F493855

General Info

Members Datasets Scaffolds Average Seq Length
1424 395 1421 212

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10436653|Ga0207689_104366531
Length 262
Sequence MELKLFFQKYFHFILFSLLFNLFFIASHAQGFLKTDGKRIVNEKGENILLRGMKSYEKLLSENKEWAQEKIKDDPEFFKRLSSLQTPEFLWIGCSDSRVPADMITGTQPGEIFVHRNIANLVVNTDINLLSVLQYAVEVLKVKHVIVCGHYGCGGIKAAMNQHYYGIIDHWLKNIKDIYRFHRKEIDAIETIDKRADRLTELNVQEQVFNLAKTSTIQAAWKNEKRPNLHGWVYGLENGIIKPVCEMQAGSPLDPLYEYDNI

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
206 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
226 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
230 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
235 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
236 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
306 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
307 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
308 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
309 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
324 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
329 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
330 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
331 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
332 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
333 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
334 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
335 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
336 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
337 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
338 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
339 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
340 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
341 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
342 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
343 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
344 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
345 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
346 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
347 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
348 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
349 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
350 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
351 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
352 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
356 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
357 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
358 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
359 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
360 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
365 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
374 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
379 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
380 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
392 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.21
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 0.98
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c001528 3300000043 Unclassified 2541
2 ARCol0yngRDRAFT_1002643 3300000652 Unclassified 1342
3 JGI24740J21852_10033948 3300001979 Bacteria 1613
4 JGI24739J22299_10115992 3300001989 Bacteria 802
5 JGI24033J26618_1011494 3300002155 Bacteria 1056
6 JGI24751J29686_10001010 3300002459 Bacteria 6178
7 JGI25406J46586_10002282 3300003203 Bacteria 9046
8 rootH2_10006463 3300003320 Bacteria 45674
9 rootH2_10012033 3300003320 Bacteria 19273
10 rootH2_10013353 3300003320 Bacteria 1925
11 rootH2_10019419 3300003320 Bacteria 55511
12 rootH2_10045629 3300003320 Bacteria 6173
13 rootH2_10066424 3300003320 Bacteria 7314
14 rootH2_10145428 3300003320 Bacteria 1990
15 rootL2_10002424 3300003322 Bacteria 4154
16 rootL2_10009909 3300003322 Bacteria 8338
17 rootL2_10067318 3300003322 Bacteria 2680
18 rootL2_10089602 3300003322 Bacteria 1138
19 rootL2_10174911 3300003322 Bacteria 5204
20 rootH1_10003786 3300003323 Bacteria 15329
21 rootH1_10007189 3300003323 Bacteria 65578
22 rootH1_10363632 3300003323 Bacteria 1508
23 JGI25160J50197_1002393 3300003354 Bacteria 8746
24 Ga0065714_10130093 3300005288 Bacteria 1258
25 Ga0065704_10121980 3300005289 Unclassified 1757
26 Ga0065712_10002378 3300005290 Bacteria 7684
27 Ga0065712_10069198 3300005290 Bacteria 7762
28 Ga0065712_10151155 3300005290 Bacteria 1368
29 Ga0065712_10317038 3300005290 Bacteria 834
30 Ga0065712_10344157 3300005290 Bacteria 796
31 Ga0065715_10094036 3300005293 Bacteria 4463
32 Ga0065715_10277639 3300005293 Bacteria 1094
33 Ga0065715_10434745 3300005293 Bacteria 837
34 Ga0065707_10083736 3300005295 Bacteria 8323
35 Ga0065707_10225606 3300005295 Bacteria 1202
36 Ga0065707_10260657 3300005295 Bacteria 1098
37 Ga0070658_10079333 3300005327 Bacteria 2695
38 Ga0070658_10120126 3300005327 Unclassified 2183
39 Ga0070658_10224038 3300005327 Bacteria 1591
40 Ga0070658_10277542 3300005327 Bacteria 1426
41 Ga0070658_10317008 3300005327 Unclassified 1331
42 Ga0070658_10485452 3300005327 Bacteria 1066
43 Ga0070676_10002040 3300005328 Bacteria 10262
44 Ga0070676_10009660 3300005328 Bacteria 5216
45 Ga0070676_10011593 3300005328 Bacteria 4795
46 Ga0070676_10057171 3300005328 Bacteria 2308
47 Ga0070676_10208428 3300005328 Bacteria 1285
48 Ga0070683_100000201 3300005329 Bacteria 40257
49 Ga0070683_100007891 3300005329 Bacteria 9021
50 Ga0070683_100043907 3300005329 Bacteria 4120
51 Ga0070683_100044982 3300005329 Bacteria 4074
52 Ga0070683_100150980 3300005329 Bacteria 2203
53 Ga0070683_100170944 3300005329 Bacteria 2063
54 Ga0070683_100193335 3300005329 Bacteria 1932
55 Ga0070683_100196357 3300005329 Unclassified 1916
56 Ga0070683_100259395 3300005329 Bacteria 1653
57 Ga0070683_100820475 3300005329 Bacteria 892
58 Ga0070690_100001766 3300005330 Bacteria 11433
59 Ga0070690_100017579 3300005330 Bacteria 4304
60 Ga0070690_100051835 3300005330 Bacteria 2621
61 Ga0070670_100010145 3300005331 Bacteria 8036
62 Ga0070670_100022437 3300005331 Bacteria 5433
63 Ga0070670_100037015 3300005331 Bacteria 4198
64 Ga0070670_100074497 3300005331 Bacteria 2916
65 Ga0070670_100137559 3300005331 Unclassified 2111
66 Ga0070670_100145553 3300005331 Unclassified 2050
67 Ga0070670_100229898 3300005331 Bacteria 1614
68 Ga0070670_100252418 3300005331 Bacteria 1537
69 Ga0070670_100261747 3300005331 Bacteria 1508
70 Ga0070670_100266292 3300005331 Bacteria 1495
71 Ga0070670_100403953 3300005331 Bacteria 1206
72 Ga0070670_100476925 3300005331 Bacteria 1108
73 Ga0070670_100510075 3300005331 Bacteria 1070
74 Ga0070670_100530745 3300005331 Bacteria 1049
75 Ga0068869_100002336 3300005334 Bacteria 11408
76 Ga0068869_100005789 3300005334 Bacteria 7798
77 Ga0068869_100021438 3300005334 Bacteria 4445
78 Ga0068869_100038116 3300005334 Bacteria 3422
79 Ga0068869_100079898 3300005334 Unclassified 2438
80 Ga0068869_100112598 3300005334 Bacteria 2072
81 Ga0068869_100418445 3300005334 Bacteria 1105
82 Ga0068869_100449976 3300005334 Bacteria 1067
83 Ga0068869_100504825 3300005334 Bacteria 1010
84 Ga0068869_100517964 3300005334 Bacteria 998
85 Ga0070666_10000096 3300005335 Bacteria 60717
86 Ga0070666_10001692 3300005335 Bacteria 13450
87 Ga0070666_10040614 3300005335 Bacteria 3105
88 Ga0070666_10058659 3300005335 Bacteria 2603
89 Ga0070666_10368859 3300005335 Bacteria 1029
90 Ga0070680_100000160 3300005336 Bacteria 42287
91 Ga0070680_100084728 3300005336 Bacteria 2618
92 Ga0070680_100249758 3300005336 Bacteria 1500
93 Ga0070682_100000012 3300005337 Bacteria 265658
94 Ga0070682_100000504 3300005337 Bacteria 24569
95 Ga0070682_100011516 3300005337 Bacteria 5056
96 Ga0070682_100019906 3300005337 Bacteria 3942
97 Ga0070682_100037628 3300005337 Bacteria 2964
98 Ga0070682_100058138 3300005337 Bacteria 2438
99 Ga0070682_100220352 3300005337 Bacteria 1350
100 Ga0070682_100286318 3300005337 Bacteria 1203
101 Ga0068868_100001409 3300005338 Bacteria 16571
102 Ga0068868_100002287 3300005338 Bacteria 13245
103 Ga0068868_100015238 3300005338 Bacteria 5682
104 Ga0068868_100053775 3300005338 Bacteria 3172
105 Ga0068868_100117014 3300005338 Bacteria 2171
106 Ga0068868_100151765 3300005338 Bacteria 1908
107 Ga0068868_100219473 3300005338 Bacteria 1591
108 Ga0068868_100394923 3300005338 Unclassified 1192
109 Ga0068868_100717835 3300005338 Bacteria 895
110 Ga0068868_100930606 3300005338 Bacteria 791
111 Ga0070660_100140793 3300005339 Bacteria 1935
112 Ga0070689_100005603 3300005340 Bacteria 8592
113 Ga0070689_100006510 3300005340 Bacteria 8096
114 Ga0070689_100021895 3300005340 Bacteria 4764
115 Ga0070689_100113914 3300005340 Bacteria 2154
116 Ga0070689_100125964 3300005340 Bacteria 2050
117 Ga0070689_100146202 3300005340 Bacteria 1904
118 Ga0070691_10002266 3300005341 Bacteria 8520
119 Ga0070691_10027775 3300005341 Bacteria 2641
120 Ga0070687_100084654 3300005343 Bacteria 1738
121 Ga0070687_100114969 3300005343 Bacteria 1529
122 Ga0070687_100237090 3300005343 Bacteria 1126
123 Ga0070661_100001257 3300005344 Bacteria 17801
124 Ga0070661_100009173 3300005344 Bacteria 6838
125 Ga0070661_100019696 3300005344 Bacteria 4808
126 Ga0070661_100252700 3300005344 Unclassified 1361
127 Ga0070661_100527248 3300005344 Bacteria 948
128 Ga0070668_100054460 3300005347 Bacteria 3085
129 Ga0070668_100193124 3300005347 Bacteria 1668
130 Ga0070668_100332296 3300005347 Bacteria 1282
131 Ga0070668_100740936 3300005347 Bacteria 869
132 Ga0070668_101022226 3300005347 Bacteria 743
133 Ga0070669_100008525 3300005353 Bacteria 7318
134 Ga0070669_100104509 3300005353 Unclassified 2141
135 Ga0070669_100177364 3300005353 Bacteria 1665
136 Ga0070669_100263259 3300005353 Unclassified 1377
137 Ga0070669_100285337 3300005353 Bacteria 1324
138 Ga0070669_100382556 3300005353 Bacteria 1148
139 Ga0070669_100510285 3300005353 Bacteria 998
140 Ga0070669_100692341 3300005353 Bacteria 860
141 Ga0070675_100019423 3300005354 Bacteria 5416
142 Ga0070675_100037861 3300005354 Bacteria 3931
143 Ga0070675_100086307 3300005354 Bacteria 2623
144 Ga0070675_100095295 3300005354 Bacteria 2499
145 Ga0070675_100133817 3300005354 Bacteria 2115
146 Ga0070675_100166494 3300005354 Unclassified 1899
147 Ga0070675_100221299 3300005354 Bacteria 1648
148 Ga0070675_100357528 3300005354 Bacteria 1296
149 Ga0070671_100020108 3300005355 Bacteria 5441
150 Ga0070671_100030491 3300005355 Bacteria 4450
151 Ga0070671_100032518 3300005355 Bacteria 4312
152 Ga0070671_100196212 3300005355 Bacteria 1711
153 Ga0070671_100320192 3300005355 Bacteria 1321
154 Ga0070671_100577135 3300005355 Bacteria 971
155 Ga0070674_100002720 3300005356 Bacteria 9779
156 Ga0070674_100009148 3300005356 Bacteria 5925
157 Ga0070674_100016377 3300005356 Bacteria 4646
158 Ga0070674_100022088 3300005356 Bacteria 4099
159 Ga0070673_100004768 3300005364 Bacteria 8614
160 Ga0070673_100011005 3300005364 Bacteria 6159
161 Ga0070673_100026881 3300005364 Bacteria 4257
162 Ga0070673_100071842 3300005364 Unclassified 2782
163 Ga0070673_100113696 3300005364 Bacteria 2248
164 Ga0070673_100158137 3300005364 Bacteria 1925
165 Ga0070673_100225368 3300005364 Unclassified 1624
166 Ga0070673_100453451 3300005364 Bacteria 1154
167 Ga0070673_100549912 3300005364 Bacteria 1049
168 Ga0070673_100970400 3300005364 Bacteria 790
169 Ga0070673_100982184 3300005364 Bacteria 786
170 Ga0070688_100003887 3300005365 Bacteria 7744
171 Ga0070688_100025799 3300005365 Bacteria 3485
172 Ga0070688_100030282 3300005365 Bacteria 3247
173 Ga0070688_100035963 3300005365 Unclassified 3010
174 Ga0070688_100065838 3300005365 Bacteria 2304
175 Ga0070688_100104037 3300005365 Bacteria 1877
176 Ga0070659_100028202 3300005366 Bacteria 4334
177 Ga0070659_100058940 3300005366 Bacteria 3031
178 Ga0070659_100120363 3300005366 Unclassified 2125
179 Ga0070659_100472869 3300005366 Unclassified 1066
180 Ga0070659_100553688 3300005366 Bacteria 985
181 Ga0070667_100005666 3300005367 Bacteria 10430
182 Ga0070667_100005976 3300005367 Bacteria 10117
183 Ga0070667_100006635 3300005367 Bacteria 9620
184 Ga0070667_100018265 3300005367 Bacteria 5814
185 Ga0070667_100020213 3300005367 Bacteria 5529
186 Ga0070667_100049027 3300005367 Bacteria 3556
187 Ga0070667_100060501 3300005367 Bacteria 3204
188 Ga0070667_100074950 3300005367 Bacteria 2888
189 Ga0070667_100088983 3300005367 Bacteria 2652
190 Ga0070667_100131074 3300005367 Bacteria 2188
191 Ga0070667_100922444 3300005367 Bacteria 813
192 Ga0070701_10042471 3300005438 Unclassified 2321
193 Ga0070711_100368199 3300005439 Bacteria 1159
194 Ga0070700_100037341 3300005441 Bacteria 2954
195 Ga0070700_100106689 3300005441 Bacteria 1855
196 Ga0070663_100052657 3300005455 Unclassified 2903
197 Ga0070663_100176381 3300005455 Bacteria 1655
198 Ga0070678_100003213 3300005456 Bacteria 9070
199 Ga0070678_100024383 3300005456 Bacteria 4049
200 Ga0070678_100099128 3300005456 Bacteria 2254
201 Ga0070678_100591385 3300005456 Bacteria 990
202 Ga0070678_100671692 3300005456 Bacteria 931
203 Ga0070662_100007657 3300005457 Bacteria 7006
204 Ga0070662_100012826 3300005457 Bacteria 5567
205 Ga0070662_100022785 3300005457 Bacteria 4292
206 Ga0070662_100042168 3300005457 Bacteria 3259
207 Ga0070662_100169669 3300005457 Bacteria 1713
208 Ga0070662_100183169 3300005457 Bacteria 1652
209 Ga0070662_100223267 3300005457 Bacteria 1504
210 Ga0070662_100999935 3300005457 Bacteria 716
211 Ga0070681_10070731 3300005458 Bacteria 3454
212 Ga0070681_10092837 3300005458 Bacteria 2967
213 Ga0070681_10143961 3300005458 Bacteria 2313
214 Ga0068867_100004129 3300005459 Bacteria 10199
215 Ga0068867_100007859 3300005459 Bacteria 7537
216 Ga0068867_100011193 3300005459 Bacteria 6329
217 Ga0068867_100022481 3300005459 Bacteria 4510
218 Ga0068867_100031631 3300005459 Bacteria 3822
219 Ga0068867_100051269 3300005459 Unclassified 3043
220 Ga0068867_100053418 3300005459 Bacteria 2984
221 Ga0068867_100057688 3300005459 Bacteria 2876
222 Ga0068867_100113496 3300005459 Bacteria 2085
223 Ga0068867_100137859 3300005459 Bacteria 1904
224 Ga0068867_100143404 3300005459 Bacteria 1869
225 Ga0068867_100163612 3300005459 Bacteria 1756
226 Ga0068867_100191483 3300005459 Bacteria 1632
227 Ga0068867_100291287 3300005459 Bacteria 1342
228 Ga0070685_10027792 3300005466 Bacteria 3130
229 Ga0070685_10028737 3300005466 Unclassified 3084
230 Ga0070685_10043958 3300005466 Unclassified 2556
231 Ga0070685_10090655 3300005466 Bacteria 1850
232 Ga0070698_100012635 3300005471 Bacteria 8940
233 Ga0070698_100096270 3300005471 Bacteria 2937
234 Ga0070679_100000373 3300005530 Bacteria 38042
235 Ga0070679_100000789 3300005530 Bacteria 27515
236 Ga0070679_100059118 3300005530 Unclassified 3820
237 Ga0070679_100072103 3300005530 Bacteria 3445
238 Ga0070679_100209481 3300005530 Bacteria 1913
239 Ga0070684_100000042 3300005535 Bacteria 89896
240 Ga0070684_100013209 3300005535 Bacteria 6650
241 Ga0070684_100025354 3300005535 Bacteria 4983
242 Ga0070684_100105457 3300005535 Bacteria 2522
243 Ga0070684_100136813 3300005535 Bacteria 2213
244 Ga0070697_100470995 3300005536 Bacteria 1096
245 Ga0068853_100005393 3300005539 Bacteria 10014
246 Ga0068853_100006084 3300005539 Bacteria 9553
247 Ga0068853_100021685 3300005539 Bacteria 5359
248 Ga0068853_100050105 3300005539 Bacteria 3591
249 Ga0068853_100080141 3300005539 Bacteria 2856
250 Ga0068853_100105734 3300005539 Bacteria 2493
251 Ga0068853_100138455 3300005539 Bacteria 2184
252 Ga0068853_100254631 3300005539 Bacteria 1612
253 Ga0068853_100277607 3300005539 Unclassified 1544
254 Ga0068853_100312176 3300005539 Bacteria 1456
255 Ga0068853_100354741 3300005539 Bacteria 1365
256 Ga0068853_100795786 3300005539 Unclassified 905
257 Ga0068853_100903315 3300005539 Unclassified 848
258 Ga0070672_100002200 3300005543 Bacteria 12292
259 Ga0070672_100029692 3300005543 Bacteria 4103
260 Ga0070672_100042007 3300005543 Bacteria 3519
261 Ga0070672_100136408 3300005543 Bacteria 2021
262 Ga0070672_100158540 3300005543 Bacteria 1876
263 Ga0070672_100201192 3300005543 Bacteria 1666
264 Ga0070672_100229632 3300005543 Bacteria 1559
265 Ga0070672_100351491 3300005543 Bacteria 1256
266 Ga0070686_100017405 3300005544 Bacteria 4199
267 Ga0070686_100168425 3300005544 Bacteria 1548
268 Ga0070686_100170180 3300005544 Unclassified 1540
269 Ga0070693_100568192 3300005547 Bacteria 814
270 Ga0070665_100000002 3300005548 Bacteria 849037
271 Ga0070665_100006924 3300005548 Bacteria 11521
272 Ga0070665_100380735 3300005548 Bacteria 1418
273 Ga0070665_100473131 3300005548 Unclassified 1263
274 Ga0070704_100456105 3300005549 Bacteria 1102
275 Ga0068855_100004845 3300005563 Bacteria 16427
276 Ga0068855_100011556 3300005563 Bacteria 10663
277 Ga0068855_100023611 3300005563 Bacteria 7365
278 Ga0068855_100048130 3300005563 Bacteria 5034
279 Ga0068855_100091589 3300005563 Bacteria 3507
280 Ga0068855_100448516 3300005563 Unclassified 1408
281 Ga0068855_100619941 3300005563 Bacteria 1165
282 Ga0068855_100633385 3300005563 Bacteria 1150
283 Ga0068855_100915766 3300005563 Bacteria 925
284 Ga0070664_100000266 3300005564 Bacteria 37671
285 Ga0070664_100014722 3300005564 Bacteria 6388
286 Ga0070664_100021759 3300005564 Bacteria 5288
287 Ga0070664_100047727 3300005564 Unclassified 3618
288 Ga0070664_100060522 3300005564 Bacteria 3225
289 Ga0070664_100106599 3300005564 Bacteria 2442
290 Ga0070664_100212043 3300005564 Unclassified 1731
291 Ga0070664_100220041 3300005564 Unclassified 1699
292 Ga0070664_100793239 3300005564 Unclassified 885
293 Ga0068857_100002333 3300005577 Bacteria 15434
294 Ga0068857_100021749 3300005577 Bacteria 5645
295 Ga0068857_100030652 3300005577 Bacteria 4750
296 Ga0068857_100043844 3300005577 Bacteria 3967
297 Ga0068857_100082222 3300005577 Bacteria 2877
298 Ga0068857_100082282 3300005577 Unclassified 2876
299 Ga0068857_100172391 3300005577 Bacteria 1967
300 Ga0068857_100387300 3300005577 Bacteria 1299
301 Ga0068857_100563801 3300005577 Bacteria 1074
302 Ga0068857_100584860 3300005577 Bacteria 1054
303 Ga0068854_100007085 3300005578 Bacteria 7157
304 Ga0068854_100022206 3300005578 Bacteria 4319
305 Ga0068854_100058017 3300005578 Bacteria 2793
306 Ga0068854_100259351 3300005578 Bacteria 1391
307 Ga0068854_100423615 3300005578 Unclassified 1106
308 Ga0068854_100554554 3300005578 Unclassified 975
309 Ga0068856_100034401 3300005614 Bacteria 4963
310 Ga0068856_100063747 3300005614 Bacteria 3641
311 Ga0068856_100192689 3300005614 Bacteria 2052
312 Ga0068856_100216941 3300005614 Bacteria 1928
313 Ga0068856_100260635 3300005614 Bacteria 1749
