857_100724108 | 3300005577 | Bacteria | 946 |
| 252 | Ga0068857_100939564 | 3300005577 | Bacteria | 830 |
| 253 | Ga0068857_101413968 | 3300005577 | Bacteria | 677 |
| 254 | Ga0068854_100519470 | 3300005578 | Bacteria | 1005 |
| 255 | Ga0068854_100683221 | 3300005578 | Bacteria | 884 |
| 256 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 257 | Ga0068856_100001486 | 3300005614 | Bacteria | 24509 |
| 258 | Ga0068856_100001797 | 3300005614 | Bacteria | 22390 |
| 259 | Ga0068856_100048231 | 3300005614 | Bacteria | 4196 |
| 260 | Ga0068856_100229169 | 3300005614 | Bacteria | 1873 |
| 261 | Ga0068856_100598667 | 3300005614 | Bacteria | 1123 |
| 262 | Ga0068856_100628871 | 3300005614 | Bacteria | 1094 |
| 263 | Ga0068856_101067250 | 3300005614 | Bacteria | 825 |
| 264 | Ga0070702_100014621 | 3300005615 | Bacteria | 3986 |
| 265 | Ga0070702_100021262 | 3300005615 | Bacteria | 3411 |
| 266 | Ga0068852_100491118 | 3300005616 | Bacteria | 1221 |
| 267 | Ga0068859_100006170 | 3300005617 | Bacteria | 12179 |
| 268 | Ga0068859_100089269 | 3300005617 | Bacteria | 3132 |
| 269 | Ga0068859_100323620 | 3300005617 | Bacteria | 1636 |
| 270 | Ga0068859_100540753 | 3300005617 | Bacteria | 1260 |
| 271 | Ga0068859_101600921 | 3300005617 | Bacteria | 719 |
| 272 | Ga0068864_100003967 | 3300005618 | Bacteria | 12179 |
| 273 | Ga0068864_100114654 | 3300005618 | Bacteria | 2403 |
| 274 | Ga0068864_102673988 | 3300005618 | Bacteria | 505 |
| 275 | Ga0068866_10002726 | 3300005718 | Bacteria | 7282 |
| 276 | Ga0068866_10003079 | 3300005718 | Bacteria | 6876 |
| 277 | Ga0068866_10100047 | 3300005718 | Bacteria | 1598 |
| 278 | Ga0068861_100008199 | 3300005719 | Bacteria | 7186 |
| 279 | Ga0068861_100126218 | 3300005719 | Bacteria | 2070 |
| 280 | Ga0068861_100131548 | 3300005719 | Bacteria | 2031 |
| 281 | Ga0068861_101025908 | 3300005719 | Bacteria | 789 |
| 282 | Ga0068851_10156813 | 3300005834 | Bacteria | 1248 |
| 283 | Ga0068870_10009891 | 3300005840 | Bacteria | 4355 |
| 284 | Ga0068870_10078377 | 3300005840 | Bacteria | 1820 |
| 285 | Ga0068870_10111576 | 3300005840 | Bacteria | 1562 |
| 286 | Ga0068863_100002985 | 3300005841 | Bacteria | 16732 |
| 287 | Ga0068863_100022347 | 3300005841 | Bacteria | 6040 |
| 288 | Ga0068863_100046276 | 3300005841 | Bacteria | 4129 |
| 289 | Ga0068863_100102476 | 3300005841 | Bacteria | 2722 |
| 290 | Ga0068863_100612467 | 3300005841 | Unclassified | 1078 |
| 291 | Ga0068863_100820175 | 3300005841 | Unclassified | 928 |
| 292 | Ga0068858_100013226 | 3300005842 | Bacteria | 7776 |
| 293 | Ga0068858_100014524 | 3300005842 | Bacteria | 7419 |
| 294 | Ga0068858_100017672 | 3300005842 | Bacteria | 6684 |
| 295 | Ga0068860_100019846 | 3300005843 | Bacteria | 6518 |
| 296 | Ga0068860_100111708 | 3300005843 | Bacteria | 2613 |
| 297 | Ga0068860_100233894 | 3300005843 | Bacteria | 1786 |
| 298 | Ga0068860_100299450 | 3300005843 | Bacteria | 1575 |
| 299 | Ga0068860_100488011 | 3300005843 | Bacteria | 1228 |
| 300 | Ga0068860_101077953 | 3300005843 | Bacteria | 822 |
| 301 | Ga0068860_101098337 | 3300005843 | Bacteria | 815 |
| 302 | Ga0068860_101153711 | 3300005843 | Bacteria | 795 |
| 303 | Ga0068862_100015629 | 3300005844 | Bacteria | 6304 |
| 304 | Ga0068862_100142453 | 3300005844 | Bacteria | 2129 |
| 305 | Ga0068862_102596470 | 3300005844 | Bacteria | 518 |
| 306 | Ga0081455_10000003 | 3300005937 | Bacteria | 367763 |
| 307 | Ga0081539_10001876 | 3300005985 | Bacteria | 32944 |
| 308 | Ga0070717_10062928 | 3300006028 | Bacteria | 3078 |
| 309 | Ga0070717_11107508 | 3300006028 | Bacteria | 721 |
| 310 | Ga0075365_10000658 | 3300006038 | Bacteria | 13797 |
| 311 | Ga0075365_10013015 | 3300006038 | Bacteria | 4962 |
| 312 | Ga0075365_10055135 | 3300006038 | Bacteria | 2638 |
| 313 | Ga0075365_10056400 | 3300006038 | Bacteria | 2611 |
| 314 | Ga0075365_10332614 | 3300006038 | Bacteria | 1070 |
| 315 | Ga0075365_10452922 | 3300006038 | Bacteria | 906 |
| 316 | Ga0075368_10000103 | 3300006042 | Bacteria | 21865 |
| 317 | Ga0075363_100000006 | 3300006048 | Bacteria | 47292 |
| 318 | Ga0075363_100031526 | 3300006048 | Bacteria | 2749 |
| 319 | Ga0075364_10000255 | 3300006051 | Bacteria | 25673 |
| 320 | Ga0075364_10000985 | 3300006051 | Bacteria | 15065 |
| 321 | Ga0075364_10005139 | 3300006051 | Bacteria | 7588 |
| 322 | Ga0075364_10008153 | 3300006051 | Bacteria | 6252 |
| 323 | Ga0075364_10008868 | 3300006051 | Bacteria | 6021 |
| 324 | Ga0075364_10056142 | 3300006051 | Bacteria | 2578 |
| 325 | Ga0075364_10117401 | 3300006051 | Bacteria | 1779 |
| 326 | Ga0075364_11172525 | 3300006051 | Unclassified | 521 |
| 327 | Ga0075432_10098869 | 3300006058 | Bacteria | 1076 |
| 328 | Ga0070715_10201379 | 3300006163 | Bacteria | 1012 |
| 329 | Ga0070716_100014982 | 3300006173 | Bacteria | 3978 |
| 330 | Ga0070716_100148286 | 3300006173 | Bacteria | 1506 |
| 331 | Ga0070712_100296952 | 3300006175 | Bacteria | 1306 |
| 332 | Ga0070712_100645686 | 3300006175 | Bacteria | 899 |
| 333 | Ga0070712_101990388 | 3300006175 | Bacteria | 509 |
| 334 | Ga0075362_10000049 | 3300006177 | Bacteria | 39227 |
| 335 | Ga0075362_10023272 | 3300006177 | Bacteria | 2619 |
| 336 | Ga0075367_10000021 | 3300006178 | Bacteria | 33969 |
| 337 | Ga0075367_10017509 | 3300006178 | Bacteria | 3934 |
| 338 | Ga0075367_10749599 | 3300006178 | Bacteria | 621 |
| 339 | Ga0075369_10000003 | 3300006186 | Bacteria | 205269 |
| 340 | Ga0075369_10000057 | 3300006186 | Bacteria | 28832 |
| 341 | Ga0075369_10077510 | 3300006186 | Unclassified | 1470 |
| 342 | Ga0075369_10128549 | 3300006186 | Bacteria | 1150 |
| 343 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 344 | Ga0075366_10000065 | 3300006195 | Bacteria | 39633 |
| 345 | Ga0075366_10000147 | 3300006195 | Bacteria | 29801 |
| 346 | Ga0075366_10001116 | 3300006195 | Bacteria | 13216 |
| 347 | Ga0075366_10026067 | 3300006195 | Bacteria | 3421 |
| 348 | Ga0075366_10027187 | 3300006195 | Bacteria | 3356 |
| 349 | Ga0075366_10174399 | 3300006195 | Bacteria | 1305 |
| 350 | Ga0075366_10214500 | 3300006195 | Bacteria | 1172 |
| 351 | Ga0097621_100006235 | 3300006237 | Bacteria | 8460 |
| 352 | Ga0097621_100062852 | 3300006237 | Bacteria | 3050 |
| 353 | Ga0097621_100107511 | 3300006237 | Bacteria | 2354 |
| 354 | Ga0097621_100154914 | 3300006237 | Bacteria | 1966 |
| 355 | Ga0097621_100548254 | 3300006237 | Bacteria | 1052 |
| 356 | Ga0075370_10006085 | 3300006353 | Bacteria | 6048 |
| 357 | Ga0075370_10116654 | 3300006353 | Bacteria | 1552 |
| 358 | Ga0075370_10606716 | 3300006353 | Unclassified | 663 |
| 359 | Ga0075370_10714798 | 3300006353 | Unclassified | 609 |
| 360 | Ga0068871_100003989 | 3300006358 | Bacteria | 10207 |
| 361 | Ga0068871_100038968 | 3300006358 | Bacteria | 3800 |
| 362 | Ga0075428_100003149 | 3300006844 | Bacteria | 18020 |
| 363 | Ga0075430_100046838 | 3300006846 | Bacteria | 3651 |
| 364 | Ga0075430_100055797 | 3300006846 | Bacteria | 3322 |
| 365 | Ga0075431_101175299 | 3300006847 | Bacteria | 730 |
| 366 | Ga0075433_10024313 | 3300006852 | Bacteria | 5111 |
| 367 | Ga0075433_10288718 | 3300006852 | Bacteria | 1453 |
| 368 | Ga0075434_100015561 | 3300006871 | Bacteria | 7300 |
| 369 | Ga0075434_100194623 | 3300006871 | Bacteria | 2048 |
| 370 | Ga0075434_100316589 | 3300006871 | Bacteria | 1581 |
| 371 | Ga0075434_101519547 | 3300006871 | Bacteria | 679 |
| 372 | Ga0068865_100005809 | 3300006881 | Bacteria | 7502 |
| 373 | Ga0068865_100028985 | 3300006881 | Bacteria | 3668 |
| 374 | Ga0068865_100394857 | 3300006881 | Bacteria | 1131 |
| 375 | Ga0075436_100048771 | 3300006914 | Bacteria | 2922 |
| 376 | Ga0075436_100164914 | 3300006914 | Bacteria | 1563 |
| 377 | Ga0075436_100268172 | 3300006914 | Bacteria | 1219 |
| 378 | Ga0097620_100006169 | 3300006931 | Bacteria | 12179 |
| 379 | Ga0097620_100089272 | 3300006931 | Bacteria | 3132 |
| 380 | Ga0097620_100323614 | 3300006931 | Bacteria | 1636 |
| 381 | Ga0097620_100540784 | 3300006931 | Bacteria | 1260 |
| 382 | Ga0097620_101600051 | 3300006931 | Bacteria | 719 |
| 383 | Ga0075435_100050036 | 3300007076 | Bacteria | 3362 |
| 384 | Ga0075435_100336262 | 3300007076 | Bacteria | 1294 |
| 385 | Ga0075435_100368822 | 3300007076 | Bacteria | 1232 |
| 386 | Ga0075435_101706836 | 3300007076 | Bacteria | 553 |
| 387 | Ga0099794_10238362 | 3300007265 | Bacteria | 937 |
| 388 | Ga0099794_10416593 | 3300007265 | Bacteria | 702 |
| 389 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 390 | Ga0105240_10034455 | 3300009093 | Bacteria | 6530 |
| 391 | Ga0105240_10040725 | 3300009093 | Bacteria | 5938 |
| 392 | Ga0105240_10302319 | 3300009093 | Bacteria | 1830 |
| 393 | Ga0105240_10312692 | 3300009093 | Bacteria | 1793 |
| 394 | Ga0105240_10482858 | 3300009093 | Bacteria | 1381 |
| 395 | Ga0111539_10027480 | 3300009094 | Bacteria | 6949 |
| 396 | Ga0111539_11877758 | 3300009094 | Bacteria | 695 |
| 397 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 398 | Ga0105245_10004395 | 3300009098 | Bacteria | 12469 |
| 399 | Ga0105245_10004821 | 3300009098 | Bacteria | 11893 |
| 400 | Ga0105245_10010103 | 3300009098 | Bacteria | 8220 |
| 401 | Ga0105245_10060520 | 3300009098 | Bacteria | 3410 |
| 402 | Ga0105245_10351023 | 3300009098 | Bacteria | 1462 |
| 403 | Ga0105245_10394322 | 3300009098 | Bacteria | 1382 |
| 404 | Ga0105245_10462980 | 3300009098 | Bacteria | 1278 |
| 405 | Ga0105245_11705662 | 3300009098 | Bacteria | 682 |
| 406 | Ga0105247_10063726 | 3300009101 | Bacteria | 2289 |
| 407 | Ga0114129_10070335 | 3300009147 | Bacteria | 4880 |
| 408 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 409 | Ga0105243_10008999 | 3300009148 | Bacteria | 7631 |
| 410 | Ga0105243_10010600 | 3300009148 | Bacteria | 6997 |
| 411 | Ga0105243_10226682 | 3300009148 | Bacteria | 1655 |
| 412 | Ga0105243_10493181 | 3300009148 | Bacteria | 1159 |
| 413 | Ga0105243_10541819 | 3300009148 | Bacteria | 1110 |
| 414 | Ga0105243_11060138 | 3300009148 | Bacteria | 817 |
| 415 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 416 | Ga0105241_10011078 | 3300009174 | Bacteria | 6617 |
| 417 | Ga0105241_10188510 | 3300009174 | Bacteria | 1715 |
| 418 | Ga0105241_10610663 | 3300009174 | Bacteria | 986 |
| 419 | Ga0105241_11032330 | 3300009174 | Bacteria | 771 |
| 420 | Ga0105241_11235668 | 3300009174 | Unclassified | 709 |
| 421 | Ga0105241_12027947 | 3300009174 | Bacteria | 567 |
| 422 | Ga0105241_12382610 | 3300009174 | Bacteria | 528 |
| 423 | Ga0105241_12643660 | 3300009174 | Unclassified | 505 |
| 424 | Ga0105242_10000011 | 3300009176 | Bacteria | 149791 |
| 425 | Ga0105242_10007562 | 3300009176 | Bacteria | 8364 |
| 426 | Ga0105242_10009973 | 3300009176 | Bacteria | 7273 |
| 427 | Ga0105242_10013678 | 3300009176 | Bacteria | 6277 |
| 428 | Ga0105242_10298770 | 3300009176 | Bacteria | 1469 |
| 429 | Ga0105242_10565124 | 3300009176 | Bacteria | 1093 |
| 430 | Ga0105242_11337195 | 3300009176 | Bacteria | 742 |
| 431 | Ga0105242_12562015 | 3300009176 | Bacteria | 559 |
| 432 | Ga0105248_10010314 | 3300009177 | Bacteria | 10284 |
| 433 | Ga0105248_10094322 | 3300009177 | Bacteria | 3370 |
| 434 | Ga0105248_10113808 | 3300009177 | Bacteria | 3051 |
| 435 | Ga0105248_10167563 | 3300009177 | Bacteria | 2476 |
| 436 | Ga0105248_11675979 | 3300009177 | Bacteria | 721 |
| 437 | Ga0105237_10472790 | 3300009545 | Bacteria | 1259 |
| 438 | Ga0105237_10631440 | 3300009545 | Bacteria | 1078 |
| 439 | Ga0105237_10828063 | 3300009545 | Bacteria | 932 |
| 440 | Ga0105237_11326470 | 3300009545 | Bacteria | 726 |
| 441 | Ga0105237_11420833 | 3300009545 | Bacteria | 700 |
| 442 | Ga0105237_11574530 | 3300009545 | Bacteria | 664 |
| 443 | Ga0105237_11592915 | 3300009545 | Bacteria | 660 |
| 444 | Ga0105237_11706766 | 3300009545 | Bacteria | 637 |
| 445 | Ga0105238_10000579 | 3300009551 | Bacteria | 38459 |
| 446 | Ga0105238_10124575 | 3300009551 | Bacteria | 2556 |
| 447 | Ga0105238_10231710 | 3300009551 | Bacteria | 1823 |
| 448 | Ga0105238_10237507 | 3300009551 | Bacteria | 1800 |
| 449 | Ga0105238_11236590 | 3300009551 | Bacteria | 772 |
| 450 | Ga0105238_11326845 | 3300009551 | Bacteria | 746 |
| 451 | Ga0105238_12020090 | 3300009551 | Bacteria | 610 |
| 452 | Ga0105238_12305224 | 3300009551 | Bacteria | 573 |
| 453 | Ga0105238_12309822 | 3300009551 | Unclassified | 573 |
| 454 | Ga0105238_12338051 | 3300009551 | Bacteria | 570 |
| 455 | Ga0105238_12453133 | 3300009551 | Bacteria | 557 |
| 456 | Ga0105249_10002379 | 3300009553 | Bacteria | 16319 |
| 457 | Ga0105249_10256697 | 3300009553 | Bacteria | 1735 |
| 458 | Ga0105249_10432368 | 3300009553 | Bacteria | 1352 |
| 459 | Ga0105249_10759437 | 3300009553 | Bacteria | 1032 |
| 460 | Ga0105249_13073428 | 3300009553 | Bacteria | 536 |
| 461 | Ga0105033_105305 | 3300009986 | Bacteria | 1107 |
| 462 | Ga0105033_119600 | 3300009986 | Bacteria | 614 |
| 463 | Ga0105030_102571 | 3300009987 | Bacteria | 1574 |
| 464 | Ga0105028_100084 | 3300009993 | Bacteria | 9852 |
| 465 | Ga0105239_10032725 | 3300010375 | Bacteria | 5713 |
| 466 | Ga0105239_10075342 | 3300010375 | Bacteria | 3710 |
| 467 | Ga0105239_10138559 | 3300010375 | Bacteria | 2710 |
| 468 | Ga0105239_10482126 | 3300010375 | Bacteria | 1409 |
| 469 | Ga0105239_10959267 | 3300010375 | Bacteria | 982 |
| 470 | Ga0105239_11707210 | 3300010375 | Bacteria | 729 |
| 471 | Ga0105239_12338703 | 3300010375 | Bacteria | 622 |
| 472 | Ga0105239_13146168 | 3300010375 | Bacteria | 538 |
| 473 | Ga0105246_10153679 | 3300011119 | Bacteria | 1745 |
| 474 | Ga0105246_10496388 | 3300011119 | Bacteria | 1036 |
| 475 | Ga0105246_10497338 | 3300011119 | Bacteria | 1035 |
| 476 | Ga0157373_10000583 | 3300013100 | Bacteria | 28402 |
| 477 | Ga0157373_10085939 | 3300013100 | Bacteria | 2217 |
| 478 | Ga0157373_10264006 | 3300013100 | Bacteria | 1218 |
| 479 | Ga0157373_10300554 | 3300013100 | Bacteria | 1139 |
| 480 | Ga0157373_11353663 | 3300013100 | Bacteria | 540 |
| 481 | Ga0157371_10000176 | 3300013102 | Bacteria | 93047 |
| 482 | Ga0157371_10204330 | 3300013102 | Bacteria | 1417 |
| 483 | Ga0157371_10350013 | 3300013102 | Bacteria | 1075 |
| 484 | Ga0157370_10022524 | 3300013104 | Bacteria | 6268 |
| 485 | Ga0157370_10126444 | 3300013104 | Bacteria | 2386 |
| 486 | Ga0157370_10253314 | 3300013104 | Bacteria | 1628 |
| 487 | Ga0157370_11103071 | 3300013104 | Bacteria | 717 |
| 488 | Ga0157370_11159277 | 3300013104 | Bacteria | 698 |
| 489 | Ga0157369_10003258 | 3300013105 | Bacteria | 19325 |
| 490 | Ga0157369_10059996 | 3300013105 | Bacteria | 4103 |
| 491 | Ga0157369_10066496 | 3300013105 | Bacteria | 3877 |
| 492 | Ga0157369_10138227 | 3300013105 | Bacteria | 2579 |
| 493 | Ga0157369_10290843 | 3300013105 | Bacteria | 1701 |
| 494 | Ga0157369_11133067 | 3300013105 | Bacteria | 799 |
| 495 | Ga0157374_10000565 | 3300013296 | Bacteria | 32833 |
| 496 | Ga0157374_10001076 | 3300013296 | Bacteria | 23646 |
| 497 | Ga0157374_10001882 | 3300013296 | Bacteria | 17636 |
| 498 | Ga0157374_10025334 | 3300013296 | Bacteria | 5324 |
| 499 | Ga0157374_10044228 | 3300013296 | Bacteria | 4116 |
| 500 | Ga0157374_10129323 | 3300013296 | Bacteria | 2443 |
| 501 | Ga0157374_10157731 | 3300013296 | Bacteria | 2209 |
| 502 | Ga0157374_10594354 | 3300013296 | Bacteria | 1116 |
| 503 | Ga0157374_10604295 | 3300013296 | Bacteria | 1107 |
| 504 | Ga0157374_11083976 | 3300013296 | Bacteria | 821 |
| 505 | Ga0157374_11918021 | 3300013296 | Bacteria | 618 |
| 506 | Ga0157378_10010736 | 3300013297 | Bacteria | 8006 |
| 507 | Ga0157378_10021639 | 3300013297 | Bacteria | 5655 |
| 508 | Ga0157378_10058507 | 3300013297 | Bacteria | 3437 |
| 509 | Ga0157378_10165606 | 3300013297 | Bacteria | 2070 |
| 510 | Ga0157378_10214933 | 3300013297 | Bacteria | 1825 |
| 511 | Ga0157378_10374383 | 3300013297 | Bacteria | 1397 |
| 512 | Ga0157378_11384493 | 3300013297 | Bacteria | 746 |
| 513 | Ga0157378_11860215 | 3300013297 | Bacteria | 651 |
| 514 | Ga0163162_10060008 | 3300013306 | Bacteria | 3837 |
| 515 | Ga0163162_10684810 | 3300013306 | Bacteria | 1148 |
| 516 | Ga0163162_11437546 | 3300013306 | Bacteria | 785 |
| 517 | Ga0157372_10000670 | 3300013307 | Bacteria | 37704 |
| 518 | Ga0157372_10002726 | 3300013307 | Bacteria | 19106 |
| 519 | Ga0157372_10687980 | 3300013307 | Bacteria | 1190 |
| 520 | Ga0157372_11086663 | 3300013307 | Bacteria | 926 |
| 521 | Ga0157372_11135780 | 3300013307 | Unclassified | 904 |
| 522 | Ga0157375_10039139 | 3300013308 | Bacteria | 4560 |
| 523 | Ga0157375_10042447 | 3300013308 | Bacteria | 4402 |
| 524 | Ga0157375_10237882 | 3300013308 | Bacteria | 1980 |
| 525 | Ga0157375_10287657 | 3300013308 | Bacteria | 1807 |
| 526 | Ga0157375_11211781 | 3300013308 | Bacteria | 886 |
| 527 | Ga0157514_121480 | 3300013874 | Bacteria | 989 |
| 528 | Ga0163163_10000689 | 3300014325 | Bacteria | 28712 |
| 529 | Ga0163163_10317037 | 3300014325 | Bacteria | 1613 |
| 530 | Ga0163163_10417887 | 3300014325 | Bacteria | 1400 |
| 531 | Ga0163163_12431835 | 3300014325 | Unclassified | 582 |
| 532 | Ga0157380_10117219 | 3300014326 | Bacteria | 2249 |
| 533 | Ga0157380_10198410 | 3300014326 | Bacteria | 1778 |
| 534 | Ga0157380_13064895 | 3300014326 | Unclassified | 533 |
| 535 | Ga0157377_10015248 | 3300014745 | Bacteria | 3927 |
| 536 | Ga0157377_10056857 | 3300014745 | Bacteria | 2223 |
| 537 | Ga0157377_11591526 | 3300014745 | Bacteria | 523 |
| 538 | Ga0157379_10029119 | 3300014968 | Bacteria | 4912 |
| 539 | Ga0157379_10030185 | 3300014968 | Bacteria | 4823 |
| 540 | Ga0157379_10062576 | 3300014968 | Bacteria | 3328 |
| 541 | Ga0157379_10103915 | 3300014968 | Bacteria | 2549 |
| 542 | Ga0157379_12271110 | 3300014968 | Bacteria | 540 |
| 543 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 544 | Ga0157376_10110927 | 3300014969 | Bacteria | 2414 |
| 545 | Ga0157376_10673519 | 3300014969 | Bacteria | 1037 |
| 546 | Ga0157376_10874119 | 3300014969 | Bacteria | 916 |
| 547 | Ga0157376_11657185 | 3300014969 | Bacteria | 674 |
| 548 | Ga0157376_12791261 | 3300014969 | Bacteria | 528 |
| 549 | Ga0163161_10121656 | 3300017792 | Bacteria | 1962 |
| 550 | Ga0163161_10504241 | 3300017792 | Bacteria | 986 |
| 551 | Ga0206355_1195425 | 3300020076 | Bacteria | 670 |
| 552 | Ga0206355_1665954 | 3300020076 | Bacteria | 537 |
| 553 | Ga0206353_10244075 | 3300020082 | Bacteria | 827 |
| 554 | Ga0206353_10922718 | 3300020082 | Bacteria | 1860 |
| 555 | Ga0154015_1346800 | 3300020610 | Bacteria | 930 |
| 556 | Ga0213872_10001745 | 3300021361 | Bacteria | 13647 |
| 557 | Ga0213875_10151352 | 3300021388 | Bacteria | 1087 |
| 558 | Ga0207656_10172742 | 3300025321 | Bacteria | 1034 |
| 559 | Ga0207682_10153778 | 3300025893 | Bacteria | 1039 |
| 560 | Ga0207692_10000677 | 3300025898 | Bacteria | 12030 |
| 561 | Ga0207692_10474147 | 3300025898 | Bacteria | 791 |
| 562 | Ga0207692_11037077 | 3300025898 | Bacteria | 542 |
| 563 | Ga0207642_10011396 | 3300025899 | Bacteria | 3170 |
| 564 | Ga0207642_10068490 | 3300025899 | Bacteria | 1679 |
| 565 | Ga0207710_10123466 | 3300025900 | Bacteria | 1238 |
| 566 | Ga0207680_10010180 | 3300025903 | Bacteria | 4694 |
| 567 | Ga0207680_10372310 | 3300025903 | Bacteria | 1006 |
| 568 | Ga0207680_10435656 | 3300025903 | Bacteria | 929 |
| 569 | Ga0207680_10870306 | 3300025903 | Unclassified | 646 |
| 570 | Ga0207680_11122379 | 3300025903 | Bacteria | 562 |
| 571 | Ga0207647_10008577 | 3300025904 | Bacteria | 7315 |
| 572 | Ga0207647_10625569 | 3300025904 | Bacteria | 592 |
| 573 | Ga0207685_10022094 | 3300025905 | Bacteria | 2144 |
| 574 | Ga0207699_10042494 | 3300025906 | Bacteria | 2634 |
| 575 | Ga0207699_10432796 | 3300025906 | Bacteria | 941 |
| 576 | Ga0207645_10005044 | 3300025907 | Bacteria | 9671 |
| 577 | Ga0207645_10143075 | 3300025907 | Bacteria | 1559 |
| 578 | Ga0207645_10282193 | 3300025907 | Bacteria | 1103 |
| 579 | Ga0207643_10014781 | 3300025908 | Bacteria | 4245 |
| 580 | Ga0207643_10022628 | 3300025908 | Bacteria | 3462 |
| 581 | Ga0207643_10856592 | 3300025908 | Bacteria | 589 |
| 582 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 583 | Ga0207705_10000038 | 3300025909 | Bacteria | 193812 |
| 584 | Ga0207705_10000167 | 3300025909 | Bacteria | 71284 |
| 585 | Ga0207705_10006171 | 3300025909 | Bacteria | 8914 |
| 586 | Ga0207705_10007444 | 3300025909 | Bacteria | 8051 |
| 587 | Ga0207705_10019143 | 3300025909 | Bacteria | 4897 |
| 588 | Ga0207705_10525686 | 3300025909 | Bacteria | 919 |
| 589 | Ga0207684_10046614 | 3300025910 | Bacteria | 3677 |
| 590 | Ga0207684_10209286 | 3300025910 | Bacteria | 1682 |
| 591 | Ga0207684_10568375 | 3300025910 | Bacteria | 969 |
| 592 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 593 | Ga0207654_10053235 | 3300025911 | Bacteria | 2336 |
| 594 | Ga0207654_10116489 | 3300025911 | Bacteria | 1671 |
| 595 | Ga0207654_10711922 | 3300025911 | Bacteria | 722 |
| 596 | Ga0207654_10949269 | 3300025911 | Bacteria | 624 |
| 597 | Ga0207707_10003287 | 3300025912 | Bacteria | 14366 |
| 598 | Ga0207707_10072140 | 3300025912 | Bacteria | 3010 |
| 599 | Ga0207707_10144644 | 3300025912 | Bacteria | 2078 |
| 600 | Ga0207707_10227503 | 3300025912 | Bacteria | 1623 |
| 601 | Ga0207707_10306010 | 3300025912 | Bacteria | 1374 |
| 602 | Ga0207707_10690226 | 3300025912 | Bacteria | 858 |
| 603 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 604 | Ga0207695_10051029 | 3300025913 | Bacteria | 4346 |
| 605 | Ga0207695_10096000 | 3300025913 | Bacteria | 2967 |
| 606 | Ga0207695_10209706 | 3300025913 | Bacteria | 1859 |
| 607 | Ga0207695_10223098 | 3300025913 | Bacteria | 1791 |
| 608 | Ga0207695_10731065 | 3300025913 | Bacteria | 870 |
| 609 | Ga0207671_10066252 | 3300025914 | Bacteria | 2688 |
| 610 | Ga0207671_10274153 | 3300025914 | Bacteria | 1330 |
| 611 | Ga0207671_10583590 | 3300025914 | Bacteria | 891 |
| 612 | Ga0207671_10884974 | 3300025914 | Unclassified | 706 |
| 613 | Ga0207671_11603295 | 3300025914 | Unclassified | 500 |
| 614 | Ga0207693_10292792 | 3300025915 | Bacteria | 1276 |
| 615 | Ga0207693_10293235 | 3300025915 | Bacteria | 1275 |
| 616 | Ga0207693_11302437 | 3300025915 | Bacteria | 543 |
| 617 | Ga0207663_10024879 | 3300025916 | Bacteria | 3453 |
| 618 | Ga0207663_10540116 | 3300025916 | Bacteria | 910 |
| 619 | Ga0207660_10000748 | 3300025917 | Bacteria | 21610 |