314 Ga0068856_100539144 3300005614 Bacteria 1188
315 Ga0070702_100004909 3300005615 Bacteria 6164
316 Ga0068852_100000391 3300005616 Bacteria 29415
317 Ga0068852_100009517 3300005616 Bacteria 7220
318 Ga0068852_100024603 3300005616 Bacteria 4869
319 Ga0068852_100045323 3300005616 Bacteria 3740
320 Ga0068852_100051115 3300005616 Unclassified 3545
321 Ga0068852_100098861 3300005616 Bacteria 2629
322 Ga0068852_100102493 3300005616 Bacteria 2586
323 Ga0068852_100208197 3300005616 Bacteria 1854
324 Ga0068852_100222919 3300005616 Bacteria 1794
325 Ga0068852_100245169 3300005616 Bacteria 1714
326 Ga0068852_100321485 3300005616 Unclassified 1503
327 Ga0068852_100443382 3300005616 Bacteria 1284
328 Ga0068852_100578448 3300005616 Bacteria 1126
329 Ga0068859_100000024 3300005617 Bacteria 217931
330 Ga0068859_100000289 3300005617 Bacteria 49979
331 Ga0068859_100023852 3300005617 Bacteria 6141
332 Ga0068859_100034839 3300005617 Bacteria 5051
333 Ga0068859_100064998 3300005617 Bacteria 3682
334 Ga0068859_100095618 3300005617 Bacteria 3023
335 Ga0068859_100117794 3300005617 Bacteria 2721
336 Ga0068859_100148245 3300005617 Bacteria 2422
337 Ga0068859_100195989 3300005617 Bacteria 2104
338 Ga0068859_100323008 3300005617 Bacteria 1637
339 Ga0068859_100678993 3300005617 Unclassified 1121
340 Ga0068859_100843105 3300005617 Bacteria 1003
341 Ga0068864_100007995 3300005618 Bacteria 8720
342 Ga0068864_100034620 3300005618 Bacteria 4296
343 Ga0068864_100039400 3300005618 Bacteria 4039
344 Ga0068864_100054971 3300005618 Bacteria 3436
345 Ga0068864_100100795 3300005618 Bacteria 2560
346 Ga0068864_100190514 3300005618 Bacteria 1880
347 Ga0068864_100205278 3300005618 Bacteria 1812
348 Ga0068864_100282018 3300005618 Bacteria 1551
349 Ga0068864_100314713 3300005618 Bacteria 1469
350 Ga0068864_100371081 3300005618 Unclassified 1354
351 Ga0068864_100691477 3300005618 Unclassified 996
352 Ga0068864_100792748 3300005618 Bacteria 931
353 Ga0068866_10015629 3300005718 Bacteria 3374
354 Ga0068866_10018529 3300005718 Bacteria 3150
355 Ga0068866_10055294 3300005718 Bacteria 2038
356 Ga0068866_10114842 3300005718 Bacteria 1508
357 Ga0068861_100002293 3300005719 Bacteria 12423
358 Ga0068861_100008102 3300005719 Bacteria 7228
359 Ga0068861_100027894 3300005719 Unclassified 4117
360 Ga0068861_100793716 3300005719 Unclassified 888
361 Ga0068851_10000961 3300005834 Bacteria 12479
362 Ga0068851_10007645 3300005834 Bacteria 4971
363 Ga0068851_10283507 3300005834 Bacteria 948
364 Ga0068870_10001518 3300005840 Bacteria 9418
365 Ga0068870_10011910 3300005840 Bacteria 4046
366 Ga0068870_10046907 3300005840 Bacteria 2268
367 Ga0068863_100001495 3300005841 Bacteria 23148
368 Ga0068863_100002737 3300005841 Bacteria 17430
369 Ga0068863_100007225 3300005841 Bacteria 10893
370 Ga0068863_100029821 3300005841 Bacteria 5210
371 Ga0068863_100042386 3300005841 Bacteria 4324
372 Ga0068863_100072382 3300005841 Bacteria 3261
373 Ga0068863_100076932 3300005841 Bacteria 3157
374 Ga0068863_100092481 3300005841 Bacteria 2869
375 Ga0068863_100252648 3300005841 Bacteria 1703
376 Ga0068863_100283452 3300005841 Bacteria 1606
377 Ga0068863_100301982 3300005841 Bacteria 1553
378 Ga0068863_100342193 3300005841 Bacteria 1455
379 Ga0068863_100404454 3300005841 Unclassified 1336
380 Ga0068863_100572153 3300005841 Bacteria 1117
381 Ga0068863_100659816 3300005841 Bacteria 1038
382 Ga0068858_100006261 3300005842 Bacteria 11597
383 Ga0068858_100006671 3300005842 Bacteria 11227
384 Ga0068858_100030976 3300005842 Bacteria 4967
385 Ga0068858_100120817 3300005842 Bacteria 2450
386 Ga0068858_100237329 3300005842 Bacteria 1729
387 Ga0068860_100000003 3300005843 Bacteria 575741
388 Ga0068860_100001839 3300005843 Bacteria 22597
389 Ga0068860_100002558 3300005843 Bacteria 19021
390 Ga0068860_100003552 3300005843 Bacteria 16035
391 Ga0068860_100007858 3300005843 Bacteria 10647
392 Ga0068860_100017352 3300005843 Bacteria 7014
393 Ga0068860_100018142 3300005843 Bacteria 6850
394 Ga0068860_100051634 3300005843 Unclassified 3912
395 Ga0068860_100064406 3300005843 Bacteria 3481
396 Ga0068860_100219497 3300005843 Unclassified 1846
397 Ga0068860_100246436 3300005843 Bacteria 1739
398 Ga0068860_100448376 3300005843 Unclassified 1283
399 Ga0068860_100523088 3300005843 Bacteria 1186
400 Ga0068862_100005509 3300005844 Bacteria 10574
401 Ga0068862_100011950 3300005844 Bacteria 7173
402 Ga0068862_100012024 3300005844 Bacteria 7152
403 Ga0068862_100431821 3300005844 Bacteria 1238
404 Ga0068862_100660753 3300005844 Bacteria 1009
405 Ga0068862_100858324 3300005844 Bacteria 890
406 Ga0081540_1004235 3300005983 Bacteria 11020
407 Ga0081539_10000696 3300005985 Bacteria 67397
408 Ga0081539_10048260 3300005985 Bacteria 2423
409 Ga0070716_100626819 3300006173 Bacteria 812
410 Ga0070712_100717916 3300006175 Unclassified 853
411 Ga0075366_10003065 3300006195 Bacteria 8726
412 Ga0075366_10044572 3300006195 Bacteria 2629
413 Ga0075366_10096473 3300006195 Unclassified 1772
414 Ga0075366_10099486 3300006195 Bacteria 1745
415 Ga0097621_100000839 3300006237 Bacteria 21631
416 Ga0097621_100003220 3300006237 Bacteria 11219
417 Ga0097621_100004096 3300006237 Bacteria 10111
418 Ga0097621_100021433 3300006237 Bacteria 4998
419 Ga0097621_100028329 3300006237 Bacteria 4415
420 Ga0097621_100030896 3300006237 Bacteria 4244
421 Ga0097621_100054689 3300006237 Bacteria 3257
422 Ga0097621_100058487 3300006237 Unclassified 3154
423 Ga0097621_100060176 3300006237 Bacteria 3113
424 Ga0097621_100126487 3300006237 Bacteria 2171
425 Ga0097621_100200836 3300006237 Bacteria 1731
426 Ga0097621_100202437 3300006237 Bacteria 1724
427 Ga0097621_100255760 3300006237 Bacteria 1535
428 Ga0097621_100320774 3300006237 Bacteria 1372
429 Ga0097621_100609436 3300006237 Bacteria 999
430 Ga0097621_100670858 3300006237 Bacteria 952
431 Ga0097621_100786536 3300006237 Unclassified 881
432 Ga0068871_100001362 3300006358 Bacteria 16385
433 Ga0068871_100005215 3300006358 Bacteria 9088
434 Ga0068871_100007064 3300006358 Bacteria 8004
435 Ga0068871_100020773 3300006358 Bacteria 5035
436 Ga0068871_100056887 3300006358 Unclassified 3181
437 Ga0068871_100062024 3300006358 Bacteria 3055
438 Ga0068871_100074941 3300006358 Bacteria 2793
439 Ga0068871_100091086 3300006358 Bacteria 2541
440 Ga0068871_100122166 3300006358 Bacteria 2201
441 Ga0068871_100154188 3300006358 Bacteria 1960
442 Ga0068871_100200219 3300006358 Bacteria 1724
443 Ga0068871_100461481 3300006358 Bacteria 1140
444 Ga0075428_100027400 3300006844 Bacteria 6305
445 Ga0075428_100221092 3300006844 Bacteria 2045
446 Ga0075428_100312599 3300006844 Unclassified 1689
447 Ga0075428_100414431 3300006844 Bacteria 1443
448 Ga0075430_100008093 3300006846 Bacteria 8885
449 Ga0075431_100028155 3300006847 Bacteria 5770
450 Ga0075429_100050388 3300006880 Bacteria 3622
451 Ga0075429_100168275 3300006880 Bacteria 1920
452 Ga0075429_100581101 3300006880 Bacteria 982
453 Ga0068865_100042968 3300006881 Bacteria 3085
454 Ga0068865_100053804 3300006881 Unclassified 2794
455 Ga0068865_100090182 3300006881 Bacteria 2222
456 Ga0068865_100782162 3300006881 Bacteria 822
457 Ga0068865_100799926 3300006881 Bacteria 813
458 Ga0068865_100835118 3300006881 Bacteria 797
459 Ga0097620_100000024 3300006931 Bacteria 217931
460 Ga0097620_100000289 3300006931 Bacteria 49979
461 Ga0097620_100023853 3300006931 Bacteria 6141
462 Ga0097620_100034840 3300006931 Bacteria 5051
463 Ga0097620_100064998 3300006931 Bacteria 3682
464 Ga0097620_100095615 3300006931 Bacteria 3023
465 Ga0097620_100117795 3300006931 Bacteria 2721
466 Ga0097620_100148236 3300006931 Bacteria 2422
467 Ga0097620_100195988 3300006931 Bacteria 2104
468 Ga0097620_100323036 3300006931 Bacteria 1637
469 Ga0097620_100679089 3300006931 Unclassified 1121
470 Ga0097620_100843129 3300006931 Bacteria 1003
471 Ga0105240_10000664 3300009093 Bacteria 63206
472 Ga0105240_10003417 3300009093 Bacteria 24669
473 Ga0105240_10005202 3300009093 Bacteria 19460
474 Ga0105240_10007539 3300009093 Bacteria 15772
475 Ga0105240_10013672 3300009093 Bacteria 11131
476 Ga0105240_10028985 3300009093 Bacteria 7220
477 Ga0105240_10030484 3300009093 Bacteria 7010
478 Ga0105240_10045365 3300009093 Bacteria 5577
479 Ga0105240_10071079 3300009093 Bacteria 4304
480 Ga0105240_10086615 3300009093 Bacteria 3836
481 Ga0105240_10698619 3300009093 Bacteria 1107
482 Ga0105240_10698937 3300009093 Bacteria 1107
483 Ga0111539_10002209 3300009094 Bacteria 25989
484 Ga0111539_10033408 3300009094 Bacteria 6244
485 Ga0111539_10556449 3300009094 Bacteria 1336
486 Ga0105247_10003052 3300009101 Bacteria 11083
487 Ga0105247_10009908 3300009101 Bacteria 5773
488 Ga0105247_10635001 3300009101 Bacteria 796
489 Ga0114129_10069752 3300009147 Bacteria 4900
490 Ga0114129_10132459 3300009147 Bacteria 3423
491 Ga0114129_10203922 3300009147 Bacteria 2677
492 Ga0114129_10367692 3300009147 Bacteria 1902
493 Ga0105243_10278713 3300009148 Bacteria 1505
494 Ga0105241_10003204 3300009174 Bacteria 12178
495 Ga0105241_10008515 3300009174 Bacteria 7542
496 Ga0105241_10015439 3300009174 Bacteria 5593
497 Ga0105241_10076424 3300009174 Bacteria 2611
498 Ga0105241_10077597 3300009174 Bacteria 2594
499 Ga0105241_10097842 3300009174 Bacteria 2327
500 Ga0105241_10113079 3300009174 Bacteria 2176
501 Ga0105241_10556677 3300009174 Unclassified 1030
502 Ga0105242_10217571 3300009176 Bacteria 1705
503 Ga0105242_10218848 3300009176 Bacteria 1701
504 Ga0105242_10245646 3300009176 Bacteria 1611
505 Ga0105242_10265860 3300009176 Unclassified 1551
506 Ga0105242_10656764 3300009176 Bacteria 1020
507 Ga0105242_10892246 3300009176 Bacteria 888
508 Ga0105242_10926683 3300009176 Bacteria 873
509 Ga0105248_10044022 3300009177 Bacteria 5006
510 Ga0105248_10158839 3300009177 Bacteria 2550
511 Ga0105248_10176413 3300009177 Bacteria 2408
512 Ga0105248_10589867 3300009177 Bacteria 1254
513 Ga0105237_10001055 3300009545 Bacteria 37018
514 Ga0105237_10001444 3300009545 Bacteria 31385
515 Ga0105237_10003471 3300009545 Bacteria 18685
516 Ga0105237_10006867 3300009545 Bacteria 12548
517 Ga0105237_10011763 3300009545 Bacteria 9258
518 Ga0105237_10058802 3300009545 Bacteria 3847
519 Ga0105237_10065053 3300009545 Bacteria 3643
520 Ga0105237_10324770 3300009545 Bacteria 1543
521 Ga0105237_10329342 3300009545 Bacteria 1531
522 Ga0105237_11156467 3300009545 Unclassified 780
523 Ga0105238_10001637 3300009551 Bacteria 22439
524 Ga0105238_10043580 3300009551 Bacteria 4540
525 Ga0105238_10164851 3300009551 Unclassified 2191
526 Ga0105238_10465072 3300009551 Bacteria 1263
527 Ga0105249_10001304 3300009553 Bacteria 21863
528 Ga0105249_10003776 3300009553 Bacteria 13077
529 Ga0105249_10006906 3300009553 Bacteria 9896
530 Ga0105249_10010160 3300009553 Bacteria 8264
531 Ga0105249_10013792 3300009553 Bacteria 7140
532 Ga0105249_10020732 3300009553 Bacteria 5878
533 Ga0105249_10049496 3300009553 Bacteria 3832
534 Ga0105249_10057076 3300009553 Bacteria 3575
535 Ga0105249_10078477 3300009553 Bacteria 3064
536 Ga0105249_10098962 3300009553 Bacteria 2740
537 Ga0105249_10330502 3300009553 Bacteria 1538
538 Ga0105249_11102410 3300009553 Bacteria 864
539 Ga0105249_11334402 3300009553 Bacteria 789
540 Ga0105239_10000488 3300010375 Bacteria 57554
541 Ga0105239_10001785 3300010375 Bacteria 28298
542 Ga0105239_10005800 3300010375 Bacteria 14406
543 Ga0105239_10008966 3300010375 Bacteria 11320
544 Ga0105239_10010713 3300010375 Bacteria 10241
545 Ga0105239_10016759 3300010375 Bacteria 8100
546 Ga0105239_10022426 3300010375 Bacteria 6960
547 Ga0105239_10191946 3300010375 Bacteria 2286
548 Ga0105239_10263924 3300010375 Bacteria 1936
549 Ga0105239_10468438 3300010375 Bacteria 1430
550 Ga0105239_10632751 3300010375 Bacteria 1221
551 Ga0105239_10920005 3300010375 Unclassified 1004
552 Ga0105246_10013688 3300011119 Bacteria 5090
553 Ga0105246_10044011 3300011119 Bacteria 3032
554 Ga0105246_10095898 3300011119 Bacteria 2148
555 Ga0105246_10220602 3300011119 Bacteria 1486
556 Ga0105246_10240190 3300011119 Bacteria 1432
557 Ga0105246_10366555 3300011119 Bacteria 1185
558 Ga0157373_10007569 3300013100 Bacteria 8071
559 Ga0157373_10020245 3300013100 Bacteria 4840
560 Ga0157373_10239824 3300013100 Bacteria 1281
561 Ga0157371_10004173 3300013102 Bacteria 12734
562 Ga0157371_10011287 3300013102 Bacteria 6898
563 Ga0157371_10018908 3300013102 Bacteria 5088
564 Ga0157371_10039728 3300013102 Bacteria 3364
565 Ga0157371_10043884 3300013102 Bacteria 3184
566 Ga0157371_10152159 3300013102 Bacteria 1650
567 Ga0157371_10295523 3300013102 Bacteria 1172
568 Ga0157370_10001484 3300013104 Bacteria 29041
569 Ga0157370_10001788 3300013104 Bacteria 26502
570 Ga0157370_10006166 3300013104 Bacteria 13302
571 Ga0157370_10008668 3300013104 Bacteria 10945
572 Ga0157370_10138668 3300013104 Bacteria 2266
573 Ga0157370_10275836 3300013104 Bacteria 1553
574 Ga0157370_10279370 3300013104 Bacteria 1543
575 Ga0157370_10450554 3300013104 Bacteria 1183
576 Ga0157370_10742032 3300013104 Bacteria 895
577 Ga0157369_10015180 3300013105 Bacteria 8695
578 Ga0157369_10016955 3300013105 Bacteria 8186
579 Ga0157369_10026472 3300013105 Bacteria 6432
580 Ga0157369_10160770 3300013105 Bacteria 2371
581 Ga0157369_10258902 3300013105 Unclassified 1815
582 Ga0157369_10608913 3300013105 Bacteria 1127
583 Ga0157374_10000013 3300013296 Bacteria 461240
584 Ga0157374_10004538 3300013296 Bacteria 11659
585 Ga0157374_10011781 3300013296 Bacteria 7585
586 Ga0157374_10022853 3300013296 Bacteria 5585
587 Ga0157374_10036791 3300013296 Bacteria 4487
588 Ga0157374_10040524 3300013296 Bacteria 4290
589 Ga0157374_10111705 3300013296 Bacteria 2629
590 Ga0157374_10124712 3300013296 Bacteria 2489
591 Ga0157374_10138785 3300013296 Bacteria 2358
592 Ga0157374_10196755 3300013296 Unclassified 1973
593 Ga0157374_10232005 3300013296 Unclassified 1813
594 Ga0157374_10251169 3300013296 Bacteria 1740
595 Ga0157374_10278121 3300013296 Bacteria 1652
596 Ga0157374_10315847 3300013296 Bacteria 1547
597 Ga0157378_10005807 3300013297 Bacteria 10818
598 Ga0157378_10006964 3300013297 Bacteria 9862
599 Ga0157378_10010274 3300013297 Bacteria 8174
600 Ga0157378_10014737 3300013297 Bacteria 6849
601 Ga0157378_10020328 3300013297 Bacteria 5839
602 Ga0157378_10087729 3300013297 Bacteria 2822
603 Ga0157378_10095605 3300013297 Bacteria 2706
604 Ga0157378_10156521 3300013297 Bacteria 2128
605 Ga0157378_10263047 3300013297 Bacteria 1656
606 Ga0157378_11469559 3300013297 Bacteria 726
607 Ga0163162_10000898 3300013306 Bacteria 27732
608 Ga0163162_10001132 3300013306 Bacteria 24804
609 Ga0163162_10001183 3300013306 Bacteria 24333
610 Ga0163162_10003339 3300013306 Bacteria 15355
611 Ga0163162_10007125 3300013306 Bacteria 10851
612 Ga0163162_10010595 3300013306 Bacteria 8965
613 Ga0163162_10010709 3300013306 Bacteria 8920
614 Ga0163162_10031486 3300013306 Bacteria 5262
615 Ga0163162_10036874 3300013306 Unclassified 4876
616 Ga0163162_10041456 3300013306 Bacteria 4606
617 Ga0163162_10043363 3300013306 Bacteria 4505
618 Ga0163162_10111300 3300013306 Bacteria 2836
619 Ga0163162_10387114 3300013306 Bacteria 1531
620 Ga0163162_10414891 3300013306 Bacteria 1478
621 Ga0163162_10507547 3300013306 Bacteria 1336
622 Ga0163162_10648537 3300013306 Bacteria 1179
623 Ga0163162_10741572 3300013306 Unclassified 1102
624 Ga0163162_11147034 3300013306 Bacteria 881
625 Ga0163162_11175175 3300013306 Bacteria 870
626 Ga0163162_11700306 3300013306 Unclassified 721
627 Ga0157372_10000965 3300013307 Bacteria 31343
628 Ga0157372_10030941 3300013307 Bacteria 5858
629 Ga0157372_10038383 3300013307 Bacteria 5284
630 Ga0157372_10066619 3300013307 Bacteria 4046
631 Ga0157372_10066758 3300013307 Unclassified 4042
632 Ga0157372_10097510 3300013307 Unclassified 3353
633 Ga0157372_10182772 3300013307 Bacteria 2428
634 Ga0157372_10216760 3300013307 Bacteria 2218
635 Ga0157372_10235085 3300013307 Bacteria 2125
636 Ga0157372_10253248 3300013307 Bacteria 2044
637 Ga0157372_10268175 3300013307 Unclassified 1983
638 Ga0157372_10425065 3300013307 Unclassified 1548
639 Ga0157372_10539341 3300013307 Bacteria 1360
640 Ga0157372_10599326 3300013307 Bacteria 1284
641 Ga0157372_10680466 3300013307 Unclassified 1197
642 Ga0157372_10815270 3300013307 Bacteria 1084
643 Ga0157372_10916320 3300013307 Bacteria 1016
644 Ga0157372_11020903 3300013307 Bacteria 958
645 Ga0157372_11102784 3300013307 Bacteria 918
646 Ga0157372_11179925 3300013307 Unclassified 885
647 Ga0157375_10004252 3300013308 Bacteria 12418
648 Ga0157375_10008550 3300013308 Bacteria 8963
649 Ga0157375_10018936 3300013308 Bacteria 6250
650 Ga0157375_10019451 3300013308 Bacteria 6176
651 Ga0157375_10020351 3300013308 Bacteria 6060
652 Ga0157375_10039994 3300013308 Bacteria 4516
653 Ga0157375_10085351 3300013308 Bacteria 3207
654 Ga0157375_10087286 3300013308 Bacteria 3172
655 Ga0157375_10103438 3300013308 Bacteria 2935
656 Ga0157375_10132544 3300013308 Bacteria 2613
657 Ga0157375_10322705 3300013308 Unclassified 1709
658 Ga0157375_10331409 3300013308 Bacteria 1687
659 Ga0157375_10756328 3300013308 Bacteria 1123
660 Ga0157375_12009377 3300013308 Bacteria 687
661 Ga0163163_10000526 3300014325 Bacteria 34147
662 Ga0163163_10000858 3300014325 Bacteria 25873
663 Ga0163163_10000952 3300014325 Bacteria 24583
664 Ga0163163_10006919 3300014325 Bacteria 9956
665 Ga0163163_10065250 3300014325 Bacteria 3613
666 Ga0163163_10105021 3300014325 Bacteria 2850
667 Ga0163163_10211471 3300014325 Bacteria 1989
668 Ga0163163_10232007 3300014325 Unclassified 1895
669 Ga0163163_10362371 3300014325 Bacteria 1506
670 Ga0163163_10701164 3300014325 Bacteria 1076
671 Ga0163163_11029096 3300014325 Bacteria 887
672 Ga0163163_11061920 3300014325 Bacteria 873
673 Ga0157380_10007560 3300014326 Bacteria 7719
674 Ga0157380_10048134 3300014326 Unclassified 3356
675 Ga0157380_10061625 3300014326 Bacteria 3002
676 Ga0157380_10106449 3300014326 Bacteria 2347
677 Ga0157380_10342931 3300014326 Bacteria 1394
678 Ga0157380_10447017 3300014326 Bacteria 1240
679 Ga0157380_10451263 3300014326 Bacteria 1235
680 Ga0157380_10472266 3300014326 Bacteria 1210
681 Ga0157380_11523776 3300014326 Bacteria 722
682 Ga0157377_10000392 3300014745 Bacteria 18955
683 Ga0157377_10001057 3300014745 Bacteria 11646
684 Ga0157377_10046592 3300014745 Bacteria 2426
685 Ga0157377_10053588 3300014745 Bacteria 2281
686 Ga0157377_10462651 3300014745 Unclassified 878
687 Ga0157379_10022827 3300014968 Bacteria 5546
688 Ga0157379_10048092 3300014968 Bacteria 3808
689 Ga0157379_10072737 3300014968 Bacteria 3076
690 Ga0157379_10079740 3300014968 Bacteria 2932
691 Ga0157379_10114075 3300014968 Bacteria 2429
692 Ga0157379_10131139 3300014968 Bacteria 2256
693 Ga0157379_10195988 3300014968 Bacteria 1826
694 Ga0157379_10227245 3300014968 Bacteria 1691
695 Ga0157379_10296621 3300014968 Bacteria 1473
696 Ga0157376_10000762 3300014969 Bacteria 21000
697 Ga0157376_10001533 3300014969 Bacteria 15240
698 Ga0157376_10009911 3300014969 Bacteria 6949
699 Ga0157376_10016300 3300014969 Bacteria 5637
700 Ga0157376_10060867 3300014969 Bacteria 3172
701 Ga0157376_10079300 3300014969 Bacteria 2814
702 Ga0157376_10080801 3300014969 Bacteria 2789
703 Ga0157376_10113215 3300014969 Bacteria 2392
704 Ga0157376_10245566 3300014969 Bacteria 1670
705 Ga0157376_10296810 3300014969 Bacteria 1528
706 Ga0157376_10299518 3300014969 Unclassified 1521
707 Ga0157376_10402627 3300014969 Unclassified 1324
708 Ga0157376_10699806 3300014969 Bacteria 1018
709 Ga0163161_10006402 3300017792 Bacteria 8155
710 Ga0163161_10022548 3300017792 Bacteria 4435
711 Ga0163161_10081953 3300017792 Bacteria 2377
712 Ga0163161_10093655 3300017792 Bacteria 2226
713 Ga0163161_10142535 3300017792 Bacteria 1815
714 Ga0163161_10169703 3300017792 Bacteria 1668
715 Ga0163161_10187944 3300017792 Bacteria 1587
716 Ga0163161_10404613 3300017792 Bacteria 1095
717 Ga0213876_10000389 3300021384 Bacteria 36929
718 Ga0213876_10017439 3300021384 Bacteria 3791
719 Ga0209646_1001769 3300025246 Bacteria 5417
720 Ga0207666_1016606 3300025271 Bacteria 1057
721 Ga0207426_1000040 3300025302 Bacteria 433920
722 Ga0207697_10085413 3300025315 Bacteria 1333
723 Ga0207697_10213379 3300025315 Bacteria 851
724 Ga0207697_10230922 3300025315 Bacteria 817
725 Ga0207656_10010007 3300025321 Bacteria 3535
726 Ga0207656_10016777 3300025321 Bacteria 2856
727 Ga0207656_10137335 3300025321 Bacteria 1150
728 Ga0207682_10076987 3300025893 Bacteria 1422
729 Ga0207642_10077250 3300025899 Bacteria 1605
730 Ga0207642_10168603 3300025899 Unclassified 1182
731 Ga0207710_10018695 3300025900 Bacteria 2949
732 Ga0207688_10039420 3300025901 Bacteria 2624
733 Ga0207688_10058506 3300025901 Bacteria 2169
734 Ga0207688_10218956 3300025901 Bacteria 1146
735 Ga0207680_10000048 3300025903 Bacteria 58651
736 Ga0207680_10008926 3300025903 Bacteria 4944
737 Ga0207680_10027434 3300025903 Bacteria 3171
738 Ga0207680_10043116 3300025903 Bacteria 2644
739 Ga0207680_10073238 3300025903 Bacteria 2129
740 Ga0207680_10238051 3300025903 Unclassified 1253
741 Ga0207647_10001560 3300025904 Bacteria 17609
742 Ga0207647_10041306 3300025904 Bacteria 2901
743 Ga0207647_10053279 3300025904 Bacteria 2493
744 Ga0207647_10083002 3300025904 Bacteria 1919
745 Ga0207647_10101158 3300025904 Bacteria 1710
746 Ga0207647_10125257 3300025904 Unclassified 1512
747 Ga0207645_10000357 3300025907 Bacteria 37837
748 Ga0207645_10001186 3300025907 Bacteria 21516
749 Ga0207645_10027538 3300025907 Bacteria 3669
750 Ga0207645_10136338 3300025907 Bacteria 1598
751 Ga0207645_10235690 3300025907 Bacteria 1208
752 Ga0207643_10016383 3300025908 Bacteria 4043
753 Ga0207643_10016455 3300025908 Bacteria 4034
754 Ga0207643_10127457 3300025908 Bacteria 1512
755 Ga0207643_10327419 3300025908 Bacteria 958
756 Ga0207643_10358573 3300025908 Bacteria 916
757 Ga0207705_10012442 3300025909 Bacteria 6147
758 Ga0207705_10103224 3300025909 Unclassified 2100
759 Ga0207705_10195874 3300025909 Bacteria 1530
760 Ga0207654_10000782 3300025911 Bacteria 17489
761 Ga0207654_10007264 3300025911 Bacteria 5583
762 Ga0207654_10054028 3300025911 Bacteria 2321
763 Ga0207654_10063973 3300025911 Unclassified 2161
764 Ga0207654_10163341 3300025911 Bacteria 1440
765 Ga0207654_10597734 3300025911 Bacteria 787
766 Ga0207654_10648243 3300025911 Bacteria 756
767 Ga0207707_10004345 3300025912 Bacteria 12541
768 Ga0207707_10082925 3300025912 Bacteria 2799
769 Ga0207707_10162934 3300025912 Bacteria 1949
770 Ga0207707_10671605 3300025912 Bacteria 872
771 Ga0207695_10000209 3300025913 Bacteria 157802
772 Ga0207695_10002106 3300025913 Bacteria 30249
773 Ga0207695_10002258 3300025913 Bacteria 28855
774 Ga0207695_10002430 3300025913 Bacteria 27580
775 Ga0207695_10010801 3300025913 Bacteria 11132
776 Ga0207695_10013165 3300025913 Bacteria 9872
777 Ga0207695_10020430 3300025913 Bacteria 7585
778 Ga0207695_10066998 3300025913 Bacteria 3684
779 Ga0207695_10080791 3300025913 Bacteria 3291
780 Ga0207695_10135248 3300025913 Bacteria 2418
781 Ga0207695_10146924 3300025913 Bacteria 2301
782 Ga0207695_10190290 3300025913 Bacteria 1970
783 Ga0207695_10696271 3300025913 Bacteria 897
784 Ga0207671_10000971 3300025914 Bacteria 35525
785 Ga0207671_10001368 3300025914 Bacteria 28441
786 Ga0207671_10001764 3300025914 Bacteria 24323
787 Ga0207671_10004891 3300025914 Bacteria 12589
788 Ga0207671_10011353 3300025914 Bacteria 7258
789 Ga0207671_10031686 3300025914 Bacteria 3939
790 Ga0207671_10036513 3300025914 Bacteria 3644
791 Ga0207671_10523540 3300025914 Bacteria 945
792 Ga0207660_10021033 3300025917 Bacteria 4384
793 Ga0207662_10086377 3300025918 Bacteria 1922
794 Ga0207662_10125757 3300025918 Bacteria 1612
795 Ga0207662_10235699 3300025918 Bacteria 1196
796 Ga0207657_10003011 3300025919 Bacteria 18059
797 Ga0207657_10035108 3300025919 Bacteria 4500
798 Ga0207657_10109615 3300025919 Unclassified 2281
799 Ga0207649_10001251 3300025920 Bacteria 15197
800 Ga0207649_10015091 3300025920 Bacteria 4338
801 Ga0207649_10042817 3300025920 Bacteria 2764
802 Ga0207649_10335198 3300025920 Bacteria 1115
803 Ga0207649_10714181 3300025920 Bacteria 778
804 Ga0207652_10002096 3300025921 Bacteria 17145
805 Ga0207652_10003075 3300025921 Bacteria 13931
806 Ga0207652_10067499 3300025921 Unclassified 3102
807 Ga0207652_10068797 3300025921 Bacteria 3072
808 Ga0207646_10549979 3300025922 Bacteria 1038
809 Ga0207681_10167712 3300025923 Bacteria 1661
810 Ga0207681_10192725 3300025923 Bacteria 1560
811 Ga0207681_10295624 3300025923 Bacteria 1280
812 Ga0207694_10002249 3300025924 Bacteria 15815
813 Ga0207694_10059489 3300025924 Bacteria 2971
814 Ga0207694_10152999 3300025924 Bacteria 1859
815 Ga0207694_10195292 3300025924 Unclassified 1645
816 Ga0207650_10003712 3300025925 Bacteria 10439
817 Ga0207650_10006841 3300025925 Bacteria 7780
818 Ga0207650_10007835 3300025925 Bacteria 7276
819 Ga0207650_10106939 3300025925 Unclassified 2161
820 Ga0207650_10146887 3300025925 Bacteria 1858
821 Ga0207650_10220871 3300025925 Bacteria 1525
822 Ga0207650_10239268 3300025925 Bacteria 1467
823 Ga0207650_10286902 3300025925 Bacteria 1341
824 Ga0207650_10725315 3300025925 Bacteria 840
825 Ga0207659_10004664 3300025926 Bacteria 8302
826 Ga0207659_10071846 3300025926 Bacteria 2528
827 Ga0207659_10114084 3300025926 Bacteria 2059
828 Ga0207659_10144451 3300025926 Bacteria 1851
829 Ga0207659_10276032 3300025926 Bacteria 1372
830 Ga0207659_10321188 3300025926 Bacteria 1277
831 Ga0207659_10376042 3300025926 Bacteria 1184
832 Ga0207659_10421235 3300025926 Bacteria 1120
833 Ga0207659_10574705 3300025926 Bacteria 959
834 Ga0207659_10819521 3300025926 Bacteria 800
835 Ga0207644_10019705 3300025931 Bacteria 4581
836 Ga0207644_10071023 3300025931 Bacteria 2546
837 Ga0207644_10134985 3300025931 Bacteria 1894
838 Ga0207644_10172330 3300025931 Bacteria 1690
839 Ga0207644_10184751 3300025931 Bacteria 1636
840 Ga0207644_10477553 3300025931 Bacteria 1026
841 Ga0207690_10016382 3300025932 Bacteria 4507
842 Ga0207690_10239253 3300025932 Bacteria 1397
843 Ga0207690_10365846 3300025932 Bacteria 1143
844 Ga0207690_10896436 3300025932 Bacteria 735
845 Ga0207706_10012656 3300025933 Bacteria 7677
846 Ga0207706_10021859 3300025933 Bacteria 5742
847 Ga0207706_10023622 3300025933 Bacteria 5520
848 Ga0207706_10033333 3300025933 Bacteria 4585
849 Ga0207706_10046152 3300025933 Unclassified 3858
850 Ga0207706_10053629 3300025933 Bacteria 3559
851 Ga0207706_10067794 3300025933 Bacteria 3140
852 Ga0207686_10000379 3300025934 Bacteria 30995
853 Ga0207686_10037347 3300025934 Bacteria 2930
854 Ga0207686_10059144 3300025934 Bacteria 2420
855 Ga0207686_10345289 3300025934 Bacteria 1119
856 Ga0207709_10088938 3300025935 Unclassified 2012
857 Ga0207670_10005077 3300025936 Bacteria 7183
858 Ga0207670_10030685 3300025936 Bacteria 3435
859 Ga0207670_10053752 3300025936 Bacteria 2715
860 Ga0207670_10112318 3300025936 Bacteria 1966
861 Ga0207670_10529896 3300025936 Bacteria 960
862 Ga0207670_10863130 3300025936 Bacteria 756
863 Ga0207669_10273355 3300025937 Bacteria 1270
864 Ga0207704_10152186 3300025938 Bacteria 1634
865 Ga0207704_10231178 3300025938 Bacteria 1375
866 Ga0207704_10382948 3300025938 Bacteria 1105
867 Ga0207691_10000753 3300025940 Bacteria 32051
868 Ga0207691_10043521 3300025940 Bacteria 4138
869 Ga0207691_10050228 3300025940 Bacteria 3818
870 Ga0207691_10087889 3300025940 Bacteria 2788
871 Ga0207691_10218555 3300025940 Bacteria 1653
872 Ga0207691_10237117 3300025940 Bacteria 1578
873 Ga0207691_10406055 3300025940 Bacteria 1162
874 Ga0207711_10039301 3300025941 Bacteria 4025
875 Ga0207711_10264770 3300025941 Bacteria 1581
876 Ga0207689_10002902 3300025942 Bacteria 15820
877 Ga0207689_10004913 3300025942 Bacteria 12042
878 Ga0207689_10007608 3300025942 Bacteria 9490
879 Ga0207689_10010865 3300025942 Bacteria 7830
880 Ga0207689_10016418 3300025942 Bacteria 6268
881 Ga0207689_10026318 3300025942 Bacteria 4871
882 Ga0207689_10026842 3300025942 Bacteria 4821
883 Ga0207689_10039616 3300025942 Bacteria 3900
884 Ga0207689_10096195 3300025942 Bacteria 2432
885 Ga0207689_10407461 3300025942 Bacteria 1134
886 Ga0207689_10436653 3300025942 Unclassified 1093
887 Ga0207689_10660302 3300025942 Bacteria 881
888 Ga0207661_10000282 3300025944 Bacteria 32518
889 Ga0207661_10013413 3300025944 Bacteria 5985
890 Ga0207661_10082624 3300025944 Bacteria 2656
891 Ga0207661_10109990 3300025944 Bacteria 2328
892 Ga0207661_10137090 3300025944 Bacteria 2103
893 Ga0207661_10171704 3300025944 Bacteria 1888
894 Ga0207661_10539719 3300025944 Bacteria 1068
895 Ga0207661_10771426 3300025944 Bacteria 885
896 Ga0207679_10000304 3300025945 Bacteria 36952
897 Ga0207679_10074199 3300025945 Bacteria 2577
898 Ga0207679_10075601 3300025945 Bacteria 2556
899 Ga0207679_10079702 3300025945 Bacteria 2498
900 Ga0207679_10105236 3300025945 Bacteria 2215
901 Ga0207679_10177741 3300025945 Unclassified 1758
902 Ga0207679_10445585 3300025945 Bacteria 1147
903 Ga0207667_10001843 3300025949 Bacteria 26625
904 Ga0207667_10027484 3300025949 Bacteria 6191
905 Ga0207667_10032326 3300025949 Bacteria 5640
906 Ga0207667_10074480 3300025949 Bacteria 3527
907 Ga0207667_10075993 3300025949 Bacteria 3486
908 Ga0207667_10097102 3300025949 Bacteria 3041
909 Ga0207667_10499634 3300025949 Unclassified 1234
910 Ga0207667_10536308 3300025949 Bacteria 1184
911 Ga0207667_10576358 3300025949 Bacteria 1136
912 Ga0207667_11221339 3300025949 Bacteria 731
913 Ga0207651_10008959 3300025960 Bacteria 5437
914 Ga0207651_10010825 3300025960 Bacteria 5074
915 Ga0207651_10016114 3300025960 Bacteria 4367
916 Ga0207651_10054890 3300025960 Bacteria 2733
917 Ga0207651_10099226 3300025960 Bacteria 2156
918 Ga0207651_10520589 3300025960 Bacteria 1031
919 Ga0207651_10768728 3300025960 Bacteria 852
920 Ga0207651_10933159 3300025960 Bacteria 774
921 Ga0207712_10001280 3300025961 Bacteria 17286
922 Ga0207712_10008286 3300025961 Bacteria 6570
923 Ga0207712_10018979 3300025961 Bacteria 4486
924 Ga0207712_10053909 3300025961 Bacteria 2823
925 Ga0207712_10072507 3300025961 Bacteria 2480
926 Ga0207712_10073651 3300025961 Bacteria 2464
927 Ga0207712_10156640 3300025961 Bacteria 1765
928 Ga0207712_10559156 3300025961 Bacteria 985
929 Ga0207712_10999876 3300025961 Bacteria 742
930 Ga0207668_10014689 3300025972 Bacteria 4851
931 Ga0207668_10022133 3300025972 Bacteria 4064
932 Ga0207668_10033343 3300025972 Bacteria 3410
933 Ga0207668_10047176 3300025972 Bacteria 2948
934 Ga0207668_10202403 3300025972 Bacteria 1582
935 Ga0207640_10085567 3300025981 Bacteria 2168
936 Ga0207640_10225331 3300025981 Bacteria 1438
937 Ga0207640_10284160 3300025981 Bacteria 1301
938 Ga0207640_10461748 3300025981 Unclassified 1049
939 Ga0207640_10478061 3300025981 Bacteria 1033
940 Ga0207658_10025520 3300025986 Bacteria 4138
941 Ga0207658_10036724 3300025986 Bacteria 3515
942 Ga0207658_10064221 3300025986 Bacteria 2753
943 Ga0207658_10134138 3300025986 Bacteria 1994
944 Ga0207658_10154370 3300025986 Bacteria 1874
945 Ga0207658_10185190 3300025986 Bacteria 1726
946 Ga0207658_10936784 3300025986 Bacteria 789
947 Ga0207658_11054459 3300025986 Bacteria 742
948 Ga0207677_10010210 3300026023 Bacteria 5307
949 Ga0207677_10010827 3300026023 Bacteria 5173
950 Ga0207677_10075423 3300026023 Unclassified 2397
951 Ga0207677_10316931 3300026023 Bacteria 1294
952 Ga0207677_10337240 3300026023 Bacteria 1258
953 Ga0207677_10360967 3300026023 Bacteria 1220
954 Ga0207677_10369176 3300026023 Bacteria 1208
955 Ga0207677_10559675 3300026023 Bacteria 998
956 Ga0207703_10001511 3300026035 Bacteria 21202
957 Ga0207703_10058716 3300026035 Bacteria 3141
958 Ga0207703_10075589 3300026035 Bacteria 2792
959 Ga0207703_10147465 3300026035 Bacteria 2048
960 Ga0207703_10205330 3300026035 Bacteria 1753
961 Ga0207703_10306723 3300026035 Bacteria 1450
962 Ga0207639_10004009 3300026041 Bacteria 9940
963 Ga0207639_10027126 3300026041 Bacteria 4168
964 Ga0207639_10081993 3300026041 Bacteria 2556
965 Ga0207639_10200977 3300026041 Unclassified 1709
966 Ga0207639_10252396 3300026041 Bacteria 1539
967 Ga0207639_10522817 3300026041 Unclassified 1087
968 Ga0207639_10657493 3300026041 Unclassified 970
969 Ga0207639_11028335 3300026041 Bacteria 772
970 Ga0207678_10092396 3300026067 Bacteria 2586
971 Ga0207678_10148849 3300026067 Bacteria 1999
972 Ga0207708_10943601 3300026075 Bacteria 748
973 Ga0207702_10063143 3300026078 Bacteria 3166
974 Ga0207702_10089600 3300026078 Bacteria 2690
975 Ga0207702_10105348 3300026078 Bacteria 2498
976 Ga0207702_10289918 3300026078 Unclassified 1550
977 Ga0207702_10753119 3300026078 Bacteria 961
978 Ga0207702_10963850 3300026078 Unclassified 846
979 Ga0207641_10000058 3300026088 Bacteria 166385
980 Ga0207641_10000627 3300026088 Bacteria 38592
981 Ga0207641_10041538 3300026088 Bacteria 3854
982 Ga0207641_10049403 3300026088 Unclassified 3554
983 Ga0207641_10063692 3300026088 Bacteria 3150
984 Ga0207641_10068779 3300026088 Bacteria 3037
985 Ga0207641_10104323 3300026088 Unclassified 2503
986 Ga0207641_10109672 3300026088 Bacteria 2445
987 Ga0207641_10137660 3300026088 Bacteria 2199
988 Ga0207641_10302865 3300026088 Bacteria 1510
989 Ga0207641_10396093 3300026088 Bacteria 1325
990 Ga0207648_10000739 3300026089 Bacteria 36659
991 Ga0207648_10000768 3300026089 Bacteria 36105
992 Ga0207648_10002407 3300026089 Bacteria 20149
993 Ga0207648_10006875 3300026089 Bacteria 11280
994 Ga0207648_10031326 3300026089 Bacteria 4701
995 Ga0207648_10035588 3300026089 Bacteria 4387
996 Ga0207648_10042904 3300026089 Bacteria 3972
997 Ga0207648_10067015 3300026089 Unclassified 3130
998 Ga0207648_10068941 3300026089 Bacteria 3082
999 Ga0207648_10100465 3300026089 Bacteria 2534
1000 Ga0207648_10167608 3300026089 Bacteria 1941
1001 Ga0207648_10187476 3300026089 Bacteria 1832
1002 Ga0207648_10210084 3300026089 Bacteria 1727
1003 Ga0207648_10664101 3300026089 Bacteria 964
1004 Ga0207676_10003726 3300026095 Bacteria 10776
1005 Ga0207676_10025840 3300026095 Bacteria 4360
1006 Ga0207676_10038012 3300026095 Bacteria 3672
1007 Ga0207676_10042685 3300026095 Bacteria 3488
1008 Ga0207676_10134381 3300026095 Bacteria 2108
1009 Ga0207676_10190485 3300026095 Bacteria 1804
1010 Ga0207676_10217877 3300026095 Bacteria 1698
1011 Ga0207676_10331542 3300026095 Bacteria 1401
1012 Ga0207676_10460741 3300026095 Unclassified 1200
1013 Ga0207676_11158422 3300026095 Bacteria 765
1014 Ga0207674_10001969 3300026116 Bacteria 26000
1015 Ga0207674_10004112 3300026116 Bacteria 17616
1016 Ga0207674_10005133 3300026116 Bacteria 15625
1017 Ga0207674_10011676 3300026116 Bacteria 9861
1018 Ga0207674_10041154 3300026116 Bacteria 4780
1019 Ga0207674_10041697 3300026116 Bacteria 4745
1020 Ga0207674_10056984 3300026116 Bacteria 3963
1021 Ga0207674_10059521 3300026116 Bacteria 3865
1022 Ga0207674_10071410 3300026116 Unclassified 3488
1023 Ga0207674_10360213 3300026116 Bacteria 1406
1024 Ga0207674_10455588 3300026116 Bacteria 1236
1025 Ga0207674_10525356 3300026116 Bacteria 1143
1026 Ga0207674_10568493 3300026116 Bacteria 1095
1027 Ga0207674_10962674 3300026116 Bacteria 822
1028 Ga0207675_100000610 3300026118 Bacteria 34895
1029 Ga0207675_100014840 3300026118 Bacteria 7271
1030 Ga0207675_100030346 3300026118 Bacteria 5035
1031 Ga0207675_100112041 3300026118 Bacteria 2575
1032 Ga0207675_100187606 3300026118 Unclassified 1982
1033 Ga0207675_100590576 3300026118 Unclassified 1113
1034 Ga0207675_100728483 3300026118 Bacteria 1002
1035 Ga0207683_10000651 3300026121 Bacteria 31796
1036 Ga0207683_10002030 3300026121 Bacteria 17898
1037 Ga0207683_10164904 3300026121 Unclassified 2004
1038 Ga0207683_10321147 3300026121 Bacteria 1418
1039 Ga0207683_10829407 3300026121 Bacteria 858
1040 Ga0207698_10007369 3300026142 Bacteria 6894
1041 Ga0207698_10017577 3300026142 Bacteria 4857
1042 Ga0207698_10022588 3300026142 Bacteria 4375
1043 Ga0207698_10027326 3300026142 Bacteria 4049
1044 Ga0207698_10059020 3300026142 Bacteria 2977
1045 Ga0207698_10082547 3300026142 Bacteria 2598
1046 Ga0207698_10195712 3300026142 Bacteria 1805
1047 Ga0207698_10212436 3300026142 Unclassified 1742
1048 Ga0207698_10226193 3300026142 Bacteria 1695
1049 Ga0207698_10320931 3300026142 Bacteria 1450
1050 Ga0207698_10405561 3300026142 Bacteria 1304
1051 Ga0207698_10432576 3300026142 Bacteria 1266
1052 Ga0207698_10650134 3300026142 Bacteria 1044
1053 Ga0207698_10669866 3300026142 Bacteria 1030
1054 Ga0207698_11002369 3300026142 Bacteria 846
1055 Ga0209984_1011710 3300027424 Bacteria 1139
1056 Ga0207428_10041576 3300027907 Bacteria 3720
1057 Ga0207428_10526443 3300027907 Bacteria 857
1058 Ga0268266_10000169 3300028379 Bacteria 119437
1059 Ga0268266_10119085 3300028379 Bacteria 2348
1060 Ga0268266_10308454 3300028379 Bacteria 1478
1061 Ga0268266_10684736 3300028379 Bacteria 988
1062 Ga0268266_10864923 3300028379 Bacteria 874
1063 Ga0268266_11037186 3300028379 Bacteria 793
1064 Ga0268265_10018367 3300028380 Bacteria 4844
1065 Ga0268265_10051463 3300028380 Bacteria 3109
1066 Ga0268265_10214670 3300028380 Bacteria 1679
1067 Ga0268265_10280845 3300028380 Bacteria 1490
1068 Ga0268265_10483491 3300028380 Bacteria 1163
1069 Ga0268265_10606658 3300028380 Bacteria 1047
1070 Ga0268265_11282271 3300028380 Bacteria 732
1071 Ga0268264_10000063 3300028381 Bacteria 301702
1072 Ga0268264_10002060 3300028381 Bacteria 17930