| 620 | Ga0207660_10031712 | 3300025917 | Bacteria | 3643 |
| 621 | Ga0207660_10143092 | 3300025917 | Bacteria | 1830 |
| 622 | Ga0207660_10807668 | 3300025917 | Bacteria | 765 |
| 623 | Ga0207660_11128405 | 3300025917 | Unclassified | 639 |
| 624 | Ga0207660_11520174 | 3300025917 | Bacteria | 541 |
| 625 | Ga0207660_11522996 | 3300025917 | Bacteria | 540 |
| 626 | Ga0207662_10183113 | 3300025918 | Bacteria | 1349 |
| 627 | Ga0207662_10415489 | 3300025918 | Bacteria | 914 |
| 628 | Ga0207662_10657989 | 3300025918 | Bacteria | 732 |
| 629 | Ga0207662_10748147 | 3300025918 | Bacteria | 687 |
| 630 | Ga0207662_11342533 | 3300025918 | Bacteria | 508 |
| 631 | Ga0207662_11376819 | 3300025918 | Bacteria | 501 |
| 632 | Ga0207657_10000280 | 3300025919 | Bacteria | 54274 |
| 633 | Ga0207657_10000804 | 3300025919 | Bacteria | 33189 |
| 634 | Ga0207657_10006928 | 3300025919 | Bacteria | 11684 |
| 635 | Ga0207657_10016230 | 3300025919 | Bacteria | 7187 |
| 636 | Ga0207657_10488203 | 3300025919 | Bacteria | 965 |
| 637 | Ga0207649_10576597 | 3300025920 | Bacteria | 863 |
| 638 | Ga0207649_10950836 | 3300025920 | Unclassified | 675 |
| 639 | Ga0207649_11197753 | 3300025920 | Bacteria | 600 |
| 640 | Ga0207652_10007578 | 3300025921 | Bacteria | 8740 |
| 641 | Ga0207652_10008454 | 3300025921 | Bacteria | 8282 |
| 642 | Ga0207652_10013911 | 3300025921 | Bacteria | 6514 |
| 643 | Ga0207652_10017326 | 3300025921 | Bacteria | 5895 |
| 644 | Ga0207652_10047579 | 3300025921 | Bacteria | 3664 |
| 645 | Ga0207652_10056559 | 3300025921 | Bacteria | 3377 |
| 646 | Ga0207652_10130422 | 3300025921 | Bacteria | 2242 |
| 647 | Ga0207652_10194495 | 3300025921 | Bacteria | 1824 |
| 648 | Ga0207652_10296884 | 3300025921 | Bacteria | 1458 |
| 649 | Ga0207652_10968734 | 3300025921 | Bacteria | 749 |
| 650 | Ga0207652_10979782 | 3300025921 | Bacteria | 744 |
| 651 | Ga0207652_10997420 | 3300025921 | Bacteria | 736 |
| 652 | Ga0207652_10998260 | 3300025921 | Bacteria | 736 |
| 653 | Ga0207652_11136868 | 3300025921 | Bacteria | 682 |
| 654 | Ga0207646_10004914 | 3300025922 | Bacteria | 14301 |
| 655 | Ga0207646_10188618 | 3300025922 | Bacteria | 1862 |
| 656 | Ga0207646_10298443 | 3300025922 | Bacteria | 1456 |
| 657 | Ga0207646_10543196 | 3300025922 | Bacteria | 1045 |
| 658 | Ga0207681_10044851 | 3300025923 | Bacteria | 2965 |
| 659 | Ga0207681_11525745 | 3300025923 | Bacteria | 560 |
| 660 | Ga0207694_10000232 | 3300025924 | Bacteria | 53672 |
| 661 | Ga0207694_10297488 | 3300025924 | Bacteria | 1328 |
| 662 | Ga0207694_10369919 | 3300025924 | Bacteria | 1189 |
| 663 | Ga0207694_10471729 | 3300025924 | Bacteria | 1049 |
| 664 | Ga0207694_10905252 | 3300025924 | Bacteria | 746 |
| 665 | Ga0207694_11515029 | 3300025924 | Bacteria | 566 |
| 666 | Ga0207650_10051370 | 3300025925 | Bacteria | 3051 |
| 667 | Ga0207650_10183495 | 3300025925 | Bacteria | 1669 |
| 668 | Ga0207659_10154532 | 3300025926 | Bacteria | 1795 |
| 669 | Ga0207659_10369763 | 3300025926 | Bacteria | 1193 |
| 670 | Ga0207659_10400232 | 3300025926 | Bacteria | 1148 |
| 671 | Ga0207687_10000030 | 3300025927 | Bacteria | 155548 |
| 672 | Ga0207687_10000318 | 3300025927 | Bacteria | 32809 |
| 673 | Ga0207687_10008644 | 3300025927 | Bacteria | 6655 |
| 674 | Ga0207687_10015188 | 3300025927 | Bacteria | 5046 |
| 675 | Ga0207687_10026767 | 3300025927 | Bacteria | 3864 |
| 676 | Ga0207687_10257708 | 3300025927 | Bacteria | 1389 |
| 677 | Ga0207687_10343208 | 3300025927 | Bacteria | 1215 |
| 678 | Ga0207687_10985624 | 3300025927 | Bacteria | 723 |
| 679 | Ga0207700_10000077 | 3300025928 | Bacteria | 60197 |
| 680 | Ga0207700_10003616 | 3300025928 | Bacteria | 9010 |
| 681 | Ga0207700_10905879 | 3300025928 | Bacteria | 789 |
| 682 | Ga0207664_10003229 | 3300025929 | Bacteria | 10836 |
| 683 | Ga0207664_10014803 | 3300025929 | Bacteria | 5646 |
| 684 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 685 | Ga0207644_10003510 | 3300025931 | Bacteria | 10149 |
| 686 | Ga0207644_10020573 | 3300025931 | Bacteria | 4488 |
| 687 | Ga0207644_10106804 | 3300025931 | Bacteria | 2111 |
| 688 | Ga0207644_10564013 | 3300025931 | Bacteria | 943 |
| 689 | Ga0207690_10000521 | 3300025932 | Bacteria | 24993 |
| 690 | Ga0207690_10163984 | 3300025932 | Bacteria | 1659 |
| 691 | Ga0207690_10226334 | 3300025932 | Bacteria | 1434 |
| 692 | Ga0207706_10068780 | 3300025933 | Bacteria | 3115 |
| 693 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 694 | Ga0207686_10000521 | 3300025934 | Bacteria | 24900 |
| 695 | Ga0207686_10005025 | 3300025934 | Bacteria | 7120 |
| 696 | Ga0207686_10015693 | 3300025934 | Bacteria | 4240 |
| 697 | Ga0207686_10088578 | 3300025934 | Bacteria | 2038 |
| 698 | Ga0207686_10188335 | 3300025934 | Bacteria | 1469 |
| 699 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 700 | Ga0207709_10006627 | 3300025935 | Bacteria | 6498 |
| 701 | Ga0207709_10008424 | 3300025935 | Bacteria | 5703 |
| 702 | Ga0207709_10256442 | 3300025935 | Bacteria | 1280 |
| 703 | Ga0207709_11293062 | 3300025935 | Bacteria | 603 |
| 704 | Ga0207670_10035982 | 3300025936 | Bacteria | 3216 |
| 705 | Ga0207670_10657956 | 3300025936 | Bacteria | 864 |
| 706 | Ga0207670_11367464 | 3300025936 | Bacteria | 601 |
| 707 | Ga0207669_10027599 | 3300025937 | Bacteria | 3111 |
| 708 | Ga0207669_10040466 | 3300025937 | Bacteria | 2704 |
| 709 | Ga0207669_10142350 | 3300025937 | Bacteria | 1667 |
| 710 | Ga0207704_10018134 | 3300025938 | Bacteria | 3667 |
| 711 | Ga0207704_10390402 | 3300025938 | Bacteria | 1095 |
| 712 | Ga0207704_11968198 | 3300025938 | Unclassified | 503 |
| 713 | Ga0207665_10133250 | 3300025939 | Bacteria | 1766 |
| 714 | Ga0207665_10163137 | 3300025939 | Bacteria | 1604 |
| 715 | Ga0207665_10168544 | 3300025939 | Bacteria | 1580 |
| 716 | Ga0207691_10054461 | 3300025940 | Bacteria | 3648 |
| 717 | Ga0207691_10126313 | 3300025940 | Bacteria | 2263 |
| 718 | Ga0207691_11229119 | 3300025940 | Bacteria | 620 |
| 719 | Ga0207711_10007779 | 3300025941 | Bacteria | 8957 |
| 720 | Ga0207711_10028146 | 3300025941 | Bacteria | 4727 |
| 721 | Ga0207711_10112488 | 3300025941 | Bacteria | 2423 |
| 722 | Ga0207711_10230905 | 3300025941 | Bacteria | 1694 |
| 723 | Ga0207711_11305411 | 3300025941 | Bacteria | 668 |
| 724 | Ga0207689_10000292 | 3300025942 | Bacteria | 45545 |
| 725 | Ga0207689_10000370 | 3300025942 | Bacteria | 42422 |
| 726 | Ga0207689_10017314 | 3300025942 | Bacteria | 6099 |
| 727 | Ga0207689_10371921 | 3300025942 | Bacteria | 1189 |
| 728 | Ga0207661_10000021 | 3300025944 | Bacteria | 205381 |
| 729 | Ga0207661_10002824 | 3300025944 | Bacteria | 11992 |
| 730 | Ga0207661_10084193 | 3300025944 | Bacteria | 2633 |
| 731 | Ga0207661_10159071 | 3300025944 | Bacteria | 1959 |
| 732 | Ga0207661_10253160 | 3300025944 | Bacteria | 1566 |
| 733 | Ga0207661_10441959 | 3300025944 | Unclassified | 1184 |
| 734 | Ga0207661_10854015 | 3300025944 | Bacteria | 838 |
| 735 | Ga0207661_11104487 | 3300025944 | Bacteria | 730 |
| 736 | Ga0207661_11995849 | 3300025944 | Unclassified | 526 |
| 737 | Ga0207679_10303101 | 3300025945 | Bacteria | 1378 |
| 738 | Ga0207679_10447699 | 3300025945 | Bacteria | 1145 |
| 739 | Ga0207679_10876936 | 3300025945 | Bacteria | 820 |
| 740 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 741 | Ga0207667_10000299 | 3300025949 | Bacteria | 68595 |
| 742 | Ga0207667_10000339 | 3300025949 | Bacteria | 64087 |
| 743 | Ga0207667_10023417 | 3300025949 | Bacteria | 6800 |
| 744 | Ga0207667_10087215 | 3300025949 | Bacteria | 3229 |
| 745 | Ga0207667_10431219 | 3300025949 | Bacteria | 1341 |
| 746 | Ga0207667_10631152 | 3300025949 | Bacteria | 1078 |
| 747 | Ga0207667_10649009 | 3300025949 | Bacteria | 1061 |
| 748 | Ga0207667_10740028 | 3300025949 | Bacteria | 983 |
| 749 | Ga0207667_11287606 | 3300025949 | Unclassified | 708 |
| 750 | Ga0207667_11305912 | 3300025949 | Bacteria | 702 |
| 751 | Ga0207667_11369619 | 3300025949 | Bacteria | 682 |
| 752 | Ga0207651_10000203 | 3300025960 | Bacteria | 25844 |
| 753 | Ga0207651_10038713 | 3300025960 | Bacteria | 3136 |
| 754 | Ga0207651_10054318 | 3300025960 | Bacteria | 2744 |
| 755 | Ga0207712_10001459 | 3300025961 | Bacteria | 16136 |
| 756 | Ga0207712_10015338 | 3300025961 | Bacteria | 4940 |
| 757 | Ga0207712_10280366 | 3300025961 | Bacteria | 1360 |
| 758 | Ga0207712_11950706 | 3300025961 | Bacteria | 526 |
| 759 | Ga0207668_10621333 | 3300025972 | Bacteria | 943 |
| 760 | Ga0207640_10609573 | 3300025981 | Bacteria | 925 |
| 761 | Ga0207640_11690498 | 3300025981 | Bacteria | 571 |
| 762 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 763 | Ga0207658_10002651 | 3300025986 | Bacteria | 12966 |
| 764 | Ga0207658_11081093 | 3300025986 | Bacteria | 732 |
| 765 | Ga0207658_11510997 | 3300025986 | Bacteria | 614 |
| 766 | Ga0207677_10001880 | 3300026023 | Bacteria | 11094 |
| 767 | Ga0207677_12129978 | 3300026023 | Bacteria | 522 |
| 768 | Ga0207703_10000517 | 3300026035 | Bacteria | 39928 |
| 769 | Ga0207703_10043986 | 3300026035 | Bacteria | 3587 |
| 770 | Ga0207703_10283662 | 3300026035 | Bacteria | 1505 |
| 771 | Ga0207703_11786449 | 3300026035 | Unclassified | 591 |
| 772 | Ga0207639_10502283 | 3300026041 | Bacteria | 1108 |
| 773 | Ga0207639_11190245 | 3300026041 | Bacteria | 715 |
| 774 | Ga0207639_11677116 | 3300026041 | Bacteria | 596 |
| 775 | Ga0207639_11891464 | 3300026041 | Unclassified | 558 |
| 776 | Ga0207678_10049262 | 3300026067 | Bacteria | 3641 |
| 777 | Ga0207678_10171922 | 3300026067 | Bacteria | 1850 |
| 778 | Ga0207708_10004151 | 3300026075 | Bacteria | 10655 |
| 779 | Ga0207708_10109455 | 3300026075 | Bacteria | 2144 |
| 780 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 781 | Ga0207702_10001268 | 3300026078 | Bacteria | 25374 |
| 782 | Ga0207702_10003219 | 3300026078 | Bacteria | 15080 |
| 783 | Ga0207702_10023468 | 3300026078 | Bacteria | 5117 |
| 784 | Ga0207702_10184378 | 3300026078 | Bacteria | 1924 |
| 785 | Ga0207702_10213107 | 3300026078 | Bacteria | 1797 |
| 786 | Ga0207702_10402809 | 3300026078 | Bacteria | 1320 |
| 787 | Ga0207702_10644031 | 3300026078 | Bacteria | 1042 |
| 788 | Ga0207702_11003924 | 3300026078 | Bacteria | 828 |
| 789 | Ga0207702_11058965 | 3300026078 | Bacteria | 805 |
| 790 | Ga0207641_10002453 | 3300026088 | Bacteria | 17140 |
| 791 | Ga0207641_10016989 | 3300026088 | Bacteria | 5958 |
| 792 | Ga0207641_10074503 | 3300026088 | Bacteria | 2928 |
| 793 | Ga0207641_10080247 | 3300026088 | Bacteria | 2830 |
| 794 | Ga0207641_11243983 | 3300026088 | Bacteria | 744 |
| 795 | Ga0207648_10055064 | 3300026089 | Bacteria | 3473 |
| 796 | Ga0207648_10063803 | 3300026089 | Bacteria | 3210 |
| 797 | Ga0207648_10067573 | 3300026089 | Bacteria | 3116 |
| 798 | Ga0207648_10190278 | 3300026089 | Bacteria | 1818 |
| 799 | Ga0207648_10390358 | 3300026089 | Bacteria | 1260 |
| 800 | Ga0207648_10415731 | 3300026089 | Bacteria | 1220 |
| 801 | Ga0207676_10000167 | 3300026095 | Bacteria | 57507 |
| 802 | Ga0207674_10000001 | 3300026116 | Bacteria | 616581 |
| 803 | Ga0207674_10005648 | 3300026116 | Bacteria | 14829 |
| 804 | Ga0207674_10513650 | 3300026116 | Bacteria | 1157 |
| 805 | Ga0207674_10928517 | 3300026116 | Bacteria | 839 |
| 806 | Ga0207674_11454072 | 3300026116 | Bacteria | 655 |
| 807 | Ga0207674_12144067 | 3300026116 | Unclassified | 522 |
| 808 | Ga0207674_12162519 | 3300026116 | Bacteria | 520 |
| 809 | Ga0207674_12293146 | 3300026116 | Bacteria | 502 |
| 810 | Ga0207675_100013573 | 3300026118 | Bacteria | 7605 |
| 811 | Ga0207675_100059255 | 3300026118 | Bacteria | 3573 |
| 812 | Ga0207675_100204893 | 3300026118 | Bacteria | 1895 |
| 813 | Ga0207675_100848329 | 3300026118 | Bacteria | 928 |
| 814 | Ga0207675_100955207 | 3300026118 | Bacteria | 875 |
| 815 | Ga0207675_102023718 | 3300026118 | Bacteria | 593 |
| 816 | Ga0207683_10000965 | 3300026121 | Bacteria | 26325 |
| 817 | Ga0207683_10002331 | 3300026121 | Bacteria | 16657 |
| 818 | Ga0207683_10041485 | 3300026121 | Bacteria | 4018 |
| 819 | Ga0207683_10046413 | 3300026121 | Bacteria | 3801 |
| 820 | Ga0207683_10375895 | 3300026121 | Bacteria | 1306 |
| 821 | Ga0207698_10233471 | 3300026142 | Bacteria | 1671 |
| 822 | Ga0207698_10657098 | 3300026142 | Bacteria | 1039 |
| 823 | Ga0207698_11663835 | 3300026142 | Bacteria | 654 |
| 824 | Ga0209998_10096500 | 3300027717 | Bacteria | 729 |
| 825 | Ga0209813_10000009 | 3300027866 | Bacteria | 102315 |
| 826 | Ga0207428_10396859 | 3300027907 | Bacteria | 1010 |
| 827 | Ga0268266_10003734 | 3300028379 | Bacteria | 14969 |
| 828 | Ga0268266_10034899 | 3300028379 | Bacteria | 4278 |
| 829 | Ga0268266_10103455 | 3300028379 | Bacteria | 2513 |
| 830 | Ga0268266_10313573 | 3300028379 | Bacteria | 1466 |
| 831 | Ga0268266_10659292 | 3300028379 | Bacteria | 1007 |
| 832 | Ga0268265_10188685 | 3300028380 | Bacteria | 1778 |
| 833 | Ga0268265_10220988 | 3300028380 | Bacteria | 1657 |
| 834 | Ga0268264_10044828 | 3300028381 | Bacteria | 3670 |
| 835 | Ga0268264_10103423 | 3300028381 | Bacteria | 2480 |
| 836 | Ga0268264_10121832 | 3300028381 | Bacteria | 2299 |
| 837 | Ga0268264_10144907 | 3300028381 | Bacteria | 2122 |
| 838 | Ga0268264_10305734 | 3300028381 | Bacteria | 1498 |
| 839 | Ga0268264_11483023 | 3300028381 | Bacteria | 689 |
| 840 | Ga0268264_11655216 | 3300028381 | Unclassified | 650 |
| 841 | Ga0268264_11988178 | 3300028381 | Bacteria | 591 |
| 842 | Ga0268264_12700054 | 3300028381 | Bacteria | 500 |
| 843 | Ga0265337_1000001 | 3300028556 | Bacteria | 140973 |
| 844 | Ga0265337_1058922 | 3300028556 | Bacteria | 1066 |
| 845 | Ga0265337_1065250 | 3300028556 | Bacteria | 1004 |
| 846 | Ga0265337_1071695 | 3300028556 | Unclassified | 951 |
| 847 | Ga0265326_10005024 | 3300028558 | Bacteria | 4190 |
| 848 | Ga0265326_10018388 | 3300028558 | Bacteria | 2012 |
| 849 | Ga0265326_10071393 | 3300028558 | Bacteria | 981 |
| 850 | Ga0265319_1179800 | 3300028563 | Bacteria | 652 |
| 851 | Ga0265334_10000049 | 3300028573 | Bacteria | 89091 |
| 852 | Ga0265334_10000114 | 3300028573 | Bacteria | 52821 |
| 853 | Ga0265334_10046542 | 3300028573 | Unclassified | 1676 |
| 854 | Ga0265334_10115392 | 3300028573 | Bacteria | 962 |
| 855 | Ga0265334_10127792 | 3300028573 | Bacteria | 906 |
| 856 | Ga0265318_10111693 | 3300028577 | Bacteria | 1005 |
| 857 | Ga0265322_10009918 | 3300028654 | Bacteria | 2762 |
| 858 | Ga0265322_10038325 | 3300028654 | Bacteria | 1364 |
| 859 | Ga0265322_10123932 | 3300028654 | Bacteria | 736 |
| 860 | Ga0265336_10000618 | 3300028666 | Bacteria | 19547 |
| 861 | Ga0265336_10135916 | 3300028666 | Unclassified | 731 |
| 862 | Ga0265336_10171602 | 3300028666 | Bacteria | 645 |
| 863 | Ga0307515_10370836 | 3300028794 | Bacteria | 1068 |
| 864 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 865 | Ga0265338_10000052 | 3300028800 | Bacteria | 209239 |
| 866 | Ga0265338_10000054 | 3300028800 | Bacteria | 207383 |
| 867 | Ga0265338_10000217 | 3300028800 | Bacteria | 106453 |
| 868 | Ga0265338_10000366 | 3300028800 | Bacteria | 81024 |
| 869 | Ga0265338_10000543 | 3300028800 | Bacteria | 66162 |
| 870 | Ga0265338_10003025 | 3300028800 | Bacteria | 24237 |
| 871 | Ga0265338_10009585 | 3300028800 | Bacteria | 11511 |
| 872 | Ga0265338_10017457 | 3300028800 | Bacteria | 7732 |
| 873 | Ga0265338_10035997 | 3300028800 | Bacteria | 4746 |
| 874 | Ga0265338_10085544 | 3300028800 | Bacteria | 2628 |
| 875 | Ga0265338_10091843 | 3300028800 | Bacteria | 2506 |
| 876 | Ga0265338_10099324 | 3300028800 | Bacteria | 2378 |
| 877 | Ga0265338_10205341 | 3300028800 | Unclassified | 1483 |
| 878 | Ga0265338_10490193 | 3300028800 | Unclassified | 866 |
| 879 | Ga0265338_10649072 | 3300028800 | Unclassified | 731 |
| 880 | Ga0265338_10687104 | 3300028800 | Unclassified | 707 |
| 881 | Ga0265338_11072257 | 3300028800 | Bacteria | 543 |
| 882 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 883 | Ga0265324_10000500 | 3300029957 | Bacteria | 27131 |
| 884 | Ga0265324_10002972 | 3300029957 | Bacteria | 8295 |
| 885 | Ga0265324_10022661 | 3300029957 | Bacteria | 2243 |
| 886 | Ga0265324_10050377 | 3300029957 | Bacteria | 1431 |
| 887 | Ga0316177_1067570 | 3300030731 | Bacteria | 897 |
| 888 | Ga0316176_1027075 | 3300030732 | Bacteria | 5585 |
| 889 | Ga0316176_1094613 | 3300030732 | Bacteria | 2595 |
| 890 | Ga0314311_1142517 | 3300030733 | Bacteria | 4898 |
| 891 | Ga0314311_1158944 | 3300030733 | Bacteria | 1907 |
| 892 | Ga0314311_1192370 | 3300030733 | Bacteria | 1826 |
| 893 | Ga0314311_1244055 | 3300030733 | Bacteria | 2784 |
| 894 | Ga0316179_1102296 | 3300030734 | Bacteria | 1086 |
| 895 | Ga0316178_1025775 | 3300030735 | Bacteria | 1317 |
| 896 | Ga0316180_1111768 | 3300030736 | Bacteria | 945 |
| 897 | Ga0316180_1156767 | 3300030736 | Bacteria | 1294 |
| 898 | Ga0316183_1139050 | 3300030742 | Bacteria | 640 |
| 899 | Ga0316181_1237823 | 3300030744 | Bacteria | 917 |
| 900 | Ga0316182_1292599 | 3300030745 | Bacteria | 1400 |
| 901 | Ga0265332_10312940 | 3300031238 | Unclassified | 648 |
| 902 | Ga0265320_10115375 | 3300031240 | Bacteria | 1228 |
| 903 | Ga0265325_10001662 | 3300031241 | Bacteria | 15453 |
| 904 | Ga0265340_10000521 | 3300031247 | Bacteria | 21203 |
| 905 | Ga0265339_10015627 | 3300031249 | Bacteria | 4546 |
| 906 | Ga0265339_10286876 | 3300031249 | Unclassified | 788 |
| 907 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 908 | Ga0265331_10008042 | 3300031250 | Bacteria | 6028 |
| 909 | Ga0265331_10019045 | 3300031250 | Bacteria | 3548 |
| 910 | Ga0265331_10300793 | 3300031250 | Bacteria | 719 |
| 911 | Ga0265331_10415547 | 3300031250 | Bacteria | 603 |
| 912 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 913 | Ga0265327_10009306 | 3300031251 | Bacteria | 7110 |
| 914 | Ga0265327_10010524 | 3300031251 | Bacteria | 6491 |
| 915 | Ga0265327_10034073 | 3300031251 | Unclassified | 2830 |
| 916 | Ga0265327_10106909 | 3300031251 | Bacteria | 1342 |
| 917 | Ga0265327_10114436 | 3300031251 | Bacteria | 1285 |
| 918 | Ga0265327_10116624 | 3300031251 | Bacteria | 1270 |
| 919 | Ga0265327_10237053 | 3300031251 | Bacteria | 816 |
| 920 | Ga0265327_10282438 | 3300031251 | Unclassified | 733 |
| 921 | Ga0265316_10061349 | 3300031344 | Bacteria | 2921 |
| 922 | Ga0265316_10104449 | 3300031344 | Bacteria | 2150 |
| 923 | Ga0265316_10148230 | 3300031344 | Bacteria | 1759 |
| 924 | Ga0265316_10178367 | 3300031344 | Bacteria | 1582 |
| 925 | Ga0265316_10263153 | 3300031344 | Bacteria | 1264 |
| 926 | Ga0265316_10413648 | 3300031344 | Bacteria | 970 |
| 927 | Ga0265316_10446833 | 3300031344 | Bacteria | 927 |
| 928 | Ga0265316_10962904 | 3300031344 | Unclassified | 595 |
| 929 | Ga0307513_10942323 | 3300031456 | Bacteria | 572 |
| 930 | Ga0307509_10463409 | 3300031507 | Bacteria | 959 |
| 931 | Ga0307408_100293872 | 3300031548 | Bacteria | 1358 |
| 932 | Ga0265313_10054666 | 3300031595 | Bacteria | 1895 |
| 933 | Ga0265313_10060644 | 3300031595 | Bacteria | 1773 |
| 934 | Ga0307508_10771347 | 3300031616 | Bacteria | 576 |
| 935 | Ga0316575_10003983 | 3300031665 | Bacteria | 5170 |
| 936 | Ga0316575_10180482 | 3300031665 | Bacteria | 876 |
| 937 | Ga0316579_10000952 | 3300031691 | Bacteria | 10118 |
| 938 | Ga0265314_10001521 | 3300031711 | Bacteria | 25613 |
| 939 | Ga0265314_10055535 | 3300031711 | Bacteria | 2733 |
| 940 | Ga0265314_10075317 | 3300031711 | Bacteria | 2246 |
| 941 | Ga0265314_10075432 | 3300031711 | Bacteria | 2243 |
| 942 | Ga0265314_10138110 | 3300031711 | Bacteria | 1511 |
| 943 | Ga0265342_10056065 | 3300031712 | Bacteria | 2337 |
| 944 | Ga0265342_10059252 | 3300031712 | Bacteria | 2262 |
| 945 | Ga0316576_10004152 | 3300031727 | Bacteria | 8640 |
| 946 | Ga0316576_10039521 | 3300031727 | Bacteria | 3387 |
| 947 | Ga0316576_10400550 | 3300031727 | Bacteria | 1017 |
| 948 | Ga0316578_10116230 | 3300031728 | Bacteria | 1607 |
| 949 | Ga0316578_10177126 | 3300031728 | Bacteria | 1285 |
| 950 | Ga0316578_10201448 | 3300031728 | Bacteria | 1198 |
| 951 | Ga0307516_10307900 | 3300031730 | Bacteria | 1258 |
| 952 | Ga0307405_10718617 | 3300031731 | Bacteria | 829 |
| 953 | Ga0316577_10141437 | 3300031733 | Bacteria | 1356 |
| 954 | Ga0316577_10876293 | 3300031733 | Bacteria | 509 |
| 955 | Ga0316577_10903634 | 3300031733 | Bacteria | 500 |
| 956 | Ga0307413_10365835 | 3300031824 | Bacteria | 1118 |
| 957 | Ga0307407_11446865 | 3300031903 | Bacteria | 542 |
| 958 | Ga0307416_103365274 | 3300032002 | Bacteria | 535 |
| 959 | Ga0307414_11252104 | 3300032004 | Bacteria | 688 |
| 960 | Ga0307411_10434820 | 3300032005 | Bacteria | 1093 |
| 961 | Ga0307415_100217593 | 3300032126 | Bacteria | 1529 |
| 962 | Ga0316583_10002208 | 3300032133 | Bacteria | 6709 |
| 963 | Ga0316583_10032677 | 3300032133 | Bacteria | 1849 |
| 964 | Ga0316585_10110045 | 3300032137 | Bacteria | 905 |
| 965 | Ga0316580_10073625 | 3300032139 | Bacteria | 1046 |
| 966 | Ga0316593_10000192 | 3300032168 | Bacteria | 9387 |
| 967 | Ga0316593_10005887 | 3300032168 | Bacteria | 3272 |
| 968 | Ga0316593_10014395 | 3300032168 | Bacteria | 2358 |
| 969 | Ga0316593_10125998 | 3300032168 | Bacteria | 922 |
| 970 | Ga0316586_1007742 | 3300033527 | Bacteria | 1573 |
| 971 | Ga0316587_1014693 | 3300033529 | Bacteria | 1293 |
| 972 | Ga0316596_1077721 | 3300033541 | Bacteria | 891 |
| 973 | Ga0373948_0047199 | 3300034817 | Bacteria | 917 |
| 974 | Ga0373934_0001385 | 3300035086 | Bacteria | 8836 |
| 975 | Ga0373944_0004129 | 3300035089 | Bacteria | 3772 |
| 976 | Ga0373951_0060477 | 3300035091 | Bacteria | 948 |
| 977 | Ga0373923_0003643 | 3300035111 | Bacteria | 4979 |
| 978 | Ga0373923_0487143 | 3300035111 | Bacteria | 600 |
| 979 | Ga0373936_0134195 | 3300035113 | Bacteria | 1065 |
| 980 | Ga0373939_0394411 | 3300035114 | Bacteria | 572 |
| 981 | Ga0373941_0116157 | 3300035115 | Bacteria | 949 |
| 982 | Ga0373945_0152160 | 3300035116 | Bacteria | 938 |
| 983 | Ga0373945_0430186 | 3300035116 | Bacteria | 582 |
| 984 | Ga0373953_0003257 | 3300035117 | Bacteria | 5032 |
| 985 | Ga0373954_0010327 | 3300035118 | Bacteria | 4119 |
| 986 | Ga0373954_0341443 | 3300035118 | Bacteria | 739 |
| 987 | Ga0373954_0420246 | 3300035118 | Bacteria | 661 |
| 988 | Ga0373956_0184605 | 3300035119 | Bacteria | 986 |