1073 Ga0268264_10006381 3300028381 Bacteria 9939
1074 Ga0268264_10007051 3300028381 Bacteria 9425
1075 Ga0268264_10008422 3300028381 Bacteria 8572
1076 Ga0268264_10008670 3300028381 Bacteria 8449
1077 Ga0268264_10029753 3300028381 Bacteria 4476
1078 Ga0268264_10040069 3300028381 Unclassified 3871
1079 Ga0268264_10100525 3300028381 Bacteria 2512
1080 Ga0268264_10178198 3300028381 Unclassified 1928
1081 Ga0268264_10261314 3300028381 Bacteria 1613
1082 Ga0268264_10342847 3300028381 Bacteria 1420
1083 Ga0307517_10000487 3300028786 Bacteria 68165
1084 Ga0307517_10167345 3300028786 Bacteria 1456
1085 Ga0307517_10248431 3300028786 Bacteria 1047
1086 Ga0307515_10000012 3300028794 Bacteria 582232
1087 Ga0307515_10000059 3300028794 Bacteria 257520
1088 Ga0307511_10021092 3300030521 Bacteria 6152
1089 Ga0265327_10000024 3300031251 Bacteria 382499
1090 Ga0265327_10000048 3300031251 Bacteria 269173
1091 Ga0265327_10016419 3300031251 Bacteria 4704
1092 Ga0265327_10029079 3300031251 Bacteria 3148
1093 Ga0265316_10267876 3300031344 Unclassified 1251
1094 Ga0307513_10168152 3300031456 Bacteria 2074
1095 Ga0307513_10610889 3300031456 Unclassified 799
1096 Ga0307509_10167237 3300031507 Unclassified 2085
1097 Ga0307509_10268431 3300031507 Bacteria 1476
1098 Ga0307509_10395808 3300031507 Bacteria 1090
1099 Ga0307408_100158217 3300031548 Bacteria 1796
1100 Ga0265313_10121691 3300031595 Bacteria 1137
1101 Ga0307508_10001171 3300031616 Bacteria 30157
1102 Ga0307508_10138399 3300031616 Bacteria 2038
1103 Ga0307508_10191802 3300031616 Bacteria 1645
1104 Ga0307516_10000384 3300031730 Bacteria 57633
1105 Ga0307405_10178518 3300031731 Bacteria 1522
1106 Ga0307413_10229040 3300031824 Bacteria 1363
1107 Ga0307413_10479365 3300031824 Bacteria 994
1108 Ga0307410_10025475 3300031852 Bacteria 3713
1109 Ga0307407_10398462 3300031903 Bacteria 987
1110 Ga0307409_100231124 3300031995 Bacteria 1677
1111 Ga0307414_10621503 3300032004 Bacteria 971
1112 Ga0307411_10450758 3300032005 Bacteria 1076
1113 Ga0307411_10605308 3300032005 Unclassified 943
1114 Ga0307507_10145799 3300033179 Bacteria 1799
1115 Ga0307510_10000336 3300033180 Bacteria 43815
1116 Ga0373934_0024549 3300035086 Bacteria 2331
1117 Ga0373936_0065728 3300035113 Bacteria 1488
1118 Ga0373955_0064317 3300035172 Bacteria 2033
1119 Ga0373924_0033853 3300035410 Bacteria 2065
1120 Ga0373931_0202388 3300035691 Unclassified 1187
1121 Ga0373935_0288996 3300035692 Bacteria 1156
1122 Ga0373927_0306480 3300035695 Bacteria 1045
1123 Ga0373933_0267856 3300035724 Bacteria 1102
1124 Ga0373933_0537092 3300035724 Unclassified 767
1125 Ga0373947_0702355 3300035725 Bacteria 690
1126 Ga0373937_0002819 3300036401 Bacteria 14528
1127 Ga0373937_0074889 3300036401 Bacteria 3125
1128 Ga0373937_1165821 3300036401 Bacteria 719
1129 Ga0373925_0192164 3300037068 Bacteria 1620
1130 Ga0373925_0426244 3300037068 Bacteria 1084
1131 Ga0395900_0005152 3300037418 Bacteria 13732
1132 Ga0395900_0042117 3300037418 Bacteria 4704
1133 Ga0395900_0300414 3300037418 Bacteria 1592
1134 Ga0395898_0098464 3300037466 Bacteria 2808
1135 Ga0395905_0002863 3300037471 Bacteria 18845
1136 Ga0395905_0014192 3300037471 Bacteria 7610
1137 Ga0395901_0739082 3300038443 Bacteria 978
1138 Ga0436365_0072673 3300039437 Bacteria 6638
1139 Ga0436365_0106519 3300039437 Bacteria 987
1140 Ga0436365_1178762 3300039437 Bacteria 1636
1141 Ga0436365_1933142 3300039437 Bacteria 64226
1142 Ga0439439_0027928 3300041406 Bacteria 1427
1143 Ga0439465_0010784 3300041413 Bacteria 2867
1144 Ga0451798_1024879 3300041458 Bacteria 848
1145 Ga0451800_1125868 3300041459 Bacteria 1470
1146 Ga0451802_0608510 3300041460 Bacteria 1942
1147 Ga0451807_2769657 3300041486 Bacteria 1421
1148 Ga0451835_1115397 3300041492 Bacteria 1363
1149 Ga0451851_0430098 3300041507 Bacteria 1313
1150 Ga0451853_0199542 3300041512 Bacteria 1147
1151 Ga0439431_0028196 3300041997 Bacteria 1382
1152 Ga0439433_0029971 3300041999 Bacteria 1243
1153 Ga0439441_005423 3300042001 Bacteria 1981
1154 Ga0439443_011468 3300042003 Bacteria 1299
1155 Ga0439445_0021990 3300042004 Bacteria 1605
1156 Ga0439448_0167442 3300042005 Bacteria 766
1157 Ga0439449_0001478 3300042007 Bacteria 9210
1158 Ga0439449_0007781 3300042007 Bacteria 4069
1159 Ga0439449_0014732 3300042007 Bacteria 2938
1160 Ga0439449_0099903 3300042007 Unclassified 1072
1161 Ga0439457_000285 3300042014 Bacteria 14022
1162 Ga0439457_019598 3300042014 Bacteria 1503
1163 Ga0439457_079903 3300042014 Bacteria 751
1164 Ga0439457_085194 3300042014 Bacteria 728
1165 Ga0439462_0001557 3300042015 Bacteria 5146
1166 Ga0439462_0013480 3300042015 Bacteria 2095
1167 Ga0439462_0031028 3300042015 Bacteria 1415
1168 Ga0439462_0037093 3300042015 Unclassified 1298
1169 Ga0450922_003706 3300042124 Bacteria 1405
1170 Ga0450923_004776 3300042125 Bacteria 2146
1171 Ga0439446_0092293 3300042156 Bacteria 949
1172 Ga0439446_0170661 3300042156 Bacteria 723
1173 Ga0439434_0019904 3300042435 Bacteria 2014
1174 Ga0451577_0002711 3300042876 Bacteria 20608
1175 Ga0451577_0147121 3300042876 Bacteria 2119
1176 Ga0451577_0192632 3300042876 Unclassified 1839
1177 Ga0466969_0000730 3300044656 Bacteria 17779
1178 Ga0466972_0000001 3300044658 Bacteria 412457
1179 Ga0466972_0000082 3300044658 Bacteria 88592
1180 Ga0466972_0002412 3300044658 Bacteria 9214
1181 Ga0453683_0047186 3300044673 Bacteria 2700
1182 Ga0453683_0219278 3300044673 Bacteria 1209
1183 Ga0466965_0253014 3300044683 Bacteria 945
1184 Ga0466966_0000501 3300044684 Bacteria 25083
1185 Ga0466961_0043828 3300044693 Bacteria 2865
1186 Ga0466961_0107712 3300044693 Bacteria 1754
1187 Ga0466964_0052662 3300044706 Bacteria 1673
1188 Ga0453684_0003843 3300044712 Bacteria 33115
1189 Ga0453684_0059693 3300044712 Bacteria 4914
1190 Ga0453684_0107331 3300044712 Bacteria 3400
1191 Ga0453684_0563307 3300044712 Bacteria 1253
1192 Ga0466968_0074621 3300044735 Bacteria 1481
1193 Ga0466970_0000065 3300044765 Bacteria 41709
1194 Ga0466970_0053511 3300044765 Bacteria 2156
1195 Ga0466970_0307650 3300044765 Bacteria 895
1196 Ga0466957_0000068 3300044842 Bacteria 40031
1197 Ga0466957_0004118 3300044842 Bacteria 8054
1198 Ga0466960_0040510 3300044901 Bacteria 2203
1199 Ga0466960_0050595 3300044901 Bacteria 2004
1200 Ga0466959_0000035 3300045049 Bacteria 108669
1201 Ga0466959_0000676 3300045049 Bacteria 19916
1202 Ga0451576_0485268 3300045051 Bacteria 1298
1203 Ga0466958_0002924 3300045836 Bacteria 8729
1204 Ga0495638_0105944 3300046460 Bacteria 1675
1205 Ga0495638_0106296 3300046460 Unclassified 1672
1206 Ga0495638_0130274 3300046460 Bacteria 1478
1207 Ga0495638_0140904 3300046460 Bacteria 1407
1208 Ga0495638_0143686 3300046460 Bacteria 1390
1209 Ga0495653_0099869 3300046463 Bacteria 2105
1210 Ga0495650_0150327 3300046471 Bacteria 836
1211 Ga0495662_0312842 3300046476 Bacteria 772
1212 Ga0495606_0004941 3300046507 Bacteria 13036
1213 Ga0495608_0077443 3300046511 Bacteria 2165
1214 Ga0495618_0038494 3300046514 Bacteria 3006
1215 Ga0495628_0153910 3300046516 Bacteria 1750
1216 Ga0495630_0020077 3300046517 Bacteria 4921
1217 Ga0495643_0042332 3300046522 Bacteria 2481
1218 Ga0495648_0002648 3300046524 Bacteria 16239
1219 Ga0495652_0204138 3300046529 Bacteria 1498
1220 Ga0495587_0040141 3300046536 Bacteria 2799
1221 Ga0495633_0017521 3300046558 Bacteria 3660
1222 Ga0495667_0132724 3300046559 Bacteria 1606
1223 Ga0495668_0000082 3300046616 Bacteria 154982
1224 Ga0495634_0047261 3300046642 Bacteria 2901
1225 Ga0495611_0002532 3300046648 Bacteria 8310
1226 Ga0495611_0200656 3300046648 Bacteria 930
1227 Ga0495625_0115255 3300046660 Bacteria 1834
1228 Ga0495635_0229698 3300046663 Bacteria 1254
1229 Ga0495657_0067603 3300046675 Bacteria 2345
1230 Ga0495599_0114874 3300046678 Bacteria 1675
1231 Ga0495658_0341361 3300046683 Bacteria 951
1232 Ga0495613_0078638 3300046689 Bacteria 2399
1233 Ga0495613_0086649 3300046689 Bacteria 2271
1234 Ga0495670_0009818 3300046691 Bacteria 4706
1235 Ga0495670_0233372 3300046691 Bacteria 979
1236 Ga0495649_0051477 3300046694 Bacteria 2232
1237 Ga0495600_0051793 3300046809 Bacteria 2680
1238 Ga0495604_0148105 3300047317 Bacteria 1671
1239 Ga0495672_0035973 3300047320 Bacteria 3045
1240 Ga0495687_001778 3300047443 Bacteria 19030
1241 Ga0495684_0121438 3300047471 Bacteria 1967
1242 Ga0495684_0211774 3300047471 Unclassified 1425
1243 Ga0495686_0000010 3300047472 Bacteria 573229
1244 Ga0495686_0252057 3300047472 Bacteria 992
1245 Ga0495686_0287524 3300047472 Bacteria 912
1246 Ga0496100_0264300 3300048903 Bacteria 1277
1247 Ga0496101_0028286 3300048904 Bacteria 3913
1248 Ga0496104_0822484 3300048907 Bacteria 835
1249 Ga0496107_0643672 3300048910 Bacteria 782
1250 Ga0496108_0340372 3300048911 Bacteria 1309
1251 Ga0496109_0068093 3300048912 Bacteria 3263
1252 Ga0496109_0157027 3300048912 Bacteria 2131
1253 Ga0496110_0024996 3300048913 Bacteria 5099
1254 Ga0496113_0440364 3300048916 Bacteria 1047
1255 Ga0496115_0172599 3300048918 Bacteria 1788
1256 Ga0496124_0060903 3300048927 Bacteria 3165
1257 Ga0501308_015872 3300049128 Bacteria 896
1258 Ga0501305_002297 3300049161 Bacteria 2041
1259 Ga0501290_005229 3300049513 Bacteria 1622
1260 Ga0501294_023272 3300049517 Bacteria 684
1261 Ga0501297_013979 3300049520 Bacteria 946
1262 Ga0501298_000356 3300049521 Bacteria 6138
1263 Ga0501312_018081 3300049528 Bacteria 1023
1264 Ga0501031_0057102 3300049568 Bacteria 2543
1265 Ga0501031_0143341 3300049568 Bacteria 1561
1266 Ga0501032_0003107 3300049569 Bacteria 12808
1267 Ga0501032_0100156 3300049569 Bacteria 1920
1268 Ga0501032_0158192 3300049569 Bacteria 1488
1269 Ga0501033_0053227 3300049570 Bacteria 2998
1270 Ga0501033_0128977 3300049570 Bacteria 1833
1271 Ga0501034_0000152 3300049571 Bacteria 130576
1272 Ga0501034_0003047 3300049571 Bacteria 19373
1273 Ga0501034_0053007 3300049571 Bacteria 4086
1274 Ga0501034_0109945 3300049571 Bacteria 2747
1275 Ga0501034_0172210 3300049571 Unclassified 2132
1276 Ga0501034_0172211 3300049571 Bacteria 2132
1277 Ga0501034_0176165 3300049571 Bacteria 2104
1278 Ga0501034_0407042 3300049571 Bacteria 1283
1279 Ga0501036_0018493 3300049572 Bacteria 5840
1280 Ga0501036_0019548 3300049572 Bacteria 5686
1281 Ga0501037_0059018 3300049573 Bacteria 2799
1282 Ga0501037_0147649 3300049573 Bacteria 1681
1283 Ga0501038_0006357 3300049574 Bacteria 10936
1284 Ga0501038_0115360 3300049574 Bacteria 2220
1285 Ga0501039_0100166 3300049575 Bacteria 2261
1286 Ga0501039_0186019 3300049575 Bacteria 1633
1287 Ga0501043_0011480 3300049579 Bacteria 6935
1288 Ga0501043_0064064 3300049579 Bacteria 2887
1289 Ga0501043_0084991 3300049579 Bacteria 2487
1290 Ga0501043_0104350 3300049579 Bacteria 2227
1291 Ga0501046_0004991 3300049580 Bacteria 11916
1292 Ga0501046_0120690 3300049580 Bacteria 1994
1293 Ga0501047_0055644 3300049581 Bacteria 3825
1294 Ga0501047_0058871 3300049581 Bacteria 3711
1295 Ga0501047_0069981 3300049581 Bacteria 3378
1296 Ga0501047_0179502 3300049581 Bacteria 1984
1297 Ga0501047_0416610 3300049581 Bacteria 1175
1298 Ga0501047_0679860 3300049581 Bacteria 847
1299 Ga0501047_0814958 3300049581 Bacteria 748
1300 Ga0501048_0009237 3300049582 Bacteria 7409
1301 Ga0501067_0038781 3300049583 Bacteria 2645
1302 Ga0501067_0202777 3300049583 Bacteria 1105
1303 Ga0501069_0079890 3300049585 Unclassified 1841
1304 Ga0501070_0025897 3300049586 Bacteria 4921
1305 Ga0501070_0186795 3300049586 Bacteria 1705
1306 Ga0501072_0151976 3300049588 Bacteria 1846
1307 Ga0501072_0172464 3300049588 Bacteria 1726
1308 Ga0501073_0001997 3300049589 Bacteria 15220
1309 Ga0501073_0028803 3300049589 Bacteria 3968
1310 Ga0501074_0025471 3300049590 Bacteria 4296
1311 Ga0501198_000395 3300049649 Bacteria 5402
1312 Ga0501201_000318 3300049651 Bacteria 4422
1313 Ga0501202_005266 3300049652 Bacteria 2290
1314 Ga0501202_032559 3300049652 Bacteria 1095
1315 Ga0501206_000308 3300049653 Bacteria 5720
1316 Ga0501207_002499 3300049654 Bacteria 2381
1317 Ga0501207_003196 3300049654 Bacteria 2167
1318 Ga0501217_000111 3300049661 Bacteria 10486
1319 Ga0501223_000680 3300049663 Bacteria 8106
1320 Ga0501224_000263 3300049664 Bacteria 6030
1321 Ga0501227_073160 3300049665 Bacteria 891
1322 Ga0501233_006270 3300049668 Bacteria 2230
1323 Ga0501235_000208 3300049669 Bacteria 10465
1324 Ga0501242_000919 3300049674 Bacteria 2808
1325 Ga0501246_004558 3300049676 Bacteria 1144
1326 Ga0501251_001644 3300049681 Bacteria 2113
1327 Ga0501252_004478 3300049682 Bacteria 1489
1328 Ga0501253_002910 3300049683 Bacteria 1989
1329 Ga0501257_028946 3300049686 Bacteria 1330
1330 Ga0501259_000655 3300049688 Bacteria 5560
1331 Ga0501261_000904 3300049690 Bacteria 3673
1332 Ga0501219_000531 3300049703 Bacteria 5697
1333 Ga0501221_000397 3300049704 Bacteria 6681
1334 Ga0501225_0000233 3300049705 Bacteria 17294
1335 Ga0501225_0000726 3300049705 Bacteria 10349
1336 Ga0501225_0043241 3300049705 Bacteria 1245
1337 Ga0501234_008232 3300049707 Bacteria 1628
1338 Ga0501245_000736 3300049708 Bacteria 4059
1339 Ga0501079_0049102 3300049741 Bacteria 3257
1340 Ga0501080_0019380 3300049742 Bacteria 6303
1341 Ga0501080_0197277 3300049742 Bacteria 1849
1342 Ga0501080_0233226 3300049742 Bacteria 1682
1343 Ga0501080_0444381 3300049742 Unclassified 1163
1344 Ga0501083_0025529 3300049744 Bacteria 4090
1345 Ga0501083_0058467 3300049744 Bacteria 2579
1346 Ga0501263_005496 3300049760 Bacteria 1432
1347 Ga0501264_017328 3300049761 Bacteria 739
1348 Ga0501268_017270 3300049765 Bacteria 1203
1349 Ga0501270_003552 3300049767 Bacteria 1692
1350 Ga0501270_005178 3300049767 Bacteria 1503
1351 Ga0501270_035267 3300049767 Unclassified 847
1352 Ga0501270_045688 3300049767 Bacteria 777
1353 Ga0501272_004052 3300049769 Bacteria 1513
1354 Ga0501279_015484 3300049775 Bacteria 1056
1355 Ga0501035_0003691 3300049822 Bacteria 14592
1356 Ga0501035_0009650 3300049822 Bacteria 8978
1357 Ga0501035_0194077 3300049822 Bacteria 1745
1358 Ga0501035_0469784 3300049822 Bacteria 1039
1359 Ga0501035_0595605 3300049822 Bacteria 901
1360 Ga0501044_0010522 3300049823 Bacteria 10039
1361 Ga0501044_0013426 3300049823 Bacteria 8857
1362 Ga0501044_0033294 3300049823 Bacteria 5417
1363 Ga0501044_0039830 3300049823 Bacteria 4900
1364 Ga0501044_0050002 3300049823 Bacteria 4315
1365 Ga0501045_0086700 3300049824 Bacteria 2311
1366 Ga0501212_001186 3300049851 Bacteria 2886
1367 Ga0501212_031808 3300049851 Bacteria 853
1368 Ga0501284_00017 3300050005 Bacteria 96362
1369 nmdc:mga0k408_11749_c1 3300050493 Bacteria 4776
1370 nmdc:mga0k408_122202_c1 3300050493 Bacteria 1543
1371 nmdc:mga0k408_13581_c1 3300050493 Bacteria 4471
1372 nmdc:mga0k408_18405_c1 3300050493 Bacteria 3900
1373 nmdc:mga0k408_94207_c1 3300050493 Unclassified 1761
1374 nmdc:mga05p37_104364_c1 3300050507 Bacteria 3487
1375 nmdc:mga05p37_167975_c1 3300050507 Bacteria 2677
1376 nmdc:mga05p37_419314_c1 3300050507 Bacteria 1558
1377 nmdc:mga09592_174407_c1 3300050508 Bacteria 1860
1378 nmdc:mga09592_93411_c1 3300050508 Bacteria 2572
1379 nmdc:mga0qj67_27449_c1 3300050509 Unclassified 4414
1380 nmdc:mga06r32_128331_c1 3300050510 Bacteria 2506
1381 nmdc:mga08y16_185540_c1 3300050511 Bacteria 2159
1382 nmdc:mga08y16_45049_c1 3300050511 Bacteria 4622
1383 Ga0495619_0164266 3300053085 Bacteria 1534
1384 Ga0495619_0568750 3300053085 Bacteria 777
1385 Ga0500578_0000060 3300053086 Bacteria 118274
1386 Ga0500578_0210606 3300053086 Bacteria 1186
1387 Ga0500644_0002545 3300053088 Bacteria 4556
1388 Ga0500644_0024560 3300053088 Bacteria 1844
1389 Ga0500646_0008048 3300053090 Bacteria 2695
1390 Ga0500646_0011263 3300053090 Bacteria 2298
1391 Ga0500583_0000003 3300053092 Bacteria 229587
1392 Ga0500583_0000778 3300053092 Bacteria 9253
1393 Ga0500651_0418566 3300053093 Bacteria 750
1394 Ga0500650_0210614 3300053098 Bacteria 883
1395 Ga0500562_000024 3300053108 Bacteria 105996
1396 Ga0500628_040824 3300053129 Bacteria 1059
1397 Ga0500642_0014700 3300053130 Bacteria 2921
1398 Ga0500652_032801 3300053131 Bacteria 2049
1399 Ga0500658_0039328 3300053134 Bacteria 1890
1400 Ga0500559_0045793 3300053136 Bacteria 1917
1401 Ga0500568_0001088 3300053139 Bacteria 18287
1402 Ga0500568_0009995 3300053139 Bacteria 4476
1403 Ga0500588_0006275 3300053146 Bacteria 2684
1404 Ga0500588_0040324 3300053146 Bacteria 1403
1405 Ga0500603_074465 3300053150 Bacteria 973
1406 Ga0500604_0003642 3300053151 Bacteria 4145
1407 Ga0500616_0014014 3300053153 Bacteria 4623
1408 Ga0500616_0051744 3300053153 Bacteria 2163
1409 Ga0500616_0093547 3300053153 Bacteria 1483
1410 Ga0500616_0105763 3300053153 Bacteria 1368
1411 Ga0500622_0000604 3300053156 Bacteria 32597
1412 Ga0500622_0004624 3300053156 Bacteria 8541
1413 Ga0500622_0074416 3300053156 Bacteria 1711
1414 Ga0500636_0254092 3300053177 Bacteria 894
1415 Ga0500611_000008 3300053727 Bacteria 198346
1416 Ga0500611_011533 3300053727 Bacteria 1465
1417 Ga0500645_008721 3300053730 Bacteria 3440
1418 Ga0500645_036823 3300053730 Bacteria 1455
1419 Ga0500645_052634 3300053730 Bacteria 1186
1420 Ga0501084_0021111 3300054114 Bacteria 5431
1421 Ga0466962_0007361 3300061719 Bacteria 5283

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10684736 Ga0268266_106847362 194
2 3300013104 Ga0157370_10275836 Ga0157370_102758362 203
3 3300013105 Ga0157369_10258902 Ga0157369_102589022 203
4 3300013308 Ga0157375_10756328 Ga0157375_107563281 203
5 3300014325 Ga0163163_10362371 Ga0163163_103623712 203
6 3300049822 Ga0501035_0469784 Ga0501035_0469784_23_640 203
7 3300031616 Ga0307508_10001171 Ga0307508_100011719 204
8 3300041486 Ga0451807_2769657 Ga0451807_2769657_739_1353 204
9 3300053085 Ga0495619_0568750 Ga0495619_0568750_20_643 204
10 3300005539 Ga0068853_100254631 Ga0068853_1002546312 205
11 3300005543 Ga0070672_100201192 Ga0070672_1002011921 205
12 3300025899 Ga0207642_10168603 Ga0207642_101686032 205
13 3300026041 Ga0207639_10522817 Ga0207639_105228171 205
14 3300005337 Ga0070682_100019906 Ga0070682_1000199064 206
15 3300005455 Ga0070663_100176381 Ga0070663_1001763812 206
16 3300013104 Ga0157370_10138668 Ga0157370_101386682 206
17 3300026067 Ga0207678_10148849 Ga0207678_101488492 206
18 iso_pu_bacteria 2818991444 2819585968 206
19 iso_pu_bacteria 2929154850 2929159264 206
20 iso_pu_bacteria 2738541278 2738725665 207
21 3300009176 Ga0105242_10892246 Ga0105242_108922461 208
22 3300037418 Ga0395900_0042117 Ga0395900_0042117_485_1120 208
23 3300044712 Ga0453684_0003843 Ga0453684_0003843_28349_28984 208
24 3300044901 Ga0466960_0040510 Ga0466960_0040510_130_768 208
25 3300049703 Ga0501219_000531 Ga0501219_000531_4971_5621 208
26 3300050005 Ga0501284_00017 Ga0501284_00017_87961_88611 208
27 3300003320 rootH2_10019419 rootH2_1001941934 209
28 3300003322 rootL2_10002424 rootL2_100024245 209
29 3300003322 rootL2_10009909 rootL2_100099092 209
30 3300003323 rootH1_10003786 rootH1_1000378610 209
31 3300005329 Ga0070683_100043907 Ga0070683_1000439074 209
32 3300005331 Ga0070670_100403953 Ga0070670_1004039532 209
33 3300005344 Ga0070661_100527248 Ga0070661_1005272481 209
34 3300005366 Ga0070659_100028202 Ga0070659_1000282024 209
35 3300005535 Ga0070684_100013209 Ga0070684_1000132092 209
36 3300005564 Ga0070664_100060522 Ga0070664_1000605224 209
37 3300005577 Ga0068857_100387300 Ga0068857_1003873002 209
38 3300005577 Ga0068857_100563801 Ga0068857_1005638012 209
39 3300005616 Ga0068852_100045323 Ga0068852_1000453236 209
40 3300005616 Ga0068852_100098861 Ga0068852_1000988612 209
41 3300013100 Ga0157373_10007569 Ga0157373_100075694 209
42 3300013102 Ga0157371_10018908 Ga0157371_100189083 209
43 3300013104 Ga0157370_10279370 Ga0157370_102793702 209
44 3300013105 Ga0157369_10016955 Ga0157369_100169554 209
45 3300013296 Ga0157374_10040524 Ga0157374_100405243 209
46 3300013296 Ga0157374_10111705 Ga0157374_101117052 209
47 3300013307 Ga0157372_10066758 Ga0157372_100667582 209
48 3300013307 Ga0157372_10182772 Ga0157372_101827722 209
49 3300013307 Ga0157372_10235085 Ga0157372_102350851 209
50 3300014969 Ga0157376_10402627 Ga0157376_104026272 209
51 3300025904 Ga0207647_10001560 Ga0207647_100015605 209
52 3300025912 Ga0207707_10671605 Ga0207707_106716052 209
53 3300025920 Ga0207649_10042817 Ga0207649_100428171 209
54 3300025932 Ga0207690_10365846 Ga0207690_103658462 209
55 3300025940 Ga0207691_10218555 Ga0207691_102185552 209
56 3300025944 Ga0207661_10082624 Ga0207661_100826242 209
57 3300025945 Ga0207679_10075601 Ga0207679_100756012 209
58 3300025960 Ga0207651_10933159 Ga0207651_109331591 209
59 3300026116 Ga0207674_10525356 Ga0207674_105253562 209
60 3300026142 Ga0207698_10017577 Ga0207698_100175772 209
61 3300027424 Ga0209984_1011710 Ga0209984_10117101 209
62 3300028794 Ga0307515_10000012 Ga0307515_10000012140 209
63 3300044673 Ga0453683_0047186 Ga0453683_0047186_2050_2682 209
64 3300044712 Ga0453684_0563307 Ga0453684_0563307_171_803 209
65 3300045051 Ga0451576_0485268 Ga0451576_0485268_160_792 209
66 3300048916 Ga0496113_0440364 Ga0496113_0440364_49_690 209
67 3300003322 rootL2_10174911 rootL2_101749116 210
68 3300003323 rootH1_10363632 rootH1_103636322 210
69 3300005288 Ga0065714_10130093 Ga0065714_101300932 210
70 3300005329 Ga0070683_100196357 Ga0070683_1001963572 210
71 3300005336 Ga0070680_100000160 Ga0070680_10000016035 210
72 3300005337 Ga0070682_100000504 Ga0070682_1000005044 210
73 3300005341 Ga0070691_10002266 Ga0070691_100022669 210
74 3300005347 Ga0070668_100740936 Ga0070668_1007409362 210
75 3300005456 Ga0070678_100671692 Ga0070678_1006716921 210
76 3300005458 Ga0070681_10092837 Ga0070681_100928373 210
77 3300005459 Ga0068867_100051269 Ga0068867_1000512692 210
78 3300005459 Ga0068867_100143404 Ga0068867_1001434042 210
79 3300005530 Ga0070679_100000789 Ga0070679_1000007892 210
80 3300005539 Ga0068853_100903315 Ga0068853_1009033151 210
81 3300005563 Ga0068855_100023611 Ga0068855_1000236112 210
82 3300005718 Ga0068866_10018529 Ga0068866_100185292 210
83 3300005719 Ga0068861_100793716 Ga0068861_1007937161 210
84 3300005843 Ga0068860_100018142 Ga0068860_1000181426 210
85 3300006237 Ga0097621_100060176 Ga0097621_1000601764 210
86 3300009093 Ga0105240_10007539 Ga0105240_100075395 210
87 3300009545 Ga0105237_10329342 Ga0105237_103293421 210
88 3300013296 Ga0157374_10138785 Ga0157374_101387851 210
89 3300013297 Ga0157378_10095605 Ga0157378_100956052 210
90 3300013307 Ga0157372_10066619 Ga0157372_100666193 210
91 3300013307 Ga0157372_10680466 Ga0157372_106804661 210
92 3300013307 Ga0157372_11102784 Ga0157372_111027842 210
93 3300014968 Ga0157379_10195988 Ga0157379_101959882 210
94 3300025908 Ga0207643_10358573 Ga0207643_103585732 210
95 3300025911 Ga0207654_10007264 Ga0207654_100072645 210
96 3300025912 Ga0207707_10004345 Ga0207707_100043455 210
97 3300025913 Ga0207695_10010801 Ga0207695_1001080111 210
98 3300025917 Ga0207660_10021033 Ga0207660_100210334 210
99 3300025921 Ga0207652_10002096 Ga0207652_1000209610 210
100 3300025942 Ga0207689_10436653 Ga0207689_104366531 210
101 3300025944 Ga0207661_10771426 Ga0207661_107714262 210
102 3300025949 Ga0207667_10032326 Ga0207667_100323266 210
103 3300025949 Ga0207667_11221339 Ga0207667_112213391 210
104 3300026041 Ga0207639_11028335 Ga0207639_110283351 210
105 3300026089 Ga0207648_10067015 Ga0207648_100670153 210
106 3300026089 Ga0207648_10187476 Ga0207648_101874762 210
107 3300026118 Ga0207675_100112041 Ga0207675_1001120412 210
108 3300026121 Ga0207683_10321147 Ga0207683_103211471 210
109 3300026142 Ga0207698_10027326 Ga0207698_100273265 210
110 3300028381 Ga0268264_10007051 Ga0268264_100070518 210
111 3300035725 Ga0373947_0702355 Ga0373947_0702355_12_647 210
112 3300042876 Ga0451577_0002711 Ga0451577_0002711_12161_12793 210
113 3300042876 Ga0451577_0147121 Ga0451577_0147121_1228_1860 210
114 3300042876 Ga0451577_0192632 Ga0451577_0192632_495_1127 210
115 3300044712 Ga0453684_0059693 Ga0453684_0059693_3810_4442 210
116 3300044712 Ga0453684_0107331 Ga0453684_0107331_2245_2877 210
117 3300046522 Ga0495643_0042332 Ga0495643_0042332_1234_1866 210
118 3300046616 Ga0495668_0000082 Ga0495668_0000082_24684_25316 210
119 3300049571 Ga0501034_0000152 Ga0501034_0000152_70161_70793 210
120 3300049585 Ga0501069_0079890 Ga0501069_0079890_1157_1798 210
121 3300049589 Ga0501073_0028803 Ga0501073_0028803_802_1443 210
122 3300049742 Ga0501080_0019380 Ga0501080_0019380_5145_5786 210
123 3300049744 Ga0501083_0058467 Ga0501083_0058467_1140_1781 210
124 3300053139 Ga0500568_0001088 Ga0500568_0001088_8879_9511 210
125 3300054114 Ga0501084_0021111 Ga0501084_0021111_3447_4088 210
126 3300000043 ARcpr5yngRDRAFT_c001528 ARcpr5yngRDRAFT_0015282 211
127 3300000652 ARCol0yngRDRAFT_1002643 ARCol0yngRDRAFT_10026431 211
128 3300001979 JGI24740J21852_10033948 JGI24740J21852_100339482 211
129 3300001989 JGI24739J22299_10115992 JGI24739J22299_101159922 211
130 3300002155 JGI24033J26618_1011494 JGI24033J26618_10114942 211
131 3300002459 JGI24751J29686_10001010 JGI24751J29686_100010104 211
132 3300003203 JGI25406J46586_10002282 JGI25406J46586_100022826 211
133 3300003320 rootH2_10006463 rootH2_1000646331 211
134 3300003320 rootH2_10012033 rootH2_1001203313 211
135 3300003320 rootH2_10013353 rootH2_100133532 211
136 3300003320 rootH2_10045629 rootH2_100456294 211
137 3300003320 rootH2_10066424 rootH2_100664243 211
138 3300003320 rootH2_10145428 rootH2_101454283 211
139 3300003322 rootL2_10067318 rootL2_100673182 211
140 3300003322 rootL2_10089602 rootL2_100896021 211
141 3300003323 rootH1_10007189 rootH1_1000718952 211
142 3300003354 JGI25160J50197_1002393 JGI25160J50197_10023934 211
143 3300005289 Ga0065704_10121980 Ga0065704_101219802 211
144 3300005290 Ga0065712_10002378 Ga0065712_100023788 211
145 3300005290 Ga0065712_10069198 Ga0065712_100691985 211
146 3300005290 Ga0065712_10151155 Ga0065712_101511551 211
147 3300005290 Ga0065712_10317038 Ga0065712_103170381 211
148 3300005290 Ga0065712_10344157 Ga0065712_103441571 211
149 3300005293 Ga0065715_10094036 Ga0065715_100940362 211
150 3300005293 Ga0065715_10277639 Ga0065715_102776392 211
151 3300005293 Ga0065715_10434745 Ga0065715_104347451 211
152 3300005295 Ga0065707_10083736 Ga0065707_100837368 211
153 3300005295 Ga0065707_10225606 Ga0065707_102256062 211
154 3300005295 Ga0065707_10260657 Ga0065707_102606572 211
155 3300005327 Ga0070658_10079333 Ga0070658_100793333 211
156 3300005327 Ga0070658_10120126 Ga0070658_101201262 211
157 3300005327 Ga0070658_10224038 Ga0070658_102240382 211
158 3300005327 Ga0070658_10277542 Ga0070658_102775421 211
159 3300005327 Ga0070658_10317008 Ga0070658_103170082 211
160 3300005327 Ga0070658_10485452 Ga0070658_104854521 211
161 3300005328 Ga0070676_10002040 Ga0070676_100020403 211
162 3300005328 Ga0070676_10009660 Ga0070676_100096604 211
163 3300005328 Ga0070676_10011593 Ga0070676_100115932 211
164 3300005328 Ga0070676_10057171 Ga0070676_100571712 211
165 3300005328 Ga0070676_10208428 Ga0070676_102084282 211
166 3300005329 Ga0070683_100000201 Ga0070683_10000020125 211
167 3300005329 Ga0070683_100007891 Ga0070683_1000078915 211
168 3300005329 Ga0070683_100044982 Ga0070683_1000449822 211
169 3300005329 Ga0070683_100150980 Ga0070683_1001509803 211
170 3300005329 Ga0070683_100170944 Ga0070683_1001709442 211
171 3300005329 Ga0070683_100193335 Ga0070683_1001933353 211
172 3300005329 Ga0070683_100259395 Ga0070683_1002593952 211
173 3300005329 Ga0070683_100820475 Ga0070683_1008204752 211
174 3300005330 Ga0070690_100001766 Ga0070690_1000017666 211
175 3300005330 Ga0070690_100017579 Ga0070690_1000175792 211
176 3300005330 Ga0070690_100051835 Ga0070690_1000518352 211
177 3300005331 Ga0070670_100010145 Ga0070670_1000101455 211
178 3300005331 Ga0070670_100022437 Ga0070670_1000224372 211
179 3300005331 Ga0070670_100037015 Ga0070670_1000370153 211
180 3300005331 Ga0070670_100074497 Ga0070670_1000744972 211
181 3300005331 Ga0070670_100137559 Ga0070670_1001375592 211
182 3300005331 Ga0070670_100145553 Ga0070670_1001455531 211
183 3300005331 Ga0070670_100229898 Ga0070670_1002298982 211
184 3300005331 Ga0070670_100252418 Ga0070670_1002524182 211
185 3300005331 Ga0070670_100261747 Ga0070670_1002617472 211
186 3300005331 Ga0070670_100266292 Ga0070670_1002662923 211
187 3300005331 Ga0070670_100476925 Ga0070670_1004769252 211
188 3300005331 Ga0070670_100510075 Ga0070670_1005100752 211
189 3300005331 Ga0070670_100530745 Ga0070670_1005307451 211
190 3300005334 Ga0068869_100002336 Ga0068869_10000233610 211
191 3300005334 Ga0068869_100005789 Ga0068869_1000057895 211
192 3300005334 Ga0068869_100021438 Ga0068869_1000214382 211
193 3300005334 Ga0068869_100038116 Ga0068869_1000381163 211
194 3300005334 Ga0068869_100079898 Ga0068869_1000798982 211
195 3300005334 Ga0068869_100112598 Ga0068869_1001125982 211
196 3300005334 Ga0068869_100418445 Ga0068869_1004184452 211
197 3300005334 Ga0068869_100449976 Ga0068869_1004499762 211
198 3300005334 Ga0068869_100504825 Ga0068869_1005048252 211
199 3300005334 Ga0068869_100517964 Ga0068869_1005179642 211
200 3300005335 Ga0070666_10000096 Ga0070666_1000009619 211
201 3300005335 Ga0070666_10001692 Ga0070666_100016924 211
202 3300005335 Ga0070666_10040614 Ga0070666_100406142 211
203 3300005335 Ga0070666_10058659 Ga0070666_100586592 211
204 3300005335 Ga0070666_10368859 Ga0070666_103688591 211
205 3300005336 Ga0070680_100084728 Ga0070680_1000847281 211
206 3300005336 Ga0070680_100249758 Ga0070680_1002497582 211
207 3300005337 Ga0070682_100000012 Ga0070682_100000012182 211
208 3300005337 Ga0070682_100011516 Ga0070682_1000115162 211
209 3300005337 Ga0070682_100037628 Ga0070682_1000376283 211
210 3300005337 Ga0070682_100058138 Ga0070682_1000581382 211
211 3300005337 Ga0070682_100220352 Ga0070682_1002203522 211
212 3300005337 Ga0070682_100286318 Ga0070682_1002863182 211
213 3300005338 Ga0068868_100001409 Ga0068868_1000014093 211
214 3300005338 Ga0068868_100002287 Ga0068868_1000022879 211
215 3300005338 Ga0068868_100015238 Ga0068868_1000152383 211
216 3300005338 Ga0068868_100053775 Ga0068868_1000537754 211
217 3300005338 Ga0068868_100117014 Ga0068868_1001170142 211
218 3300005338 Ga0068868_100151765 Ga0068868_1001517652 211
219 3300005338 Ga0068868_100219473 Ga0068868_1002194732 211
220 3300005338 Ga0068868_100394923 Ga0068868_1003949231 211
221 3300005338 Ga0068868_100717835 Ga0068868_1007178351 211
222 3300005338 Ga0068868_100930606 Ga0068868_1009306061 211
223 3300005339 Ga0070660_100140793 Ga0070660_1001407932 211
224 3300005340 Ga0070689_100005603 Ga0070689_1000056035 211
225 3300005340 Ga0070689_100006510 Ga0070689_1000065105 211
226 3300005340 Ga0070689_100021895 Ga0070689_1000218952 211
227 3300005340 Ga0070689_100113914 Ga0070689_1001139143 211
228 3300005340 Ga0070689_100125964 Ga0070689_1001259642 211
229 3300005340 Ga0070689_100146202 Ga0070689_1001462022 211
230 3300005341 Ga0070691_10027775 Ga0070691_100277753 211
231 3300005343 Ga0070687_100084654 Ga0070687_1000846543 211
232 3300005343 Ga0070687_100114969 Ga0070687_1001149692 211
233 3300005343 Ga0070687_100237090 Ga0070687_1002370901 211
234 3300005344 Ga0070661_100001257 Ga0070661_10000125712 211
235 3300005344 Ga0070661_100009173 Ga0070661_1000091733 211
236 3300005344 Ga0070661_100019696 Ga0070661_1000196964 211
237 3300005344 Ga0070661_100252700 Ga0070661_1002527002 211
238 3300005347 Ga0070668_100054460 Ga0070668_1000544603 211
239 3300005347 Ga0070668_100193124 Ga0070668_1001931243 211
240 3300005347 Ga0070668_100332296 Ga0070668_1003322962 211
241 3300005347 Ga0070668_101022226 Ga0070668_1010222261 211
242 3300005353 Ga0070669_100008525 Ga0070669_1000085255 211
243 3300005353 Ga0070669_100104509 Ga0070669_1001045092 211
244 3300005353 Ga0070669_100177364 Ga0070669_1001773642 211
245 3300005353 Ga0070669_100263259 Ga0070669_1002632592 211
246 3300005353 Ga0070669_100285337 Ga0070669_1002853372 211
247 3300005353 Ga0070669_100382556 Ga0070669_1003825561 211
248 3300005353 Ga0070669_100510285 Ga0070669_1005102851 211
249 3300005353 Ga0070669_100692341 Ga0070669_1006923411 211
250 3300005354 Ga0070675_100019423 Ga0070675_1000194233 211
251 3300005354 Ga0070675_100037861 Ga0070675_1000378613 211
252 3300005354 Ga0070675_100086307 Ga0070675_1000863071 211
253 3300005354 Ga0070675_100095295 Ga0070675_1000952952 211
254 3300005354 Ga0070675_100133817 Ga0070675_1001338172 211
255 3300005354 Ga0070675_100166494 Ga0070675_1001664942 211
256 3300005354 Ga0070675_100221299 Ga0070675_1002212993 211
257 3300005354 Ga0070675_100357528 Ga0070675_1003575282 211
258 3300005355 Ga0070671_100020108 Ga0070671_1000201084 211
259 3300005355 Ga0070671_100030491 Ga0070671_1000304912 211
260 3300005355 Ga0070671_100032518 Ga0070671_1000325185 211
261 3300005355 Ga0070671_100196212 Ga0070671_1001962123 211
262 3300005355 Ga0070671_100320192 Ga0070671_1003201922 211
263 3300005355 Ga0070671_100577135 Ga0070671_1005771351 211
264 3300005356 Ga0070674_100002720 Ga0070674_1000027202 211
265 3300005356 Ga0070674_100009148 Ga0070674_1000091483 211
266 3300005356 Ga0070674_100016377 Ga0070674_1000163772 211
267 3300005356 Ga0070674_100022088 Ga0070674_1000220885 211
268 3300005364 Ga0070673_100004768 Ga0070673_1000047689 211
269 3300005364 Ga0070673_100011005 Ga0070673_1000110056 211
270 3300005364 Ga0070673_100026881 Ga0070673_1000268813 211
271 3300005364 Ga0070673_100071842 Ga0070673_1000718422 211
272 3300005364 Ga0070673_100113696 Ga0070673_1001136962 211
273 3300005364 Ga0070673_100158137 Ga0070673_1001581372 211
274 3300005364 Ga0070673_100225368 Ga0070673_1002253682 211
275 3300005364 Ga0070673_100453451 Ga0070673_1004534512 211
276 3300005364 Ga0070673_100549912 Ga0070673_1005499121 211
277 3300005364 Ga0070673_100970400 Ga0070673_1009704001 211
278 3300005364 Ga0070673_100982184 Ga0070673_1009821841 211
279 3300005365 Ga0070688_100003887 Ga0070688_1000038879 211
280 3300005365 Ga0070688_100025799 Ga0070688_1000257992 211
281 3300005365 Ga0070688_100030282 Ga0070688_1000302823 211
282 3300005365 Ga0070688_100035963 Ga0070688_1000359632 211
283 3300005365 Ga0070688_100065838 Ga0070688_1000658382 211
284 3300005365 Ga0070688_100104037 Ga0070688_1001040371 211
285 3300005366 Ga0070659_100058940 Ga0070659_1000589402 211
286 3300005366 Ga0070659_100120363 Ga0070659_1001203632 211
287 3300005366 Ga0070659_100472869 Ga0070659_1004728691 211
288 3300005366 Ga0070659_100553688 Ga0070659_1005536882 211
289 3300005367 Ga0070667_100005666 Ga0070667_1000056669 211
290 3300005367 Ga0070667_100005976 Ga0070667_1000059762 211
291 3300005367 Ga0070667_100006635 Ga0070667_1000066358 211
292 3300005367 Ga0070667_100018265 Ga0070667_1000182655 211
293 3300005367 Ga0070667_100020213 Ga0070667_1000202133 211
294 3300005367 Ga0070667_100049027 Ga0070667_1000490271 211
295 3300005367 Ga0070667_100060501 Ga0070667_1000605013 211
296 3300005367 Ga0070667_100074950 Ga0070667_1000749502 211
297 3300005367 Ga0070667_100088983 Ga0070667_1000889832 211
298 3300005367 Ga0070667_100131074 Ga0070667_1001310742 211
299 3300005367 Ga0070667_100922444 Ga0070667_1009224441 211
300 3300005438 Ga0070701_10042471 Ga0070701_100424713 211
301 3300005439 Ga0070711_100368199 Ga0070711_1003681991 211
302 3300005441 Ga0070700_100037341 Ga0070700_1000373413 211
303 3300005441 Ga0070700_100106689 Ga0070700_1001066891 211
304 3300005455 Ga0070663_100052657 Ga0070663_1000526572 211
305 3300005456 Ga0070678_100003213 Ga0070678_1000032132 211
306 3300005456 Ga0070678_100024383 Ga0070678_1000243833 211
307 3300005456 Ga0070678_100099128 Ga0070678_1000991282 211
308 3300005456 Ga0070678_100591385 Ga0070678_1005913851 211
309 3300005457 Ga0070662_100007657 Ga0070662_1000076572 211
310 3300005457 Ga0070662_100012826 Ga0070662_1000128263 211
311 3300005457 Ga0070662_100022785 Ga0070662_1000227852 211
312 3300005457 Ga0070662_100042168 Ga0070662_1000421683 211
313 3300005457 Ga0070662_100169669 Ga0070662_1001696692 211
314 3300005457 Ga0070662_100183169 Ga0070662_1001831691 211
315 3300005457 Ga0070662_100223267 Ga0070662_1002232672 211
316 3300005457 Ga0070662_100999935 Ga0070662_1009999351 211
317 3300005458 Ga0070681_10070731 Ga0070681_100707313 211
318 3300005458 Ga0070681_10143961 Ga0070681_101439612 211
319 3300005459 Ga0068867_100004129 Ga0068867_1000041292 211
320 3300005459 Ga0068867_100007859 Ga0068867_1000078593 211
321 3300005459 Ga0068867_100011193 Ga0068867_1000111934 211
322 3300005459 Ga0068867_100022481 Ga0068867_1000224812 211
323 3300005459 Ga0068867_100031631 Ga0068867_1000316312 211
324 3300005459 Ga0068867_100053418 Ga0068867_1000534181 211
325 3300005459 Ga0068867_100057688 Ga0068867_1000576882 211
326 3300005459 Ga0068867_100113496 Ga0068867_1001134962 211
327 3300005459 Ga0068867_100137859 Ga0068867_1001378591 211
328 3300005459 Ga0068867_100163612 Ga0068867_1001636122 211
329 3300005459 Ga0068867_100191483 Ga0068867_1001914832 211
330 3300005459 Ga0068867_100291287 Ga0068867_1002912872 211
331 3300005466 Ga0070685_10027792 Ga0070685_100277922 211
332 3300005466 Ga0070685_10028737 Ga0070685_100287373 211
333 3300005466 Ga0070685_10043958 Ga0070685_100439582 211
334 3300005466 Ga0070685_10090655 Ga0070685_100906552 211
335 3300005471 Ga0070698_100012635 Ga0070698_1000126356 211
336 3300005471 Ga0070698_100096270 Ga0070698_1000962702 211
337 3300005530 Ga0070679_100000373 Ga0070679_1000003738 211
338 3300005530 Ga0070679_100059118 Ga0070679_1000591183 211