| 989 | Ga0373956_0221180 | 3300035119 | Bacteria | 899 |
| 990 | Ga0373956_0509410 | 3300035119 | Bacteria | 574 |
| 991 | Ga0373957_0018186 | 3300035120 | Bacteria | 2457 |
| 992 | Ga0373957_0320900 | 3300035120 | Bacteria | 659 |
| 993 | Ga0373960_0031594 | 3300035121 | Bacteria | 1482 |
| 994 | Ga0373943_0039852 | 3300035170 | Bacteria | 2265 |
| 995 | Ga0373943_0141017 | 3300035170 | Bacteria | 1298 |
| 996 | Ga0373943_0917103 | 3300035170 | Bacteria | 524 |
| 997 | Ga0373946_0187961 | 3300035171 | Bacteria | 983 |
| 998 | Ga0373955_0008568 | 3300035172 | Bacteria | 4754 |
| 999 | Ga0373955_0082639 | 3300035172 | Bacteria | 1818 |
| 1000 | Ga0316574_0000624 | 3300035398 | Bacteria | 14789 |
| 1001 | Ga0316574_0028540 | 3300035398 | Bacteria | 3366 |
| 1002 | Ga0316574_0371676 | 3300035398 | Bacteria | 903 |
| 1003 | Ga0316574_0445870 | 3300035398 | Bacteria | 811 |
| 1004 | Ga0373924_0000835 | 3300035410 | Bacteria | 9645 |
| 1005 | Ga0373924_0005225 | 3300035410 | Bacteria | 4585 |
| 1006 | Ga0373924_0102692 | 3300035410 | Bacteria | 1231 |
| 1007 | Ga0373931_0217568 | 3300035691 | Bacteria | 1149 |
| 1008 | Ga0373931_0285379 | 3300035691 | Bacteria | 1015 |
| 1009 | Ga0373935_0057224 | 3300035692 | Bacteria | 2487 |
| 1010 | Ga0373935_0110058 | 3300035692 | Bacteria | 1827 |
| 1011 | Ga0373935_0288115 | 3300035692 | Bacteria | 1158 |
| 1012 | Ga0373935_0366602 | 3300035692 | Bacteria | 1029 |
| 1013 | Ga0373935_0479919 | 3300035692 | Bacteria | 901 |
| 1014 | Ga0373927_0031676 | 3300035695 | Bacteria | 3445 |
| 1015 | Ga0373927_0034603 | 3300035695 | Bacteria | 3286 |
| 1016 | Ga0373927_0144358 | 3300035695 | Bacteria | 1557 |
| 1017 | Ga0373933_0235585 | 3300035724 | Bacteria | 1177 |
| 1018 | Ga0373947_0180653 | 3300035725 | Bacteria | 1373 |
| 1019 | Ga0373947_0418832 | 3300035725 | Bacteria | 905 |
| 1020 | Ga0373947_0621701 | 3300035725 | Bacteria | 736 |
| 1021 | Ga0373947_1143924 | 3300035725 | Bacteria | 530 |
| 1022 | Ga0373937_0065847 | 3300036401 | Bacteria | 3336 |
| 1023 | Ga0373937_0388613 | 3300036401 | Bacteria | 1323 |
| 1024 | Ga0373937_0568946 | 3300036401 | Bacteria | 1076 |
| 1025 | Ga0316582_0002553 | 3300036647 | Bacteria | 8612 |
| 1026 | Ga0316582_0226216 | 3300036647 | Bacteria | 1280 |
| 1027 | Ga0316582_0667790 | 3300036647 | Bacteria | 714 |
| 1028 | Ga0316584_0047720 | 3300036712 | Bacteria | 3199 |
| 1029 | Ga0316584_0103190 | 3300036712 | Bacteria | 2135 |
| 1030 | Ga0373925_0044970 | 3300037068 | Bacteria | 3279 |
| 1031 | Ga0373925_0058172 | 3300037068 | Bacteria | 2898 |
| 1032 | Ga0373925_0063911 | 3300037068 | Bacteria | 2769 |
| 1033 | Ga0373925_0391982 | 3300037068 | Bacteria | 1132 |
| 1034 | Ga0373925_1257303 | 3300037068 | Bacteria | 608 |
| 1035 | Ga0395899_0003098 | 3300037312 | Bacteria | 13233 |
| 1036 | Ga0395899_0058565 | 3300037312 | Bacteria | 2841 |
| 1037 | Ga0395899_0253422 | 3300037312 | Bacteria | 1207 |
| 1038 | Ga0395899_0747026 | 3300037312 | Bacteria | 609 |
| 1039 | Ga0395900_0001412 | 3300037418 | Bacteria | 28734 |
| 1040 | Ga0395900_0003612 | 3300037418 | Bacteria | 16623 |
| 1041 | Ga0395900_0007425 | 3300037418 | Bacteria | 11327 |
| 1042 | Ga0395900_0083127 | 3300037418 | Bacteria | 3290 |
| 1043 | Ga0395900_0230270 | 3300037418 | Bacteria | 1864 |
| 1044 | Ga0395900_0254362 | 3300037418 | Bacteria | 1756 |
| 1045 | Ga0395900_0291831 | 3300037418 | Unclassified | 1619 |
| 1046 | Ga0395900_1596364 | 3300037418 | Bacteria | 564 |
| 1047 | Ga0395898_0002536 | 3300037466 | Bacteria | 21416 |
| 1048 | Ga0395898_0022692 | 3300037466 | Bacteria | 6353 |
| 1049 | Ga0395898_0043059 | 3300037466 | Bacteria | 4449 |
| 1050 | Ga0395898_0129171 | 3300037466 | Bacteria | 2421 |
| 1051 | Ga0395898_0334575 | 3300037466 | Bacteria | 1444 |
| 1052 | Ga0395898_1066782 | 3300037466 | Unclassified | 742 |
| 1053 | Ga0395905_0000238 | 3300037471 | Bacteria | 83164 |
| 1054 | Ga0395905_0008237 | 3300037471 | Bacteria | 10294 |
| 1055 | Ga0395905_0039862 | 3300037471 | Bacteria | 4407 |
| 1056 | Ga0395905_0572892 | 3300037471 | Bacteria | 1030 |
| 1057 | Ga0395905_1051475 | 3300037471 | Bacteria | 717 |
| 1058 | Ga0316581_0001079 | 3300037588 | Bacteria | 5893 |
| 1059 | Ga0436364_0155867 | 3300037853 | Bacteria | 1296 |
| 1060 | Ga0395901_0008414 | 3300038443 | Bacteria | 10428 |
| 1061 | Ga0395901_0069107 | 3300038443 | Bacteria | 3678 |
| 1062 | Ga0395901_0421595 | 3300038443 | Bacteria | 1368 |
| 1063 | Ga0395901_0503058 | 3300038443 | Bacteria | 1233 |
| 1064 | Ga0395901_2056643 | 3300038443 | Bacteria | 517 |
| 1065 | Ga0242420_027369 | 3300038996 | Bacteria | 1044 |
| 1066 | Ga0436360_1155810 | 3300039438 | Bacteria | 644 |
| 1067 | Ga0436361_0050017 | 3300039447 | Bacteria | 26618 |
| 1068 | Ga0436361_0639184 | 3300039447 | Bacteria | 525 |
| 1069 | Ga0436361_0718323 | 3300039447 | Bacteria | 1148 |
| 1070 | Ga0451800_0118075 | 3300041459 | Unclassified | 898 |
| 1071 | Ga0451800_0640511 | 3300041459 | Bacteria | 514 |
| 1072 | Ga0451807_1349481 | 3300041486 | Bacteria | 2952 |
| 1073 | Ga0451851_1235575 | 3300041507 | Unclassified | 646 |
| 1074 | Ga0451855_0198077 | 3300041511 | Bacteria | 563 |
| 1075 | Ga0451853_2112008 | 3300041512 | Bacteria | 632 |
| 1076 | Ga0439431_0052111 | 3300041997 | Bacteria | 1063 |
| 1077 | Ga0439448_0133959 | 3300042005 | Bacteria | 855 |
| 1078 | Ga0439432_230863 | 3300042006 | Bacteria | 533 |
| 1079 | Ga0451577_0044456 | 3300042876 | Bacteria | 3976 |
| 1080 | Ga0451577_0064949 | 3300042876 | Bacteria | 3254 |
| 1081 | Ga0451577_0420337 | 3300042876 | Bacteria | 1214 |
| 1082 | Ga0451577_0608581 | 3300042876 | Bacteria | 991 |
| 1083 | Ga0451577_0929866 | 3300042876 | Bacteria | 782 |
| 1084 | Ga0466969_0002476 | 3300044656 | Bacteria | 9861 |
| 1085 | Ga0466972_0028528 | 3300044658 | Bacteria | 2752 |
| 1086 | Ga0453683_0030079 | 3300044673 | Bacteria | 3434 |
| 1087 | Ga0466965_0009915 | 3300044683 | Bacteria | 4431 |
| 1088 | Ga0466965_0015196 | 3300044683 | Bacteria | 3656 |
| 1089 | Ga0466965_0849677 | 3300044683 | Bacteria | 530 |
| 1090 | Ga0466966_0117105 | 3300044684 | Bacteria | 1639 |
| 1091 | Ga0466963_1236540 | 3300044694 | Bacteria | 524 |
| 1092 | Ga0453684_0000989 | 3300044712 | Bacteria | 92793 |
| 1093 | Ga0453684_0065104 | 3300044712 | Bacteria | 4650 |
| 1094 | Ga0453684_0177715 | 3300044712 | Bacteria | 2502 |
| 1095 | Ga0453684_0692456 | 3300044712 | Bacteria | 1108 |
| 1096 | Ga0453684_1181452 | 3300044712 | Bacteria | 804 |
| 1097 | Ga0453684_1766408 | 3300044712 | Bacteria | 630 |
| 1098 | Ga0453684_1798289 | 3300044712 | Bacteria | 623 |
| 1099 | Ga0466968_0187929 | 3300044735 | Bacteria | 963 |
| 1100 | Ga0466970_0186437 | 3300044765 | Bacteria | 1152 |
| 1101 | Ga0466970_0229101 | 3300044765 | Bacteria | 1038 |
| 1102 | Ga0466970_0238164 | 3300044765 | Bacteria | 1018 |
| 1103 | Ga0466957_0962489 | 3300044842 | Bacteria | 612 |
| 1104 | Ga0466960_0154991 | 3300044901 | Bacteria | 1226 |
| 1105 | Ga0466959_0013856 | 3300045049 | Bacteria | 5855 |
| 1106 | Ga0451576_0002065 | 3300045051 | Bacteria | 31530 |
| 1107 | Ga0451576_0010036 | 3300045051 | Bacteria | 10905 |
| 1108 | Ga0451576_0060875 | 3300045051 | Bacteria | 3937 |
| 1109 | Ga0451576_0069932 | 3300045051 | Bacteria | 3653 |
| 1110 | Ga0451576_0374709 | 3300045051 | Bacteria | 1491 |
| 1111 | Ga0451576_0892687 | 3300045051 | Bacteria | 933 |
| 1112 | Ga0451576_0995167 | 3300045051 | Bacteria | 879 |
| 1113 | Ga0451576_1973837 | 3300045051 | Bacteria | 601 |
| 1114 | Ga0451576_2301714 | 3300045051 | Bacteria | 552 |
| 1115 | Ga0466967_1716616 | 3300045976 | Bacteria | 625 |
| 1116 | Ga0466967_1954204 | 3300045976 | Bacteria | 583 |
| 1117 | Ga0495627_047044 | 3300046453 | Bacteria | 1309 |
| 1118 | Ga0495592_0494464 | 3300046454 | Bacteria | 760 |
| 1119 | Ga0495603_0095784 | 3300046455 | Bacteria | 1734 |
| 1120 | Ga0495629_0008006 | 3300046459 | Bacteria | 7777 |
| 1121 | Ga0495629_0087873 | 3300046459 | Bacteria | 2168 |
| 1122 | Ga0495641_0112411 | 3300046461 | Bacteria | 1215 |
| 1123 | Ga0495651_0075629 | 3300046462 | Bacteria | 2553 |
| 1124 | Ga0495580_0024838 | 3300046472 | Bacteria | 4382 |
| 1125 | Ga0495580_0050998 | 3300046472 | Bacteria | 2925 |
| 1126 | Ga0495580_0087842 | 3300046472 | Bacteria | 2165 |
| 1127 | Ga0495580_0477228 | 3300046472 | Bacteria | 834 |
| 1128 | Ga0495582_0005514 | 3300046473 | Bacteria | 7048 |
| 1129 | Ga0495582_0093504 | 3300046473 | Bacteria | 1678 |
| 1130 | Ga0495639_0016200 | 3300046475 | Bacteria | 3234 |
| 1131 | Ga0495662_0333812 | 3300046476 | Bacteria | 745 |
| 1132 | Ga0495664_0083745 | 3300046477 | Bacteria | 1914 |
| 1133 | Ga0495583_0018179 | 3300046506 | Bacteria | 3707 |
| 1134 | Ga0495628_0203969 | 3300046516 | Bacteria | 1489 |
| 1135 | Ga0495632_0454162 | 3300046519 | Unclassified | 556 |
| 1136 | Ga0495666_0019131 | 3300046526 | Bacteria | 3402 |
| 1137 | Ga0495666_0385723 | 3300046526 | Bacteria | 630 |
| 1138 | Ga0495665_0012732 | 3300046531 | Bacteria | 4551 |
| 1139 | Ga0495665_0393199 | 3300046531 | Bacteria | 703 |
| 1140 | Ga0495586_0390632 | 3300046535 | Bacteria | 800 |
| 1141 | Ga0495587_0107233 | 3300046536 | Bacteria | 1606 |
| 1142 | Ga0495609_0074311 | 3300046538 | Bacteria | 1491 |
| 1143 | Ga0495645_0044382 | 3300046543 | Bacteria | 3242 |
| 1144 | Ga0495622_0000035 | 3300046557 | Bacteria | 122963 |
| 1145 | Ga0495622_0306889 | 3300046557 | Bacteria | 691 |
| 1146 | Ga0495667_0103714 | 3300046559 | Bacteria | 1839 |
| 1147 | Ga0495668_0766092 | 3300046616 | Bacteria | 534 |
| 1148 | Ga0495634_0082715 | 3300046642 | Bacteria | 2097 |
| 1149 | Ga0495634_0768214 | 3300046642 | Bacteria | 551 |
| 1150 | Ga0495611_0122748 | 3300046648 | Bacteria | 1211 |
| 1151 | Ga0495635_0028671 | 3300046663 | Bacteria | 3869 |
| 1152 | Ga0495635_0880300 | 3300046663 | Bacteria | 574 |
| 1153 | Ga0495635_0997884 | 3300046663 | Bacteria | 533 |
| 1154 | Ga0495588_0000116 | 3300046674 | Bacteria | 135919 |
| 1155 | Ga0495588_0146739 | 3300046674 | Bacteria | 1247 |
| 1156 | Ga0495657_0163529 | 3300046675 | Bacteria | 1376 |
| 1157 | Ga0495657_0296422 | 3300046675 | Bacteria | 965 |
| 1158 | Ga0495599_0424504 | 3300046678 | Bacteria | 789 |
| 1159 | Ga0495623_0328187 | 3300046679 | Bacteria | 838 |
| 1160 | Ga0495658_0001981 | 3300046683 | Bacteria | 10438 |
| 1161 | Ga0495658_0004803 | 3300046683 | Bacteria | 6626 |
| 1162 | Ga0495658_0726466 | 3300046683 | Unclassified | 636 |
| 1163 | Ga0495658_0777569 | 3300046683 | Bacteria | 613 |
| 1164 | Ga0495613_0007458 | 3300046689 | Bacteria | 8147 |
| 1165 | Ga0495671_0080213 | 3300046692 | Bacteria | 1599 |
| 1166 | Ga0495671_0276630 | 3300046692 | Bacteria | 809 |
| 1167 | Ga0495649_0000182 | 3300046694 | Bacteria | 54760 |
| 1168 | Ga0495600_0006859 | 3300046809 | Bacteria | 6945 |
| 1169 | Ga0495600_0073547 | 3300046809 | Bacteria | 2232 |
| 1170 | Ga0495581_0002892 | 3300047315 | Bacteria | 9824 |
| 1171 | Ga0495604_0124498 | 3300047317 | Bacteria | 1861 |
| 1172 | Ga0495674_0205458 | 3300047319 | Bacteria | 1633 |
| 1173 | Ga0495672_0000016 | 3300047320 | Bacteria | 500601 |
| 1174 | Ga0495672_0178980 | 3300047320 | Bacteria | 1075 |
| 1175 | Ga0495672_0220012 | 3300047320 | Bacteria | 938 |
| 1176 | Ga0495672_0418254 | 3300047320 | Unclassified | 610 |
| 1177 | Ga0495676_0595134 | 3300047321 | Unclassified | 720 |
| 1178 | Ga0495675_0049040 | 3300047444 | Bacteria | 2685 |
| 1179 | Ga0495677_0216334 | 3300047445 | Bacteria | 746 |
| 1180 | Ga0495681_0027011 | 3300047470 | Bacteria | 2977 |
| 1181 | Ga0495681_0232862 | 3300047470 | Bacteria | 734 |
| 1182 | Ga0495684_0086399 | 3300047471 | Bacteria | 2377 |
| 1183 | Ga0495593_0036034 | 3300047673 | Bacteria | 2684 |
| 1184 | Ga0495602_0271531 | 3300048088 | Bacteria | 1253 |
| 1185 | Ga0495602_0377579 | 3300048088 | Bacteria | 1016 |
| 1186 | Ga0495614_0034982 | 3300048089 | Bacteria | 2159 |
| 1187 | Ga0495614_0084538 | 3300048089 | Bacteria | 1377 |
| 1188 | Ga0496100_0135185 | 3300048903 | Bacteria | 1741 |
| 1189 | Ga0496100_0157178 | 3300048903 | Bacteria | 1627 |
| 1190 | Ga0496100_0163979 | 3300048903 | Bacteria | 1595 |
| 1191 | Ga0496101_0130394 | 3300048904 | Bacteria | 1909 |
| 1192 | Ga0496101_0606236 | 3300048904 | Unclassified | 866 |
| 1193 | Ga0496102_0024884 | 3300048905 | Bacteria | 5324 |
| 1194 | Ga0496104_0015885 | 3300048907 | Bacteria | 6831 |
| 1195 | Ga0496104_0284051 | 3300048907 | Bacteria | 1568 |
| 1196 | Ga0496104_0716034 | 3300048907 | Bacteria | 908 |
| 1197 | Ga0496105_0097194 | 3300048908 | Bacteria | 2432 |
| 1198 | Ga0496105_0719108 | 3300048908 | Bacteria | 765 |
| 1199 | Ga0496106_0081553 | 3300048909 | Bacteria | 2485 |
| 1200 | Ga0496107_0289122 | 3300048910 | Bacteria | 1220 |
| 1201 | Ga0496107_0714590 | 3300048910 | Bacteria | 736 |
| 1202 | Ga0496107_0758955 | 3300048910 | Bacteria | 711 |
| 1203 | Ga0496108_0091599 | 3300048911 | Bacteria | 2584 |
| 1204 | Ga0496108_0380138 | 3300048911 | Bacteria | 1233 |
| 1205 | Ga0496108_1230186 | 3300048911 | Bacteria | 632 |
| 1206 | Ga0496108_1522713 | 3300048911 | Bacteria | 556 |
| 1207 | Ga0496109_0022741 | 3300048912 | Bacteria | 5554 |
| 1208 | Ga0496109_1953823 | 3300048912 | Bacteria | 519 |
| 1209 | Ga0496110_1142387 | 3300048913 | Bacteria | 687 |
| 1210 | Ga0496112_0002149 | 3300048915 | Bacteria | 15656 |
| 1211 | Ga0496112_0022409 | 3300048915 | Bacteria | 6020 |
| 1212 | Ga0496112_0483582 | 3300048915 | Bacteria | 1174 |
| 1213 | Ga0496112_0608066 | 3300048915 | Bacteria | 1025 |
| 1214 | Ga0496113_0112570 | 3300048916 | Bacteria | 2120 |
| 1215 | Ga0496113_0114796 | 3300048916 | Bacteria | 2100 |
| 1216 | Ga0496113_1476942 | 3300048916 | Bacteria | 525 |
| 1217 | Ga0496114_0014567 | 3300048917 | Bacteria | 6317 |
| 1218 | Ga0496114_0117322 | 3300048917 | Bacteria | 2286 |
| 1219 | Ga0496114_1172215 | 3300048917 | Bacteria | 654 |
| 1220 | Ga0496115_0209364 | 3300048918 | Bacteria | 1610 |
| 1221 | Ga0496125_0438035 | 3300048928 | Bacteria | 752 |
| 1222 | Ga0496126_0110593 | 3300048929 | Bacteria | 2393 |
| 1223 | Ga0501305_026105 | 3300049161 | Bacteria | 889 |
| 1224 | Ga0501298_011845 | 3300049521 | Bacteria | 1521 |
| 1225 | Ga0501299_012331 | 3300049522 | Bacteria | 1457 |
| 1226 | Ga0501031_0004386 | 3300049568 | Bacteria | 9142 |
| 1227 | Ga0501031_0545012 | 3300049568 | Bacteria | 747 |
| 1228 | Ga0501032_0000394 | 3300049569 | Bacteria | 36017 |
| 1229 | Ga0501033_0020233 | 3300049570 | Bacteria | 5031 |
| 1230 | Ga0501034_0020539 | 3300049571 | Bacteria | 6745 |
| 1231 | Ga0501034_0324359 | 3300049571 | Bacteria | 1472 |
| 1232 | Ga0501034_1204950 | 3300049571 | Unclassified | 636 |
| 1233 | Ga0501034_1265307 | 3300049571 | Bacteria | 615 |
| 1234 | Ga0501036_0006553 | 3300049572 | Bacteria | 9458 |
| 1235 | Ga0501036_0041349 | 3300049572 | Bacteria | 3901 |
| 1236 | Ga0501036_0058031 | 3300049572 | Bacteria | 3279 |
| 1237 | Ga0501037_0000133 | 3300049573 | Bacteria | 69741 |
| 1238 | Ga0501037_0172677 | 3300049573 | Bacteria | 1536 |
| 1239 | Ga0501037_0254096 | 3300049573 | Bacteria | 1229 |
| 1240 | Ga0501037_0271907 | 3300049573 | Unclassified | 1182 |
| 1241 | Ga0501038_0023933 | 3300049574 | Bacteria | 5454 |
| 1242 | Ga0501038_0200854 | 3300049574 | Bacteria | 1600 |
| 1243 | Ga0501039_0033552 | 3300049575 | Bacteria | 3958 |
| 1244 | Ga0501039_0602411 | 3300049575 | Bacteria | 861 |
| 1245 | Ga0501040_0067749 | 3300049576 | Bacteria | 2460 |
| 1246 | Ga0501041_0003344 | 3300049577 | Bacteria | 9229 |
| 1247 | Ga0501042_0009869 | 3300049578 | Bacteria | 6379 |
| 1248 | Ga0501042_0279825 | 3300049578 | Bacteria | 1205 |
| 1249 | Ga0501043_0000404 | 3300049579 | Bacteria | 38801 |
| 1250 | Ga0501046_0000038 | 3300049580 | Bacteria | 159193 |
| 1251 | Ga0501046_0179631 | 3300049580 | Bacteria | 1583 |
| 1252 | Ga0501047_0006066 | 3300049581 | Bacteria | 11360 |
| 1253 | Ga0501047_1050570 | 3300049581 | Bacteria | 628 |
| 1254 | Ga0501048_0000033 | 3300049582 | Bacteria | 64896 |
| 1255 | Ga0501048_0426138 | 3300049582 | Bacteria | 949 |
| 1256 | Ga0501048_0590393 | 3300049582 | Bacteria | 797 |
| 1257 | Ga0501067_0376346 | 3300049583 | Bacteria | 792 |
| 1258 | Ga0501068_0320666 | 3300049584 | Bacteria | 993 |
| 1259 | Ga0501069_0338998 | 3300049585 | Bacteria | 885 |
| 1260 | Ga0501069_0621482 | 3300049585 | Bacteria | 649 |
| 1261 | Ga0501070_0035569 | 3300049586 | Bacteria | 4161 |
| 1262 | Ga0501070_0044881 | 3300049586 | Bacteria | 3676 |
| 1263 | Ga0501070_0079948 | 3300049586 | Bacteria | 2705 |
| 1264 | Ga0501070_0330131 | 3300049586 | Bacteria | 1240 |
| 1265 | Ga0501070_0427853 | 3300049586 | Bacteria | 1069 |
| 1266 | Ga0501071_0102836 | 3300049587 | Bacteria | 2107 |
| 1267 | Ga0501071_0114002 | 3300049587 | Bacteria | 1999 |
| 1268 | Ga0501071_1056501 | 3300049587 | Bacteria | 627 |
| 1269 | Ga0501071_1170168 | 3300049587 | Bacteria | 594 |
| 1270 | Ga0501072_0327339 | 3300049588 | Bacteria | 1217 |
| 1271 | Ga0501073_0012572 | 3300049589 | Bacteria | 6177 |
| 1272 | Ga0501073_0038822 | 3300049589 | Bacteria | 3376 |
| 1273 | Ga0501073_0125551 | 3300049589 | Unclassified | 1779 |
| 1274 | Ga0501073_0198652 | 3300049589 | Bacteria | 1387 |
| 1275 | Ga0501073_0713056 | 3300049589 | Bacteria | 692 |
| 1276 | Ga0501074_0018349 | 3300049590 | Bacteria | 5081 |
| 1277 | Ga0501074_0775032 | 3300049590 | Bacteria | 676 |
| 1278 | Ga0501074_1151784 | 3300049590 | Bacteria | 544 |
| 1279 | Ga0501075_0003793 | 3300049591 | Bacteria | 10167 |
| 1280 | Ga0501075_0290534 | 3300049591 | Bacteria | 1245 |
| 1281 | Ga0501076_0000663 | 3300049592 | Bacteria | 22052 |
| 1282 | Ga0501076_0046380 | 3300049592 | Bacteria | 3434 |
| 1283 | Ga0501077_0049998 | 3300049593 | Bacteria | 2657 |
| 1284 | Ga0501077_0209868 | 3300049593 | Bacteria | 1237 |
| 1285 | Ga0501079_0015785 | 3300049741 | Bacteria | 5770 |
| 1286 | Ga0501079_0160362 | 3300049741 | Bacteria | 1754 |
| 1287 | Ga0501079_0508395 | 3300049741 | Bacteria | 947 |
| 1288 | Ga0501080_0001402 | 3300049742 | Bacteria | 20194 |
| 1289 | Ga0501080_0005999 | 3300049742 | Bacteria | 10889 |
| 1290 | Ga0501080_0028144 | 3300049742 | Bacteria | 5226 |
| 1291 | Ga0501080_0030200 | 3300049742 | Bacteria | 5049 |
| 1292 | Ga0501080_0588692 | 3300049742 | Bacteria | 988 |
| 1293 | Ga0501081_0014826 | 3300049743 | Bacteria | 5143 |
| 1294 | Ga0501083_0014244 | 3300049744 | Bacteria | 5563 |
| 1295 | Ga0501083_0026580 | 3300049744 | Bacteria | 4000 |
| 1296 | Ga0501083_0143087 | 3300049744 | Bacteria | 1566 |
| 1297 | Ga0501276_001027 | 3300049773 | Bacteria | 1816 |
| 1298 | Ga0501035_0000562 | 3300049822 | Bacteria | 41104 |
| 1299 | Ga0501035_0263579 | 3300049822 | Bacteria | 1460 |
| 1300 | Ga0501044_0028311 | 3300049823 | Bacteria | 5914 |
| 1301 | Ga0501045_0003651 | 3300049824 | Bacteria | 10578 |
| 1302 | Ga0501045_0089934 | 3300049824 | Bacteria | 2268 |
| 1303 | nmdc:mga03683_66_c2 | 3300050489 | Bacteria | 39227 |
| 1304 | nmdc:mga03n38_19_c1 | 3300050490 | Bacteria | 41192 |
| 1305 | nmdc:mga03n38_78327_c1 | 3300050490 | Bacteria | 1547 |
| 1306 | nmdc:mga00v17_1041970_c1 | 3300050491 | Unclassified | 514 |
| 1307 | nmdc:mga00v17_145_c1 | 3300050491 | Bacteria | 23071 |
| 1308 | nmdc:mga00v17_196366_c1 | 3300050491 | Bacteria | 1304 |
| 1309 | nmdc:mga00v17_33755_c1 | 3300050491 | Bacteria | 3034 |
| 1310 | nmdc:mga00v17_420686_c1 | 3300050491 | Bacteria | 868 |
| 1311 | nmdc:mga00v17_6642_c1 | 3300050491 | Bacteria | 6143 |
| 1312 | nmdc:mga00v17_67056_c1 | 3300050491 | Bacteria | 2217 |
| 1313 | nmdc:mga00v17_857_c1 | 3300050491 | Bacteria | 16451 |
| 1314 | nmdc:mga00v17_9991_c1 | 3300050491 | Bacteria | 3385 |
| 1315 | nmdc:mga0yw44_100296_c1 | 3300050492 | Bacteria | 1843 |
| 1316 | nmdc:mga0yw44_192268_c1 | 3300050492 | Unclassified | 1346 |
| 1317 | nmdc:mga0yw44_24_c1 | 3300050492 | Bacteria | 63201 |
| 1318 | nmdc:mga0yw44_2_c1 | 3300050492 | Bacteria | 586884 |
| 1319 | nmdc:mga0yw44_391363_c1 | 3300050492 | Bacteria | 939 |
| 1320 | nmdc:mga0yw44_6972_c1 | 3300050492 | Bacteria | 5518 |
| 1321 | nmdc:mga0k408_142831_c1 | 3300050493 | Bacteria | 1424 |
| 1322 | nmdc:mga0k408_144_c1 | 3300050493 | Bacteria | 36305 |
| 1323 | nmdc:mga0k408_1480_c1 | 3300050493 | Bacteria | 12680 |
| 1324 | nmdc:mga0k408_14_c3 | 3300050493 | Bacteria | 36052 |
| 1325 | nmdc:mga0k408_165086_c1 | 3300050493 | Bacteria | 1319 |
| 1326 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 1327 | nmdc:mga0k408_24_c2 | 3300050493 | Bacteria | 61722 |
| 1328 | nmdc:mga0k408_6815_c1 | 3300050493 | Bacteria | 6090 |
| 1329 | nmdc:mga0k408_78109_c1 | 3300050493 | Bacteria | 1104 |
| 1330 | nmdc:mga06z11_14_c1 | 3300050494 | Bacteria | 96662 |
| 1331 | nmdc:mga06z11_53_c2 | 3300050494 | Bacteria | 47411 |
| 1332 | nmdc:mga04h51_10_c1 | 3300050495 | Bacteria | 102434 |
| 1333 | nmdc:mga07m45_2913_c1 | 3300050496 | Bacteria | 8113 |
| 1334 | nmdc:mga07m45_303921_c1 | 3300050496 | Bacteria | 928 |
| 1335 | nmdc:mga07m45_353018_c1 | 3300050496 | Bacteria | 854 |
| 1336 | nmdc:mga07m45_494652_c1 | 3300050496 | Unclassified | 708 |
| 1337 | nmdc:mga07m45_647256_c1 | 3300050496 | Unclassified | 609 |
| 1338 | nmdc:mga07m45_72126_c1 | 3300050496 | Bacteria | 1965 |
| 1339 | nmdc:mga05p37_167955_c1 | 3300050507 | Bacteria | 2677 |
| 1340 | nmdc:mga0qj67_29906_c1 | 3300050509 | Bacteria | 4234 |
| 1341 | nmdc:mga0qj67_48239_c1 | 3300050509 | Bacteria | 3364 |
| 1342 | nmdc:mga08y16_21258_c1 | 3300050511 | Bacteria | 6852 |
| 1343 | nmdc:mga0n895_111604_c1 | 3300050512 | Bacteria | 2750 |
| 1344 | nmdc:mga0n895_1812005_c1 | 3300050512 | Bacteria | 571 |
| 1345 | nmdc:mga0n895_259430_c1 | 3300050512 | Bacteria | 1764 |
| 1346 | nmdc:mga0n895_71889_c1 | 3300050512 | Bacteria | 3431 |
| 1347 | nmdc:mga0n895_944918_c1 | 3300050512 | Bacteria | 846 |
| 1348 | nmdc:mga0rr50_1501726_c1 | 3300050513 | Bacteria | 570 |
| 1349 | nmdc:mga0rr50_302106_c1 | 3300050513 | Bacteria | 1339 |
| 1350 | nmdc:mga0rr50_32159_c1 | 3300050513 | Bacteria | 3735 |
| 1351 | nmdc:mga0rr50_34673_c1 | 3300050513 | Bacteria | 3616 |
| 1352 | nmdc:mga08x19_141689_c1 | 3300050514 | Bacteria | 1624 |
| 1353 | nmdc:mga08x19_52009_c1 | 3300050514 | Bacteria | 2633 |
| 1354 | nmdc:mga08x19_65848_c1 | 3300050514 | Bacteria | 2354 |