339 3300005530 Ga0070679_100072103 Ga0070679_1000721032 211
340 3300005530 Ga0070679_100209481 Ga0070679_1002094812 211
341 3300005535 Ga0070684_100000042 Ga0070684_10000004235 211
342 3300005535 Ga0070684_100025354 Ga0070684_1000253544 211
343 3300005535 Ga0070684_100105457 Ga0070684_1001054572 211
344 3300005535 Ga0070684_100136813 Ga0070684_1001368132 211
345 3300005536 Ga0070697_100470995 Ga0070697_1004709952 211
346 3300005539 Ga0068853_100005393 Ga0068853_1000053936 211
347 3300005539 Ga0068853_100006084 Ga0068853_1000060846 211
348 3300005539 Ga0068853_100021685 Ga0068853_1000216852 211
349 3300005539 Ga0068853_100050105 Ga0068853_1000501051 211
350 3300005539 Ga0068853_100080141 Ga0068853_1000801413 211
351 3300005539 Ga0068853_100105734 Ga0068853_1001057342 211
352 3300005539 Ga0068853_100138455 Ga0068853_1001384551 211
353 3300005539 Ga0068853_100277607 Ga0068853_1002776072 211
354 3300005539 Ga0068853_100312176 Ga0068853_1003121762 211
355 3300005539 Ga0068853_100354741 Ga0068853_1003547412 211
356 3300005539 Ga0068853_100795786 Ga0068853_1007957861 211
357 3300005543 Ga0070672_100002200 Ga0070672_1000022004 211
358 3300005543 Ga0070672_100029692 Ga0070672_1000296922 211
359 3300005543 Ga0070672_100042007 Ga0070672_1000420073 211
360 3300005543 Ga0070672_100136408 Ga0070672_1001364082 211
361 3300005543 Ga0070672_100158540 Ga0070672_1001585403 211
362 3300005543 Ga0070672_100229632 Ga0070672_1002296322 211
363 3300005543 Ga0070672_100351491 Ga0070672_1003514912 211
364 3300005544 Ga0070686_100017405 Ga0070686_1000174052 211
365 3300005544 Ga0070686_100168425 Ga0070686_1001684252 211
366 3300005544 Ga0070686_100170180 Ga0070686_1001701802 211
367 3300005547 Ga0070693_100568192 Ga0070693_1005681921 211
368 3300005548 Ga0070665_100000002 Ga0070665_100000002688 211
369 3300005548 Ga0070665_100006924 Ga0070665_1000069249 211
370 3300005548 Ga0070665_100380735 Ga0070665_1003807352 211
371 3300005548 Ga0070665_100473131 Ga0070665_1004731312 211
372 3300005549 Ga0070704_100456105 Ga0070704_1004561052 211
373 3300005563 Ga0068855_100004845 Ga0068855_10000484510 211
374 3300005563 Ga0068855_100011556 Ga0068855_1000115564 211
375 3300005563 Ga0068855_100048130 Ga0068855_1000481303 211
376 3300005563 Ga0068855_100091589 Ga0068855_1000915892 211
377 3300005563 Ga0068855_100448516 Ga0068855_1004485162 211
378 3300005563 Ga0068855_100619941 Ga0068855_1006199412 211
379 3300005563 Ga0068855_100633385 Ga0068855_1006333852 211
380 3300005563 Ga0068855_100915766 Ga0068855_1009157662 211
381 3300005564 Ga0070664_100000266 Ga0070664_1000002669 211
382 3300005564 Ga0070664_100014722 Ga0070664_1000147222 211
383 3300005564 Ga0070664_100021759 Ga0070664_1000217596 211
384 3300005564 Ga0070664_100047727 Ga0070664_1000477273 211
385 3300005564 Ga0070664_100106599 Ga0070664_1001065992 211
386 3300005564 Ga0070664_100212043 Ga0070664_1002120432 211
387 3300005564 Ga0070664_100220041 Ga0070664_1002200412 211
388 3300005564 Ga0070664_100793239 Ga0070664_1007932391 211
389 3300005577 Ga0068857_100002333 Ga0068857_1000023332 211
390 3300005577 Ga0068857_100021749 Ga0068857_1000217493 211
391 3300005577 Ga0068857_100030652 Ga0068857_1000306523 211
392 3300005577 Ga0068857_100043844 Ga0068857_1000438443 211
393 3300005577 Ga0068857_100082222 Ga0068857_1000822223 211
394 3300005577 Ga0068857_100082282 Ga0068857_1000822823 211
395 3300005577 Ga0068857_100172391 Ga0068857_1001723912 211
396 3300005577 Ga0068857_100584860 Ga0068857_1005848602 211
397 3300005578 Ga0068854_100007085 Ga0068854_1000070854 211
398 3300005578 Ga0068854_100022206 Ga0068854_1000222062 211
399 3300005578 Ga0068854_100058017 Ga0068854_1000580172 211
400 3300005578 Ga0068854_100259351 Ga0068854_1002593512 211
401 3300005578 Ga0068854_100423615 Ga0068854_1004236151 211
402 3300005578 Ga0068854_100554554 Ga0068854_1005545541 211
403 3300005614 Ga0068856_100034401 Ga0068856_1000344012 211
404 3300005614 Ga0068856_100063747 Ga0068856_1000637473 211
405 3300005614 Ga0068856_100192689 Ga0068856_1001926892 211
406 3300005614 Ga0068856_100216941 Ga0068856_1002169412 211
407 3300005614 Ga0068856_100260635 Ga0068856_1002606352 211
408 3300005614 Ga0068856_100539144 Ga0068856_1005391442 211
409 3300005615 Ga0070702_100004909 Ga0070702_1000049095 211
410 3300005616 Ga0068852_100000391 Ga0068852_10000039115 211
411 3300005616 Ga0068852_100009517 Ga0068852_1000095174 211
412 3300005616 Ga0068852_100024603 Ga0068852_1000246036 211
413 3300005616 Ga0068852_100051115 Ga0068852_1000511152 211
414 3300005616 Ga0068852_100102493 Ga0068852_1001024932 211
415 3300005616 Ga0068852_100208197 Ga0068852_1002081971 211
416 3300005616 Ga0068852_100222919 Ga0068852_1002229192 211
417 3300005616 Ga0068852_100245169 Ga0068852_1002451691 211
418 3300005616 Ga0068852_100321485 Ga0068852_1003214852 211
419 3300005616 Ga0068852_100443382 Ga0068852_1004433822 211
420 3300005616 Ga0068852_100578448 Ga0068852_1005784483 211
421 3300005617 Ga0068859_100000024 Ga0068859_10000002487 211
422 3300005617 Ga0068859_100000289 Ga0068859_1000002895 211
423 3300005617 Ga0068859_100023852 Ga0068859_1000238523 211
424 3300005617 Ga0068859_100034839 Ga0068859_1000348393 211
425 3300005617 Ga0068859_100064998 Ga0068859_1000649985 211
426 3300005617 Ga0068859_100095618 Ga0068859_1000956182 211
427 3300005617 Ga0068859_100117794 Ga0068859_1001177943 211
428 3300005617 Ga0068859_100148245 Ga0068859_1001482452 211
429 3300005617 Ga0068859_100195989 Ga0068859_1001959892 211
430 3300005617 Ga0068859_100323008 Ga0068859_1003230082 211
431 3300005617 Ga0068859_100678993 Ga0068859_1006789932 211
432 3300005617 Ga0068859_100843105 Ga0068859_1008431052 211
433 3300005618 Ga0068864_100007995 Ga0068864_1000079958 211
434 3300005618 Ga0068864_100034620 Ga0068864_1000346202 211
435 3300005618 Ga0068864_100039400 Ga0068864_1000394001 211
436 3300005618 Ga0068864_100054971 Ga0068864_1000549712 211
437 3300005618 Ga0068864_100100795 Ga0068864_1001007952 211
438 3300005618 Ga0068864_100190514 Ga0068864_1001905142 211
439 3300005618 Ga0068864_100205278 Ga0068864_1002052781 211
440 3300005618 Ga0068864_100282018 Ga0068864_1002820182 211
441 3300005618 Ga0068864_100314713 Ga0068864_1003147132 211
442 3300005618 Ga0068864_100371081 Ga0068864_1003710813 211
443 3300005618 Ga0068864_100691477 Ga0068864_1006914772 211
444 3300005618 Ga0068864_100792748 Ga0068864_1007927482 211
445 3300005718 Ga0068866_10015629 Ga0068866_100156294 211
446 3300005718 Ga0068866_10055294 Ga0068866_100552942 211
447 3300005718 Ga0068866_10114842 Ga0068866_101148422 211
448 3300005719 Ga0068861_100002293 Ga0068861_1000022937 211
449 3300005719 Ga0068861_100008102 Ga0068861_1000081027 211
450 3300005719 Ga0068861_100027894 Ga0068861_1000278943 211
451 3300005834 Ga0068851_10000961 Ga0068851_1000096112 211
452 3300005834 Ga0068851_10007645 Ga0068851_100076452 211
453 3300005834 Ga0068851_10283507 Ga0068851_102835072 211
454 3300005840 Ga0068870_10001518 Ga0068870_100015188 211
455 3300005840 Ga0068870_10011910 Ga0068870_100119104 211
456 3300005840 Ga0068870_10046907 Ga0068870_100469072 211
457 3300005841 Ga0068863_100001495 Ga0068863_10000149522 211
458 3300005841 Ga0068863_100002737 Ga0068863_1000027374 211
459 3300005841 Ga0068863_100007225 Ga0068863_1000072253 211
460 3300005841 Ga0068863_100029821 Ga0068863_1000298215 211
461 3300005841 Ga0068863_100042386 Ga0068863_1000423863 211
462 3300005841 Ga0068863_100072382 Ga0068863_1000723823 211
463 3300005841 Ga0068863_100076932 Ga0068863_1000769323 211
464 3300005841 Ga0068863_100092481 Ga0068863_1000924813 211
465 3300005841 Ga0068863_100252648 Ga0068863_1002526482 211
466 3300005841 Ga0068863_100283452 Ga0068863_1002834522 211
467 3300005841 Ga0068863_100301982 Ga0068863_1003019822 211
468 3300005841 Ga0068863_100342193 Ga0068863_1003421932 211
469 3300005841 Ga0068863_100404454 Ga0068863_1004044542 211
470 3300005841 Ga0068863_100572153 Ga0068863_1005721532 211
471 3300005841 Ga0068863_100659816 Ga0068863_1006598161 211
472 3300005842 Ga0068858_100006261 Ga0068858_1000062619 211
473 3300005842 Ga0068858_100006671 Ga0068858_1000066713 211
474 3300005842 Ga0068858_100030976 Ga0068858_1000309761 211
475 3300005842 Ga0068858_100120817 Ga0068858_1001208172 211
476 3300005842 Ga0068858_100237329 Ga0068858_1002373292 211
477 3300005843 Ga0068860_100000003 Ga0068860_100000003307 211
478 3300005843 Ga0068860_100001839 Ga0068860_1000018392 211
479 3300005843 Ga0068860_100002558 Ga0068860_10000255810 211
480 3300005843 Ga0068860_100003552 Ga0068860_1000035529 211
481 3300005843 Ga0068860_100007858 Ga0068860_1000078583 211
482 3300005843 Ga0068860_100017352 Ga0068860_1000173522 211
483 3300005843 Ga0068860_100051634 Ga0068860_1000516343 211
484 3300005843 Ga0068860_100064406 Ga0068860_1000644062 211
485 3300005843 Ga0068860_100219497 Ga0068860_1002194971 211
486 3300005843 Ga0068860_100246436 Ga0068860_1002464362 211
487 3300005843 Ga0068860_100448376 Ga0068860_1004483762 211
488 3300005843 Ga0068860_100523088 Ga0068860_1005230881 211
489 3300005844 Ga0068862_100005509 Ga0068862_10000550910 211
490 3300005844 Ga0068862_100011950 Ga0068862_1000119506 211
491 3300005844 Ga0068862_100012024 Ga0068862_1000120243 211
492 3300005844 Ga0068862_100431821 Ga0068862_1004318212 211
493 3300005844 Ga0068862_100660753 Ga0068862_1006607532 211
494 3300005844 Ga0068862_100858324 Ga0068862_1008583241 211
495 3300005983 Ga0081540_1004235 Ga0081540_10042355 211
496 3300005985 Ga0081539_10000696 Ga0081539_1000069633 211
497 3300005985 Ga0081539_10048260 Ga0081539_100482602 211
498 3300006173 Ga0070716_100626819 Ga0070716_1006268191 211
499 3300006175 Ga0070712_100717916 Ga0070712_1007179162 211
500 3300006195 Ga0075366_10003065 Ga0075366_100030658 211
501 3300006195 Ga0075366_10044572 Ga0075366_100445722 211
502 3300006195 Ga0075366_10096473 Ga0075366_100964732 211
503 3300006195 Ga0075366_10099486 Ga0075366_100994862 211
504 3300006237 Ga0097621_100000839 Ga0097621_1000008396 211
505 3300006237 Ga0097621_100003220 Ga0097621_1000032208 211
506 3300006237 Ga0097621_100004096 Ga0097621_1000040967 211
507 3300006237 Ga0097621_100021433 Ga0097621_1000214334 211
508 3300006237 Ga0097621_100028329 Ga0097621_1000283294 211
509 3300006237 Ga0097621_100030896 Ga0097621_1000308963 211
510 3300006237 Ga0097621_100054689 Ga0097621_1000546892 211
511 3300006237 Ga0097621_100058487 Ga0097621_1000584872 211
512 3300006237 Ga0097621_100126487 Ga0097621_1001264872 211
513 3300006237 Ga0097621_100200836 Ga0097621_1002008363 211
514 3300006237 Ga0097621_100202437 Ga0097621_1002024372 211
515 3300006237 Ga0097621_100255760 Ga0097621_1002557602 211
516 3300006237 Ga0097621_100320774 Ga0097621_1003207742 211
517 3300006237 Ga0097621_100609436 Ga0097621_1006094362 211
518 3300006237 Ga0097621_100670858 Ga0097621_1006708581 211
519 3300006237 Ga0097621_100786536 Ga0097621_1007865361 211
520 3300006358 Ga0068871_100001362 Ga0068871_10000136211 211
521 3300006358 Ga0068871_100005215 Ga0068871_1000052156 211
522 3300006358 Ga0068871_100007064 Ga0068871_1000070647 211
523 3300006358 Ga0068871_100020773 Ga0068871_1000207734 211
524 3300006358 Ga0068871_100056887 Ga0068871_1000568873 211
525 3300006358 Ga0068871_100062024 Ga0068871_1000620241 211
526 3300006358 Ga0068871_100074941 Ga0068871_1000749414 211
527 3300006358 Ga0068871_100091086 Ga0068871_1000910862 211
528 3300006358 Ga0068871_100122166 Ga0068871_1001221663 211
529 3300006358 Ga0068871_100154188 Ga0068871_1001541882 211
530 3300006358 Ga0068871_100200219 Ga0068871_1002002192 211
531 3300006358 Ga0068871_100461481 Ga0068871_1004614812 211
532 3300006844 Ga0075428_100027400 Ga0075428_1000274008 211
533 3300006844 Ga0075428_100221092 Ga0075428_1002210922 211
534 3300006844 Ga0075428_100312599 Ga0075428_1003125992 211
535 3300006844 Ga0075428_100414431 Ga0075428_1004144312 211
536 3300006846 Ga0075430_100008093 Ga0075430_1000080938 211
537 3300006847 Ga0075431_100028155 Ga0075431_1000281557 211
538 3300006880 Ga0075429_100050388 Ga0075429_1000503881 211
539 3300006880 Ga0075429_100168275 Ga0075429_1001682752 211
540 3300006880 Ga0075429_100581101 Ga0075429_1005811012 211
541 3300006881 Ga0068865_100042968 Ga0068865_1000429683 211
542 3300006881 Ga0068865_100053804 Ga0068865_1000538042 211
543 3300006881 Ga0068865_100090182 Ga0068865_1000901822 211
544 3300006881 Ga0068865_100782162 Ga0068865_1007821621 211
545 3300006881 Ga0068865_100799926 Ga0068865_1007999261 211
546 3300006881 Ga0068865_100835118 Ga0068865_1008351181 211
547 3300006931 Ga0097620_100000024 Ga0097620_10000002487 211
548 3300006931 Ga0097620_100000289 Ga0097620_10000028946 211
549 3300006931 Ga0097620_100023853 Ga0097620_1000238533 211
550 3300006931 Ga0097620_100034840 Ga0097620_1000348403 211
551 3300006931 Ga0097620_100064998 Ga0097620_1000649985 211
552 3300006931 Ga0097620_100095615 Ga0097620_1000956152 211
553 3300006931 Ga0097620_100117795 Ga0097620_1001177953 211
554 3300006931 Ga0097620_100148236 Ga0097620_1001482362 211
555 3300006931 Ga0097620_100195988 Ga0097620_1001959882 211
556 3300006931 Ga0097620_100323036 Ga0097620_1003230362 211
557 3300006931 Ga0097620_100679089 Ga0097620_1006790892 211
558 3300006931 Ga0097620_100843129 Ga0097620_1008431292 211
559 3300009093 Ga0105240_10000664 Ga0105240_1000066418 211
560 3300009093 Ga0105240_10003417 Ga0105240_100034174 211
561 3300009093 Ga0105240_10005202 Ga0105240_100052024 211
562 3300009093 Ga0105240_10013672 Ga0105240_100136724 211
563 3300009093 Ga0105240_10028985 Ga0105240_100289853 211
564 3300009093 Ga0105240_10030484 Ga0105240_100304843 211
565 3300009093 Ga0105240_10045365 Ga0105240_100453656 211
566 3300009093 Ga0105240_10071079 Ga0105240_100710792 211
567 3300009093 Ga0105240_10086615 Ga0105240_100866152 211
568 3300009093 Ga0105240_10698619 Ga0105240_106986192 211
569 3300009093 Ga0105240_10698937 Ga0105240_106989372 211
570 3300009094 Ga0111539_10002209 Ga0111539_1000220913 211
571 3300009094 Ga0111539_10033408 Ga0111539_100334084 211
572 3300009094 Ga0111539_10556449 Ga0111539_105564492 211
573 3300009101 Ga0105247_10003052 Ga0105247_100030526 211
574 3300009101 Ga0105247_10009908 Ga0105247_100099086 211
575 3300009101 Ga0105247_10635001 Ga0105247_106350011 211
576 3300009147 Ga0114129_10069752 Ga0114129_100697523 211
577 3300009147 Ga0114129_10132459 Ga0114129_101324593 211
578 3300009147 Ga0114129_10203922 Ga0114129_102039222 211
579 3300009147 Ga0114129_10367692 Ga0114129_103676922 211
580 3300009148 Ga0105243_10278713 Ga0105243_102787132 211
581 3300009174 Ga0105241_10003204 Ga0105241_100032043 211
582 3300009174 Ga0105241_10008515 Ga0105241_100085153 211
583 3300009174 Ga0105241_10015439 Ga0105241_100154392 211
584 3300009174 Ga0105241_10076424 Ga0105241_100764242 211
585 3300009174 Ga0105241_10077597 Ga0105241_100775973 211
586 3300009174 Ga0105241_10097842 Ga0105241_100978422 211
587 3300009174 Ga0105241_10113079 Ga0105241_101130791 211
588 3300009174 Ga0105241_10556677 Ga0105241_105566772 211
589 3300009176 Ga0105242_10217571 Ga0105242_102175712 211
590 3300009176 Ga0105242_10218848 Ga0105242_102188482 211
591 3300009176 Ga0105242_10245646 Ga0105242_102456462 211
592 3300009176 Ga0105242_10265860 Ga0105242_102658602 211
593 3300009176 Ga0105242_10656764 Ga0105242_106567642 211
594 3300009176 Ga0105242_10926683 Ga0105242_109266832 211
595 3300009177 Ga0105248_10044022 Ga0105248_100440223 211
596 3300009177 Ga0105248_10158839 Ga0105248_101588392 211
597 3300009177 Ga0105248_10176413 Ga0105248_101764133 211
598 3300009177 Ga0105248_10589867 Ga0105248_105898672 211
599 3300009545 Ga0105237_10001055 Ga0105237_1000105531 211
600 3300009545 Ga0105237_10001444 Ga0105237_1000144417 211
601 3300009545 Ga0105237_10003471 Ga0105237_100034714 211
602 3300009545 Ga0105237_10006867 Ga0105237_100068673 211
603 3300009545 Ga0105237_10011763 Ga0105237_100117636 211
604 3300009545 Ga0105237_10058802 Ga0105237_100588021 211
605 3300009545 Ga0105237_10065053 Ga0105237_100650533 211
606 3300009545 Ga0105237_10324770 Ga0105237_103247702 211
607 3300009545 Ga0105237_11156467 Ga0105237_111564671 211
608 3300009551 Ga0105238_10001637 Ga0105238_100016373 211
609 3300009551 Ga0105238_10043580 Ga0105238_100435803 211
610 3300009551 Ga0105238_10164851 Ga0105238_101648512 211
611 3300009551 Ga0105238_10465072 Ga0105238_104650721 211
612 3300009553 Ga0105249_10001304 Ga0105249_1000130413 211
613 3300009553 Ga0105249_10003776 Ga0105249_100037767 211
614 3300009553 Ga0105249_10006906 Ga0105249_100069066 211
615 3300009553 Ga0105249_10010160 Ga0105249_100101601 211
616 3300009553 Ga0105249_10013792 Ga0105249_100137922 211
617 3300009553 Ga0105249_10020732 Ga0105249_100207323 211
618 3300009553 Ga0105249_10049496 Ga0105249_100494964 211
619 3300009553 Ga0105249_10057076 Ga0105249_100570763 211
620 3300009553 Ga0105249_10078477 Ga0105249_100784772 211
621 3300009553 Ga0105249_10098962 Ga0105249_100989622 211
622 3300009553 Ga0105249_10330502 Ga0105249_103305022 211
623 3300009553 Ga0105249_11102410 Ga0105249_111024101 211
624 3300009553 Ga0105249_11334402 Ga0105249_113344022 211
625 3300010375 Ga0105239_10000488 Ga0105239_1000048850 211
626 3300010375 Ga0105239_10001785 Ga0105239_1000178511 211
627 3300010375 Ga0105239_10005800 Ga0105239_100058004 211
628 3300010375 Ga0105239_10008966 Ga0105239_100089667 211
629 3300010375 Ga0105239_10010713 Ga0105239_100107136 211
630 3300010375 Ga0105239_10016759 Ga0105239_100167594 211
631 3300010375 Ga0105239_10022426 Ga0105239_100224262 211
632 3300010375 Ga0105239_10191946 Ga0105239_101919463 211
633 3300010375 Ga0105239_10263924 Ga0105239_102639242 211
634 3300010375 Ga0105239_10468438 Ga0105239_104684382 211
635 3300010375 Ga0105239_10632751 Ga0105239_106327512 211
636 3300010375 Ga0105239_10920005 Ga0105239_109200051 211
637 3300011119 Ga0105246_10013688 Ga0105246_100136885 211
638 3300011119 Ga0105246_10044011 Ga0105246_100440114 211
639 3300011119 Ga0105246_10095898 Ga0105246_100958982 211
640 3300011119 Ga0105246_10220602 Ga0105246_102206022 211
641 3300011119 Ga0105246_10240190 Ga0105246_102401902 211
642 3300011119 Ga0105246_10366555 Ga0105246_103665552 211
643 3300013100 Ga0157373_10020245 Ga0157373_100202453 211
644 3300013100 Ga0157373_10239824 Ga0157373_102398242 211
645 3300013102 Ga0157371_10004173 Ga0157371_100041731 211
646 3300013102 Ga0157371_10011287 Ga0157371_100112877 211
647 3300013102 Ga0157371_10039728 Ga0157371_100397282 211
648 3300013102 Ga0157371_10043884 Ga0157371_100438843 211
649 3300013102 Ga0157371_10152159 Ga0157371_101521592 211
650 3300013102 Ga0157371_10295523 Ga0157371_102955232 211
651 3300013104 Ga0157370_10001484 Ga0157370_1000148426 211
652 3300013104 Ga0157370_10001788 Ga0157370_1000178816 211
653 3300013104 Ga0157370_10006166 Ga0157370_100061665 211
654 3300013104 Ga0157370_10008668 Ga0157370_100086683 211
655 3300013104 Ga0157370_10450554 Ga0157370_104505542 211
656 3300013104 Ga0157370_10742032 Ga0157370_107420322 211
657 3300013105 Ga0157369_10015180 Ga0157369_100151808 211
658 3300013105 Ga0157369_10026472 Ga0157369_100264727 211
659 3300013105 Ga0157369_10160770 Ga0157369_101607703 211
660 3300013105 Ga0157369_10608913 Ga0157369_106089131 211
661 3300013296 Ga0157374_10000013 Ga0157374_10000013374 211
662 3300013296 Ga0157374_10004538 Ga0157374_1000453810 211
663 3300013296 Ga0157374_10011781 Ga0157374_100117816 211
664 3300013296 Ga0157374_10022853 Ga0157374_100228533 211
665 3300013296 Ga0157374_10036791 Ga0157374_100367915 211
666 3300013296 Ga0157374_10124712 Ga0157374_101247122 211
667 3300013296 Ga0157374_10196755 Ga0157374_101967552 211
668 3300013296 Ga0157374_10232005 Ga0157374_102320052 211
669 3300013296 Ga0157374_10251169 Ga0157374_102511692 211
670 3300013296 Ga0157374_10278121 Ga0157374_102781212 211
671 3300013296 Ga0157374_10315847 Ga0157374_103158471 211
672 3300013297 Ga0157378_10005807 Ga0157378_100058072 211
673 3300013297 Ga0157378_10006964 Ga0157378_100069649 211
674 3300013297 Ga0157378_10010274 Ga0157378_100102743 211
675 3300013297 Ga0157378_10014737 Ga0157378_100147374 211
676 3300013297 Ga0157378_10020328 Ga0157378_100203285 211
677 3300013297 Ga0157378_10087729 Ga0157378_100877292 211
678 3300013297 Ga0157378_10156521 Ga0157378_101565212 211
679 3300013297 Ga0157378_10263047 Ga0157378_102630472 211
680 3300013297 Ga0157378_11469559 Ga0157378_114695591 211
681 3300013306 Ga0163162_10000898 Ga0163162_1000089811 211
682 3300013306 Ga0163162_10001132 Ga0163162_100011324 211
683 3300013306 Ga0163162_10001183 Ga0163162_100011836 211
684 3300013306 Ga0163162_10003339 Ga0163162_1000333912 211
685 3300013306 Ga0163162_10007125 Ga0163162_100071257 211
686 3300013306 Ga0163162_10010595 Ga0163162_100105955 211
687 3300013306 Ga0163162_10010709 Ga0163162_100107099 211
688 3300013306 Ga0163162_10031486 Ga0163162_100314864 211
689 3300013306 Ga0163162_10036874 Ga0163162_100368743 211
690 3300013306 Ga0163162_10041456 Ga0163162_100414563 211
691 3300013306 Ga0163162_10043363 Ga0163162_100433632 211
692 3300013306 Ga0163162_10111300 Ga0163162_101113002 211
693 3300013306 Ga0163162_10387114 Ga0163162_103871142 211
694 3300013306 Ga0163162_10414891 Ga0163162_104148911 211
695 3300013306 Ga0163162_10507547 Ga0163162_105075472 211
696 3300013306 Ga0163162_10648537 Ga0163162_106485372 211
697 3300013306 Ga0163162_10741572 Ga0163162_107415722 211
698 3300013306 Ga0163162_11147034 Ga0163162_111470341 211
699 3300013306 Ga0163162_11175175 Ga0163162_111751752 211
700 3300013306 Ga0163162_11700306 Ga0163162_117003062 211
701 3300013307 Ga0157372_10000965 Ga0157372_100009652 211
702 3300013307 Ga0157372_10030941 Ga0157372_100309412 211
703 3300013307 Ga0157372_10038383 Ga0157372_100383834 211
704 3300013307 Ga0157372_10097510 Ga0157372_100975102 211
705 3300013307 Ga0157372_10216760 Ga0157372_102167602 211
706 3300013307 Ga0157372_10253248 Ga0157372_102532482 211
707 3300013307 Ga0157372_10268175 Ga0157372_102681751 211
708 3300013307 Ga0157372_10425065 Ga0157372_104250652 211
709 3300013307 Ga0157372_10539341 Ga0157372_105393412 211
710 3300013307 Ga0157372_10599326 Ga0157372_105993262 211
711 3300013307 Ga0157372_10815270 Ga0157372_108152702 211
712 3300013307 Ga0157372_10916320 Ga0157372_109163201 211
713 3300013307 Ga0157372_11020903 Ga0157372_110209031 211
714 3300013307 Ga0157372_11179925 Ga0157372_111799251 211
715 3300013308 Ga0157375_10004252 Ga0157375_100042527 211
716 3300013308 Ga0157375_10008550 Ga0157375_100085509 211
717 3300013308 Ga0157375_10018936 Ga0157375_100189363 211
718 3300013308 Ga0157375_10019451 Ga0157375_100194513 211
719 3300013308 Ga0157375_10020351 Ga0157375_100203516 211
720 3300013308 Ga0157375_10039994 Ga0157375_100399944 211
721 3300013308 Ga0157375_10085351 Ga0157375_100853513 211
722 3300013308 Ga0157375_10087286 Ga0157375_100872863 211
723 3300013308 Ga0157375_10103438 Ga0157375_101034383 211
724 3300013308 Ga0157375_10132544 Ga0157375_101325442 211
725 3300013308 Ga0157375_10322705 Ga0157375_103227052 211
726 3300013308 Ga0157375_10331409 Ga0157375_103314092 211
727 3300013308 Ga0157375_12009377 Ga0157375_120093771 211
728 3300014325 Ga0163163_10000526 Ga0163163_100005263 211
729 3300014325 Ga0163163_10000858 Ga0163163_1000085812 211
730 3300014325 Ga0163163_10000952 Ga0163163_100009523 211
731 3300014325 Ga0163163_10006919 Ga0163163_100069196 211
732 3300014325 Ga0163163_10065250 Ga0163163_100652502 211
733 3300014325 Ga0163163_10105021 Ga0163163_101050212 211
734 3300014325 Ga0163163_10211471 Ga0163163_102114713 211
735 3300014325 Ga0163163_10232007 Ga0163163_102320071 211
736 3300014325 Ga0163163_10701164 Ga0163163_107011641 211
737 3300014325 Ga0163163_11029096 Ga0163163_110290961 211
738 3300014325 Ga0163163_11061920 Ga0163163_110619201 211
739 3300014326 Ga0157380_10007560 Ga0157380_100075606 211
740 3300014326 Ga0157380_10048134 Ga0157380_100481343 211
741 3300014326 Ga0157380_10061625 Ga0157380_100616253 211
742 3300014326 Ga0157380_10106449 Ga0157380_101064494 211
743 3300014326 Ga0157380_10342931 Ga0157380_103429312 211
744 3300014326 Ga0157380_10447017 Ga0157380_104470172 211
745 3300014326 Ga0157380_10451263 Ga0157380_104512631 211
746 3300014326 Ga0157380_10472266 Ga0157380_104722662 211
747 3300014326 Ga0157380_11523776 Ga0157380_115237761 211
748 3300014745 Ga0157377_10000392 Ga0157377_1000039210 211
749 3300014745 Ga0157377_10001057 Ga0157377_100010579 211
750 3300014745 Ga0157377_10046592 Ga0157377_100465921 211
751 3300014745 Ga0157377_10053588 Ga0157377_100535882 211
752 3300014745 Ga0157377_10462651 Ga0157377_104626511 211
753 3300014968 Ga0157379_10022827 Ga0157379_100228272 211
754 3300014968 Ga0157379_10048092 Ga0157379_100480925 211
755 3300014968 Ga0157379_10072737 Ga0157379_100727371 211
756 3300014968 Ga0157379_10079740 Ga0157379_100797402 211
757 3300014968 Ga0157379_10114075 Ga0157379_101140752 211
758 3300014968 Ga0157379_10131139 Ga0157379_101311392 211
759 3300014968 Ga0157379_10227245 Ga0157379_102272452 211
760 3300014968 Ga0157379_10296621 Ga0157379_102966212 211
761 3300014969 Ga0157376_10000762 Ga0157376_1000076214 211
762 3300014969 Ga0157376_10001533 Ga0157376_100015337 211
763 3300014969 Ga0157376_10009911 Ga0157376_100099113 211
764 3300014969 Ga0157376_10016300 Ga0157376_100163004 211
765 3300014969 Ga0157376_10060867 Ga0157376_100608673 211
766 3300014969 Ga0157376_10079300 Ga0157376_100793002 211
767 3300014969 Ga0157376_10080801 Ga0157376_100808012 211
768 3300014969 Ga0157376_10113215 Ga0157376_101132151 211
769 3300014969 Ga0157376_10245566 Ga0157376_102455661 211
770 3300014969 Ga0157376_10296810 Ga0157376_102968102 211
771 3300014969 Ga0157376_10299518 Ga0157376_102995182 211
772 3300014969 Ga0157376_10699806 Ga0157376_106998062 211
773 3300017792 Ga0163161_10006402 Ga0163161_100064028 211
774 3300017792 Ga0163161_10022548 Ga0163161_100225483 211
775 3300017792 Ga0163161_10081953 Ga0163161_100819532 211
776 3300017792 Ga0163161_10093655 Ga0163161_100936552 211
777 3300017792 Ga0163161_10142535 Ga0163161_101425352 211
778 3300017792 Ga0163161_10169703 Ga0163161_101697032 211
779 3300017792 Ga0163161_10187944 Ga0163161_101879442 211
780 3300017792 Ga0163161_10404613 Ga0163161_104046132 211
781 3300021384 Ga0213876_10000389 Ga0213876_100003896 211
782 3300021384 Ga0213876_10017439 Ga0213876_100174396 211
783 3300025246 Ga0209646_1001769 Ga0209646_10017696 211
784 3300025271 Ga0207666_1016606 Ga0207666_10166061 211
785 3300025302 Ga0207426_1000040 Ga0207426_100004088 211
786 3300025315 Ga0207697_10085413 Ga0207697_100854132 211
787 3300025315 Ga0207697_10213379 Ga0207697_102133791 211
788 3300025315 Ga0207697_10230922 Ga0207697_102309221 211
789 3300025321 Ga0207656_10010007 Ga0207656_100100072 211
790 3300025321 Ga0207656_10016777 Ga0207656_100167771 211
791 3300025321 Ga0207656_10137335 Ga0207656_101373352 211
792 3300025893 Ga0207682_10076987 Ga0207682_100769872 211
793 3300025899 Ga0207642_10077250 Ga0207642_100772501 211
794 3300025900 Ga0207710_10018695 Ga0207710_100186953 211
795 3300025901 Ga0207688_10039420 Ga0207688_100394202 211
796 3300025901 Ga0207688_10058506 Ga0207688_100585062 211
797 3300025901 Ga0207688_10218956 Ga0207688_102189562 211
798 3300025903 Ga0207680_10000048 Ga0207680_1000004815 211
799 3300025903 Ga0207680_10008926 Ga0207680_100089262 211
800 3300025903 Ga0207680_10027434 Ga0207680_100274344 211
801 3300025903 Ga0207680_10043116 Ga0207680_100431162 211
802 3300025903 Ga0207680_10073238 Ga0207680_100732382 211
803 3300025903 Ga0207680_10238051 Ga0207680_102380511 211
804 3300025904 Ga0207647_10041306 Ga0207647_100413063 211
805 3300025904 Ga0207647_10053279 Ga0207647_100532792 211
806 3300025904 Ga0207647_10083002 Ga0207647_100830023 211
807 3300025904 Ga0207647_10101158 Ga0207647_101011582 211
808 3300025904 Ga0207647_10125257 Ga0207647_101252572 211
809 3300025907 Ga0207645_10000357 Ga0207645_1000035713 211
810 3300025907 Ga0207645_10001186 Ga0207645_100011865 211
811 3300025907 Ga0207645_10027538 Ga0207645_100275382 211
812 3300025907 Ga0207645_10136338 Ga0207645_101363382 211
813 3300025907 Ga0207645_10235690 Ga0207645_102356902 211
814 3300025908 Ga0207643_10016383 Ga0207643_100163832 211
815 3300025908 Ga0207643_10016455 Ga0207643_100164555 211
816 3300025908 Ga0207643_10127457 Ga0207643_101274572 211
817 3300025908 Ga0207643_10327419 Ga0207643_103274192 211
818 3300025909 Ga0207705_10012442 Ga0207705_100124425 211
819 3300025909 Ga0207705_10103224 Ga0207705_101032242 211
820 3300025909 Ga0207705_10195874 Ga0207705_101958742 211
821 3300025911 Ga0207654_10000782 Ga0207654_100007829 211
822 3300025911 Ga0207654_10054028 Ga0207654_100540283 211
823 3300025911 Ga0207654_10063973 Ga0207654_100639732 211
824 3300025911 Ga0207654_10163341 Ga0207654_101633412 211
825 3300025911 Ga0207654_10597734 Ga0207654_105977341 211
826 3300025911 Ga0207654_10648243 Ga0207654_106482432 211
827 3300025912 Ga0207707_10082925 Ga0207707_100829252 211
828 3300025912 Ga0207707_10162934 Ga0207707_101629342 211
829 3300025913 Ga0207695_10000209 Ga0207695_10000209120 211
830 3300025913 Ga0207695_10002106 Ga0207695_100021064 211
831 3300025913 Ga0207695_10002258 Ga0207695_100022584 211
832 3300025913 Ga0207695_10002430 Ga0207695_1000243022 211
833 3300025913 Ga0207695_10013165 Ga0207695_100131658 211
834 3300025913 Ga0207695_10020430 Ga0207695_100204306 211
835 3300025913 Ga0207695_10066998 Ga0207695_100669984 211
836 3300025913 Ga0207695_10080791 Ga0207695_100807912 211
837 3300025913 Ga0207695_10135248 Ga0207695_101352482 211
838 3300025913 Ga0207695_10146924 Ga0207695_101469242 211
839 3300025913 Ga0207695_10190290 Ga0207695_101902902 211
840 3300025913 Ga0207695_10696271 Ga0207695_106962711 211
841 3300025914 Ga0207671_10000971 Ga0207671_100009713 211
842 3300025914 Ga0207671_10001368 Ga0207671_1000136813 211
843 3300025914 Ga0207671_10001764 Ga0207671_100017649 211
844 3300025914 Ga0207671_10004891 Ga0207671_100048913 211
845 3300025914 Ga0207671_10011353 Ga0207671_100113532 211
846 3300025914 Ga0207671_10031686 Ga0207671_100316863 211
847 3300025914 Ga0207671_10036513 Ga0207671_100365133 211
848 3300025914 Ga0207671_10523540 Ga0207671_105235402 211
849 3300025918 Ga0207662_10086377 Ga0207662_100863772 211
850 3300025918 Ga0207662_10125757 Ga0207662_101257571 211
851 3300025918 Ga0207662_10235699 Ga0207662_102356992 211
852 3300025919 Ga0207657_10003011 Ga0207657_1000301118 211
853 3300025919 Ga0207657_10035108 Ga0207657_100351083 211
854 3300025919 Ga0207657_10109615 Ga0207657_101096152 211
855 3300025920 Ga0207649_10001251 Ga0207649_100012514 211
856 3300025920 Ga0207649_10015091 Ga0207649_100150914 211
857 3300025920 Ga0207649_10335198 Ga0207649_103351981 211
858 3300025920 Ga0207649_10714181 Ga0207649_107141812 211
859 3300025921 Ga0207652_10003075 Ga0207652_100030754 211
860 3300025921 Ga0207652_10067499 Ga0207652_100674994 211
861 3300025921 Ga0207652_10068797 Ga0207652_100687973 211
862 3300025922 Ga0207646_10549979 Ga0207646_105499792 211
863 3300025923 Ga0207681_10167712 Ga0207681_101677122 211
864 3300025923 Ga0207681_10192725 Ga0207681_101927252 211
865 3300025923 Ga0207681_10295624 Ga0207681_102956242 211
866 3300025924 Ga0207694_10002249 Ga0207694_100022499 211
867 3300025924 Ga0207694_10059489 Ga0207694_100594892 211
868 3300025924 Ga0207694_10152999 Ga0207694_101529992 211
869 3300025924 Ga0207694_10195292 Ga0207694_101952922 211
870 3300025925 Ga0207650_10003712 Ga0207650_100037123 211
871 3300025925 Ga0207650_10006841 Ga0207650_100068413 211
872 3300025925 Ga0207650_10007835 Ga0207650_100078352 211
873 3300025925 Ga0207650_10106939 Ga0207650_101069392 211
874 3300025925 Ga0207650_10146887 Ga0207650_101468871 211
875 3300025925 Ga0207650_10220871 Ga0207650_102208712 211
876 3300025925 Ga0207650_10239268 Ga0207650_102392682 211
877 3300025925 Ga0207650_10286902 Ga0207650_102869022 211
878 3300025925 Ga0207650_10725315 Ga0207650_107253152 211
879 3300025926 Ga0207659_10004664 Ga0207659_100046648 211
880 3300025926 Ga0207659_10071846 Ga0207659_100718462 211
881 3300025926 Ga0207659_10114084 Ga0207659_101140842 211
882 3300025926 Ga0207659_10144451 Ga0207659_101444512 211
883 3300025926 Ga0207659_10276032 Ga0207659_102760322 211
884 3300025926 Ga0207659_10321188 Ga0207659_103211882 211
885 3300025926 Ga0207659_10376042 Ga0207659_103760421 211
886 3300025926 Ga0207659_10421235 Ga0207659_104212352 211
887 3300025926 Ga0207659_10574705 Ga0207659_105747051 211
888 3300025926 Ga0207659_10819521 Ga0207659_108195211 211
889 3300025931 Ga0207644_10019705 Ga0207644_100197052 211
890 3300025931 Ga0207644_10071023 Ga0207644_100710232 211
891 3300025931 Ga0207644_10134985 Ga0207644_101349852 211
892 3300025931 Ga0207644_10172330 Ga0207644_101723302 211
893 3300025931 Ga0207644_10184751 Ga0207644_101847512 211
894 3300025931 Ga0207644_10477553 Ga0207644_104775532 211
895 3300025932 Ga0207690_10016382 Ga0207690_100163822 211
896 3300025932 Ga0207690_10239253 Ga0207690_102392532 211
897 3300025932 Ga0207690_10896436 Ga0207690_108964361 211
898 3300025933 Ga0207706_10012656 Ga0207706_100126562 211
899 3300025933 Ga0207706_10021859 Ga0207706_100218594 211
900 3300025933 Ga0207706_10023622 Ga0207706_100236225 211
901 3300025933 Ga0207706_10033333 Ga0207706_100333332 211
902 3300025933 Ga0207706_10046152 Ga0207706_100461524 211
903 3300025933 Ga0207706_10053629 Ga0207706_100536293 211
904 3300025933 Ga0207706_10067794 Ga0207706_100677942 211
905 3300025934 Ga0207686_10000379 Ga0207686_1000037918 211
906 3300025934 Ga0207686_10037347 Ga0207686_100373473 211
907 3300025934 Ga0207686_10059144 Ga0207686_100591442 211
908 3300025934 Ga0207686_10345289 Ga0207686_103452892 211
909 3300025935 Ga0207709_10088938 Ga0207709_100889382 211
910 3300025936 Ga0207670_10005077 Ga0207670_100050774 211
911 3300025936 Ga0207670_10030685 Ga0207670_100306854 211
912 3300025936 Ga0207670_10053752 Ga0207670_100537522 211
913 3300025936 Ga0207670_10112318 Ga0207670_101123183 211
914 3300025936 Ga0207670_10529896 Ga0207670_105298962 211
915 3300025936 Ga0207670_10863130 Ga0207670_108631302 211
916 3300025937 Ga0207669_10273355 Ga0207669_102733552 211
917 3300025938 Ga0207704_10152186 Ga0207704_101521862 211
918 3300025938 Ga0207704_10231178 Ga0207704_102311782 211
919 3300025938 Ga0207704_10382948 Ga0207704_103829482 211
920 3300025940 Ga0207691_10000753 Ga0207691_1000075320 211
921 3300025940 Ga0207691_10043521 Ga0207691_100435211 211
922 3300025940 Ga0207691_10050228 Ga0207691_100502283 211
923 3300025940 Ga0207691_10087889 Ga0207691_100878893 211
924 3300025940 Ga0207691_10237117 Ga0207691_102371172 211
925 3300025940 Ga0207691_10406055 Ga0207691_104060552 211
926 3300025941 Ga0207711_10039301 Ga0207711_100393013 211
927 3300025941 Ga0207711_10264770 Ga0207711_102647702 211
928 3300025942 Ga0207689_10002902 Ga0207689_100029024 211
929 3300025942 Ga0207689_10004913 Ga0207689_100049135 211
930 3300025942 Ga0207689_10007608 Ga0207689_100076086 211
931 3300025942 Ga0207689_10010865 Ga0207689_100108655 211
932 3300025942 Ga0207689_10016418 Ga0207689_100164186 211
933 3300025942 Ga0207689_10026318 Ga0207689_100263183 211
934 3300025942 Ga0207689_10026842 Ga0207689_100268422 211
935 3300025942 Ga0207689_10039616 Ga0207689_100396164 211
936 3300025942 Ga0207689_10096195 Ga0207689_100961953 211
937 3300025942 Ga0207689_10407461 Ga0207689_104074611 211
938 3300025942 Ga0207689_10660302 Ga0207689_106603021 211
939 3300025944 Ga0207661_10000282 Ga0207661_1000028227 211
940 3300025944 Ga0207661_10013413 Ga0207661_100134134 211
941 3300025944 Ga0207661_10109990 Ga0207661_101099902 211
942 3300025944 Ga0207661_10137090 Ga0207661_101370902 211
943 3300025944 Ga0207661_10171704 Ga0207661_101717042 211
944 3300025944 Ga0207661_10539719 Ga0207661_105397192 211
945 3300025945 Ga0207679_10000304 Ga0207679_1000030424 211
946 3300025945 Ga0207679_10074199 Ga0207679_100741993 211
947 3300025945 Ga0207679_10079702 Ga0207679_100797022 211
948 3300025945 Ga0207679_10105236 Ga0207679_101052363 211
949 3300025945 Ga0207679_10177741 Ga0207679_101777412 211
950 3300025945 Ga0207679_10445585 Ga0207679_104455852 211
951 3300025949 Ga0207667_10001843 Ga0207667_100018432 211
952 3300025949 Ga0207667_10027484 Ga0207667_100274846 211
953 3300025949 Ga0207667_10074480 Ga0207667_100744802 211
954 3300025949 Ga0207667_10075993 Ga0207667_100759933 211
955 3300025949 Ga0207667_10097102 Ga0207667_100971023 211
956 3300025949 Ga0207667_10499634 Ga0207667_104996342 211
957 3300025949 Ga0207667_10536308 Ga0207667_105363082 211
958 3300025949 Ga0207667_10576358 Ga0207667_105763582 211
959 3300025960 Ga0207651_10008959 Ga0207651_100089595 211
960 3300025960 Ga0207651_10010825 Ga0207651_100108255 211
961 3300025960 Ga0207651_10016114 Ga0207651_100161144 211
962 3300025960 Ga0207651_10054890 Ga0207651_100548903 211
963 3300025960 Ga0207651_10099226 Ga0207651_100992262 211
964 3300025960 Ga0207651_10520589 Ga0207651_105205892 211
965 3300025960 Ga0207651_10768728 Ga0207651_107687282 211
966 3300025961 Ga0207712_10001280 Ga0207712_100012807 211
967 3300025961 Ga0207712_10008286 Ga0207712_100082866 211
968 3300025961 Ga0207712_10018979 Ga0207712_100189792 211