| 1355 | nmdc:mga0a205_28754_c1 | 3300050515 | Bacteria | 5316 |
| 1356 | nmdc:mga0a205_858248_c1 | 3300050515 | Bacteria | 755 |
| 1357 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 1358 | nmdc:mga0sz30_30554_c1 | 3300050516 | Bacteria | 2225 |
| 1359 | nmdc:mga0sz30_460715_c1 | 3300050516 | Bacteria | 571 |
| 1360 | nmdc:mga0sz30_8_c1 | 3300050516 | Bacteria | 107909 |
| 1361 | nmdc:mga0sz30_96240_c1 | 3300050516 | Bacteria | 584 |
| 1362 | Ga0495601_0498313 | 3300053077 | Bacteria | 786 |
| 1363 | Ga0495612_0049342 | 3300053078 | Bacteria | 1727 |
| 1364 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 1365 | Ga0500610_0024857 | 3300053079 | Bacteria | 2981 |
| 1366 | Ga0500610_0160911 | 3300053079 | Bacteria | 1117 |
| 1367 | Ga0495655_0065643 | 3300053083 | Bacteria | 1002 |
| 1368 | Ga0495619_0004860 | 3300053085 | Bacteria | 8527 |
| 1369 | Ga0495619_0012469 | 3300053085 | Bacteria | 5354 |
| 1370 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 1371 | Ga0500643_000038 | 3300053087 | Bacteria | 178974 |
| 1372 | Ga0500643_007309 | 3300053087 | Bacteria | 4482 |
| 1373 | Ga0500644_0000365 | 3300053088 | Bacteria | 22175 |
| 1374 | Ga0500644_0000636 | 3300053088 | Bacteria | 13080 |
| 1375 | Ga0500644_0001805 | 3300053088 | Bacteria | 5534 |
| 1376 | Ga0500644_0019854 | 3300053088 | Bacteria | 1989 |
| 1377 | Ga0500646_0000823 | 3300053090 | Bacteria | 8581 |
| 1378 | Ga0500583_0000067 | 3300053092 | Bacteria | 64775 |
| 1379 | Ga0500583_0002599 | 3300053092 | Bacteria | 5470 |
| 1380 | Ga0500583_0015393 | 3300053092 | Bacteria | 3024 |
| 1381 | Ga0500583_0069456 | 3300053092 | Bacteria | 1682 |
| 1382 | Ga0500651_0000416 | 3300053093 | Bacteria | 22899 |
| 1383 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 1384 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 1385 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 1386 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 1387 | Ga0500555_007840 | 3300053103 | Bacteria | 3037 |
| 1388 | Ga0500555_022461 | 3300053103 | Bacteria | 1812 |
| 1389 | Ga0500556_0000829 | 3300053104 | Bacteria | 17806 |
| 1390 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 1391 | Ga0500562_004964 | 3300053108 | Bacteria | 3353 |
| 1392 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 1393 | Ga0500594_0000139 | 3300053118 | Bacteria | 20048 |
| 1394 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 1395 | Ga0500614_002410 | 3300053123 | Bacteria | 4177 |
| 1396 | Ga0500614_014092 | 3300053123 | Bacteria | 1765 |
| 1397 | Ga0500628_000006 | 3300053129 | Bacteria | 154858 |
| 1398 | Ga0500628_001507 | 3300053129 | Bacteria | 3984 |
| 1399 | Ga0500642_0002538 | 3300053130 | Bacteria | 5379 |
| 1400 | Ga0500652_000084 | 3300053131 | Bacteria | 39562 |
| 1401 | Ga0500655_001993 | 3300053133 | Bacteria | 3793 |
| 1402 | Ga0500559_0015490 | 3300053136 | Bacteria | 3219 |
| 1403 | Ga0500561_0000001 | 3300053137 | Bacteria | 957685 |
| 1404 | Ga0500568_0011040 | 3300053139 | Bacteria | 4207 |
| 1405 | Ga0500568_0014440 | 3300053139 | Bacteria | 3566 |
| 1406 | Ga0500568_0066436 | 3300053139 | Bacteria | 1387 |
| 1407 | Ga0500574_083757 | 3300053141 | Bacteria | 942 |
| 1408 | Ga0500577_0000514 | 3300053142 | Bacteria | 9995 |
| 1409 | Ga0500577_0021093 | 3300053142 | Bacteria | 2142 |
| 1410 | Ga0500579_016957 | 3300053143 | Bacteria | 4707 |
| 1411 | Ga0500589_000008 | 3300053147 | Bacteria | 137145 |
| 1412 | Ga0500589_099901 | 3300053147 | Unclassified | 1262 |
| 1413 | Ga0500600_0114189 | 3300053149 | Bacteria | 1403 |
| 1414 | Ga0500603_138389 | 3300053150 | Bacteria | 748 |
| 1415 | Ga0500604_0010658 | 3300053151 | Unclassified | 2462 |
| 1416 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 1417 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 1418 | Ga0500633_0014746 | 3300053160 | Bacteria | 2225 |
| 1419 | Ga0500649_000014 | 3300053722 | Bacteria | 56198 |
| 1420 | Ga0500570_000045 | 3300053724 | Bacteria | 31120 |
| 1421 | Ga0500611_008584 | 3300053727 | Bacteria | 1586 |
| 1422 | Ga0500611_009762 | 3300053727 | Bacteria | 1532 |
| 1423 | Ga0501084_0018257 | 3300054114 | Bacteria | 5841 |
| 1424 | Ga0501084_0502704 | 3300054114 | Bacteria | 1024 |
| 1425 | Ga0587083_0181080 | 3300059505 | Bacteria | 590 |
| 1426 | Ga0587085_104013 | 3300059506 | Bacteria | 603 |
| 1427 | Ga0587109_016406 | 3300059624 | Bacteria | 1269 |
| 1428 | Ga0587071_052725 | 3300060344 | Bacteria | 845 |
| 1429 | Ga0587111_0042374 | 3300060346 | Bacteria | 975 |
| 1430 | Ga0501082_0008910 | 3300060353 | Bacteria | 8656 |
| 1431 | Ga0501082_0226637 | 3300060353 | Bacteria | 1626 |
| 1432 | Ga0530510_0006785 | 3300061734 | Bacteria | 7977 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031727 | Ga0316576_10039521 | Ga0316576_100395214 | 79 |
| 2 | 3300031728 | Ga0316578_10177126 | Ga0316578_101771262 | 79 |
| 3 | 3300031733 | Ga0316577_10876293 | Ga0316577_108762932 | 79 |
| 4 | 3300032139 | Ga0316580_10073625 | Ga0316580_100736252 | 79 |
| 5 | 3300036712 | Ga0316584_0103190 | Ga0316584_0103190_979_1281 | 79 |
| 6 | 3300009093 | Ga0105240_10302319 | Ga0105240_103023193 | 84 |
| 7 | 3300009545 | Ga0105237_11574530 | Ga0105237_115745302 | 84 |
| 8 | 3300010375 | Ga0105239_10959267 | Ga0105239_109592672 | 84 |
| 9 | 3300025914 | Ga0207671_11603295 | Ga0207671_116032951 | 84 |
| 10 | 3300035724 | Ga0373933_0235585 | Ga0373933_0235585_667_957 | 84 |
| 11 | 3300005437 | Ga0070710_10000430 | Ga0070710_1000043011 | 85 |
| 12 | 3300005439 | Ga0070711_100788194 | Ga0070711_1007881943 | 85 |
| 13 | 3300025898 | Ga0207692_10000677 | Ga0207692_100006778 | 85 |
| 14 | 3300025916 | Ga0207663_10540116 | Ga0207663_105401163 | 85 |
| 15 | 3300030732 | Ga0316176_1027075 | Ga0316176_102707511 | 85 |
| 16 | 3300030733 | Ga0314311_1142517 | Ga0314311_11425177 | 85 |
| 17 | 3300030733 | Ga0314311_1192370 | Ga0314311_11923705 | 85 |
| 18 | 3300030736 | Ga0316180_1111768 | Ga0316180_11117681 | 85 |
| 19 | 3300030745 | Ga0316182_1292599 | Ga0316182_12925994 | 85 |
| 20 | 3300031507 | Ga0307509_10463409 | Ga0307509_104634093 | 85 |
| 21 | 3300044658 | Ga0466972_0028528 | Ga0466972_0028528_893_1186 | 85 |
| 22 | 3300044683 | Ga0466965_0009915 | Ga0466965_0009915_3856_4149 | 85 |
| 23 | 3300044683 | Ga0466965_0015196 | Ga0466965_0015196_225_518 | 85 |
| 24 | 3300044683 | Ga0466965_0849677 | Ga0466965_0849677_101_394 | 85 |
| 25 | 3300044735 | Ga0466968_0187929 | Ga0466968_0187929_528_821 | 85 |
| 26 | 3300044901 | Ga0466960_0154991 | Ga0466960_0154991_263_556 | 85 |
| 27 | 3300049583 | Ga0501067_0376346 | Ga0501067_0376346_64_357 | 85 |
| 28 | iso_pu_bacteria | 2526164512 | 2526214044 | 85 |
| 29 | iso_pu_bacteria | 2547132103 | 2547375772 | 85 |
| 30 | iso_pu_bacteria | 2643221613 | 2644081279 | 85 |
| 31 | iso_pu_bacteria | 2643221721 | 2644663410 | 85 |
| 32 | iso_pu_bacteria | 2738541272 | 2738698222 | 85 |
| 33 | iso_pu_bacteria | 2738543027 | 2739326538 | 85 |
| 34 | iso_pu_bacteria | 2739367654 | 2739604614 | 85 |
| 35 | iso_pu_bacteria | 2758568522 | 2760308356 | 85 |
| 36 | iso_pu_bacteria | 2758568621 | 2760622999 | 85 |
| 37 | iso_pu_bacteria | 2808606394 | 2809027781 | 85 |
| 38 | iso_pu_bacteria | 2835188231 | 2835189038 | 85 |
| 39 | iso_pu_bacteria | 2843690924 | 2843691335 | 85 |
| 40 | iso_pu_bacteria | 2846033681 | 2846034383 | 85 |
| 41 | iso_pu_bacteria | 2846037992 | 2846041874 | 85 |
| 42 | iso_pu_bacteria | 2855020534 | 2855020888 | 85 |
| 43 | iso_pu_bacteria | 2935890801 | 2935892323 | 85 |
| 44 | iso_pu_bacteria | 8056579771 | 8056581958 | 85 |
| 45 | 3300004799 | Ga0058863_11971832 | Ga0058863_119718326 | 88 |
| 46 | 3300004803 | Ga0058862_12728945 | Ga0058862_127289452 | 88 |
| 47 | 3300020076 | Ga0206355_1195425 | Ga0206355_11954252 | 88 |
| 48 | 3300001915 | JGI24741J21665_1001539 | JGI24741J21665_100153912 | 89 |
| 49 | 3300001979 | JGI24740J21852_10004196 | JGI24740J21852_100041965 | 89 |
| 50 | 3300001979 | JGI24740J21852_10034505 | JGI24740J21852_100345052 | 89 |
| 51 | 3300001990 | JGI24737J22298_10126222 | JGI24737J22298_101262222 | 89 |
| 52 | 3300002067 | JGI24735J21928_10000083 | JGI24735J21928_1000008326 | 89 |
| 53 | 3300003323 | rootH1_10286273 | rootH1_102862732 | 89 |
| 54 | 3300004803 | Ga0058862_10110798 | Ga0058862_101107988 | 89 |
| 55 | 3300005289 | Ga0065704_10211023 | Ga0065704_102110232 | 89 |
| 56 | 3300005290 | Ga0065712_10032246 | Ga0065712_100322461 | 89 |
| 57 | 3300005293 | Ga0065715_10687863 | Ga0065715_106878632 | 89 |
| 58 | 3300005295 | Ga0065707_10554872 | Ga0065707_105548722 | 89 |
| 59 | 3300005295 | Ga0065707_10742430 | Ga0065707_107424302 | 89 |
| 60 | 3300005327 | Ga0070658_10000012 | Ga0070658_10000012244 | 89 |
| 61 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001524 | 89 |
| 62 | 3300005327 | Ga0070658_10000118 | Ga0070658_100001186 | 89 |
| 63 | 3300005327 | Ga0070658_10001050 | Ga0070658_1000105027 | 89 |
| 64 | 3300005327 | Ga0070658_10013418 | Ga0070658_100134184 | 89 |
| 65 | 3300005327 | Ga0070658_10026903 | Ga0070658_100269037 | 89 |
| 66 | 3300005327 | Ga0070658_10457586 | Ga0070658_104575862 | 89 |
| 67 | 3300005327 | Ga0070658_11424826 | Ga0070658_114248262 | 89 |
| 68 | 3300005328 | Ga0070676_10000822 | Ga0070676_1000082214 | 89 |
| 69 | 3300005328 | Ga0070676_10147148 | Ga0070676_101471483 | 89 |
| 70 | 3300005328 | Ga0070676_10459818 | Ga0070676_104598182 | 89 |
| 71 | 3300005329 | Ga0070683_100000450 | Ga0070683_10000045014 | 89 |
| 72 | 3300005329 | Ga0070683_100005670 | Ga0070683_10000567014 | 89 |
| 73 | 3300005329 | Ga0070683_100053815 | Ga0070683_1000538153 | 89 |
| 74 | 3300005329 | Ga0070683_100103418 | Ga0070683_1001034185 | 89 |
| 75 | 3300005329 | Ga0070683_100175681 | Ga0070683_1001756814 | 89 |
| 76 | 3300005329 | Ga0070683_100374788 | Ga0070683_1003747881 | 89 |
| 77 | 3300005329 | Ga0070683_100509232 | Ga0070683_1005092323 | 89 |
| 78 | 3300005329 | Ga0070683_101596493 | Ga0070683_1015964932 | 89 |
| 79 | 3300005329 | Ga0070683_102314359 | Ga0070683_1023143592 | 89 |
| 80 | 3300005330 | Ga0070690_100010582 | Ga0070690_1000105827 | 89 |
| 81 | 3300005330 | Ga0070690_100017999 | Ga0070690_1000179996 | 89 |
| 82 | 3300005330 | Ga0070690_100085186 | Ga0070690_1000851863 | 89 |
| 83 | 3300005331 | Ga0070670_100303793 | Ga0070670_1003037933 | 89 |
| 84 | 3300005331 | Ga0070670_100634924 | Ga0070670_1006349242 | 89 |
| 85 | 3300005331 | Ga0070670_101347777 | Ga0070670_1013477772 | 89 |
| 86 | 3300005334 | Ga0068869_100000239 | Ga0068869_10000023927 | 89 |
| 87 | 3300005334 | Ga0068869_100002849 | Ga0068869_10000284915 | 89 |
| 88 | 3300005334 | Ga0068869_100288562 | Ga0068869_1002885622 | 89 |
| 89 | 3300005334 | Ga0068869_100421488 | Ga0068869_1004214883 | 89 |
| 90 | 3300005335 | Ga0070666_10041378 | Ga0070666_100413782 | 89 |
| 91 | 3300005335 | Ga0070666_10119177 | Ga0070666_101191773 | 89 |
| 92 | 3300005335 | Ga0070666_10343483 | Ga0070666_103434832 | 89 |
| 93 | 3300005335 | Ga0070666_10568010 | Ga0070666_105680102 | 89 |
| 94 | 3300005335 | Ga0070666_11073963 | Ga0070666_110739631 | 89 |
| 95 | 3300005336 | Ga0070680_100000672 | Ga0070680_10000067229 | 89 |
| 96 | 3300005336 | Ga0070680_100038367 | Ga0070680_1000383678 | 89 |
| 97 | 3300005336 | Ga0070680_100149390 | Ga0070680_1001493902 | 89 |
| 98 | 3300005336 | Ga0070680_100316508 | Ga0070680_1003165082 | 89 |
| 99 | 3300005336 | Ga0070680_101703993 | Ga0070680_1017039932 | 89 |
| 100 | 3300005337 | Ga0070682_100232877 | Ga0070682_1002328772 | 89 |
| 101 | 3300005337 | Ga0070682_100402999 | Ga0070682_1004029993 | 89 |
| 102 | 3300005337 | Ga0070682_100863385 | Ga0070682_1008633851 | 89 |
| 103 | 3300005337 | Ga0070682_101111607 | Ga0070682_1011116072 | 89 |
| 104 | 3300005337 | Ga0070682_101677233 | Ga0070682_1016772331 | 89 |
| 105 | 3300005338 | Ga0068868_100110068 | Ga0068868_1001100682 | 89 |
| 106 | 3300005338 | Ga0068868_100277744 | Ga0068868_1002777441 | 89 |
| 107 | 3300005339 | Ga0070660_100000176 | Ga0070660_10000017626 | 89 |
| 108 | 3300005339 | Ga0070660_100002817 | Ga0070660_1000028178 | 89 |
| 109 | 3300005339 | Ga0070660_100008505 | Ga0070660_10000850510 | 89 |
| 110 | 3300005339 | Ga0070660_100029132 | Ga0070660_1000291322 | 89 |
| 111 | 3300005339 | Ga0070660_100426131 | Ga0070660_1004261312 | 89 |
| 112 | 3300005340 | Ga0070689_100003982 | Ga0070689_1000039827 | 89 |
| 113 | 3300005340 | Ga0070689_100010970 | Ga0070689_1000109708 | 89 |
| 114 | 3300005340 | Ga0070689_101762510 | Ga0070689_1017625101 | 89 |
| 115 | 3300005341 | Ga0070691_10037648 | Ga0070691_100376484 | 89 |
| 116 | 3300005341 | Ga0070691_10082496 | Ga0070691_100824962 | 89 |
| 117 | 3300005341 | Ga0070691_10187215 | Ga0070691_101872152 | 89 |
| 118 | 3300005341 | Ga0070691_10497255 | Ga0070691_104972551 | 89 |
| 119 | 3300005341 | Ga0070691_10998864 | Ga0070691_109988641 | 89 |
| 120 | 3300005343 | Ga0070687_100514328 | Ga0070687_1005143282 | 89 |
| 121 | 3300005343 | Ga0070687_100854927 | Ga0070687_1008549273 | 89 |
| 122 | 3300005343 | Ga0070687_100910603 | Ga0070687_1009106031 | 89 |
| 123 | 3300005344 | Ga0070661_100130867 | Ga0070661_1001308673 | 89 |
| 124 | 3300005344 | Ga0070661_100900332 | Ga0070661_1009003322 | 89 |
| 125 | 3300005345 | Ga0070692_10026456 | Ga0070692_100264563 | 89 |
| 126 | 3300005345 | Ga0070692_11092894 | Ga0070692_110928941 | 89 |
| 127 | 3300005347 | Ga0070668_101351262 | Ga0070668_1013512622 | 89 |
| 128 | 3300005353 | Ga0070669_100665908 | Ga0070669_1006659082 | 89 |
| 129 | 3300005353 | Ga0070669_100707179 | Ga0070669_1007071792 | 89 |
| 130 | 3300005353 | Ga0070669_101785717 | Ga0070669_1017857172 | 89 |
| 131 | 3300005354 | Ga0070675_100125842 | Ga0070675_1001258424 | 89 |
| 132 | 3300005354 | Ga0070675_101433649 | Ga0070675_1014336491 | 89 |
| 133 | 3300005354 | Ga0070675_101494068 | Ga0070675_1014940681 | 89 |
| 134 | 3300005355 | Ga0070671_100000001 | Ga0070671_100000001461 | 89 |
| 135 | 3300005355 | Ga0070671_100035416 | Ga0070671_1000354166 | 89 |
| 136 | 3300005355 | Ga0070671_100133678 | Ga0070671_1001336783 | 89 |
| 137 | 3300005355 | Ga0070671_100226312 | Ga0070671_1002263123 | 89 |
| 138 | 3300005355 | Ga0070671_100777476 | Ga0070671_1007774762 | 89 |
| 139 | 3300005355 | Ga0070671_101060315 | Ga0070671_1010603152 | 89 |
| 140 | 3300005356 | Ga0070674_100004150 | Ga0070674_1000041509 | 89 |
| 141 | 3300005356 | Ga0070674_100014629 | Ga0070674_1000146292 | 89 |
| 142 | 3300005356 | Ga0070674_100044487 | Ga0070674_1000444873 | 89 |
| 143 | 3300005356 | Ga0070674_100061550 | Ga0070674_1000615502 | 89 |
| 144 | 3300005356 | Ga0070674_100191276 | Ga0070674_1001912763 | 89 |
| 145 | 3300005364 | Ga0070673_100000306 | Ga0070673_10000030630 | 89 |
| 146 | 3300005364 | Ga0070673_100085073 | Ga0070673_1000850733 | 89 |
| 147 | 3300005365 | Ga0070688_100002345 | Ga0070688_10000234515 | 89 |
| 148 | 3300005366 | Ga0070659_100000215 | Ga0070659_10000021527 | 89 |
| 149 | 3300005366 | Ga0070659_100096145 | Ga0070659_1000961452 | 89 |
| 150 | 3300005366 | Ga0070659_100199395 | Ga0070659_1001993952 | 89 |
| 151 | 3300005366 | Ga0070659_101770959 | Ga0070659_1017709592 | 89 |
| 152 | 3300005367 | Ga0070667_100000001 | Ga0070667_100000001801 | 89 |
| 153 | 3300005367 | Ga0070667_100004521 | Ga0070667_1000045216 | 89 |
| 154 | 3300005367 | Ga0070667_100225186 | Ga0070667_1002251863 | 89 |
| 155 | 3300005434 | Ga0070709_10019345 | Ga0070709_100193455 | 89 |
| 156 | 3300005435 | Ga0070714_100000778 | Ga0070714_10000077815 | 89 |
| 157 | 3300005435 | Ga0070714_100127912 | Ga0070714_1001279125 | 89 |
| 158 | 3300005436 | Ga0070713_100000028 | Ga0070713_10000002826 | 89 |
| 159 | 3300005436 | Ga0070713_100741052 | Ga0070713_1007410522 | 89 |
| 160 | 3300005436 | Ga0070713_100797064 | Ga0070713_1007970642 | 89 |
| 161 | 3300005436 | Ga0070713_101107328 | Ga0070713_1011073281 | 89 |
| 162 | 3300005437 | Ga0070710_10043307 | Ga0070710_100433073 | 89 |
| 163 | 3300005437 | Ga0070710_10684253 | Ga0070710_106842531 | 89 |
| 164 | 3300005437 | Ga0070710_11052535 | Ga0070710_110525351 | 89 |
| 165 | 3300005438 | Ga0070701_10004910 | Ga0070701_100049108 | 89 |
| 166 | 3300005438 | Ga0070701_10042135 | Ga0070701_100421354 | 89 |
| 167 | 3300005438 | Ga0070701_10088809 | Ga0070701_100888094 | 89 |
| 168 | 3300005439 | Ga0070711_100008240 | Ga0070711_10000824011 | 89 |
| 169 | 3300005439 | Ga0070711_101624119 | Ga0070711_1016241192 | 89 |
| 170 | 3300005440 | Ga0070705_100139886 | Ga0070705_1001398864 | 89 |
| 171 | 3300005440 | Ga0070705_100376505 | Ga0070705_1003765052 | 89 |
| 172 | 3300005441 | Ga0070700_100022163 | Ga0070700_1000221635 | 89 |
| 173 | 3300005441 | Ga0070700_100283345 | Ga0070700_1002833452 | 89 |
| 174 | 3300005441 | Ga0070700_100294450 | Ga0070700_1002944502 | 89 |
| 175 | 3300005441 | Ga0070700_101581130 | Ga0070700_1015811302 | 89 |
| 176 | 3300005441 | Ga0070700_101616892 | Ga0070700_1016168921 | 89 |
| 177 | 3300005441 | Ga0070700_101791338 | Ga0070700_1017913382 | 89 |
| 178 | 3300005444 | Ga0070694_100103515 | Ga0070694_1001035155 | 89 |
| 179 | 3300005444 | Ga0070694_100170239 | Ga0070694_1001702392 | 89 |
| 180 | 3300005444 | Ga0070694_100645100 | Ga0070694_1006451002 | 89 |
| 181 | 3300005445 | Ga0070708_100069490 | Ga0070708_1000694906 | 89 |
| 182 | 3300005445 | Ga0070708_100327113 | Ga0070708_1003271133 | 89 |
| 183 | 3300005445 | Ga0070708_101895666 | Ga0070708_1018956661 | 89 |
| 184 | 3300005455 | Ga0070663_100085826 | Ga0070663_1000858265 | 89 |
| 185 | 3300005456 | Ga0070678_100000168 | Ga0070678_10000016834 | 89 |
| 186 | 3300005456 | Ga0070678_100016595 | Ga0070678_1000165953 | 89 |
| 187 | 3300005456 | Ga0070678_100032057 | Ga0070678_1000320573 | 89 |
| 188 | 3300005456 | Ga0070678_100138031 | Ga0070678_1001380313 | 89 |
| 189 | 3300005456 | Ga0070678_100586520 | Ga0070678_1005865202 | 89 |
| 190 | 3300005457 | Ga0070662_100268460 | Ga0070662_1002684603 | 89 |
| 191 | 3300005458 | Ga0070681_10002189 | Ga0070681_1000218910 | 89 |
| 192 | 3300005458 | Ga0070681_10084187 | Ga0070681_100841873 | 89 |
| 193 | 3300005458 | Ga0070681_10094055 | Ga0070681_100940552 | 89 |
| 194 | 3300005458 | Ga0070681_10419962 | Ga0070681_104199623 | 89 |
| 195 | 3300005458 | Ga0070681_10439726 | Ga0070681_104397263 | 89 |
| 196 | 3300005459 | Ga0068867_100020156 | Ga0068867_10002015611 | 89 |
| 197 | 3300005459 | Ga0068867_100384049 | Ga0068867_1003840492 | 89 |
| 198 | 3300005459 | Ga0068867_100415565 | Ga0068867_1004155653 | 89 |
| 199 | 3300005466 | Ga0070685_10000188 | Ga0070685_1000018849 | 89 |
| 200 | 3300005466 | Ga0070685_10002659 | Ga0070685_100026592 | 89 |
| 201 | 3300005466 | Ga0070685_10007961 | Ga0070685_100079612 | 89 |
| 202 | 3300005466 | Ga0070685_11496398 | Ga0070685_114963982 | 89 |
| 203 | 3300005467 | Ga0070706_100018649 | Ga0070706_10001864911 | 89 |
| 204 | 3300005467 | Ga0070706_100047586 | Ga0070706_1000475862 | 89 |
| 205 | 3300005467 | Ga0070706_100250396 | Ga0070706_1002503963 | 89 |
| 206 | 3300005467 | Ga0070706_100367139 | Ga0070706_1003671391 | 89 |
| 207 | 3300005467 | Ga0070706_100826259 | Ga0070706_1008262592 | 89 |
| 208 | 3300005468 | Ga0070707_100025860 | Ga0070707_1000258607 | 89 |
| 209 | 3300005468 | Ga0070707_100045940 | Ga0070707_1000459404 | 89 |
| 210 | 3300005468 | Ga0070707_100410844 | Ga0070707_1004108443 | 89 |
| 211 | 3300005468 | Ga0070707_101437982 | Ga0070707_1014379822 | 89 |
| 212 | 3300005471 | Ga0070698_100010119 | Ga0070698_10001011918 | 89 |
| 213 | 3300005471 | Ga0070698_100051877 | Ga0070698_1000518778 | 89 |
| 214 | 3300005471 | Ga0070698_101320062 | Ga0070698_1013200621 | 89 |
| 215 | 3300005471 | Ga0070698_101334219 | Ga0070698_1013342191 | 89 |
| 216 | 3300005518 | Ga0070699_100011946 | Ga0070699_1000119462 | 89 |
| 217 | 3300005518 | Ga0070699_100043286 | Ga0070699_1000432862 | 89 |
| 218 | 3300005518 | Ga0070699_100085613 | Ga0070699_1000856134 | 89 |
| 219 | 3300005518 | Ga0070699_101600800 | Ga0070699_1016008001 | 89 |
| 220 | 3300005530 | Ga0070679_100003967 | Ga0070679_10000396712 | 89 |
| 221 | 3300005530 | Ga0070679_100005719 | Ga0070679_10000571915 | 89 |
| 222 | 3300005530 | Ga0070679_100014538 | Ga0070679_1000145387 | 89 |
| 223 | 3300005530 | Ga0070679_100021502 | Ga0070679_1000215029 | 89 |
| 224 | 3300005530 | Ga0070679_100023544 | Ga0070679_1000235443 | 89 |
| 225 | 3300005530 | Ga0070679_100024441 | Ga0070679_1000244419 | 89 |
| 226 | 3300005530 | Ga0070679_100052255 | Ga0070679_1000522557 | 89 |
| 227 | 3300005530 | Ga0070679_100077724 | Ga0070679_1000777243 | 89 |
| 228 | 3300005530 | Ga0070679_100083398 | Ga0070679_1000833982 | 89 |
| 229 | 3300005530 | Ga0070679_100231961 | Ga0070679_1002319612 | 89 |
| 230 | 3300005530 | Ga0070679_100268287 | Ga0070679_1002682873 | 89 |
| 231 | 3300005530 | Ga0070679_100301518 | Ga0070679_1003015182 | 89 |
| 232 | 3300005530 | Ga0070679_100771831 | Ga0070679_1007718312 | 89 |
| 233 | 3300005530 | Ga0070679_100852103 | Ga0070679_1008521032 | 89 |
| 234 | 3300005530 | Ga0070679_101122339 | Ga0070679_1011223392 | 89 |
| 235 | 3300005530 | Ga0070679_101467208 | Ga0070679_1014672082 | 89 |
| 236 | 3300005530 | Ga0070679_101557783 | Ga0070679_1015577832 | 89 |
| 237 | 3300005530 | Ga0070679_101711619 | Ga0070679_1017116191 | 89 |
| 238 | 3300005535 | Ga0070684_100001744 | Ga0070684_1000017442 | 89 |
| 239 | 3300005535 | Ga0070684_100002149 | Ga0070684_10000214914 | 89 |
| 240 | 3300005535 | Ga0070684_100159000 | Ga0070684_1001590003 | 89 |
| 241 | 3300005535 | Ga0070684_100439426 | Ga0070684_1004394263 | 89 |
| 242 | 3300005535 | Ga0070684_100907488 | Ga0070684_1009074882 | 89 |
| 243 | 3300005536 | Ga0070697_100018681 | Ga0070697_1000186818 | 89 |
| 244 | 3300005536 | Ga0070697_100158062 | Ga0070697_1001580623 | 89 |
| 245 | 3300005536 | Ga0070697_101089830 | Ga0070697_1010898301 | 89 |
| 246 | 3300005539 | Ga0068853_100179945 | Ga0068853_1001799453 | 89 |
| 247 | 3300005539 | Ga0068853_100202551 | Ga0068853_1002025513 | 89 |
| 248 | 3300005539 | Ga0068853_100447060 | Ga0068853_1004470601 | 89 |
| 249 | 3300005543 | Ga0070672_100055954 | Ga0070672_1000559548 | 89 |
| 250 | 3300005543 | Ga0070672_100361662 | Ga0070672_1003616623 | 89 |