969 3300025961 Ga0207712_10053909 Ga0207712_100539092 211
970 3300025961 Ga0207712_10072507 Ga0207712_100725072 211
971 3300025961 Ga0207712_10073651 Ga0207712_100736512 211
972 3300025961 Ga0207712_10156640 Ga0207712_101566401 211
973 3300025961 Ga0207712_10559156 Ga0207712_105591562 211
974 3300025961 Ga0207712_10999876 Ga0207712_109998761 211
975 3300025972 Ga0207668_10014689 Ga0207668_100146895 211
976 3300025972 Ga0207668_10022133 Ga0207668_100221335 211
977 3300025972 Ga0207668_10033343 Ga0207668_100333433 211
978 3300025972 Ga0207668_10047176 Ga0207668_100471764 211
979 3300025972 Ga0207668_10202403 Ga0207668_102024032 211
980 3300025981 Ga0207640_10085567 Ga0207640_100855672 211
981 3300025981 Ga0207640_10225331 Ga0207640_102253311 211
982 3300025981 Ga0207640_10284160 Ga0207640_102841602 211
983 3300025981 Ga0207640_10461748 Ga0207640_104617482 211
984 3300025981 Ga0207640_10478061 Ga0207640_104780612 211
985 3300025986 Ga0207658_10025520 Ga0207658_100255204 211
986 3300025986 Ga0207658_10036724 Ga0207658_100367243 211
987 3300025986 Ga0207658_10064221 Ga0207658_100642212 211
988 3300025986 Ga0207658_10134138 Ga0207658_101341382 211
989 3300025986 Ga0207658_10154370 Ga0207658_101543702 211
990 3300025986 Ga0207658_10185190 Ga0207658_101851901 211
991 3300025986 Ga0207658_10936784 Ga0207658_109367841 211
992 3300025986 Ga0207658_11054459 Ga0207658_110544591 211
993 3300026023 Ga0207677_10010210 Ga0207677_100102105 211
994 3300026023 Ga0207677_10010827 Ga0207677_100108272 211
995 3300026023 Ga0207677_10075423 Ga0207677_100754234 211
996 3300026023 Ga0207677_10316931 Ga0207677_103169311 211
997 3300026023 Ga0207677_10337240 Ga0207677_103372402 211
998 3300026023 Ga0207677_10360967 Ga0207677_103609671 211
999 3300026023 Ga0207677_10369176 Ga0207677_103691762 211
1000 3300026023 Ga0207677_10559675 Ga0207677_105596751 211
1001 3300026035 Ga0207703_10001511 Ga0207703_1000151118 211
1002 3300026035 Ga0207703_10058716 Ga0207703_100587162 211
1003 3300026035 Ga0207703_10075589 Ga0207703_100755893 211
1004 3300026035 Ga0207703_10147465 Ga0207703_101474652 211
1005 3300026035 Ga0207703_10205330 Ga0207703_102053302 211
1006 3300026035 Ga0207703_10306723 Ga0207703_103067232 211
1007 3300026041 Ga0207639_10004009 Ga0207639_1000400912 211
1008 3300026041 Ga0207639_10027126 Ga0207639_100271262 211
1009 3300026041 Ga0207639_10081993 Ga0207639_100819933 211
1010 3300026041 Ga0207639_10200977 Ga0207639_102009771 211
1011 3300026041 Ga0207639_10252396 Ga0207639_102523962 211
1012 3300026041 Ga0207639_10657493 Ga0207639_106574931 211
1013 3300026067 Ga0207678_10092396 Ga0207678_100923962 211
1014 3300026075 Ga0207708_10943601 Ga0207708_109436011 211
1015 3300026078 Ga0207702_10063143 Ga0207702_100631433 211
1016 3300026078 Ga0207702_10089600 Ga0207702_100896002 211
1017 3300026078 Ga0207702_10105348 Ga0207702_101053482 211
1018 3300026078 Ga0207702_10289918 Ga0207702_102899182 211
1019 3300026078 Ga0207702_10753119 Ga0207702_107531192 211
1020 3300026078 Ga0207702_10963850 Ga0207702_109638502 211
1021 3300026088 Ga0207641_10000058 Ga0207641_10000058155 211
1022 3300026088 Ga0207641_10000627 Ga0207641_1000062734 211
1023 3300026088 Ga0207641_10041538 Ga0207641_100415381 211
1024 3300026088 Ga0207641_10049403 Ga0207641_100494033 211
1025 3300026088 Ga0207641_10063692 Ga0207641_100636923 211
1026 3300026088 Ga0207641_10068779 Ga0207641_100687792 211
1027 3300026088 Ga0207641_10104323 Ga0207641_101043232 211
1028 3300026088 Ga0207641_10109672 Ga0207641_101096723 211
1029 3300026088 Ga0207641_10137660 Ga0207641_101376602 211
1030 3300026088 Ga0207641_10302865 Ga0207641_103028652 211
1031 3300026088 Ga0207641_10396093 Ga0207641_103960931 211
1032 3300026089 Ga0207648_10000739 Ga0207648_1000073921 211
1033 3300026089 Ga0207648_10000768 Ga0207648_100007689 211
1034 3300026089 Ga0207648_10002407 Ga0207648_100024076 211
1035 3300026089 Ga0207648_10006875 Ga0207648_100068753 211
1036 3300026089 Ga0207648_10031326 Ga0207648_100313264 211
1037 3300026089 Ga0207648_10035588 Ga0207648_100355883 211
1038 3300026089 Ga0207648_10042904 Ga0207648_100429042 211
1039 3300026089 Ga0207648_10068941 Ga0207648_100689412 211
1040 3300026089 Ga0207648_10100465 Ga0207648_101004652 211
1041 3300026089 Ga0207648_10167608 Ga0207648_101676083 211
1042 3300026089 Ga0207648_10210084 Ga0207648_102100842 211
1043 3300026089 Ga0207648_10664101 Ga0207648_106641011 211
1044 3300026095 Ga0207676_10003726 Ga0207676_100037265 211
1045 3300026095 Ga0207676_10025840 Ga0207676_100258401 211
1046 3300026095 Ga0207676_10038012 Ga0207676_100380124 211
1047 3300026095 Ga0207676_10042685 Ga0207676_100426853 211
1048 3300026095 Ga0207676_10134381 Ga0207676_101343813 211
1049 3300026095 Ga0207676_10190485 Ga0207676_101904851 211
1050 3300026095 Ga0207676_10217877 Ga0207676_102178772 211
1051 3300026095 Ga0207676_10331542 Ga0207676_103315421 211
1052 3300026095 Ga0207676_10460741 Ga0207676_104607412 211
1053 3300026095 Ga0207676_11158422 Ga0207676_111584221 211
1054 3300026116 Ga0207674_10001969 Ga0207674_100019693 211
1055 3300026116 Ga0207674_10004112 Ga0207674_1000411215 211
1056 3300026116 Ga0207674_10005133 Ga0207674_100051339 211
1057 3300026116 Ga0207674_10011676 Ga0207674_100116766 211
1058 3300026116 Ga0207674_10041154 Ga0207674_100411544 211
1059 3300026116 Ga0207674_10041697 Ga0207674_100416973 211
1060 3300026116 Ga0207674_10056984 Ga0207674_100569842 211
1061 3300026116 Ga0207674_10059521 Ga0207674_100595213 211
1062 3300026116 Ga0207674_10071410 Ga0207674_100714103 211
1063 3300026116 Ga0207674_10360213 Ga0207674_103602132 211
1064 3300026116 Ga0207674_10455588 Ga0207674_104555882 211
1065 3300026116 Ga0207674_10568493 Ga0207674_105684932 211
1066 3300026116 Ga0207674_10962674 Ga0207674_109626742 211
1067 3300026118 Ga0207675_100000610 Ga0207675_1000006109 211
1068 3300026118 Ga0207675_100014840 Ga0207675_1000148405 211
1069 3300026118 Ga0207675_100030346 Ga0207675_1000303464 211
1070 3300026118 Ga0207675_100187606 Ga0207675_1001876062 211
1071 3300026118 Ga0207675_100590576 Ga0207675_1005905762 211
1072 3300026118 Ga0207675_100728483 Ga0207675_1007284832 211
1073 3300026121 Ga0207683_10000651 Ga0207683_1000065116 211
1074 3300026121 Ga0207683_10002030 Ga0207683_100020309 211
1075 3300026121 Ga0207683_10164904 Ga0207683_101649041 211
1076 3300026121 Ga0207683_10829407 Ga0207683_108294071 211
1077 3300026142 Ga0207698_10007369 Ga0207698_100073694 211
1078 3300026142 Ga0207698_10022588 Ga0207698_100225881 211
1079 3300026142 Ga0207698_10059020 Ga0207698_100590202 211
1080 3300026142 Ga0207698_10082547 Ga0207698_100825471 211
1081 3300026142 Ga0207698_10195712 Ga0207698_101957122 211
1082 3300026142 Ga0207698_10212436 Ga0207698_102124362 211
1083 3300026142 Ga0207698_10226193 Ga0207698_102261932 211
1084 3300026142 Ga0207698_10320931 Ga0207698_103209312 211
1085 3300026142 Ga0207698_10405561 Ga0207698_104055611 211
1086 3300026142 Ga0207698_10432576 Ga0207698_104325762 211
1087 3300026142 Ga0207698_10650134 Ga0207698_106501342 211
1088 3300026142 Ga0207698_10669866 Ga0207698_106698662 211
1089 3300026142 Ga0207698_11002369 Ga0207698_110023691 211
1090 3300027907 Ga0207428_10041576 Ga0207428_100415764 211
1091 3300027907 Ga0207428_10526443 Ga0207428_105264432 211
1092 3300028379 Ga0268266_10000169 Ga0268266_1000016963 211
1093 3300028379 Ga0268266_10119085 Ga0268266_101190852 211
1094 3300028379 Ga0268266_10308454 Ga0268266_103084541 211
1095 3300028379 Ga0268266_10864923 Ga0268266_108649232 211
1096 3300028379 Ga0268266_11037186 Ga0268266_110371861 211
1097 3300028380 Ga0268265_10018367 Ga0268265_100183676 211
1098 3300028380 Ga0268265_10051463 Ga0268265_100514631 211
1099 3300028380 Ga0268265_10214670 Ga0268265_102146702 211
1100 3300028380 Ga0268265_10280845 Ga0268265_102808452 211
1101 3300028380 Ga0268265_10483491 Ga0268265_104834912 211
1102 3300028380 Ga0268265_10606658 Ga0268265_106066582 211
1103 3300028380 Ga0268265_11282271 Ga0268265_112822711 211
1104 3300028381 Ga0268264_10000063 Ga0268264_10000063224 211
1105 3300028381 Ga0268264_10002060 Ga0268264_1000206019 211
1106 3300028381 Ga0268264_10006381 Ga0268264_100063811 211
1107 3300028381 Ga0268264_10008422 Ga0268264_100084228 211
1108 3300028381 Ga0268264_10008670 Ga0268264_100086702 211
1109 3300028381 Ga0268264_10029753 Ga0268264_100297534 211
1110 3300028381 Ga0268264_10040069 Ga0268264_100400691 211
1111 3300028381 Ga0268264_10100525 Ga0268264_101005252 211
1112 3300028381 Ga0268264_10178198 Ga0268264_101781982 211
1113 3300028381 Ga0268264_10261314 Ga0268264_102613142 211
1114 3300028381 Ga0268264_10342847 Ga0268264_103428471 211
1115 3300028786 Ga0307517_10000487 Ga0307517_1000048717 211
1116 3300028786 Ga0307517_10167345 Ga0307517_101673452 211
1117 3300028786 Ga0307517_10248431 Ga0307517_102484312 211
1118 3300028794 Ga0307515_10000059 Ga0307515_1000005957 211
1119 3300030521 Ga0307511_10021092 Ga0307511_100210922 211
1120 3300031251 Ga0265327_10000024 Ga0265327_1000002469 211
1121 3300031251 Ga0265327_10000048 Ga0265327_1000004865 211
1122 3300031251 Ga0265327_10016419 Ga0265327_100164193 211
1123 3300031251 Ga0265327_10029079 Ga0265327_100290792 211
1124 3300031344 Ga0265316_10267876 Ga0265316_102678762 211
1125 3300031456 Ga0307513_10168152 Ga0307513_101681522 211
1126 3300031456 Ga0307513_10610889 Ga0307513_106108891 211
1127 3300031507 Ga0307509_10167237 Ga0307509_101672372 211
1128 3300031507 Ga0307509_10268431 Ga0307509_102684312 211
1129 3300031507 Ga0307509_10395808 Ga0307509_103958082 211
1130 3300031548 Ga0307408_100158217 Ga0307408_1001582172 211
1131 3300031595 Ga0265313_10121691 Ga0265313_101216912 211
1132 3300031616 Ga0307508_10138399 Ga0307508_101383992 211
1133 3300031616 Ga0307508_10191802 Ga0307508_101918022 211
1134 3300031730 Ga0307516_10000384 Ga0307516_1000038425 211
1135 3300031731 Ga0307405_10178518 Ga0307405_101785182 211
1136 3300031824 Ga0307413_10229040 Ga0307413_102290402 211
1137 3300031824 Ga0307413_10479365 Ga0307413_104793651 211
1138 3300031852 Ga0307410_10025475 Ga0307410_100254751 211
1139 3300031903 Ga0307407_10398462 Ga0307407_103984622 211
1140 3300031995 Ga0307409_100231124 Ga0307409_1002311241 211
1141 3300032004 Ga0307414_10621503 Ga0307414_106215032 211
1142 3300032005 Ga0307411_10450758 Ga0307411_104507581 211
1143 3300032005 Ga0307411_10605308 Ga0307411_106053081 211
1144 3300033179 Ga0307507_10145799 Ga0307507_101457991 211
1145 3300033180 Ga0307510_10000336 Ga0307510_1000033625 211
1146 3300035086 Ga0373934_0024549 Ga0373934_0024549_500_1135 211
1147 3300035113 Ga0373936_0065728 Ga0373936_0065728_372_1007 211
1148 3300035172 Ga0373955_0064317 Ga0373955_0064317_512_1147 211
1149 3300035410 Ga0373924_0033853 Ga0373924_0033853_1037_1672 211
1150 3300035691 Ga0373931_0202388 Ga0373931_0202388_532_1167 211
1151 3300035692 Ga0373935_0288996 Ga0373935_0288996_313_948 211
1152 3300035695 Ga0373927_0306480 Ga0373927_0306480_287_922 211
1153 3300035724 Ga0373933_0267856 Ga0373933_0267856_405_1049 211
1154 3300035724 Ga0373933_0537092 Ga0373933_0537092_60_695 211
1155 3300036401 Ga0373937_0002819 Ga0373937_0002819_1718_2353 211
1156 3300036401 Ga0373937_0074889 Ga0373937_0074889_302_946 211
1157 3300036401 Ga0373937_1165821 Ga0373937_1165821_13_648 211
1158 3300037068 Ga0373925_0192164 Ga0373925_0192164_964_1599 211
1159 3300037068 Ga0373925_0426244 Ga0373925_0426244_356_991 211
1160 3300037418 Ga0395900_0005152 Ga0395900_0005152_11306_11941 211
1161 3300037418 Ga0395900_0300414 Ga0395900_0300414_942_1577 211
1162 3300037466 Ga0395898_0098464 Ga0395898_0098464_1505_2140 211
1163 3300037471 Ga0395905_0002863 Ga0395905_0002863_12832_13467 211
1164 3300037471 Ga0395905_0014192 Ga0395905_0014192_91_726 211
1165 3300038443 Ga0395901_0739082 Ga0395901_0739082_164_799 211
1166 3300039437 Ga0436365_0072673 Ga0436365_0072673_4506_5141 211
1167 3300039437 Ga0436365_0106519 Ga0436365_0106519_306_941 211
1168 3300039437 Ga0436365_1178762 Ga0436365_1178762_234_869 211
1169 3300039437 Ga0436365_1933142 Ga0436365_1933142_32248_32883 211
1170 3300041406 Ga0439439_0027928 Ga0439439_0027928_228_863 211
1171 3300041413 Ga0439465_0010784 Ga0439465_0010784_1711_2346 211
1172 3300041458 Ga0451798_1024879 Ga0451798_1024879_203_838 211
1173 3300041459 Ga0451800_1125868 Ga0451800_1125868_585_1298 211
1174 3300041460 Ga0451802_0608510 Ga0451802_0608510_162_800 211
1175 3300041492 Ga0451835_1115397 Ga0451835_1115397_575_1210 211
1176 3300041507 Ga0451851_0430098 Ga0451851_0430098_184_819 211
1177 3300041512 Ga0451853_0199542 Ga0451853_0199542_172_807 211
1178 3300041997 Ga0439431_0028196 Ga0439431_0028196_564_1199 211
1179 3300041999 Ga0439433_0029971 Ga0439433_0029971_352_987 211
1180 3300042001 Ga0439441_005423 Ga0439441_005423_414_1049 211
1181 3300042003 Ga0439443_011468 Ga0439443_011468_304_939 211
1182 3300042004 Ga0439445_0021990 Ga0439445_0021990_449_1084 211
1183 3300042005 Ga0439448_0167442 Ga0439448_0167442_81_716 211
1184 3300042007 Ga0439449_0001478 Ga0439449_0001478_572_1207 211
1185 3300042007 Ga0439449_0007781 Ga0439449_0007781_1557_2192 211
1186 3300042007 Ga0439449_0014732 Ga0439449_0014732_783_1421 211
1187 3300042007 Ga0439449_0099903 Ga0439449_0099903_270_911 211
1188 3300042014 Ga0439457_000285 Ga0439457_000285_8299_8937 211
1189 3300042014 Ga0439457_019598 Ga0439457_019598_382_1017 211
1190 3300042014 Ga0439457_079903 Ga0439457_079903_84_719 211
1191 3300042014 Ga0439457_085194 Ga0439457_085194_14_649 211
1192 3300042015 Ga0439462_0001557 Ga0439462_0001557_3329_3967 211
1193 3300042015 Ga0439462_0013480 Ga0439462_0013480_1327_1962 211
1194 3300042015 Ga0439462_0031028 Ga0439462_0031028_103_738 211
1195 3300042015 Ga0439462_0037093 Ga0439462_0037093_503_1138 211
1196 3300042124 Ga0450922_003706 Ga0450922_003706_298_933 211
1197 3300042125 Ga0450923_004776 Ga0450923_004776_1077_1712 211
1198 3300042156 Ga0439446_0092293 Ga0439446_0092293_251_886 211
1199 3300042156 Ga0439446_0170661 Ga0439446_0170661_77_712 211
1200 3300042435 Ga0439434_0019904 Ga0439434_0019904_1326_1961 211
1201 3300044656 Ga0466969_0000730 Ga0466969_0000730_9988_10623 211
1202 3300044658 Ga0466972_0000001 Ga0466972_0000001_162617_163270 211
1203 3300044658 Ga0466972_0000082 Ga0466972_0000082_16023_16658 211
1204 3300044658 Ga0466972_0002412 Ga0466972_0002412_3981_4616 211
1205 3300044673 Ga0453683_0219278 Ga0453683_0219278_407_1042 211
1206 3300044683 Ga0466965_0253014 Ga0466965_0253014_156_791 211
1207 3300044684 Ga0466966_0000501 Ga0466966_0000501_9458_10093 211
1208 3300044693 Ga0466961_0043828 Ga0466961_0043828_1447_2082 211
1209 3300044693 Ga0466961_0107712 Ga0466961_0107712_607_1242 211
1210 3300044706 Ga0466964_0052662 Ga0466964_0052662_233_868 211
1211 3300044735 Ga0466968_0074621 Ga0466968_0074621_796_1431 211
1212 3300044765 Ga0466970_0000065 Ga0466970_0000065_5022_5675 211
1213 3300044765 Ga0466970_0053511 Ga0466970_0053511_967_1602 211
1214 3300044765 Ga0466970_0307650 Ga0466970_0307650_195_830 211
1215 3300044842 Ga0466957_0000068 Ga0466957_0000068_18853_19488 211
1216 3300044842 Ga0466957_0004118 Ga0466957_0004118_1798_2433 211
1217 3300044901 Ga0466960_0050595 Ga0466960_0050595_150_785 211
1218 3300045049 Ga0466959_0000035 Ga0466959_0000035_8206_8841 211
1219 3300045049 Ga0466959_0000676 Ga0466959_0000676_14970_15605 211
1220 3300045836 Ga0466958_0002924 Ga0466958_0002924_4403_5038 211
1221 3300046460 Ga0495638_0105944 Ga0495638_0105944_1020_1658 211
1222 3300046460 Ga0495638_0106296 Ga0495638_0106296_895_1530 211
1223 3300046460 Ga0495638_0130274 Ga0495638_0130274_147_782 211
1224 3300046460 Ga0495638_0140904 Ga0495638_0140904_389_1102 211
1225 3300046460 Ga0495638_0143686 Ga0495638_0143686_367_1002 211
1226 3300046463 Ga0495653_0099869 Ga0495653_0099869_500_1135 211
1227 3300046471 Ga0495650_0150327 Ga0495650_0150327_10_645 211
1228 3300046476 Ga0495662_0312842 Ga0495662_0312842_88_732 211
1229 3300046507 Ga0495606_0004941 Ga0495606_0004941_9322_9957 211
1230 3300046511 Ga0495608_0077443 Ga0495608_0077443_646_1281 211
1231 3300046514 Ga0495618_0038494 Ga0495618_0038494_640_1275 211
1232 3300046516 Ga0495628_0153910 Ga0495628_0153910_906_1541 211
1233 3300046517 Ga0495630_0020077 Ga0495630_0020077_3617_4252 211
1234 3300046524 Ga0495648_0002648 Ga0495648_0002648_13999_14712 211
1235 3300046529 Ga0495652_0204138 Ga0495652_0204138_622_1257 211
1236 3300046536 Ga0495587_0040141 Ga0495587_0040141_1415_2050 211
1237 3300046558 Ga0495633_0017521 Ga0495633_0017521_1726_2370 211
1238 3300046559 Ga0495667_0132724 Ga0495667_0132724_349_984 211
1239 3300046642 Ga0495634_0047261 Ga0495634_0047261_1763_2398 211
1240 3300046648 Ga0495611_0002532 Ga0495611_0002532_5038_5685 211
1241 3300046648 Ga0495611_0200656 Ga0495611_0200656_37_750 211
1242 3300046660 Ga0495625_0115255 Ga0495625_0115255_100_813 211
1243 3300046663 Ga0495635_0229698 Ga0495635_0229698_450_1085 211
1244 3300046675 Ga0495657_0067603 Ga0495657_0067603_366_1001 211
1245 3300046678 Ga0495599_0114874 Ga0495599_0114874_968_1603 211
1246 3300046683 Ga0495658_0341361 Ga0495658_0341361_33_677 211
1247 3300046689 Ga0495613_0078638 Ga0495613_0078638_114_749 211
1248 3300046689 Ga0495613_0086649 Ga0495613_0086649_520_1164 211
1249 3300046691 Ga0495670_0009818 Ga0495670_0009818_1330_1974 211
1250 3300046691 Ga0495670_0233372 Ga0495670_0233372_85_720 211
1251 3300046694 Ga0495649_0051477 Ga0495649_0051477_91_726 211
1252 3300046809 Ga0495600_0051793 Ga0495600_0051793_617_1252 211
1253 3300047317 Ga0495604_0148105 Ga0495604_0148105_90_725 211
1254 3300047320 Ga0495672_0035973 Ga0495672_0035973_2391_3032 211
1255 3300047443 Ga0495687_001778 Ga0495687_001778_13720_14355 211
1256 3300047471 Ga0495684_0121438 Ga0495684_0121438_455_1090 211
1257 3300047471 Ga0495684_0211774 Ga0495684_0211774_51_686 211
1258 3300047472 Ga0495686_0000010 Ga0495686_0000010_523139_523774 211
1259 3300047472 Ga0495686_0252057 Ga0495686_0252057_306_941 211
1260 3300047472 Ga0495686_0287524 Ga0495686_0287524_175_834 211
1261 3300048903 Ga0496100_0264300 Ga0496100_0264300_485_1123 211
1262 3300048904 Ga0496101_0028286 Ga0496101_0028286_232_870 211
1263 3300048907 Ga0496104_0822484 Ga0496104_0822484_166_801 211
1264 3300048910 Ga0496107_0643672 Ga0496107_0643672_57_692 211
1265 3300048911 Ga0496108_0340372 Ga0496108_0340372_565_1200 211
1266 3300048912 Ga0496109_0068093 Ga0496109_0068093_115_762 211
1267 3300048912 Ga0496109_0157027 Ga0496109_0157027_1433_2068 211
1268 3300048913 Ga0496110_0024996 Ga0496110_0024996_3330_3965 211
1269 3300048918 Ga0496115_0172599 Ga0496115_0172599_424_1071 211
1270 3