| 251 | 3300005543 | Ga0070672_101131026 | Ga0070672_1011310262 | 89 |
| 252 | 3300005543 | Ga0070672_101643846 | Ga0070672_1016438461 | 89 |
| 253 | 3300005544 | Ga0070686_100000984 | Ga0070686_1000009843 | 89 |
| 254 | 3300005544 | Ga0070686_100018275 | Ga0070686_1000182752 | 89 |
| 255 | 3300005544 | Ga0070686_100100808 | Ga0070686_1001008083 | 89 |
| 256 | 3300005544 | Ga0070686_100309276 | Ga0070686_1003092763 | 89 |
| 257 | 3300005544 | Ga0070686_100482156 | Ga0070686_1004821563 | 89 |
| 258 | 3300005545 | Ga0070695_100058601 | Ga0070695_1000586012 | 89 |
| 259 | 3300005545 | Ga0070695_100177189 | Ga0070695_1001771893 | 89 |
| 260 | 3300005545 | Ga0070695_101677620 | Ga0070695_1016776201 | 89 |
| 261 | 3300005546 | Ga0070696_100030255 | Ga0070696_1000302555 | 89 |
| 262 | 3300005546 | Ga0070696_100134021 | Ga0070696_1001340213 | 89 |
| 263 | 3300005546 | Ga0070696_100194163 | Ga0070696_1001941634 | 89 |
| 264 | 3300005546 | Ga0070696_100717074 | Ga0070696_1007170742 | 89 |
| 265 | 3300005546 | Ga0070696_100878728 | Ga0070696_1008787282 | 89 |
| 266 | 3300005547 | Ga0070693_100025656 | Ga0070693_1000256565 | 89 |
| 267 | 3300005547 | Ga0070693_100095941 | Ga0070693_1000959412 | 89 |
| 268 | 3300005548 | Ga0070665_100029414 | Ga0070665_1000294147 | 89 |
| 269 | 3300005548 | Ga0070665_100096550 | Ga0070665_1000965504 | 89 |
| 270 | 3300005548 | Ga0070665_100171863 | Ga0070665_1001718632 | 89 |
| 271 | 3300005548 | Ga0070665_100181226 | Ga0070665_1001812265 | 89 |
| 272 | 3300005548 | Ga0070665_100339080 | Ga0070665_1003390802 | 89 |
| 273 | 3300005549 | Ga0070704_100001908 | Ga0070704_10000190816 | 89 |
| 274 | 3300005549 | Ga0070704_100011835 | Ga0070704_10001183511 | 89 |
| 275 | 3300005563 | Ga0068855_100000003 | Ga0068855_100000003146 | 89 |
| 276 | 3300005563 | Ga0068855_100000168 | Ga0068855_10000016880 | 89 |
| 277 | 3300005563 | Ga0068855_100004673 | Ga0068855_1000046738 | 89 |
| 278 | 3300005563 | Ga0068855_100020905 | Ga0068855_1000209057 | 89 |
| 279 | 3300005563 | Ga0068855_100042627 | Ga0068855_1000426272 | 89 |
| 280 | 3300005563 | Ga0068855_100044376 | Ga0068855_1000443768 | 89 |
| 281 | 3300005563 | Ga0068855_100122011 | Ga0068855_1001220114 | 89 |
| 282 | 3300005563 | Ga0068855_100631942 | Ga0068855_1006319422 | 89 |
| 283 | 3300005563 | Ga0068855_100699930 | Ga0068855_1006999302 | 89 |
| 284 | 3300005563 | Ga0068855_100787163 | Ga0068855_1007871632 | 89 |
| 285 | 3300005563 | Ga0068855_101057751 | Ga0068855_1010577512 | 89 |
| 286 | 3300005563 | Ga0068855_101095095 | Ga0068855_1010950952 | 89 |
| 287 | 3300005563 | Ga0068855_101243012 | Ga0068855_1012430122 | 89 |
| 288 | 3300005564 | Ga0070664_100364069 | Ga0070664_1003640693 | 89 |
| 289 | 3300005564 | Ga0070664_100434554 | Ga0070664_1004345543 | 89 |
| 290 | 3300005564 | Ga0070664_100580627 | Ga0070664_1005806273 | 89 |
| 291 | 3300005577 | Ga0068857_100000124 | Ga0068857_10000012431 | 89 |
| 292 | 3300005577 | Ga0068857_100406048 | Ga0068857_1004060483 | 89 |
| 293 | 3300005577 | Ga0068857_100564509 | Ga0068857_1005645092 | 89 |
| 294 | 3300005577 | Ga0068857_100724108 | Ga0068857_1007241082 | 89 |
| 295 | 3300005577 | Ga0068857_100939564 | Ga0068857_1009395642 | 89 |
| 296 | 3300005577 | Ga0068857_101413968 | Ga0068857_1014139682 | 89 |
| 297 | 3300005578 | Ga0068854_100519470 | Ga0068854_1005194701 | 89 |
| 298 | 3300005578 | Ga0068854_100683221 | Ga0068854_1006832212 | 89 |
| 299 | 3300005614 | Ga0068856_100000001 | Ga0068856_100000001295 | 89 |
| 300 | 3300005614 | Ga0068856_100001486 | Ga0068856_10000148632 | 89 |
| 301 | 3300005614 | Ga0068856_100001797 | Ga0068856_10000179731 | 89 |
| 302 | 3300005614 | Ga0068856_100048231 | Ga0068856_1000482312 | 89 |
| 303 | 3300005614 | Ga0068856_100229169 | Ga0068856_1002291695 | 89 |
| 304 | 3300005614 | Ga0068856_100598667 | Ga0068856_1005986673 | 89 |
| 305 | 3300005614 | Ga0068856_100628871 | Ga0068856_1006288712 | 89 |
| 306 | 3300005614 | Ga0068856_101067250 | Ga0068856_1010672502 | 89 |
| 307 | 3300005615 | Ga0070702_100014621 | Ga0070702_1000146218 | 89 |
| 308 | 3300005615 | Ga0070702_100021262 | Ga0070702_1000212625 | 89 |
| 309 | 3300005616 | Ga0068852_100491118 | Ga0068852_1004911182 | 89 |
| 310 | 3300005617 | Ga0068859_100006170 | Ga0068859_10000617016 | 89 |
| 311 | 3300005617 | Ga0068859_100089269 | Ga0068859_1000892693 | 89 |
| 312 | 3300005617 | Ga0068859_100323620 | Ga0068859_1003236201 | 89 |
| 313 | 3300005617 | Ga0068859_100540753 | Ga0068859_1005407532 | 89 |
| 314 | 3300005617 | Ga0068859_101600921 | Ga0068859_1016009212 | 89 |
| 315 | 3300005618 | Ga0068864_100003967 | Ga0068864_10000396716 | 89 |
| 316 | 3300005618 | Ga0068864_100114654 | Ga0068864_1001146542 | 89 |
| 317 | 3300005618 | Ga0068864_102673988 | Ga0068864_1026739881 | 89 |
| 318 | 3300005718 | Ga0068866_10002726 | Ga0068866_1000272614 | 89 |
| 319 | 3300005718 | Ga0068866_10003079 | Ga0068866_1000307911 | 89 |
| 320 | 3300005718 | Ga0068866_10100047 | Ga0068866_101000473 | 89 |
| 321 | 3300005719 | Ga0068861_100008199 | Ga0068861_10000819911 | 89 |
| 322 | 3300005719 | Ga0068861_100126218 | Ga0068861_1001262185 | 89 |
| 323 | 3300005719 | Ga0068861_100131548 | Ga0068861_1001315482 | 89 |
| 324 | 3300005719 | Ga0068861_101025908 | Ga0068861_1010259082 | 89 |
| 325 | 3300005834 | Ga0068851_10156813 | Ga0068851_101568132 | 89 |
| 326 | 3300005840 | Ga0068870_10009891 | Ga0068870_100098915 | 89 |
| 327 | 3300005840 | Ga0068870_10078377 | Ga0068870_100783774 | 89 |
| 328 | 3300005840 | Ga0068870_10111576 | Ga0068870_101115762 | 89 |
| 329 | 3300005841 | Ga0068863_100002985 | Ga0068863_10000298527 | 89 |
| 330 | 3300005841 | Ga0068863_100022347 | Ga0068863_1000223475 | 89 |
| 331 | 3300005841 | Ga0068863_100046276 | Ga0068863_1000462762 | 89 |
| 332 | 3300005841 | Ga0068863_100102476 | Ga0068863_1001024762 | 89 |
| 333 | 3300005841 | Ga0068863_100612467 | Ga0068863_1006124672 | 89 |
| 334 | 3300005841 | Ga0068863_100820175 | Ga0068863_1008201751 | 89 |
| 335 | 3300005842 | Ga0068858_100013226 | Ga0068858_1000132263 | 89 |
| 336 | 3300005842 | Ga0068858_100014524 | Ga0068858_1000145246 | 89 |
| 337 | 3300005842 | Ga0068858_100017672 | Ga0068858_1000176728 | 89 |
| 338 | 3300005843 | Ga0068860_100019846 | Ga0068860_1000198468 | 89 |
| 339 | 3300005843 | Ga0068860_100111708 | Ga0068860_1001117084 | 89 |
| 340 | 3300005843 | Ga0068860_100233894 | Ga0068860_1002338942 | 89 |
| 341 | 3300005843 | Ga0068860_100299450 | Ga0068860_1002994502 | 89 |
| 342 | 3300005843 | Ga0068860_100488011 | Ga0068860_1004880112 | 89 |
| 343 | 3300005843 | Ga0068860_101077953 | Ga0068860_1010779532 | 89 |
| 344 | 3300005843 | Ga0068860_101098337 | Ga0068860_1010983371 | 89 |
| 345 | 3300005843 | Ga0068860_101153711 | Ga0068860_1011537112 | 89 |
| 346 | 3300005844 | Ga0068862_100015629 | Ga0068862_1000156298 | 89 |
| 347 | 3300005844 | Ga0068862_100142453 | Ga0068862_1001424533 | 89 |
| 348 | 3300005844 | Ga0068862_102596470 | Ga0068862_1025964702 | 89 |
| 349 | 3300005937 | Ga0081455_10000003 | Ga0081455_10000003281 | 89 |
| 350 | 3300005985 | Ga0081539_10001876 | Ga0081539_1000187624 | 89 |
| 351 | 3300006028 | Ga0070717_10062928 | Ga0070717_100629285 | 89 |
| 352 | 3300006028 | Ga0070717_11107508 | Ga0070717_111075082 | 89 |
| 353 | 3300006038 | Ga0075365_10000658 | Ga0075365_100006585 | 89 |
| 354 | 3300006038 | Ga0075365_10013015 | Ga0075365_100130159 | 89 |
| 355 | 3300006038 | Ga0075365_10055135 | Ga0075365_100551356 | 89 |
| 356 | 3300006038 | Ga0075365_10056400 | Ga0075365_100564005 | 89 |
| 357 | 3300006038 | Ga0075365_10332614 | Ga0075365_103326142 | 89 |
| 358 | 3300006038 | Ga0075365_10452922 | Ga0075365_104529222 | 89 |
| 359 | 3300006042 | Ga0075368_10000103 | Ga0075368_100001038 | 89 |
| 360 | 3300006048 | Ga0075363_100000006 | Ga0075363_10000000621 | 89 |
| 361 | 3300006048 | Ga0075363_100031526 | Ga0075363_1000315263 | 89 |
| 362 | 3300006051 | Ga0075364_10000255 | Ga0075364_1000025525 | 89 |
| 363 | 3300006051 | Ga0075364_10000985 | Ga0075364_1000098518 | 89 |
| 364 | 3300006051 | Ga0075364_10005139 | Ga0075364_1000513914 | 89 |
| 365 | 3300006051 | Ga0075364_10008153 | Ga0075364_100081539 | 89 |
| 366 | 3300006051 | Ga0075364_10008868 | Ga0075364_100088682 | 89 |
| 367 | 3300006051 | Ga0075364_10056142 | Ga0075364_100561427 | 89 |
| 368 | 3300006051 | Ga0075364_10117401 | Ga0075364_101174012 | 89 |
| 369 | 3300006051 | Ga0075364_11172525 | Ga0075364_111725252 | 89 |
| 370 | 3300006058 | Ga0075432_10098869 | Ga0075432_100988693 | 89 |
| 371 | 3300006163 | Ga0070715_10201379 | Ga0070715_102013792 | 89 |
| 372 | 3300006173 | Ga0070716_100014982 | Ga0070716_1000149826 | 89 |
| 373 | 3300006173 | Ga0070716_100148286 | Ga0070716_1001482862 | 89 |
| 374 | 3300006175 | Ga0070712_100296952 | Ga0070712_1002969521 | 89 |
| 375 | 3300006175 | Ga0070712_100645686 | Ga0070712_1006456862 | 89 |
| 376 | 3300006175 | Ga0070712_101990388 | Ga0070712_1019903881 | 89 |
| 377 | 3300006177 | Ga0075362_10000049 | Ga0075362_1000004947 | 89 |
| 378 | 3300006177 | Ga0075362_10023272 | Ga0075362_100232727 | 89 |
| 379 | 3300006178 | Ga0075367_10000021 | Ga0075367_1000002139 | 89 |
| 380 | 3300006178 | Ga0075367_10017509 | Ga0075367_100175095 | 89 |
| 381 | 3300006178 | Ga0075367_10749599 | Ga0075367_107495992 | 89 |
| 382 | 3300006186 | Ga0075369_10000003 | Ga0075369_10000003236 | 89 |
| 383 | 3300006186 | Ga0075369_10000057 | Ga0075369_1000005742 | 89 |
| 384 | 3300006186 | Ga0075369_10077510 | Ga0075369_100775101 | 89 |
| 385 | 3300006186 | Ga0075369_10128549 | Ga0075369_101285492 | 89 |
| 386 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001368 | 89 |
| 387 | 3300006195 | Ga0075366_10000065 | Ga0075366_1000006542 | 89 |
| 388 | 3300006195 | Ga0075366_10000147 | Ga0075366_1000014719 | 89 |
| 389 | 3300006195 | Ga0075366_10001116 | Ga0075366_1000111615 | 89 |
| 390 | 3300006195 | Ga0075366_10026067 | Ga0075366_100260676 | 89 |
| 391 | 3300006195 | Ga0075366_10027187 | Ga0075366_100271874 | 89 |
| 392 | 3300006195 | Ga0075366_10174399 | Ga0075366_101743992 | 89 |
| 393 | 3300006195 | Ga0075366_10214500 | Ga0075366_102145002 | 89 |
| 394 | 3300006237 | Ga0097621_100006235 | Ga0097621_10000623515 | 89 |
| 395 | 3300006237 | Ga0097621_100062852 | Ga0097621_1000628524 | 89 |
| 396 | 3300006237 | Ga0097621_100107511 | Ga0097621_1001075116 | 89 |
| 397 | 3300006237 | Ga0097621_100154914 | Ga0097621_1001549143 | 89 |
| 398 | 3300006237 | Ga0097621_100548254 | Ga0097621_1005482542 | 89 |
| 399 | 3300006353 | Ga0075370_10006085 | Ga0075370_100060858 | 89 |
| 400 | 3300006353 | Ga0075370_10116654 | Ga0075370_101166541 | 89 |
| 401 | 3300006353 | Ga0075370_10606716 | Ga0075370_106067161 | 89 |
| 402 | 3300006353 | Ga0075370_10714798 | Ga0075370_107147982 | 89 |
| 403 | 3300006358 | Ga0068871_100003989 | Ga0068871_1000039893 | 89 |
| 404 | 3300006358 | Ga0068871_100038968 | Ga0068871_1000389683 | 89 |
| 405 | 3300006844 | Ga0075428_100003149 | Ga0075428_10000314923 | 89 |
| 406 | 3300006846 | Ga0075430_100046838 | Ga0075430_1000468387 | 89 |
| 407 | 3300006846 | Ga0075430_100055797 | Ga0075430_1000557976 | 89 |
| 408 | 3300006847 | Ga0075431_101175299 | Ga0075431_1011752992 | 89 |
| 409 | 3300006852 | Ga0075433_10024313 | Ga0075433_100243136 | 89 |
| 410 | 3300006852 | Ga0075433_10288718 | Ga0075433_102887183 | 89 |
| 411 | 3300006871 | Ga0075434_100015561 | Ga0075434_1000155617 | 89 |
| 412 | 3300006871 | Ga0075434_100194623 | Ga0075434_1001946235 | 89 |
| 413 | 3300006871 | Ga0075434_100316589 | Ga0075434_1003165892 | 89 |
| 414 | 3300006871 | Ga0075434_101519547 | Ga0075434_1015195472 | 89 |
| 415 | 3300006881 | Ga0068865_100005809 | Ga0068865_10000580916 | 89 |
| 416 | 3300006881 | Ga0068865_100028985 | Ga0068865_1000289853 | 89 |
| 417 | 3300006881 | Ga0068865_100394857 | Ga0068865_1003948572 | 89 |
| 418 | 3300006914 | Ga0075436_100048771 | Ga0075436_1000487712 | 89 |
| 419 | 3300006914 | Ga0075436_100164914 | Ga0075436_1001649144 | 89 |
| 420 | 3300006914 | Ga0075436_100268172 | Ga0075436_1002681722 | 89 |
| 421 | 3300006931 | Ga0097620_100006169 | Ga0097620_10000616916 | 89 |
| 422 | 3300006931 | Ga0097620_100089272 | Ga0097620_1000892723 | 89 |
| 423 | 3300006931 | Ga0097620_100323614 | Ga0097620_1003236144 | 89 |
| 424 | 3300006931 | Ga0097620_100540784 | Ga0097620_1005407844 | 89 |
| 425 | 3300006931 | Ga0097620_101600051 | Ga0097620_1016000511 | 89 |
| 426 | 3300007076 | Ga0075435_100050036 | Ga0075435_1000500366 | 89 |
| 427 | 3300007076 | Ga0075435_100336262 | Ga0075435_1003362622 | 89 |
| 428 | 3300007076 | Ga0075435_100368822 | Ga0075435_1003688222 | 89 |
| 429 | 3300007076 | Ga0075435_101706836 | Ga0075435_1017068362 | 89 |
| 430 | 3300007265 | Ga0099794_10238362 | Ga0099794_102383622 | 89 |
| 431 | 3300007265 | Ga0099794_10416593 | Ga0099794_104165932 | 89 |
| 432 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003849 | 89 |
| 433 | 3300009093 | Ga0105240_10034455 | Ga0105240_100344553 | 89 |
| 434 | 3300009093 | Ga0105240_10040725 | Ga0105240_1004072513 | 89 |
| 435 | 3300009093 | Ga0105240_10312692 | Ga0105240_103126922 | 89 |
| 436 | 3300009093 | Ga0105240_10482858 | Ga0105240_104828584 | 89 |
| 437 | 3300009094 | Ga0111539_10027480 | Ga0111539_100274808 | 89 |
| 438 | 3300009094 | Ga0111539_11877758 | Ga0111539_118777582 | 89 |
| 439 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001330 | 89 |
| 440 | 3300009098 | Ga0105245_10004395 | Ga0105245_1000439513 | 89 |
| 441 | 3300009098 | Ga0105245_10004821 | Ga0105245_100048214 | 89 |
| 442 | 3300009098 | Ga0105245_10010103 | Ga0105245_1001010316 | 89 |
| 443 | 3300009098 | Ga0105245_10060520 | Ga0105245_100605203 | 89 |
| 444 | 3300009098 | Ga0105245_10351023 | Ga0105245_103510232 | 89 |
| 445 | 3300009098 | Ga0105245_10394322 | Ga0105245_103943222 | 89 |
| 446 | 3300009098 | Ga0105245_10462980 | Ga0105245_104629802 | 89 |
| 447 | 3300009098 | Ga0105245_11705662 | Ga0105245_117056622 | 89 |
| 448 | 3300009101 | Ga0105247_10063726 | Ga0105247_100637263 | 89 |
| 449 | 3300009147 | Ga0114129_10070335 | Ga0114129_100703358 | 89 |
| 450 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001442 | 89 |
| 451 | 3300009148 | Ga0105243_10008999 | Ga0105243_1000899911 | 89 |
| 452 | 3300009148 | Ga0105243_10010600 | Ga0105243_100106006 | 89 |
| 453 | 3300009148 | Ga0105243_10226682 | Ga0105243_102266822 | 89 |
| 454 | 3300009148 | Ga0105243_10493181 | Ga0105243_104931811 | 89 |
| 455 | 3300009148 | Ga0105243_10541819 | Ga0105243_105418193 | 89 |
| 456 | 3300009148 | Ga0105243_11060138 | Ga0105243_110601382 | 89 |
| 457 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003157 | 89 |
| 458 | 3300009174 | Ga0105241_10011078 | Ga0105241_100110782 | 89 |
| 459 | 3300009174 | Ga0105241_10188510 | Ga0105241_101885102 | 89 |
| 460 | 3300009174 | Ga0105241_10610663 | Ga0105241_106106633 | 89 |
| 461 | 3300009174 | Ga0105241_11032330 | Ga0105241_110323302 | 89 |
| 462 | 3300009174 | Ga0105241_11235668 | Ga0105241_112356681 | 89 |
| 463 | 3300009174 | Ga0105241_12027947 | Ga0105241_120279472 | 89 |
| 464 | 3300009174 | Ga0105241_12382610 | Ga0105241_123826102 | 89 |
| 465 | 3300009174 | Ga0105241_12643660 | Ga0105241_126436602 | 89 |
| 466 | 3300009176 | Ga0105242_10000011 | Ga0105242_100000119 | 89 |
| 467 | 3300009176 | Ga0105242_10007562 | Ga0105242_1000756210 | 89 |
| 468 | 3300009176 | Ga0105242_10009973 | Ga0105242_100099736 | 89 |
| 469 | 3300009176 | Ga0105242_10013678 | Ga0105242_100136788 | 89 |
| 470 | 3300009176 | Ga0105242_10298770 | Ga0105242_102987702 | 89 |
| 471 | 3300009176 | Ga0105242_10565124 | Ga0105242_105651242 | 89 |
| 472 | 3300009176 | Ga0105242_11337195 | Ga0105242_113371952 | 89 |
| 473 | 3300009176 | Ga0105242_12562015 | Ga0105242_125620152 | 89 |
| 474 | 3300009177 | Ga0105248_10010314 | Ga0105248_1001031415 | 89 |
| 475 | 3300009177 | Ga0105248_10094322 | Ga0105248_100943227 | 89 |
| 476 | 3300009177 | Ga0105248_10113808 | Ga0105248_101138085 | 89 |
| 477 | 3300009177 | Ga0105248_10167563 | Ga0105248_101675634 | 89 |
| 478 | 3300009177 | Ga0105248_11675979 | Ga0105248_116759792 | 89 |
| 479 | 3300009545 | Ga0105237_10472790 | Ga0105237_104727903 | 89 |
| 480 | 3300009545 | Ga0105237_10631440 | Ga0105237_106314402 | 89 |
| 481 | 3300009545 | Ga0105237_10828063 | Ga0105237_108280632 | 89 |
| 482 | 3300009545 | Ga0105237_11326470 | Ga0105237_113264702 | 89 |
| 483 | 3300009545 | Ga0105237_11420833 | Ga0105237_114208332 | 89 |
| 484 | 3300009545 | Ga0105237_11592915 | Ga0105237_115929151 | 89 |
| 485 | 3300009545 | Ga0105237_11706766 | Ga0105237_117067661 | 89 |
| 486 | 3300009551 | Ga0105238_10000579 | Ga0105238_1000057936 | 89 |
| 487 | 3300009551 | Ga0105238_10124575 | Ga0105238_101245751 | 89 |
| 488 | 3300009551 | Ga0105238_10231710 | Ga0105238_102317103 | 89 |
| 489 | 3300009551 | Ga0105238_10237507 | Ga0105238_102375073 | 89 |
| 490 | 3300009551 | Ga0105238_11236590 | Ga0105238_112365902 | 89 |
| 491 | 3300009551 | Ga0105238_11326845 | Ga0105238_113268452 | 89 |
| 492 | 3300009551 | Ga0105238_12020090 | Ga0105238_120200902 | 89 |
| 493 | 3300009551 | Ga0105238_12305224 | Ga0105238_123052242 | 89 |
| 494 | 3300009551 | Ga0105238_12309822 | Ga0105238_123098221 | 89 |
| 495 | 3300009551 | Ga0105238_12338051 | Ga0105238_123380511 | 89 |
| 496 | 3300009551 | Ga0105238_12453133 | Ga0105238_124531331 | 89 |
| 497 | 3300009553 | Ga0105249_10002379 | Ga0105249_1000237914 | 89 |
| 498 | 3300009553 | Ga0105249_10256697 | Ga0105249_102566972 | 89 |
| 499 | 3300009553 | Ga0105249_10432368 | Ga0105249_104323683 | 89 |
| 500 | 3300009553 | Ga0105249_10759437 | Ga0105249_107594372 | 89 |
| 501 | 3300009553 | Ga0105249_13073428 | Ga0105249_130734282 | 89 |
| 502 | 3300009986 | Ga0105033_105305 | Ga0105033_1053053 | 89 |
| 503 | 3300009986 | Ga0105033_119600 | Ga0105033_1196002 | 89 |
| 504 | 3300009987 | Ga0105030_102571 | Ga0105030_1025711 | 89 |
| 505 | 3300009993 | Ga0105028_100084 | Ga0105028_10008410 | 89 |
| 506 | 3300010375 | Ga0105239_10032725 | Ga0105239_1003272510 | 89 |
| 507 | 3300010375 | Ga0105239_10075342 | Ga0105239_100753428 | 89 |
| 508 | 3300010375 | Ga0105239_10138559 | Ga0105239_101385597 | 89 |
| 509 | 3300010375 | Ga0105239_10482126 | Ga0105239_104821261 | 89 |
| 510 | 3300010375 | Ga0105239_11707210 | Ga0105239_117072102 | 89 |
| 511 | 3300010375 | Ga0105239_12338703 | Ga0105239_123387031 | 89 |
| 512 | 3300010375 | Ga0105239_13146168 | Ga0105239_131461682 | 89 |
| 513 | 3300011119 | Ga0105246_10153679 | Ga0105246_101536792 | 89 |
| 514 | 3300011119 | Ga0105246_10496388 | Ga0105246_104963882 | 89 |
| 515 | 3300011119 | Ga0105246_10497338 | Ga0105246_104973382 | 89 |
| 516 | 3300013100 | Ga0157373_10000583 | Ga0157373_100005839 | 89 |
| 517 | 3300013100 | Ga0157373_10085939 | Ga0157373_100859394 | 89 |
| 518 | 3300013100 | Ga0157373_10264006 | Ga0157373_102640063 | 89 |
| 519 | 3300013100 | Ga0157373_10300554 | Ga0157373_103005543 | 89 |
| 520 | 3300013100 | Ga0157373_11353663 | Ga0157373_113536632 | 89 |
| 521 | 3300013102 | Ga0157371_10000176 | Ga0157371_1000017624 | 89 |
| 522 | 3300013102 | Ga0157371_10204330 | Ga0157371_102043302 | 89 |
| 523 | 3300013102 | Ga0157371_10350013 | Ga0157371_103500132 | 89 |
| 524 | 3300013104 | Ga0157370_10022524 | Ga0157370_1002252413 | 89 |
| 525 | 3300013104 | Ga0157370_10126444 | Ga0157370_101264444 | 89 |
| 526 | 3300013104 | Ga0157370_10253314 | Ga0157370_102533143 | 89 |
| 527 | 3300013104 | Ga0157370_11103071 | Ga0157370_111030711 | 89 |
| 528 | 3300013104 | Ga0157370_11159277 | Ga0157370_111592772 | 89 |
| 529 | 3300013105 | Ga0157369_10003258 | Ga0157369_1000325819 | 89 |
| 530 | 3300013105 | Ga0157369_10059996 | Ga0157369_100599967 | 89 |
| 531 | 3300013105 | Ga0157369_10066496 | Ga0157369_100664968 | 89 |
| 532 | 3300013105 | Ga0157369_10138227 | Ga0157369_101382273 | 89 |
| 533 | 3300013105 | Ga0157369_10290843 | Ga0157369_102908433 | 89 |
| 534 | 3300013105 | Ga0157369_11133067 | Ga0157369_111330672 | 89 |
| 535 | 3300013296 | Ga0157374_10000565 | Ga0157374_1000056516 | 89 |
| 536 | 3300013296 | Ga0157374_10001076 | Ga0157374_1000107634 | 89 |
| 537 | 3300013296 | Ga0157374_10001882 | Ga0157374_1000188216 | 89 |
| 538 | 3300013296 | Ga0157374_10025334 | Ga0157374_100253343 | 89 |
| 539 | 3300013296 | Ga0157374_10044228 | Ga0157374_100442287 | 89 |
| 540 | 3300013296 | Ga0157374_10129323 | Ga0157374_101293237 | 89 |
| 541 | 3300013296 | Ga0157374_10157731 | Ga0157374_101577317 | 89 |
| 542 | 3300013296 | Ga0157374_10594354 | Ga0157374_105943543 | 89 |
| 543 | 3300013296 | Ga0157374_10604295 | Ga0157374_106042952 | 89 |
| 544 | 3300013296 | Ga0157374_11083976 | Ga0157374_110839762 | 89 |
| 545 | 3300013296 | Ga0157374_11918021 | Ga0157374_119180212 | 89 |
| 546 | 3300013297 | Ga0157378_10010736 | Ga0157378_1001073614 | 89 |
| 547 | 3300013297 | Ga0157378_10021639 | Ga0157378_100216393 | 89 |
| 548 | 3300013297 | Ga0157378_10058507 | Ga0157378_100585073 | 89 |
| 549 | 3300013297 | Ga0157378_10165606 | Ga0157378_101656063 | 89 |
| 550 | 3300013297 | Ga0157378_10214933 | Ga0157378_102149334 | 89 |
| 551 | 3300013297 | Ga0157378_10374383 | Ga0157378_103743832 | 89 |
| 552 | 3300013297 | Ga0157378_11384493 | Ga0157378_113844932 | 89 |
| 553 | 3300013297 | Ga0157378_11860215 | Ga0157378_118602152 | 89 |
| 554 | 3300013306 | Ga0163162_10060008 | Ga0163162_100600084 | 89 |
| 555 | 3300013306 | Ga0163162_10684810 | Ga0163162_106848102 | 89 |
| 556 | 3300013306 | Ga0163162_11437546 | Ga0163162_114375462 | 89 |
| 557 | 3300013307 | Ga0157372_10000670 | Ga0157372_1000067039 | 89 |
| 558 | 3300013307 | Ga0157372_10002726 | Ga0157372_1000272622 | 89 |
| 559 | 3300013307 | Ga0157372_10687980 | Ga0157372_106879802 | 89 |
| 560 | 3300013307 | Ga0157372_11086663 | Ga0157372_110866632 | 89 |
| 561 | 3300013307 | Ga0157372_11135780 | Ga0157372_111357802 | 89 |
| 562 | 3300013308 | Ga0157375_10039139 | Ga0157375_100391398 | 89 |
| 563 | 3300013308 | Ga0157375_10042447 | Ga0157375_1004244711 | 89 |
| 564 | 3300013308 | Ga0157375_10237882 | Ga0157375_102378823 | 89 |
| 565 | 3300013308 | Ga0157375_10287657 | Ga0157375_102876572 | 89 |
| 566 | 3300013308 | Ga0157375_11211781 | Ga0157375_112117812 | 89 |
| 567 | 3300013874 | Ga0157514_121480 | Ga0157514_1214803 | 89 |
| 568 | 3300014325 | Ga0163163_10000689 | Ga0163163_1000068930 | 89 |
| 569 | 3300014325 | Ga0163163_10317037 | Ga0163163_103170372 | 89 |
| 570 | 3300014325 | Ga0163163_10417887 | Ga0163163_104178873 | 89 |
| 571 | 3300014325 | Ga0163163_12431835 | Ga0163163_124318352 | 89 |
| 572 | 3300014326 | Ga0157380_10117219 | Ga0157380_101172192 | 89 |
| 573 | 3300014326 | Ga0157380_10198410 | Ga0157380_101984103 | 89 |
| 574 | 3300014326 | Ga0157380_13064895 | Ga0157380_130648952 | 89 |
| 575 | 3300014745 | Ga0157377_10015248 | Ga0157377_100152483 | 89 |
| 576 | 3300014745 | Ga0157377_10056857 | Ga0157377_100568573 | 89 |
| 577 | 3300014745 | Ga0157377_11591526 | Ga0157377_115915261 | 89 |
| 578 | 3300014968 | Ga0157379_10029119 | Ga0157379_1002911910 | 89 |
| 579 | 3300014968 | Ga0157379_10030185 | Ga0157379_100301857 | 89 |
| 580 | 3300014968 | Ga0157379_10062576 | Ga0157379_100625762 | 89 |
| 581 | 3300014968 | Ga0157379_10103915 | Ga0157379_101039152 | 89 |
| 582 | 3300014968 | Ga0157379_12271110 | Ga0157379_122711102 | 89 |
| 583 | 3300014969 | Ga0157376_10000001 | Ga0157376_1000000183 | 89 |
| 584 | 3300014969 | Ga0157376_10110927 | Ga0157376_101109273 | 89 |
| 585 | 3300014969 | Ga0157376_10673519 | Ga0157376_106735192 | 89 |
| 586 | 3300014969 | Ga0157376_10874119 | Ga0157376_108741192 | 89 |
| 587 | 3300014969 | Ga0157376_11657185 | Ga0157376_116571852 | 89 |
| 588 | 3300014969 | Ga0157376_12791261 | Ga0157376_127912612 | 89 |
| 589 | 3300017792 | Ga0163161_10121656 | Ga0163161_101216562 | 89 |
| 590 | 3300017792 | Ga0163161_10504241 | Ga0163161_105042412 | 89 |
| 591 | 3300020076 | Ga0206355_1665954 | Ga0206355_16659542 | 89 |
| 592 | 3300020082 | Ga0206353_10244075 | Ga0206353_102440751 | 89 |
| 593 | 3300020082 | Ga0206353_10922718 | Ga0206353_109227184 | 89 |
| 594 | 3300020610 | Ga0154015_1346800 | Ga0154015_13468003 | 89 |
| 595 | 3300021361 | Ga0213872_10001745 | Ga0213872_1000174512 | 89 |
| 596 | 3300021388 | Ga0213875_10151352 | Ga0213875_101513522 | 89 |
| 597 | 3300025321 | Ga0207656_10172742 | Ga0207656_101727421 | 89 |
| 598 | 3300025893 | Ga0207682_10153778 | Ga0207682_101537783 | 89 |
| 599 | 3300025898 | Ga0207692_10474147 | Ga0207692_104741471 | 89 |
| 600 | 3300025898 | Ga0207692_11037077 | Ga0207692_110370771 | 89 |
| 601 | 3300025899 | Ga0207642_10011396 | Ga0207642_100113965 | 89 |
| 602 | 3300025899 | Ga0207642_10068490 | Ga0207642_100684904 | 89 |
| 603 | 3300025900 | Ga0207710_10123466 | Ga0207710_101234662 | 89 |
| 604 | 3300025903 | Ga0207680_10010180 | Ga0207680_100101804 | 89 |
| 605 | 3300025903 | Ga0207680_10372310 | Ga0207680_103723102 | 89 |
| 606 | 3300025903 | Ga0207680_10435656 | Ga0207680_104356562 | 89 |
| 607 | 3300025903 | Ga0207680_10870306 | Ga0207680_108703062 | 89 |
| 608 | 3300025903 | Ga0207680_11122379 | Ga0207680_111223791 | 89 |
| 609 | 3300025904 | Ga0207647_10008577 | Ga0207647_1000857710 | 89 |
| 610 | 3300025904 | Ga0207647_10625569 | Ga0207647_106255692 | 89 |
| 611 | 3300025905 | Ga0207685_10022094 | Ga0207685_100220945 | 89 |
| 612 | 3300025906 | Ga0207699_10042494 | Ga0207699_100424942 | 89 |
| 613 | 3300025906 | Ga0207699_10432796 | Ga0207699_104327961 | 89 |
| 614 | 3300025907 | Ga0207645_10005044 | Ga0207645_1000504416 | 89 |
| 615 | 3300025907 | Ga0207645_10143075 | Ga0207645_101430753 | 89 |
| 616 | 3300025907 | Ga0207645_10282193 | Ga0207645_102821932 | 89 |
| 617 | 3300025908 | Ga0207643_10014781 | Ga0207643_100147818 | 89 |
| 618 | 3300025908 | Ga0207643_10022628 | Ga0207643_100226288 | 89 |
| 619 | 3300025908 | Ga0207643_10856592 | Ga0207643_108565921 | 89 |
| 620 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011322 | 89 |
| 621 | 3300025909 | Ga0207705_10000038 | Ga0207705_10000038210 | 89 |
| 622 | 3300025909 | Ga0207705_10000167 | Ga0207705_1000016783 | 89 |
| 623 | 3300025909 | Ga0207705_10006171 | Ga0207705_1000617118 | 89 |
| 624 | 3300025909 | Ga0207705_10007444 | Ga0207705_100074441 | 89 |
| 625 | 3300025909 | Ga0207705_10019143 | Ga0207705_100191437 | 89 |
| 626 | 3300025909 | Ga0207705_10525686 | Ga0207705_105256862 | 89 |
| 627 | 3300025910 | Ga0207684_10046614 | Ga0207684_100466143 | 89 |
| 628 | 3300025910 | Ga0207684_10209286 | Ga0207684_102092863 | 89 |
| 629 | 3300025910 | Ga0207684_10568375 | Ga0207684_105683752 | 89 |
| 630 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021052 | 89 |
| 631 | 3300025911 | Ga0207654_10053235 | Ga0207654_100532355 | 89 |
| 632 | 3300025911 | Ga0207654_10116489 | Ga0207654_101164892 | 89 |
| 633 | 3300025911 | Ga0207654_10711922 | Ga0207654_107119222 | 89 |
| 634 | 3300025911 | Ga0207654_10949269 | Ga0207654_109492692 | 89 |
| 635 | 3300025912 | Ga0207707_10003287 | Ga0207707_1000328710 | 89 |
| 636 | 3300025912 | Ga0207707_10072140 | Ga0207707_100721403 | 89 |
| 637 | 3300025912 | Ga0207707_10144644 | Ga0207707_101446444 | 89 |
| 638 | 3300025912 | Ga0207707_10227503 | Ga0207707_102275033 | 89 |
| 639 | 3300025912 | Ga0207707_10306010 | Ga0207707_103060103 | 89 |
| 640 | 3300025912 | Ga0207707_10690226 | Ga0207707_106902262 | 89 |
| 641 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005859 | 89 |
| 642 | 3300025913 | Ga0207695_10051029 | Ga0207695_100510292 | 89 |
| 643 | 3300025913 | Ga0207695_10096000 | Ga0207695_100960004 | 89 |
| 644 | 3300025913 | Ga0207695_10209706 | Ga0207695_102097063 | 89 |
| 645 | 3300025913 | Ga0207695_10223098 | Ga0207695_102230985 | 89 |
| 646 | 3300025913 | Ga0207695_10731065 | Ga0207695_107310652 | 89 |
| 647 | 3300025914 | Ga0207671_10066252 | Ga0207671_100662524 | 89 |
| 648 | 3300025914 | Ga0207671_10274153 | Ga0207671_102741532 | 89 |
| 649 | 3300025914 | Ga0207671_10583590 | Ga0207671_105835902 | 89 |
| 650 | 3300025914 | Ga0207671_10884974 | Ga0207671_108849743 | 89 |
| 651 | 3300025915 | Ga0207693_10292792 | Ga0207693_102927923 | 89 |
| 652 | 3300025915 | Ga0207693_10293235 | Ga0207693_102932353 | 89 |
| 653 | 3300025915 | Ga0207693_11302437 | Ga0207693_113024372 | 89 |
| 654 | 3300025916 | Ga0207663_10024879 | Ga0207663_100248793 | 89 |
| 655 | 3300025917 | Ga0207660_10000748 | Ga0207660_1000074823 | 89 |
| 656 | 3300025917 | Ga0207660_10031712 | Ga0207660_100317128 | 89 |
| 657 | 3300025917 | Ga0207660_10143092 | Ga0207660_101430922 | 89 |
| 658 | 3300025917 | Ga0207660_10807668 | Ga0207660_108076682 | 89 |
| 659 | 3300025917 | Ga0207660_11128405 | Ga0207660_111284052 | 89 |
| 660 | 3300025917 | Ga0207660_11520174 | Ga0207660_115201742 | 89 |
| 661 | 3300025917 | Ga0207660_11522996 | Ga0207660_115229962 | 89 |
| 662 | 3300025918 | Ga0207662_10183113 | Ga0207662_101831133 | 89 |
| 663 | 3300025918 | Ga0207662_10415489 | Ga0207662_104154892 | 89 |
| 664 | 3300025918 | Ga0207662_10657989 | Ga0207662_106579892 | 89 |
| 665 | 3300025918 | Ga0207662_10748147 | Ga0207662_107481472 | 89 |
| 666 | 3300025918 | Ga0207662_11342533 | Ga0207662_113425332 | 89 |
| 667 | 3300025918 | Ga0207662_11376819 | Ga0207662_113768191 | 89 |
| 668 | 3300025919 | Ga0207657_10000280 | Ga0207657_100002804 | 89 |
| 669 | 3300025919 | Ga0207657_10000804 | Ga0207657_1000080433 | 89 |
| 670 | 3300025919 | Ga0207657_10006928 | Ga0207657_1000692819 | 89 |
| 671 | 3300025919 | Ga0207657_10016230 | Ga0207657_1001623010 | 89 |
| 672 | 3300025919 | Ga0207657_10488203 | Ga0207657_104882032 | 89 |
| 673 | 3300025920 | Ga0207649_10576597 | Ga0207649_105765972 | 89 |
| 674 | 3300025920 | Ga0207649_10950836 | Ga0207649_109508361 | 89 |
| 675 | 3300025920 | Ga0207649_11197753 | Ga0207649_111977532 | 89 |
| 676 | 3300025921 | Ga0207652_10007578 | Ga0207652_1000757818 | 89 |
| 677 | 3300025921 | Ga0207652_10008454 | Ga0207652_1000845418 | 89 |
| 678 | 3300025921 | Ga0207652_10013911 | Ga0207652_100139117 | 89 |
| 679 | 3300025921 | Ga0207652_10017326 | Ga0207652_100173267 | 89 |
| 680 | 3300025921 | Ga0207652_10047579 | Ga0207652_100475797 | 89 |
| 681 | 3300025921 | Ga0207652_10056559 | Ga0207652_100565593 | 89 |
| 682 | 3300025921 | Ga0207652_10130422 | Ga0207652_101304223 | 89 |
| 683 | 3300025921 | Ga0207652_10194495 | Ga0207652_101944952 | 89 |
| 684 | 3300025921 | Ga0207652_10296884 | Ga0207652_102968842 | 89 |
| 685 | 3300025921 | Ga0207652_10968734 | Ga0207652_109687341 | 89 |
| 686 | 3300025921 | Ga0207652_10979782 | Ga0207652_109797822 | 89 |
| 687 | 3300025921 | Ga0207652_10997420 | Ga0207652_109974202 | 89 |
| 688 | 3300025921 | Ga0207652_10998260 | Ga0207652_109982602 | 89 |
| 689 | 3300025921 | Ga0207652_11136868 | Ga0207652_111368682 | 89 |
| 690 | 3300025922 | Ga0207646_10004914 | Ga0207646_1000491417 | 89 |
| 691 | 3300025922 | Ga0207646_10188618 | Ga0207646_101886183 | 89 |
| 692 | 3300025922 | Ga0207646_10298443 | Ga0207646_102984432 | 89 |
| 693 | 3300025922 | Ga0207646_10543196 | Ga0207646_105431962 | 89 |
| 694 | 3300025923 | Ga0207681_10044851 | Ga0207681_100448518 | 89 |
| 695 | 3300025923 | Ga0207681_11525745 | Ga0207681_115257452 | 89 |
| 696 | 3300025924 | Ga0207694_10000232 | Ga0207694_1000023245 | 89 |
| 697 | 3300025924 | Ga0207694_10297488 | Ga0207694_102974883 | 89 |
| 698 | 3300025924 | Ga0207694_10369919 | Ga0207694_103699193 | 89 |
| 699 | 3300025924 | Ga0207694_10471729 | Ga0207694_104717293 | 89 |
| 700 | 3300025924 | Ga0207694_10905252 | Ga0207694_109052522 | 89 |
| 701 | 3300025924 | Ga0207694_11515029 | Ga0207694_115150291 | 89 |
| 702 | 3300025925 | Ga0207650_10051370 | Ga0207650_100513703 | 89 |
| 703 | 3300025925 | Ga0207650_10183495 | Ga0207650_101834954 | 89 |
| 704 | 3300025926 | Ga0207659_10154532 | Ga0207659_101545324 | 89 |
| 705 | 3300025926 | Ga0207659_10369763 | Ga0207659_103697632 | 89 |
| 706 | 3300025926 | Ga0207659_10400232 | Ga0207659_104002322 | 89 |
| 707 | 3300025927 | Ga0207687_10000030 | Ga0207687_10000030108 | 89 |
| 708 | 3300025927 | Ga0207687_10000318 | Ga0207687_1000031833 | 89 |
| 709 | 3300025927 | Ga0207687_10008644 | Ga0207687_100086443 | 89 |
| 710 | 3300025927 | Ga0207687_10015188 | Ga0207687_1001518810 | 89 |
| 711 | 3300025927 | Ga0207687_10026767 | Ga0207687_100267678 | 89 |
| 712 | 3300025927 | Ga0207687_10257708 | Ga0207687_102577082 | 89 |
| 713 | 3300025927 | Ga0207687_10343208 | Ga0207687_103432081 | 89 |
| 714 | 3300025927 | Ga0207687_10985624 | Ga0207687_109856242 | 89 |
| 715 | 3300025928 | Ga0207700_10000077 | Ga0207700_1000007752 | 89 |
| 716 | 3300025928 | Ga0207700_10003616 | Ga0207700_1000361613 | 89 |
| 717 | 3300025928 | Ga0207700_10905879 | Ga0207700_109058792 | 89 |
| 718 | 3300025929 | Ga0207664_10003229 | Ga0207664_100032296 | 89 |
| 719 | 3300025929 | Ga0207664_10014803 | Ga0207664_1001480312 | 89 |
| 720 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001975 | 89 |
| 721 | 3300025931 | Ga0207644_10003510 | Ga0207644_100035108 | 89 |
| 722 | 3300025931 | Ga0207644_10020573 | Ga0207644_100205734 | 89 |
| 723 | 3300025931 | Ga0207644_10106804 | Ga0207644_101068043 | 89 |
| 724 | 3300025931 | Ga0207644_10564013 | Ga0207644_105640133 | 89 |
| 725 | 3300025932 | Ga0207690_10000521 | Ga0207690_1000052123 | 89 |
| 726 | 3300025932 | Ga0207690_10163984 | Ga0207690_101639843 | 89 |
| 727 | 3300025932 | Ga0207690_10226334 | Ga0207690_102263344 | 89 |
| 728 | 3300025933 | Ga0207706_10068780 | Ga0207706_100687804 | 89 |
| 729 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001700 | 89 |
| 730 | 3300025934 | Ga0207686_10000521 | Ga0207686_1000052116 | 89 |
| 731 | 3300025934 | Ga0207686_10005025 | Ga0207686_1000502510 | 89 |
| 732 | 3300025934 | Ga0207686_10015693 | Ga0207686_100156935 | 89 |
| 733 | 3300025934 | Ga0207686_10088578 | Ga0207686_100885784 | 89 |
| 734 | 3300025934 | Ga0207686_10188335 | Ga0207686_101883352 | 89 |
| 735 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002818 | 89 |
| 736 | 3300025935 | Ga0207709_10006627 | Ga0207709_100066275 | 89 |
| 737 | 3300025935 | Ga0207709_10008424 | Ga0207709_1000842411 | 89 |
| 738 | 3300025935 | Ga0207709_10256442 | Ga0207709_102564422 | 89 |
| 739 | 3300025935 | Ga0207709_11293062 | Ga0207709_112930622 | 89 |
| 740 | 3300025936 | Ga0207670_10035982 | Ga0207670_100359826 | 89 |
| 741 | 3300025936 | Ga0207670_10657956 | Ga0207670_106579561 | 89 |
| 742 | 3300025936 | Ga0207670_11367464 | Ga0207670_113674642 | 89 |
| 743 | 3300025937 | Ga0207669_10027599 | Ga0207669_100275996 | 89 |
| 744 | 3300025937 | Ga0207669_10040466 | Ga0207669_100404667 | 89 |
| 745 | 3300025937 | Ga0207669_10142350 | Ga0207669_101423503 | 89 |
| 746 | 3300025938 | Ga0207704_10018134 | Ga0207704_100181348 | 89 |
| 747 | 3300025938 | Ga0207704_10390402 | Ga0207704_103904021 | 89 |
| 748 | 3300025938 | Ga0207704_11968198 | Ga0207704_119681981 | 89 |
| 749 | 3300025939 | Ga0207665_10133250 | Ga0207665_101332503 | 89 |
| 750 | 3300025939 | Ga0207665_10163137 | Ga0207665_101631374 | 89 |
| 751 | 3300025939 | Ga0207665_10168544 | Ga0207665_101685441 | 89 |
| 752 | 3300025940 | Ga0207691_10054461 | Ga0207691_100544617 | 89 |
| 753 | 3300025940 | Ga0207691_10126313 | Ga0207691_101263133 | 89 |
| 754 | 3300025940 | Ga0207691_11229119 | Ga0207691_112291192 | 89 |
| 755 | 3300025941 | Ga0207711_10007779 | Ga0207711_1000777916 | 89 |
| 756 | 3300025941 | Ga0207711_10028146 | Ga0207711_100281465 | 89 |
| 757 | 3300025941 | Ga0207711_10112488 | Ga0207711_101124884 | 89 |
| 758 | 3300025941 | Ga0207711_10230905 | Ga0207711_102309052 | 89 |
| 759 | 3300025941 | Ga0207711_11305411 | Ga0207711_113054112 | 89 |
| 760 | 3300025942 | Ga0207689_10000292 | Ga0207689_1000029241 | 89 |
| 761 | 3300025942 | Ga0207689_10000370 | Ga0207689_1000037016 | 89 |
| 762 | 3300025942 | Ga0207689_10017314 | Ga0207689_1001731411 | 89 |
| 763 | 3300025942 | Ga0207689_10371921 | Ga0207689_103719213 | 89 |
| 764 | 3300025944 | Ga0207661_10000021 | Ga0207661_10000021176 | 89 |
| 765 | 3300025944 | Ga0207661_10002824 | Ga0207661_1000282414 | 89 |
| 766 | 3300025944 | Ga0207661_10084193 | Ga0207661_100841934 | 89 |
| 767 | 3300025944 | Ga0207661_10159071 | Ga0207661_101590712 | 89 |
| 768 | 3300025944 | Ga0207661_10253160 | Ga0207661_102531603 | 89 |
| 769 | 3300025944 | Ga0207661_10441959 | Ga0207661_104419591 | 89 |
| 770 | 3300025944 | Ga0207661_10854015 | Ga0207661_108540152 | 89 |
| 771 | 3300025944 | Ga0207661_11104487 | Ga0207661_111044871 | 89 |
| 772 | 3300025944 | Ga0207661_11995849 | Ga0207661_119958492 | 89 |
| 773 | 3300025945 | Ga0207679_10303101 | Ga0207679_103031013 | 89 |
| 774 | 3300025945 | Ga0207679_10447699 | Ga0207679_104476991 | 89 |
| 775 | 3300025945 | Ga0207679_10876936 | Ga0207679_108769362 | 89 |
| 776 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008145 | 89 |
| 777 | 3300025949 | Ga0207667_10000299 | Ga0207667_1000029910 | 89 |
| 778 | 3300025949 | Ga0207667_10000339 | Ga0207667_1000033928 | 89 |
| 779 | 3300025949 | Ga0207667_10023417 | Ga0207667_100234177 | 89 |
| 780 | 3300025949 | Ga0207667_10087215 | Ga0207667_100872156 | 89 |
| 781 | 3300025949 | Ga0207667_10431219 | Ga0207667_104312192 | 89 |
| 782 | 3300025949 | Ga0207667_10631152 | Ga0207667_106311522 | 89 |
| 783 | 3300025949 | Ga0207667_10649009 | Ga0207667_106490093 | 89 |
| 784 | 3300025949 | Ga0207667_10740028 | Ga0207667_107400282 | 89 |
| 785 | 3300025949 | Ga0207667_11287606 | Ga0207667_112876062 | 89 |
| 786 | 3300025949 | Ga0207667_11305912 | Ga0207667_113059122 | 89 |
| 787 | 3300025949 | Ga0207667_11369619 | Ga0207667_113696192 | 89 |
| 788 | 3300025960 | Ga0207651_10000203 | Ga0207651_1000020330 | 89 |
| 789 | 3300025960 | Ga0207651_10038713 | Ga0207651_100387132 | 89 |
| 790 | 3300025960 | Ga0207651_10054318 | Ga0207651_100543183 | 89 |
| 791 | 3300025961 | Ga0207712_10001459 | Ga0207712_1000145918 | 89 |
| 792 | 3300025961 | Ga0207712_10015338 | Ga0207712_1001533811 | 89 |
| 793 | 3300025961 | Ga0207712_10280366 | Ga0207712_102803663 | 89 |
| 794 | 3300025961 | Ga0207712_11950706 | Ga0207712_119507062 | 89 |
| 795 | 3300025972 | Ga0207668_10621333 | Ga0207668_106213332 | 89 |
| 796 | 3300025981 | Ga0207640_10609573 | Ga0207640_106095732 | 89 |
| 797 | 3300025981 | Ga0207640_11690498 | Ga0207640_116904982 | 89 |
| 798 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003578 | 89 |
| 799 | 3300025986 | Ga0207658_10002651 | Ga0207658_1000265110 | 89 |
| 800 | 3300025986 | Ga0207658_11081093 | Ga0207658_110810932 | 89 |
| 801 | 3300025986 | Ga0207658_11510997 | Ga0207658_115109972 | 89 |
| 802 | 3300026023 | Ga0207677_10001880 | Ga0207677_100018808 | 89 |
| 803 | 3300026023 | Ga0207677_12129978 | Ga0207677_121299781 | 89 |
| 804 | 3300026035 | Ga0207703_10000517 | Ga0207703_1000051716 | 89 |
| 805 | 3300026035 | Ga0207703_10043986 | Ga0207703_100439862 | 89 |
| 806 | 3300026035 | Ga0207703_10283662 | Ga0207703_102836624 | 89 |
| 807 | 3300026035 | Ga0207703_11786449 | Ga0207703_117864492 | 89 |
| 808 | 3300026041 | Ga0207639_10502283 | Ga0207639_105022832 | 89 |
| 809 | 3300026041 | Ga0207639_11190245 | Ga0207639_111902451 | 89 |
| 810 | 3300026041 | Ga0207639_11677116 | Ga0207639_116771162 | 89 |
| 811 | 3300026041 | Ga0207639_11891464 | Ga0207639_118914641 | 89 |
| 812 | 3300026067 | Ga0207678_10049262 | Ga0207678_100492627 | 89 |
| 813 | 3300026067 | Ga0207678_10171922 | Ga0207678_101719222 | 89 |
| 814 | 3300026075 | Ga0207708_10004151 | Ga0207708_1000415116 | 89 |
| 815 | 3300026075 | Ga0207708_10109455 | Ga0207708_101094552 | 89 |
| 816 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001844 | 89 |
| 817 | 3300026078 | Ga0207702_10001268 | Ga0207702_1000126833 | 89 |
| 818 | 3300026078 | Ga0207702_10003219 | Ga0207702_1000321920 | 89 |
| 819 | 3300026078 | Ga0207702_10023468 | Ga0207702_1002346811 | 89 |
| 820 | 3300026078 | Ga0207702_10184378 | Ga0207702_101843785 | 89 |
| 821 | 3300026078 | Ga0207702_10213107 | Ga0207702_102131072 | 89 |
| 822 | 3300026078 | Ga0207702_10402809 | Ga0207702_104028092 | 89 |
| 823 | 3300026078 | Ga0207702_10644031 | Ga0207702_106440312 | 89 |
| 824 | 3300026078 | Ga0207702_11003924 | Ga0207702_110039242 | 89 |
| 825 | 3300026078 | Ga0207702_11058965 | Ga0207702_110589652 | 89 |
| 826 | 3300026088 | Ga0207641_10002453 | Ga0207641_1000245320 | 89 |
| 827 | 3300026088 | Ga0207641_10016989 | Ga0207641_100169897 | 89 |
| 828 | 3300026088 | Ga0207641_10074503 | Ga0207641_100745037 | 89 |
| 829 | 3300026088 | Ga0207641_10080247 | Ga0207641_100802476 | 89 |
| 830 | 3300026088 | Ga0207641_11243983 | Ga0207641_112439832 | 89 |
| 831 | 3300026089 | Ga0207648_10055064 | Ga0207648_100550642 | 89 |
| 832 | 3300026089 | Ga0207648_10063803 | Ga0207648_100638032 | 89 |
| 833 | 3300026089 | Ga0207648_10067573 | Ga0207648_100675737 | 89 |
| 834 | 3300026089 | Ga0207648_10190278 | Ga0207648_101902783 | 89 |
| 835 | 3300026089 | Ga0207648_10390358 | Ga0207648_103903584 | 89 |
| 836 | 3300026089 | Ga0207648_10415731 | Ga0207648_104157312 | 89 |
| 837 | 3300026095 | Ga0207676_10000167 | Ga0207676_1000016729 | 89 |
| 838 | 3300026116 | Ga0207674_10000001 | Ga0207674_10000001395 | 89 |
| 839 | 3300026116 | Ga0207674_10005648 | Ga0207674_1000564811 | 89 |
| 840 | 3300026116 | Ga0207674_10513650 | Ga0207674_105136503 | 89 |
| 841 | 3300026116 | Ga0207674_10928517 | Ga0207674_109285173 | 89 |
| 842 | 3300026116 | Ga0207674_11454072 | Ga0207674_114540722 | 89 |
| 843 | 3300026116 | Ga0207674_12144067 | Ga0207674_121440671 | 89 |
| 844 | 3300026116 | Ga0207674_12162519 | Ga0207674_121625191 | 89 |
| 845 | 3300026116 | Ga0207674_12293146 | Ga0207674_122931462 | 89 |
| 846 | 3300026118 | Ga0207675_100013573 | Ga0207675_1000135733 | 89 |
| 847 | 3300026118 | Ga0207675_100059255 | Ga0207675_1000592557 | 89 |
| 848 | 3300026118 | Ga0207675_100204893 | Ga0207675_1002048935 | 89 |
| 849 | 3300026118 | Ga0207675_100848329 | Ga0207675_1008483292 | 89 |
| 850 | 3300026118 | Ga0207675_100955207 | Ga0207675_1009552072 | 89 |
| 851 | 3300026118 | Ga0207675_102023718 | Ga0207675_1020237182 | 89 |
| 852 | 3300026121 | Ga0207683_10000965 | Ga0207683_1000096530 | 89 |
| 853 | 3300026121 | Ga0207683_10002331 | Ga0207683_100023312 | 89 |
| 854 | 3300026121 | Ga0207683_10041485 | Ga0207683_100414858 | 89 |
| 855 | 3300026121 | Ga0207683_10046413 | Ga0207683_100464138 | 89 |
| 856 | 3300026121 | Ga0207683_10375895 | Ga0207683_103758952 | 89 |
| 857 | 3300026142 | Ga0207698_10233471 | Ga0207698_102334712 | 89 |
| 858 | 3300026142 | Ga0207698_10657098 | Ga0207698_106570982 | 89 |
| 859 | 3300026142 | Ga0207698_11663835 | Ga0207698_116638352 | 89 |
| 860 | 3300027717 | Ga0209998_10096500 | Ga0209998_100965001 | 89 |
| 861 | 3300027866 | Ga0209813_10000009 | Ga0209813_1000000936 | 89 |
| 862 | 3300027907 | Ga0207428_10396859 | Ga0207428_103968591 | 89 |
| 863 | 3300028379 | Ga0268266_10003734 | Ga0268266_1000373411 | 89 |
| 864 | 3300028379 | Ga0268266_10034899 | Ga0268266_100348994 | 89 |
| 865 | 3300028379 | Ga0268266_10103455 | Ga0268266_101034555 | 89 |
| 866 | 3300028379 | Ga0268266_10313573 | Ga0268266_103135733 | 89 |
| 867 | 3300028379 | Ga0268266_10659292 | Ga0268266_106592923 | 89 |
| 868 | 3300028380 | Ga0268265_10188685 | Ga0268265_101886854 | 89 |
| 869 | 3300028380 | Ga0268265_10220988 | Ga0268265_102209883 | 89 |
| 870 | 3300028381 | Ga0268264_10044828 | Ga0268264_100448288 | 89 |
| 871 | 3300028381 | Ga0268264_10103423 | Ga0268264_101034232 | 89 |
| 872 | 3300028381 | Ga0268264_10121832 | Ga0268264_101218323 | 89 |
| 873 | 3300028381 | Ga0268264_10144907 | Ga0268264_101449072 | 89 |
| 874 | 3300028381 | Ga0268264_10305734 | Ga0268264_103057342 | 89 |
| 875 | 3300028381 | Ga0268264_11483023 | Ga0268264_114830232 | 89 |
| 876 | 3300028381 | Ga0268264_11655216 | Ga0268264_116552162 | 89 |
| 877 | 3300028381 | Ga0268264_11988178 | Ga0268264_119881782 | 89 |
| 878 | 3300028381 | Ga0268264_12700054 | Ga0268264_127000542 | 89 |
| 879 | 3300028556 | Ga0265337_1000001 | Ga0265337_100000183 | 89 |
| 880 | 3300028556 | Ga0265337_1058922 | Ga0265337_10589223 | 89 |
| 881 | 3300028556 | Ga0265337_1065250 | Ga0265337_10652502 | 89 |
| 882 | 3300028556 | Ga0265337_1071695 | Ga0265337_10716952 | 89 |
| 883 | 3300028558 | Ga0265326_10005024 | Ga0265326_100050241 | 89 |
| 884 | 3300028558 | Ga0265326_10018388 | Ga0265326_100183882 | 89 |
| 885 | 3300028558 | Ga0265326_10071393 | Ga0265326_100713932 | 89 |
| 886 | 3300028563 | Ga0265319_1179800 | Ga0265319_11798001 | 89 |
| 887 | 3300028573 | Ga0265334_10000049 | Ga0265334_1000004919 | 89 |
| 888 | 3300028573 | Ga0265334_10000114 | Ga0265334_1000011427 | 89 |
| 889 | 3300028573 | Ga0265334_10046542 | Ga0265334_100465424 | 89 |
| 890 | 3300028573 | Ga0265334_10115392 | Ga0265334_101153922 | 89 |
| 891 | 3300028573 | Ga0265334_10127792 | Ga0265334_101277922 | 89 |
| 892 | 3300028577 | Ga0265318_10111693 | Ga0265318_101116931 | 89 |
| 893 | 3300028654 | Ga0265322_10009918 | Ga0265322_100099186 | 89 |
| 894 | 3300028654 | Ga0265322_10038325 | Ga0265322_100383251 | 89 |
| 895 | 3300028654 | Ga0265322_10123932 | Ga0265322_101239322 | 89 |
| 896 | 3300028666 | Ga0265336_10000618 | Ga0265336_1000061816 | 89 |
| 897 | 3300028666 | Ga0265336_10135916 | Ga0265336_101359161 | 89 |
| 898 | 3300028666 | Ga0265336_10171602 | Ga0265336_101716022 | 89 |
| 899 | 3300028794 | Ga0307515_10370836 | Ga0307515_103708362 | 89 |
| 900 | 3300028800 | Ga0265338_10000003 | Ga0265338_10000003498 | 89 |
| 901 | 3300028800 | Ga0265338_10000052 | Ga0265338_1000005260 | 89 |
| 902 | 3300028800 | Ga0265338_10000054 | Ga0265338_10000054142 | 89 |
| 903 | 3300028800 | Ga0265338_10000217 | Ga0265338_10000217111 | 89 |
| 904 | 3300028800 | Ga0265338_10000366 | Ga0265338_1000036636 | 89 |
| 905 | 3300028800 | Ga0265338_10000543 | Ga0265338_1000054342 | 89 |
| 906 | 3300028800 | Ga0265338_10003025 | Ga0265338_100030255 | 89 |
| 907 | 3300028800 | Ga0265338_10009585 | Ga0265338_1000958516 | 89 |
| 908 | 3300028800 | Ga0265338_10017457 | Ga0265338_100174577 | 89 |
| 909 | 3300028800 | Ga0265338_10035997 | Ga0265338_100359975 | 89 |
| 910 | 3300028800 | Ga0265338_10085544 | Ga0265338_100855445 | 89 |
| 911 | 3300028800 | Ga0265338_10091843 | Ga0265338_100918435 | 89 |
| 912 | 3300028800 | Ga0265338_10099324 | Ga0265338_100993246 | 89 |
| 913 | 3300028800 | Ga0265338_10205341 | Ga0265338_102053412 | 89 |
| 914 | 3300028800 | Ga0265338_10490193 | Ga0265338_104901932 | 89 |
| 915 | 3300028800 | Ga0265338_10649072 | Ga0265338_106490721 | 89 |
| 916 | 3300028800 | Ga0265338_10687104 | Ga0265338_106871041 | 89 |
| 917 | 3300028800 | Ga0265338_11072257 | Ga0265338_110722572 | 89 |
| 918 | 3300029957 | Ga0265324_10000002 | Ga0265324_1000000279 | 89 |
| 919 | 3300029957 | Ga0265324_10000500 | Ga0265324_1000050030 | 89 |
| 920 | 3300029957 | Ga0265324_10002972 | Ga0265324_100029724 | 89 |
| 921 | 3300029957 | Ga0265324_10022661 | Ga0265324_100226612 | 89 |
| 922 | 3300029957 | Ga0265324_10050377 | Ga0265324_100503772 | 89 |
| 923 | 3300030731 | Ga0316177_1067570 | Ga0316177_10675703 | 89 |
| 924 | 3300030732 | Ga0316176_1094613 | Ga0316176_10946136 | 89 |
| 925 | 3300030733 | Ga0314311_1158944 | Ga0314311_11589445 | 89 |
| 926 | 3300030733 | Ga0314311_1244055 | Ga0314311_12440556 | 89 |
| 927 | 3300030734 | Ga0316179_1102296 | Ga0316179_11022963 | 89 |
| 928 | 3300030735 | Ga0316178_1025775 | Ga0316178_10257752 | 89 |
| 929 | 3300030736 | Ga0316180_1156767 | Ga0316180_11567672 | 89 |
| 930 | 3300030742 | Ga0316183_1139050 | Ga0316183_11390502 | 89 |
| 931 | 3300030744 | Ga0316181_1237823 | Ga0316181_12378233 | 89 |
| 932 | 3300031238 | Ga0265332_10312940 | Ga0265332_103129402 | 89 |
| 933 | 3300031240 | Ga0265320_10115375 | Ga0265320_101153753 | 89 |
| 934 | 3300031241 | Ga0265325_10001662 | Ga0265325_100016627 | 89 |
| 935 | 3300031247 | Ga0265340_10000521 | Ga0265340_1000052111 | 89 |
| 936 | 3300031249 | Ga0265339_10015627 | Ga0265339_100156278 | 89 |
| 937 | 3300031249 | Ga0265339_10286876 | Ga0265339_102868762 | 89 |
| 938 | 3300031250 | Ga0265331_10000050 | Ga0265331_10000050127 | 89 |
| 939 | 3300031250 | Ga0265331_10008042 | Ga0265331_100080425 | 89 |
| 940 | 3300031250 | Ga0265331_10019045 | Ga0265331_100190451 | 89 |
| 941 | 3300031250 | Ga0265331_10300793 | Ga0265331_103007932 | 89 |
| 942 | 3300031250 | Ga0265331_10415547 | Ga0265331_104155472 | 89 |
| 943 | 3300031251 | Ga0265327_10000109 | Ga0265327_1000010998 | 89 |
| 944 | 3300031251 | Ga0265327_10009306 | Ga0265327_100093068 | 89 |
| 945 | 3300031251 | Ga0265327_10010524 | Ga0265327_100105243 | 89 |
| 946 | 3300031251 | Ga0265327_10034073 | Ga0265327_100340737 | 89 |
| 947 | 3300031251 | Ga0265327_10106909 | Ga0265327_101069093 | 89 |
| 948 | 3300031251 | Ga0265327_10114436 | Ga0265327_101144362 | 89 |
| 949 | 3300031251 | Ga0265327_10116624 | Ga0265327_101166242 | 89 |
| 950 | 3300031251 | Ga0265327_10237053 | Ga0265327_102370531 | 89 |
| 951 | 3300031251 | Ga0265327_10282438 | Ga0265327_102824382 | 89 |
| 952 | 3300031344 | Ga0265316_10061349 | Ga0265316_100613498 | 89 |
| 953 | 3300031344 | Ga0265316_10104449 | Ga0265316_101044494 | 89 |
| 954 | 3300031344 | Ga0265316_10148230 | Ga0265316_101482304 | 89 |
| 955 | 3300031344 | Ga0265316_10178367 | Ga0265316_101783672 | 89 |
| 956 | 3300031344 | Ga0265316_10263153 | Ga0265316_102631532 | 89 |
| 957 | 3300031344 | Ga0265316_10413648 | Ga0265316_104136481 | 89 |
| 958 | 3300031344 | Ga0265316_10446833 | Ga0265316_104468333 | 89 |
| 959 | 3300031344 | Ga0265316_10962904 | Ga0265316_109629042 | 89 |
| 960 | 3300031456 | Ga0307513_10942323 | Ga0307513_109423231 | 89 |
| 961 | 3300031548 | Ga0307408_100293872 | Ga0307408_1002938723 | 89 |
| 962 | 3300031595 | Ga0265313_10054666 | Ga0265313_100546664 | 89 |
| 963 | 3300031595 | Ga0265313_10060644 | Ga0265313_100606442 | 89 |
| 964 | 3300031616 | Ga0307508_10771347 | Ga0307508_107713471 | 89 |
| 965 | 3300031665 | Ga0316575_10003983 | Ga0316575_100039835 | 89 |
| 966 | 3300031665 | Ga0316575_10180482 | Ga0316575_101804822 | 89 |
| 967 | 3300031691 | Ga0316579_10000952 | Ga0316579_100009528 | 89 |
| 968 | 3300031711 | Ga0265314_10001521 | Ga0265314_1000152116 | 89 |
| 969 | 3300031711 | Ga0265314_10055535 | Ga0265314_100555358 | 89 |
| 970 | 3300031711 | Ga0265314_10075317 | Ga0265314_100753171 | 89 |
| 971 | 3300031711 | Ga0265314_10075432 | Ga0265314_100754322 | 89 |
| 972 | 3300031711 | Ga0265314_10138110 | Ga0265314_101381103 | 89 |
| 973 | 3300031712 | Ga0265342_10056065 | Ga0265342_100560656 | 89 |
| 974 | 3300031712 | Ga0265342_10059252 | Ga0265342_100592523 | 89 |
| 975 | 3300031727 | Ga0316576_10004152 | Ga0316576_100041522 | 89 |
| 976 | 3300031727 | Ga0316576_10400550 | Ga0316576_104005502 | 89 |
| 977 | 3300031728 | Ga0316578_10116230 | Ga0316578_101162302 | 89 |
| 978 | 3300031728 | Ga0316578_10201448 | Ga0316578_102014482 | 89 |
| 979 | 3300031730 | Ga0307516_10307900 | Ga0307516_103079002 | 89 |
| 980 | 3300031731 | Ga0307405_10718617 | Ga0307405_107186172 | 89 |
| 981 | 3300031733 | Ga0316577_10141437 | Ga0316577_101414372 | 89 |
| 982 | 3300031733 | Ga0316577_10903634 | Ga0316577_109036341 | 89 |
| 983 | 3300031824 | Ga0307413_10365835 | Ga0307413_103658351 | 89 |
| 984 | 3300031903 | Ga0307407_11446865 | Ga0307407_114468651 | 89 |
| 985 | 3300032002 | Ga0307416_103365274 | Ga0307416_1033652741 | 89 |
| 986 | 3300032004 | Ga0307414_11252104 | Ga0307414_112521042 | 89 |
| 987 | 3300032005 | Ga0307411_10434820 | Ga0307411_104348203 | 89 |
| 988 | 3300032126 | Ga0307415_100217593 | Ga0307415_1002175933 | 89 |
| 989 | 3300032133 | Ga0316583_10002208 | Ga0316583_100022084 | 89 |
| 990 | 3300032133 | Ga0316583_10032677 | Ga0316583_100326772 | 89 |
| 991 | 3300032137 | Ga0316585_10110045 | Ga0316585_101100452 | 89 |
| 992 | 3300032168 | Ga0316593_10000192 | Ga0316593_1000019214 | 89 |
| 993 | 3300032168 | Ga0316593_10005887 | Ga0316593_100058871 | 89 |
| 994 | 3300032168 | Ga0316593_10014395 | Ga0316593_100143955 | 89 |
| 995 | 3300032168 | Ga0316593_10125998 | Ga0316593_101259982 | 89 |
| 996 | 3300033527 | Ga0316586_1007742 | Ga0316586_10077423 | 89 |
| 997 | 3300033529 | Ga0316587_1014693 | Ga0316587_10146931 | 89 |
| 998 | 3300033541 | Ga0316596_1077721 | Ga0316596_10777212 | 89 |
| 999 | 3300034817 | Ga0373948_0047199 | Ga0373948_0047199_433_738 | 89 |
| 1000 | 3300035086 | Ga0373934_0001385 | Ga0373934_0001385_846_1151 | 89 |
| 1001 | 3300035089 | Ga0373944_0004129 | Ga0373944_0004129_2693_2998 | 89 |
| 1002 | 3300035091 | Ga0373951_0060477 | Ga0373951_0060477_255_560 | 89 |
| 1003 | 3300035111 | Ga0373923_0003643 | Ga0373923_0003643_3475_3780 | 89 |
| 1004 | 3300035111 | Ga0373923_0487143 | Ga0373923_0487143_181_486 | 89 |
| 1005 | 3300035113 | Ga0373936_0134195 | Ga0373936_0134195_127_432 | 89 |
| 1006 | 3300035114 | Ga0373939_0394411 | Ga0373939_0394411_249_554 | 89 |
| 1007 | 3300035115 | Ga0373941_0116157 | Ga0373941_0116157_383_688 | 89 |
| 1008 | 3300035116 | Ga0373945_0152160 | Ga0373945_0152160_424_729 | 89 |
| 1009 | 3300035116 | Ga0373945_0430186 | Ga0373945_0430186_108_413 | 89 |
| 1010 | 3300035117 | Ga0373953_0003257 | Ga0373953_0003257_391_696 | 89 |
| 1011 | 3300035118 | Ga0373954_0010327 | Ga0373954_0010327_72_377 | 89 |
| 1012 | 3300035118 | Ga0373954_0341443 | Ga0373954_0341443_72_377 | 89 |
| 1013 | 3300035118 | Ga0373954_0420246 | Ga0373954_0420246_75_380 | 89 |
| 1014 | 3300035119 | Ga0373956_0184605 | Ga0373956_0184605_401_706 | 89 |
| 1015 | 3300035119 | Ga0373956_0221180 | Ga0373956_0221180_266_571 | 89 |
| 1016 | 3300035119 | Ga0373956_0509410 | Ga0373956_0509410_246_551 | 89 |
| 1017 | 3300035120 | Ga0373957_0018186 | Ga0373957_0018186_1793_2098 | 89 |
| 1018 | 3300035120 | Ga0373957_0320900 | Ga0373957_0320900_276_581 | 89 |
| 1019 | 3300035121 | Ga0373960_0031594 | Ga0373960_0031594_645_950 | 89 |
| 1020 | 3300035170 | Ga0373943_0039852 | Ga0373943_0039852_1889_2194 | 89 |
| 1021 | 3300035170 | Ga0373943_0141017 | Ga0373943_0141017_640_945 | 89 |
| 1022 | 3300035170 | Ga0373943_0917103 | Ga0373943_0917103_55_360 | 89 |
| 1023 | 3300035171 | Ga0373946_0187961 | Ga0373946_0187961_451_756 | 89 |
| 1024 | 3300035172 | Ga0373955_0008568 | Ga0373955_0008568_578_883 | 89 |
| 1025 | 3300035172 | Ga0373955_0082639 | Ga0373955_0082639_69_374 | 89 |
| 1026 | 3300035398 | Ga0316574_0000624 | Ga0316574_0000624_8686_8991 | 89 |
| 1027 | 3300035398 | Ga0316574_0028540 | Ga0316574_0028540_1545_1850 | 89 |
| 1028 | 3300035398 | Ga0316574_0371676 | Ga0316574_0371676_208_510 | 89 |
| 1029 | 3300035398 | Ga0316574_0445870 | Ga0316574_0445870_14_319 | 89 |
| 1030 | 3300035410 | Ga0373924_0000835 | Ga0373924_0000835_1354_1659 | 89 |
| 1031 | 3300035410 | Ga0373924_0005225 | Ga0373924_0005225_1565_1870 | 89 |
| 1032 | 3300035410 | Ga0373924_0102692 | Ga0373924_0102692_820_1125 | 89 |
| 1033 | 3300035691 | Ga0373931_0217568 | Ga0373931_0217568_178_483 | 89 |
| 1034 | 3300035691 | Ga0373931_0285379 | Ga0373931_0285379_405_710 | 89 |
| 1035 | 3300035692 | Ga0373935_0057224 | Ga0373935_0057224_1788_2093 | 89 |
| 1036 | 3300035692 | Ga0373935_0110058 | Ga0373935_0110058_461_766 | 89 |
| 1037 | 3300035692 | Ga0373935_0288115 | Ga0373935_0288115_520_825 | 89 |
| 1038 | 3300035692 | Ga0373935_0366602 | Ga0373935_0366602_351_656 | 89 |
| 1039 | 3300035692 | Ga0373935_0479919 | Ga0373935_0479919_262_567 | 89 |
| 1040 | 3300035695 | Ga0373927_0031676 | Ga0373927_0031676_2736_3041 | 89 |
| 1041 | 3300035695 | Ga0373927_0034603 | Ga0373927_0034603_1383_1688 | 89 |
| 1042 | 3300035695 | Ga0373927_0144358 | Ga0373927_0144358_1224_1529 | 89 |
| 1043 | 3300035725 | Ga0373947_0180653 | Ga0373947_0180653_154_459 | 89 |
| 1044 | 3300035725 | Ga0373947_0418832 | Ga0373947_0418832_328_633 | 89 |
| 1045 | 3300035725 | Ga0373947_0621701 | Ga0373947_0621701_97_402 | 89 |
| 1046 | 3300035725 | Ga0373947_1143924 | Ga0373947_1143924_159_464 | 89 |
| 1047 | 3300036401 | Ga0373937_0065847 | Ga0373937_0065847_1491_1796 | 89 |
| 1048 | 3300036401 | Ga0373937_0388613 | Ga0373937_0388613_386_691 | 89 |
| 1049 | 3300036401 | Ga0373937_0568946 | Ga0373937_0568946_540_845 | 89 |
| 1050 | 3300036647 | Ga0316582_0002553 | Ga0316582_0002553_1334_1639 | 89 |
| 1051 | 3300036647 | Ga0316582_0226216 | Ga0316582_0226216_872_1177 | 89 |
| 1052 | 3300036647 | Ga0316582_0667790 | Ga0316582_0667790_43_348 | 89 |
| 1053 | 3300036712 | Ga0316584_0047720 | Ga0316584_0047720_940_1245 | 89 |
| 1054 | 3300037068 | Ga0373925_0044970 | Ga0373925_0044970_2387_2692 | 89 |
| 1055 | 3300037068 | Ga0373925_0058172 | Ga0373925_0058172_2260_2565 | 89 |
| 1056 | 3300037068 | Ga0373925_0063911 | Ga0373925_0063911_2435_2740 | 89 |
| 1057 | 3300037068 | Ga0373925_0391982 | Ga0373925_0391982_514_819 | 89 |
| 1058 | 3300037068 | Ga0373925_1257303 | Ga0373925_1257303_122_427 | 89 |
| 1059 | 3300037312 | Ga0395899_0003098 | Ga0395899_0003098_11283_11552 | 89 |
| 1060 | 3300037312 | Ga0395899_0058565 | Ga0395899_0058565_700_969 | 89 |
| 1061 | 3300037312 | Ga0395899_0253422 | Ga0395899_0253422_443_712 | 89 |
| 1062 | 3300037312 | Ga0395899_0747026 | Ga0395899_0747026_41_310 | 89 |
| 1063 | 3300037418 | Ga0395900_0001412 | Ga0395900_0001412_22721_22990 | 89 |
| 1064 | 3300037418 | Ga0395900_0003612 | Ga0395900_0003612_12466_12735 | 89 |
| 1065 | 3300037418 | Ga0395900_0007425 | Ga0395900_0007425_10616_10885 | 89 |
| 1066 | 3300037418 | Ga0395900_0083127 | Ga0395900_0083127_2594_2863 | 89 |
| 1067 | 3300037418 | Ga0395900_0230270 | Ga0395900_0230270_1181_1450 | 89 |
| 1068 | 3300037418 | Ga0395900_0254362 | Ga0395900_0254362_125_394 | 89 |
| 1069 | 3300037418 | Ga0395900_0291831 | Ga0395900_0291831_1028_1297 | 89 |
| 1070 | 3300037418 | Ga0395900_1596364 | Ga0395900_1596364_95_364 | 89 |
| 1071 | 3300037466 | Ga0395898_0002536 | Ga0395898_0002536_11329_11598 | 89 |
| 1072 | 3300037466 | Ga0395898_0022692 | Ga0395898_0022692_5868_6137 | 89 |
| 1073 | 3300037466 | Ga0395898_0043059 | Ga0395898_0043059_3265_3534 | 89 |
| 1074 | 3300037466 | Ga0395898_0129171 | Ga0395898_0129171_1787_2089 | 89 |
| 1075 | 3300037466 | Ga0395898_0334575 | Ga0395898_0334575_1002_1271 | 89 |
| 1076 | 3300037466 | Ga0395898_1066782 | Ga0395898_1066782_70_339 | 89 |
| 1077 | 3300037471 | Ga0395905_0000238 | Ga0395905_0000238_75779_76048 | 89 |
| 1078 | 3300037471 | Ga0395905_0008237 | Ga0395905_0008237_8663_8932 | 89 |
| 1079 | 3300037471 | Ga0395905_0039862 | Ga0395905_0039862_468_737 | 89 |
| 1080 | 3300037471 | Ga0395905_0572892 | Ga0395905_0572892_152_421 | 89 |
| 1081 | 3300037471 | Ga0395905_1051475 | Ga0395905_1051475_249_551 | 89 |
| 1082 | 3300037588 | Ga0316581_0001079 | Ga0316581_0001079_2437_2742 | 89 |
| 1083 | 3300037853 | Ga0436364_0155867 | Ga0436364_0155867_386_691 | 89 |
| 1084 | 3300038443 | Ga0395901_0008414 | Ga0395901_0008414_5689_5958 | 89 |
| 1085 | 3300038443 | Ga0395901_0069107 | Ga0395901_0069107_478_747 | 89 |
| 1086 | 3300038443 | Ga0395901_0421595 | Ga0395901_0421595_691_960 | 89 |
| 1087 | 3300038443 | Ga0395901_0503058 | Ga0395901_0503058_84_353 | 89 |
| 1088 | 3300038443 | Ga0395901_2056643 | Ga0395901_2056643_135_437 | 89 |
| 1089 | 3300038996 | Ga0242420_027369 | Ga0242420_027369_448_873 | 89 |
| 1090 | 3300039438 | Ga0436360_1155810 | Ga0436360_1155810_272_577 | 89 |
| 1091 | 3300039447 | Ga0436361_0050017 | Ga0436361_0050017_19486_19791 | 89 |
| 1092 | 3300039447 | Ga0436361_0639184 | Ga0436361_0639184_91_396 | 89 |
| 1093 | 3300039447 | Ga0436361_0718323 | Ga0436361_0718323_193_498 | 89 |
| 1094 | 3300041459 | Ga0451800_0118075 | Ga0451800_0118075_593_862 | 89 |
| 1095 | 3300041459 | Ga0451800_0640511 | Ga0451800_0640511_200_469 | 89 |
| 1096 | 3300041486 | Ga0451807_1349481 | Ga0451807_1349481_2197_2466 | 89 |
| 1097 | 3300041507 | Ga0451851_1235575 | Ga0451851_1235575_99_368 | 89 |
| 1098 | 3300041511 | Ga0451855_0198077 | Ga0451855_0198077_28_333 | 89 |
| 1099 | 3300041512 | Ga0451853_2112008 | Ga0451853_2112008_206_511 | 89 |
| 1100 | 3300041997 | Ga0439431_0052111 | Ga0439431_0052111_427_696 | 89 |
| 1101 | 3300042005 | Ga0439448_0133959 | Ga0439448_0133959_175_480 | 89 |
| 1102 | 3300042006 | Ga0439432_230863 | Ga0439432_230863_51_320 | 89 |
| 1103 | 3300042876 | Ga0451577_0044456 | Ga0451577_0044456_1706_2011 | 89 |
| 1104 | 3300042876 | Ga0451577_0064949 | Ga0451577_0064949_2603_2908 | 89 |
| 1105 | 3300042876 | Ga0451577_0420337 | Ga0451577_0420337_776_1081 | 89 |
| 1106 | 3300042876 | Ga0451577_0608581 | Ga0451577_0608581_162_467 | 89 |
| 1107 | 3300042876 | Ga0451577_0929866 | Ga0451577_0929866_236_541 | 89 |
| 1108 | 3300044656 | Ga0466969_0002476 | Ga0466969_0002476_2557_2862 | 89 |
| 1109 | 3300044673 | Ga0453683_0030079 | Ga0453683_0030079_1875_2180 | 89 |
| 1110 | 3300044684 | Ga0466966_0117105 | Ga0466966_0117105_129_434 | 89 |
| 1111 | 3300044694 | Ga0466963_1236540 | Ga0466963_1236540_82_351 | 89 |
| 1112 | 3300044712 | Ga0453684_0000989 | Ga0453684_0000989_85882_86187 | 89 |
| 1113 | 3300044712 | Ga0453684_0065104 | Ga0453684_0065104_43_348 | 89 |
| 1114 | 3300044712 | Ga0453684_0177715 | Ga0453684_0177715_1770_2075 | 89 |
| 1115 | 3300044712 | Ga0453684_0692456 | Ga0453684_0692456_420_725 | 89 |
| 1116 | 3300044712 | Ga0453684_1181452 | Ga0453684_1181452_466_771 | 89 |
| 1117 | 3300044712 | Ga0453684_1766408 | Ga0453684_1766408_60_365 | 89 |
| 1118 | 3300044712 | Ga0453684_1798289 | Ga0453684_1798289_203_508 | 89 |
| 1119 | 3300044765 | Ga0466970_0186437 | Ga0466970_0186437_599_904 | 89 |
| 1120 | 3300044765 | Ga0466970_0229101 | Ga0466970_0229101_98_403 | 89 |
| 1121 | 3300044765 | Ga0466970_0238164 | Ga0466970_0238164_80_349 | 89 |
| 1122 | 3300044842 | Ga0466957_0962489 | Ga0466957_0962489_225_530 | 89 |
| 1123 | 3300045049 | Ga0466959_0013856 | Ga0466959_0013856_71_376 | 89 |
| 1124 | 3300045051 | Ga0451576_0002065 | Ga0451576_0002065_154_456 | 89 |
| 1125 | 3300045051 | Ga0451576_0010036 | Ga0451576_0010036_5536_5841 | 89 |
| 1126 | 3300045051 | Ga0451576_0060875 | Ga0451576_0060875_77_379 | 89 |
| 1127 | 3300045051 | Ga0451576_0069932 | Ga0451576_0069932_3047_3352 | 89 |
| 1128 | 3300045051 | Ga0451576_0374709 | Ga0451576_0374709_142_444 | 89 |
| 1129 | 3300045051 | Ga0451576_0892687 | Ga0451576_0892687_216_521 | 89 |
| 1130 | 3300045051 | Ga0451576_0995167 | Ga0451576_0995167_524_829 | 89 |
| 1131 | 3300045051 | Ga0451576_1973837 | Ga0451576_1973837_103_405 | 89 |
| 1132 | 3300045051 | Ga0451576_2301714 | Ga0451576_2301714_49_354 | 89 |
| 1133 | 3300045976 | Ga0466967_1716616 | Ga0466967_1716616_213_482 | 89 |
| 1134 | 3300045976 | Ga0466967_1954204 | Ga0466967_1954204_179_448 | 89 |
| 1135 | 3300046453 | Ga0495627_047044 | Ga0495627_047044_946_1251 | 89 |
| 1136 | 3300046454 | Ga0495592_0494464 | Ga0495592_0494464_180_485 | 89 |
| 1137 | 3300046455 | Ga0495603_0095784 | Ga0495603_0095784_1114_1419 | 89 |
| 1138 | 3300046459 | Ga0495629_0008006 | Ga0495629_0008006_723_992 | 89 |
| 1139 | 3300046459 | Ga0495629_0087873 | Ga0495629_0087873_1823_2128 | 89 |
| 1140 | 3300046461 | Ga0495641_0112411 | Ga0495641_0112411_566_835 | 89 |
| 1141 | 3300046462 | Ga0495651_0075629 | Ga0495651_0075629_1760_2065 | 89 |
| 1142 | 3300046472 | Ga0495580_0024838 | Ga0495580_0024838_2791_3096 | 89 |
| 1143 | 3300046472 | Ga0495580_0050998 | Ga0495580_0050998_1288_1593 | 89 |
| 1144 | 3300046472 | Ga0495580_0087842 | Ga0495580_0087842_1495_1800 | 89 |
| 1145 | 3300046472 | Ga0495580_0477228 | Ga0495580_0477228_443_748 | 89 |
| 1146 | 3300046473 | Ga0495582_0005514 | Ga0495582_0005514_5049_5354 | 89 |
| 1147 | 3300046473 | Ga0495582_0093504 | Ga0495582_0093504_1262_1531 | 89 |
| 1148 | 3300046475 | Ga0495639_0016200 | Ga0495639_0016200_524_829 | 89 |
| 1149 | 3300046476 | Ga0495662_0333812 | Ga0495662_0333812_369_674 | 89 |
| 1150 | 3300046477 | Ga0495664_0083745 | Ga0495664_0083745_1111_1416 | 89 |
| 1151 | 3300046506 | Ga0495583_0018179 | Ga0495583_0018179_1136_1405 | 89 |
| 1152 | 3300046516 | Ga0495628_0203969 | Ga0495628_0203969_320_625 | 89 |
| 1153 | 3300046519 | Ga0495632_0454162 | Ga0495632_0454162_75_344 | 89 |
| 1154 | 3300046526 | Ga0495666_0019131 | Ga0495666_0019131_2627_2932 | 89 |
| 1155 | 3300046526 | Ga0495666_0385723 | Ga0495666_0385723_20_325 | 89 |
| 1156 | 3300046531 | Ga0495665_0012732 | Ga0495665_0012732_4068_4373 | 89 |
| 1157 | 3300046531 | Ga0495665_0393199 | Ga0495665_0393199_220_525 | 89 |
| 1158 | 3300046535 | Ga0495586_0390632 | Ga0495586_0390632_422_727 | 89 |
| 1159 | 3300046536 | Ga0495587_0107233 | Ga0495587_0107233_602_907 | 89 |
| 1160 | 3300046538 | Ga0495609_0074311 | Ga0495609_0074311_63_332 | 89 |
| 1161 | 3300046543 | Ga0495645_0044382 | Ga0495645_0044382_1930_2235 | 89 |
| 1162 | 3300046557 | Ga0495622_0000035 | Ga0495622_0000035_33318_33587 | 89 |
| 1163 | 3300046557 | Ga0495622_0306889 | Ga0495622_0306889_114_419 | 89 |
| 1164 | 3300046559 | Ga0495667_0103714 | Ga0495667_0103714_178_483 | 89 |
| 1165 | 3300046616 | Ga0495668_0766092 | Ga0495668_0766092_94_399 | 89 |
| 1166 | 3300046642 | Ga0495634_0082715 | Ga0495634_0082715_1100_1405 | 89 |
| 1167 | 3300046642 | Ga0495634_0768214 | Ga0495634_0768214_184_453 | 89 |
| 1168 | 3300046648 | Ga0495611_0122748 | Ga0495611_0122748_836_1105 | 89 |
| 1169 | 3300046663 | Ga0495635_0028671 | Ga0495635_0028671_313_618 | 89 |
| 1170 | 3300046663 | Ga0495635_0880300 | Ga0495635_0880300_210_515 | 89 |
| 1171 | 3300046663 | Ga0495635_0997884 | Ga0495635_0997884_80_349 | 89 |
| 1172 | 3300046674 | Ga0495588_0000116 | Ga0495588_0000116_23805_24074 | 89 |
| 1173 | 3300046674 | Ga0495588_0146739 | Ga0495588_0146739_601_906 | 89 |
| 1174 | 3300046675 | Ga0495657_0163529 | Ga0495657_0163529_477_782 | 89 |
| 1175 | 3300046675 | Ga0495657_0296422 | Ga0495657_0296422_468_773 | 89 |
| 1176 | 3300046678 | Ga0495599_0424504 | Ga0495599_0424504_376_681 | 89 |
| 1177 | 3300046679 | Ga0495623_0328187 | Ga0495623_0328187_194_499 | 89 |
| 1178 | 3300046683 | Ga0495658_0001981 | Ga0495658_0001981_2460_2729 | 89 |
| 1179 | 3300046683 | Ga0495658_0004803 | Ga0495658_0004803_4068_4373 | 89 |
| 1180 | 3300046683 | Ga0495658_0726466 | Ga0495658_0726466_317_586 | 89 |
| 1181 | 3300046683 | Ga0495658_0777569 | Ga0495658_0777569_115_384 | 89 |
| 1182 | 3300046689 | Ga0495613_0007458 | Ga0495613_0007458_2323_2628 | 89 |
| 1183 | 3300046692 | Ga0495671_0080213 | Ga0495671_0080213_925_1194 | 89 |
| 1184 | 3300046692 | Ga0495671_0276630 | Ga0495671_0276630_261_530 | 89 |
| 1185 | 3300046694 | Ga0495649_0000182 | Ga0495649_0000182_11129_11398 | 89 |
| 1186 | 3300046809 | Ga0495600_0006859 | Ga0495600_0006859_337_606 | 89 |
| 1187 | 3300046809 | Ga0495600_0073547 | Ga0495600_0073547_1135_1440 | 89 |
| 1188 | 3300047315 | Ga0495581_0002892 | Ga0495581_0002892_6848_7153 | 89 |
| 1189 | 3300047317 | Ga0495604_0124498 | Ga0495604_0124498_514_819 | 89 |
| 1190 | 3300047319 | Ga0495674_0205458 | Ga0495674_0205458_1014_1319 | 89 |
| 1191 | 3300047320 | Ga0495672_0000016 | Ga0495672_0000016_36767_37036 | 89 |
| 1192 | 3300047320 | Ga0495672_0178980 | Ga0495672_0178980_31_300 | 89 |
| 1193 | 3300047320 | Ga0495672_0220012 | Ga0495672_0220012_457_726 | 89 |
| 1194 | 3300047320 | Ga0495672_0418254 | Ga0495672_0418254_187_456 | 89 |
| 1195 | 3300047321 | Ga0495676_0595134 | Ga0495676_0595134_226_495 | 89 |
| 1196 | 3300047444 | Ga0495675_0049040 | Ga0495675_0049040_283_588 | 89 |
| 1197 | 3300047445 | Ga0495677_0216334 | Ga0495677_0216334_367_636 | 89 |
| 1198 | 3300047470 | Ga0495681_0027011 | Ga0495681_0027011_1070_1375 | 89 |
| 1199 | 3300047470 | Ga0495681_0232862 | Ga0495681_0232862_301_570 | 89 |
| 1200 | 3300047471 | Ga0495684_0086399 | Ga0495684_0086399_888_1193 | 89 |
| 1201 | 3300047673 | Ga0495593_0036034 | Ga0495593_0036034_233_538 | 89 |
| 1202 | 3300048088 | Ga0495602_0271531 | Ga0495602_0271531_590_895 | 89 |
| 1203 | 3300048088 | Ga0495602_0377579 | Ga0495602_0377579_104_373 | 89 |
| 1204 | 3300048089 | Ga0495614_0034982 | Ga0495614_0034982_70_375 | 89 |
| 1205 | 3300048089 | Ga0495614_0084538 | Ga0495614_0084538_982_1251 | 89 |
| 1206 | 3300048903 | Ga0496100_0135185 | Ga0496100_0135185_1089_1394 | 89 |
| 1207 | 3300048903 | Ga0496100_0157178 | Ga0496100_0157178_1085_1390 | 89 |
| 1208 | 3300048903 | Ga0496100_0163979 | Ga0496100_0163979_465_734 | 89 |
| 1209 | 3300048904 | Ga0496101_0130394 | Ga0496101_0130394_736_1041 | 89 |
| 1210 | 3300048904 | Ga0496101_0606236 | Ga0496101_0606236_117_386 | 89 |
| 1211 | 3300048905 | Ga0496102_0024884 | Ga0496102_0024884_478_783 | 89 |
| 1212 | 3300048907 | Ga0496104_0015885 | Ga0496104_0015885_1190_1495 | 89 |
| 1213 | 3300048907 | Ga0496104_0284051 | Ga0496104_0284051_135_404 | 89 |
| 1214 | 3300048907 | Ga0496104_0716034 | Ga0496104_0716034_401_670 | 89 |
| 1215 | 3300048908 | Ga0496105_0097194 | Ga0496105_0097194_929_1234 | 89 |
| 1216 | 3300048908 | Ga0496105_0719108 | Ga0496105_0719108_342_611 | 89 |
| 1217 | 3300048909 | Ga0496106_0081553 | Ga0496106_0081553_1108_1413 | 89 |
| 1218 | 3300048910 | Ga0496107_0289122 | Ga0496107_0289122_185_490 | 89 |
| 1219 | 3300048910 | Ga0496107_0714590 | Ga0496107_0714590_360_665 | 89 |
| 1220 | 3300048910 | Ga0496107_0758955 | Ga0496107_0758955_72_377 | 89 |
| 1221 | 3300048911 | Ga0496108_0091599 | Ga0496108_0091599_2232_2537 | 89 |
| 1222 | 3300048911 | Ga0496108_0380138 | Ga0496108_0380138_113_418 | 89 |
| 1223 | 3300048911 | Ga0496108_1230186 | Ga0496108_1230186_189_494 | 89 |
| 1224 | 3300048911 | Ga0496108_1522713 | Ga0496108_1522713_76_345 | 89 |
| 1225 | 3300048912 | Ga0496109_0022741 | Ga0496109_0022741_2624_2929 | 89 |
| 1226 | 3300048912 | Ga0496109_1953823 | Ga0496109_1953823_150_455 | 89 |
| 1227 | 3300048913 | Ga0496110_1142387 | Ga0496110_1142387_121_426 | 89 |
| 1228 | 3300048915 | Ga0496112_0002149 | Ga0496112_0002149_8401_8670 | 89 |
| 1229 | 3300048915 | Ga0496112_0022409 | Ga0496112_0022409_2625_2930 | 89 |
| 1230 | 3300048915 | Ga0496112_0483582 | Ga0496112_0483582_196_501 | 89 |
| 1231 | 3300048915 | Ga0496112_0608066 | Ga0496112_0608066_408_677 | 89 |
| 1232 | 3300048916 | Ga0496113_0112570 | Ga0496113_0112570_654_959 | 89 |
| 1233 | 3300048916 | Ga0496113_0114796 | Ga0496113_0114796_329_634 | 89 |
| 1234 | 3300048916 | Ga0496113_1476942 | Ga0496113_1476942_52_321 | 89 |
| 1235 | 3300048917 | Ga0496114_0014567 | Ga0496114_0014567_2308_2613 | 89 |
| 1236 | 3300048917 | Ga0496114_0117322 | Ga0496114_0117322_160_465 | 89 |
| 1237 | 3300048917 | Ga0496114_1172215 | Ga0496114_1172215_232_537 | 89 |
| 1238 | 3300048918 | Ga0496115_0209364 | Ga0496115_0209364_301_606 | 89 |
| 1239 | 3300048928 | Ga0496125_0438035 | Ga0496125_0438035_227_496 | 89 |
| 1240 | 3300048929 | Ga0496126_0110593 | Ga0496126_0110593_605_874 | 89 |
| 1241 | 3300049161 | Ga0501305_026105 | Ga0501305_026105_34_339 | 89 |
| 1242 | 3300049521 | Ga0501298_011845 | Ga0501298_011845_400_705 | 89 |
| 1243 | 3300049522 | Ga0501299_012331 | Ga0501299_012331_971_1240 | 89 |
| 1244 | 3300049568 | Ga0501031_0004386 | Ga0501031_0004386_750_1019 | 89 |
| 1245 | 3300049568 | Ga0501031_0545012 | Ga0501031_0545012_278_583 | 89 |
| 1246 | 3300049569 | Ga0501032_0000394 | Ga0501032_0000394_1649_1918 | 89 |
| 1247 | 3300049570 | Ga0501033_0020233 | Ga0501033_0020233_4139_4444 | 89 |
| 1248 | 3300049571 | Ga0501034_0020539 | Ga0501034_0020539_2028_2297 | 89 |
| 1249 | 3300049571 | Ga0501034_0324359 | Ga0501034_0324359_656_925 | 89 |
| 1250 | 3300049571 | Ga0501034_1204950 | Ga0501034_1204950_285_554 | 89 |
| 1251 | 3300049571 | Ga0501034_1265307 | Ga0501034_1265307_28_297 | 89 |
| 1252 | 3300049572 | Ga0501036_0006553 | Ga0501036_0006553_6534_6839 | 89 |
| 1253 | 3300049572 | Ga0501036_0041349 | Ga0501036_0041349_1535_1840 | 89 |
| 1254 | 3300049572 | Ga0501036_0058031 | Ga0501036_0058031_392_661 | 89 |
| 1255 | 3300049573 | Ga0501037_0000133 | Ga0501037_0000133_36215_36484 | 89 |
| 1256 | 3300049573 | Ga0501037_0172677 | Ga0501037_0172677_987_1292 | 89 |
| 1257 | 3300049573 | Ga0501037_0254096 | Ga0501037_0254096_397_666 | 89 |
| 1258 | 3300049573 | Ga0501037_0271907 | Ga0501037_0271907_270_539 | 89 |
| 1259 | 3300049574 | Ga0501038_0023933 | Ga0501038_0023933_3377_3646 | 89 |
| 1260 | 3300049574 | Ga0501038_0200854 | Ga0501038_0200854_1012_1317 | 89 |
| 1261 | 3300049575 | Ga0501039_0033552 | Ga0501039_0033552_3132_3437 | 89 |
| 1262 | 3300049575 | Ga0501039_0602411 | Ga0501039_0602411_347_616 | 89 |
| 1263 | 3300049576 | Ga0501040_0067749 | Ga0501040_0067749_2056_2361 | 89 |
| 1264 | 3300049577 | Ga0501041_0003344 | Ga0501041_0003344_5120_5425 | 89 |
| 1265 | 3300049578 | Ga0501042_0009869 | Ga0501042_0009869_3264_3569 | 89 |
| 1266 | 3300049578 | Ga0501042_0279825 | Ga0501042_0279825_169_438 | 89 |
| 1267 | 3300049579 | Ga0501043_0000404 | Ga0501043_0000404_35384_35653 | 89 |
| 1268 | 3300049580 | Ga0501046_0000038 | Ga0501046_0000038_113705_113974 | 89 |
| 1269 | 3300049580 | Ga0501046_0179631 | Ga0501046_0179631_220_525 | 89 |
| 1270 | 3300049581 | Ga0501047_0006066 | Ga0501047_0006066_5684_5953 | 89 |
| 1271 | 3300049581 | Ga0501047_1050570 | Ga0501047_1050570_123_392 | 89 |
| 1272 | 3300049582 | Ga0501048_0000033 | Ga0501048_0000033_50589_50858 | 89 |
| 1273 | 3300049582 | Ga0501048_0426138 | Ga0501048_0426138_603_872 | 89 |
| 1274 | 3300049582 | Ga0501048_0590393 | Ga0501048_0590393_473_778 | 89 |
| 1275 | 3300049584 | Ga0501068_0320666 | Ga0501068_0320666_313_618 | 89 |
| 1276 | 3300049585 | Ga0501069_0338998 | Ga0501069_0338998_533_802 | 89 |
| 1277 | 3300049585 | Ga0501069_0621482 | Ga0501069_0621482_156_461 | 89 |
| 1278 | 3300049586 | Ga0501070_0035569 | Ga0501070_0035569_526_831 | 89 |
| 1279 | 3300049586 | Ga0501070_0044881 | Ga0501070_0044881_2353_2658 | 89 |
| 1280 | 3300049586 | Ga0501070_0079948 | Ga0501070_0079948_837_1106 | 89 |
| 1281 | 3300049586 | Ga0501070_0330131 | Ga0501070_0330131_487_756 | 89 |
| 1282 | 3300049586 | Ga0501070_0427853 | Ga0501070_0427853_35_304 | 89 |
| 1283 | 3300049587 | Ga0501071_0102836 | Ga0501071_0102836_107_412 | 89 |
| 1284 | 3300049587 | Ga0501071_0114002 | Ga0501071_0114002_389_694 | 89 |
| 1285 | 3300049587 | Ga0501071_1056501 | Ga0501071_1056501_136_405 | 89 |
| 1286 | 3300049587 | Ga0501071_1170168 | Ga0501071_1170168_163_468 | 89 |
| 1287 | 3300049588 | Ga0501072_0327339 | Ga0501072_0327339_408_713 | 89 |
| 1288 | 3300049589 | Ga0501073_0012572 | Ga0501073_0012572_2923_3192 | 89 |
| 1289 | 3300049589 | Ga0501073_0038822 | Ga0501073_0038822_641_946 | 89 |
| 1290 | 3300049589 | Ga0501073_0125551 | Ga0501073_0125551_225_494 | 89 |
| 1291 | 3300049589 | Ga0501073_0198652 | Ga0501073_0198652_301_606 | 89 |
| 1292 | 3300049589 | Ga0501073_0713056 | Ga0501073_0713056_361_630 | 89 |
| 1293 | 3300049590 | Ga0501074_0018349 | Ga0501074_0018349_2163_2468 | 89 |
| 1294 | 3300049590 | Ga0501074_0775032 | Ga0501074_0775032_361_666 | 89 |
| 1295 | 3300049590 | Ga0501074_1151784 | Ga0501074_1151784_162_467 | 89 |
| 1296 | 3300049591 | Ga0501075_0003793 | Ga0501075_0003793_5315_5620 | 89 |
| 1297 | 3300049591 | Ga0501075_0290534 | Ga0501075_0290534_244_549 | 89 |
| 1298 | 3300049592 | Ga0501076_0000663 | Ga0501076_0000663_7512_7817 | 89 |
| 1299 | 3300049592 | Ga0501076_0046380 | Ga0501076_0046380_1990_2295 | 89 |
| 1300 | 3300049593 | Ga0501077_0049998 | Ga0501077_0049998_535_840 | 89 |
| 1301 | 3300049593 | Ga0501077_0209868 | Ga0501077_0209868_734_1039 | 89 |
| 1302 | 3300049741 | Ga0501079_0015785 | Ga0501079_0015785_3189_3494 | 89 |
| 1303 | 3300049741 | Ga0501079_0160362 | Ga0501079_0160362_930_1235 | 89 |
| 1304 | 3300049741 | Ga0501079_0508395 | Ga0501079_0508395_57_362 | 89 |
| 1305 | 3300049742 | Ga0501080_0001402 | Ga0501080_0001402_7175_7444 | 89 |
| 1306 | 3300049742 | Ga0501080_0005999 | Ga0501080_0005999_7304_7609 | 89 |
| 1307 | 3300049742 | Ga0501080_0028144 | Ga0501080_0028144_2595_2900 | 89 |
| 1308 | 3300049742 | Ga0501080_0030200 | Ga0501080_0030200_623_892 | 89 |
| 1309 | 3300049742 | Ga0501080_0588692 | Ga0501080_0588692_429_698 | 89 |
| 1310 | 3300049743 | Ga0501081_0014826 | Ga0501081_0014826_1295_1600 | 89 |
| 1311 | 3300049744 | Ga0501083_0014244 | Ga0501083_0014244_4531_4800 | 89 |
| 1312 | 3300049744 | Ga0501083_0026580 | Ga0501083_0026580_329_598 | 89 |
| 1313 | 3300049744 | Ga0501083_0143087 | Ga0501083_0143087_924_1229 | 89 |
| 1314 | 3300049773 | Ga0501276_001027 | Ga0501276_001027_1067_1336 | 89 |
| 1315 | 3300049822 | Ga0501035_0000562 | Ga0501035_0000562_39314_39583 | 89 |
| 1316 | 3300049822 | Ga0501035_0263579 | Ga0501035_0263579_736_1041 | 89 |
| 1317 | 3300049823 | Ga0501044_0028311 | Ga0501044_0028311_3344_3613 | 89 |
| 1318 | 3300049824 | Ga0501045_0003651 | Ga0501045_0003651_3314_3619 | 89 |
| 1319 | 3300049824 | Ga0501045_0089934 | Ga0501045_0089934_1439_1744 | 89 |
| 1320 | 3300050489 | nmdc:mga03683_66_c2 | nmdc:mga03683_66_c2_1315_1584 | 89 |
| 1321 | 3300050490 | nmdc:mga03n38_19_c1 | nmdc:mga03n38_19_c1_7938_8207 | 89 |
| 1322 | 3300050490 | nmdc:mga03n38_78327_c1 | nmdc:mga03n38_78327_c1_626_895 | 89 |
| 1323 | 3300050491 | nmdc:mga00v17_1041970_c1 | nmdc:mga00v17_1041970_c1_170_439 | 89 |
| 1324 | 3300050491 | nmdc:mga00v17_145_c1 | nmdc:mga00v17_145_c1_5484_5753 | 89 |
| 1325 | 3300050491 | nmdc:mga00v17_196366_c1 | nmdc:mga00v17_196366_c1_387_656 | 89 |
| 1326 | 3300050491 | nmdc:mga00v17_33755_c1 | nmdc:mga00v17_33755_c1_977_1246 | 89 |
| 1327 | 3300050491 | nmdc:mga00v17_420686_c1 | nmdc:mga00v17_420686_c1_23_292 | 89 |
| 1328 | 3300050491 | nmdc:mga00v17_6642_c1 | nmdc:mga00v17_6642_c1_2980_3249 | 89 |
| 1329 | 3300050491 | nmdc:mga00v17_67056_c1 | nmdc:mga00v17_67056_c1_733_1002 | 89 |
| 1330 | 3300050491 | nmdc:mga00v17_857_c1 | nmdc:mga00v17_857_c1_8155_8433 | 89 |
| 1331 | 3300050491 | nmdc:mga00v17_9991_c1 | nmdc:mga00v17_9991_c1_2618_2887 | 89 |
| 1332 | 3300050492 | nmdc:mga0yw44_100296_c1 | nmdc:mga0yw44_100296_c1_516_785 | 89 |
| 1333 | 3300050492 | nmdc:mga0yw44_192268_c1 | nmdc:mga0yw44_192268_c1_206_547 | 89 |
| 1334 | 3300050492 | nmdc:mga0yw44_24_c1 | nmdc:mga0yw44_24_c1_3450_3728 | 89 |
| 1335 | 3300050492 | nmdc:mga0yw44_2_c1 | nmdc:mga0yw44_2_c1_297911_298180 | 89 |
| 1336 | 3300050492 | nmdc:mga0yw44_391363_c1 | nmdc:mga0yw44_391363_c1_258_527 | 89 |
| 1337 | 3300050492 | nmdc:mga0yw44_6972_c1 | nmdc:mga0yw44_6972_c1_4293_4562 | 89 |
| 1338 | 3300050493 | nmdc:mga0k408_142831_c1 | nmdc:mga0k408_142831_c1_521_790 | 89 |
| 1339 | 3300050493 | nmdc:mga0k408_144_c1 | nmdc:mga0k408_144_c1_3087_3356 | 89 |
| 1340 | 3300050493 | nmdc:mga0k408_1480_c1 | nmdc:mga0k408_1480_c1_7558_7827 | 89 |
| 1341 | 3300050493 | nmdc:mga0k408_14_c3 | nmdc:mga0k408_14_c3_33822_34091 | 89 |
| 1342 | 3300050493 | nmdc:mga0k408_165086_c1 | nmdc:mga0k408_165086_c1_396_665 | 89 |
| 1343 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_741754_742023 | 89 |
| 1344 | 3300050493 | nmdc:mga0k408_24_c2 | nmdc:mga0k408_24_c2_60052_60321 | 89 |
| 1345 | 3300050493 | nmdc:mga0k408_6815_c1 | nmdc:mga0k408_6815_c1_441_710 | 89 |
| 1346 | 3300050493 | nmdc:mga0k408_78109_c1 | nmdc:mga0k408_78109_c1_587_892 | 89 |
| 1347 | 3300050494 | nmdc:mga06z11_14_c1 | nmdc:mga06z11_14_c1_33076_33345 | 89 |
| 1348 | 3300050494 | nmdc:mga06z11_53_c2 | nmdc:mga06z11_53_c2_1939_2208 | 89 |
| 1349 | 3300050495 | nmdc:mga04h51_10_c1 | nmdc:mga04h51_10_c1_33953_34222 | 89 |
| 1350 | 3300050496 | nmdc:mga07m45_2913_c1 | nmdc:mga07m45_2913_c1_1312_1581 | 89 |
| 1351 | 3300050496 | nmdc:mga07m45_303921_c1 | nmdc:mga07m45_303921_c1_487_756 | 89 |
| 1352 | 3300050496 | nmdc:mga07m45_353018_c1 | nmdc:mga07m45_353018_c1_68_373 | 89 |
| 1353 | 3300050496 | nmdc:mga07m45_494652_c1 | nmdc:mga07m45_494652_c1_365_634 | 89 |
| 1354 | 3300050496 | nmdc:mga07m45_647256_c1 | nmdc:mga07m45_647256_c1_314_583 | 89 |
| 1355 | 3300050496 | nmdc:mga07m45_72126_c1 | nmdc:mga07m45_72126_c1_1059_1328 | 89 |
| 1356 | 3300050507 | nmdc:mga05p37_167955_c1 | nmdc:mga05p37_167955_c1_1980_2285 | 89 |
| 1357 | 3300050509 | nmdc:mga0qj67_29906_c1 | nmdc:mga0qj67_29906_c1_1256_1525 | 89 |
| 1358 | 3300050509 | nmdc:mga0qj67_48239_c1 | nmdc:mga0qj67_48239_c1_2661_2930 | 89 |
| 1359 | 3300050511 | nmdc:mga08y16_21258_c1 | nmdc:mga08y16_21258_c1_4287_4556 | 89 |
| 1360 | 3300050512 | nmdc:mga0n895_111604_c1 | nmdc:mga0n895_111604_c1_1905_2210 | 89 |
| 1361 | 3300050512 | nmdc:mga0n895_1812005_c1 | nmdc:mga0n895_1812005_c1_77_382 | 89 |
| 1362 | 3300050512 | nmdc:mga0n895_259430_c1 | nmdc:mga0n895_259430_c1_580_885 | 89 |
| 1363 | 3300050512 | nmdc:mga0n895_71889_c1 | nmdc:mga0n895_71889_c1_2474_2779 | 89 |
| 1364 | 3300050512 | nmdc:mga0n895_944918_c1 | nmdc:mga0n895_944918_c1_377_682 | 89 |
| 1365 | 3300050513 | nmdc:mga0rr50_1501726_c1 | nmdc:mga0rr50_1501726_c1_89_394 | 89 |
| 1366 | 3300050513 | nmdc:mga0rr50_302106_c1 | nmdc:mga0rr50_302106_c1_255_560 | 89 |
| 1367 | 3300050513 | nmdc:mga0rr50_32159_c1 | nmdc:mga0rr50_32159_c1_725_1030 | 89 |
| 1368 | 3300050513 | nmdc:mga0rr50_34673_c1 | nmdc:mga0rr50_34673_c1_990_1295 | 89 |
| 1369 | 3300050514 | nmdc:mga08x19_141689_c1 | nmdc:mga08x19_141689_c1_1255_1560 | 89 |
| 1370 | 3300050514 | nmdc:mga08x19_52009_c1 | nmdc:mga08x19_52009_c1_842_1147 | 89 |
| 1371 | 3300050514 | nmdc:mga08x19_65848_c1 | nmdc:mga08x19_65848_c1_83_388 | 89 |
| 1372 | 3300050515 | nmdc:mga0a205_28754_c1 | nmdc:mga0a205_28754_c1_2289_2594 | 89 |
| 1373 | 3300050515 | nmdc:mga0a205_858248_c1 | nmdc:mga0a205_858248_c1_368_673 | 89 |
| 1374 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_316852_317121 | 89 |
| 1375 | 3300050516 | nmdc:mga0sz30_30554_c1 | nmdc:mga0sz30_30554_c1_945_1214 | 89 |
| 1376 | 3300050516 | nmdc:mga0sz30_460715_c1 | nmdc:mga0sz30_460715_c1_55_333 | 89 |
| 1377 | 3300050516 | nmdc:mga0sz30_8_c1 | nmdc:mga0sz30_8_c1_107585_107854 | 89 |
| 1378 | 3300050516 | nmdc:mga0sz30_96240_c1 | nmdc:mga0sz30_96240_c1_184_453 | 89 |
| 1379 | 3300053077 | Ga0495601_0498313 | Ga0495601_0498313_55_360 | 89 |
| 1380 | 3300053078 | Ga0495612_0049342 | Ga0495612_0049342_771_1076 | 89 |
| 1381 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_51630_51899 | 89 |
| 1382 | 3300053079 | Ga0500610_0024857 | Ga0500610_0024857_1870_2139 | 89 |
| 1383 | 3300053079 | Ga0500610_0160911 | Ga0500610_0160911_340_609 | 89 |
| 1384 | 3300053083 | Ga0495655_0065643 | Ga0495655_0065643_558_863 | 89 |
| 1385 | 3300053085 | Ga0495619_0004860 | Ga0495619_0004860_6313_6618 | 89 |
| 1386 | 3300053085 | Ga0495619_0012469 | Ga0495619_0012469_1210_1515 | 89 |
| 1387 | 3300053087 | Ga0500643_000010 | Ga0500643_000010_332817_333086 | 89 |
| 1388 | 3300053087 | Ga0500643_000038 | Ga0500643_000038_137285_137554 | 89 |
| 1389 | 3300053087 | Ga0500643_007309 | Ga0500643_007309_2251_2520 | 89 |
| 1390 | 3300053088 | Ga0500644_0000365 | Ga0500644_0000365_7547_7816 | 89 |
| 1391 | 3300053088 | Ga0500644_0000636 | Ga0500644_0000636_1882_2151 | 89 |
| 1392 | 3300053088 | Ga0500644_0001805 | Ga0500644_0001805_2303_2572 | 89 |
| 1393 | 3300053088 | Ga0500644_0019854 | Ga0500644_0019854_115_384 | 89 |
| 1394 | 3300053090 | Ga0500646_0000823 | Ga0500646_0000823_3149_3418 | 89 |
| 1395 | 3300053092 | Ga0500583_0000067 | Ga0500583_0000067_5498_5767 | 89 |
| 1396 | 3300053092 | Ga0500583_0002599 | Ga0500583_0002599_2412_2681 | 89 |
| 1397 | 3300053092 | Ga0500583_0015393 | Ga0500583_0015393_1423_1692 | 89 |
| 1398 | 3300053092 | Ga0500583_0069456 | Ga0500583_0069456_460_729 | 89 |
| 1399 | 3300053093 | Ga0500651_0000416 | Ga0500651_0000416_18380_18649 | 89 |
| 1400 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_679636_679905 | 89 |
| 1401 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_521647_521916 | 89 |
| 1402 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_801435_801704 | 89 |
| 1403 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_466950_467219 | 89 |
| 1404 | 3300053103 | Ga0500555_007840 | Ga0500555_007840_483_752 | 89 |
| 1405 | 3300053103 | Ga0500555_022461 | Ga0500555_022461_747_1016 | 89 |
| 1406 | 3300053104 | Ga0500556_0000829 | Ga0500556_0000829_14842_15111 | 89 |
| 1407 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_941749_942018 | 89 |
| 1408 | 3300053108 | Ga0500562_004964 | Ga0500562_004964_2234_2503 | 89 |
| 1409 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_5764_6033 | 89 |
| 1410 | 3300053118 | Ga0500594_0000139 | Ga0500594_0000139_6840_7109 | 89 |
| 1411 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_226281_226550 | 89 |
| 1412 | 3300053123 | Ga0500614_002410 | Ga0500614_002410_1519_1788 | 89 |
| 1413 | 3300053123 | Ga0500614_014092 | Ga0500614_014092_201_470 | 89 |
| 1414 | 3300053129 | Ga0500628_000006 | Ga0500628_000006_142864_143133 | 89 |
| 1415 | 3300053129 | Ga0500628_001507 | Ga0500628_001507_2141_2410 | 89 |
| 1416 | 3300053130 | Ga0500642_0002538 | Ga0500642_0002538_3965_4234 | 89 |
| 1417 | 3300053131 | Ga0500652_000084 | Ga0500652_000084_25300_25569 | 89 |
| 1418 | 3300053133 | Ga0500655_001993 | Ga0500655_001993_1841_2110 | 89 |
| 1419 | 3300053136 | Ga0500559_0015490 | Ga0500559_0015490_127_396 | 89 |
| 1420 | 3300053137 | Ga0500561_0000001 | Ga0500561_0000001_529888_530157 | 89 |
| 1421 | 3300053139 | Ga0500568_0011040 | Ga0500568_0011040_2699_2968 | 89 |
| 1422 | 3300053139 | Ga0500568_0014440 | Ga0500568_0014440_1304_1573 | 89 |
| 1423 | 3300053139 | Ga0500568_0066436 | Ga0500568_0066436_58_327 | 89 |
| 1424 | 3300053141 | Ga0500574_083757 | Ga0500574_083757_128_397 | 89 |
| 1425 | 3300053142 | Ga0500577_0000514 | Ga0500577_0000514_4599_4868 | 89 |
| 1426 | 3300053142 | Ga0500577_0021093 | Ga0500577_0021093_1171_1440 | 89 |
| 1427 | 3300053143 | Ga0500579_016957 | Ga0500579_016957_1894_2163 | 89 |
| 1428 | 3300053147 | Ga0500589_000008 | Ga0500589_000008_31741_32010 | 89 |
| 1429 | 3300053147 | Ga0500589_099901 | Ga0500589_099901_740_1009 | 89 |
| 1430 | 3300053149 | Ga0500600_0114189 | Ga0500600_0114189_200_505 | 89 |
| 1431 | 3300053150 | Ga0500603_138389 | Ga0500603_138389_89_358 | 89 |
| 1432 | 3300053151 | Ga0500604_0010658 | Ga0500604_0010658_1918_2187 | 89 |
| 1433 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_398686_398955 | 89 |
| 1434 | 3300053156 | Ga0500622_0000002 | Ga0500622_0000002_6724_7029 | 89 |
| 1435 | 3300053160 | Ga0500633_0014746 | Ga0500633_0014746_44_313 | 89 |
| 1436 | 3300053722 | Ga0500649_000014 | Ga0500649_000014_26665_26934 | 89 |
| 1437 | 3300053724 | Ga0500570_000045 | Ga0500570_000045_18826_19095 | 89 |
| 1438 | 3300053727 | Ga0500611_008584 | Ga0500611_008584_924_1193 | 89 |
| 1439 | 3300053727 | Ga0500611_009762 | Ga0500611_009762_649_918 | 89 |
| 1440 | 3300054114 | Ga0501084_0018257 | Ga0501084_0018257_3974_4279 | 89 |
| 1441 | 3300054114 | Ga0501084_0502704 | Ga0501084_0502704_699_1004 | 89 |
| 1442 | 3300059505 | Ga0587083_0181080 | Ga0587083_0181080_167_472 | 89 |
| 1443 | 3300059506 | Ga0587085_104013 | Ga0587085_104013_24_329 | 89 |
| 1444 | 3300059624 | Ga0587109_016406 | Ga0587109_016406_117_422 | 89 |
| 1445 | 3300060344 | Ga0587071_052725 | Ga0587071_052725_416_721 | 89 |
| 1446 | 3300060346 | Ga0587111_0042374 | Ga0587111_0042374_268_573 | 89 |
| 1447 | 3300060353 | Ga0501082_0008910 | Ga0501082_0008910_1206_1511 | 89 |
| 1448 | 3300060353 | Ga0501082_0226637 | Ga0501082_0226637_469_738 | 89 |
| 1449 | 3300061734 | Ga0530510_0006785 | Ga0530510_0006785_6972_7277 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5aj3-assembly1.cif.gz_N | structure of the small subunit of the mammalian mitoribosome | 0.8592 | 7 | 89 |
| 8any-assembly1.cif.gz_AK | human mitochondrial ribosome in complex with lrpprc, slirp, a-site, p-site, e-site trnas and mrna | 0.8582 | 7 | 89 |
| 7a5g-assembly1.cif.gz_K6 | structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna | 0.8525 | 7 | 89 |
| 7nql-assembly1.cif.gz_AN | 55s mammalian mitochondrial ribosome with ict1 and p site trnamet | 0.8513 | 7 | 89 |
| 7pnu-assembly1.cif.gz_K | assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa inward conformation | 0.849 | 7 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5AJZ7_16_105_1.10.287.1480 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8768 | 6 | 79 | 1.10.287.1480 |
| af_Q8IHZ0_73_161_1.10.287.1480 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8747 | 1 | 77 | 1.10.287.1480 |
| af_O42859_6_94_1.10.287.1480 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8739 | 6 | 77 | 1.10.287.1480 |
| af_Q2FYU5_1_89_1.10.287.1480 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8606 | 1 | 89 | 1.10.287.1480 |
| af_B2RYT4_28_118_1.10.287.1480 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8583 | 1 | 79 | 1.10.287.1480 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7Z851-F1-model_v4 | deleted | 0.9387 | 1 | 49 |
|
| AF-A0A317ZBY6-F1-model_v4 | Small ribosomal subunit protein uS14 | 0.9103 | 16 | 83 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A8B4HQ36-F1-model_v4 | deleted | 0.9082 | 1 | 89 |
|
| AF-A0A7R9A0Z6-F1-model_v4 | Uncharacterized protein | 0.9062 | 1 | 80 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 |
| AF-A0A7S2ZU28-F1-model_v4 | Ribosomal protein S14 | 0.9052 | 10 | 84 |
GO:0003735
GO:0005763 GO:0006412 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar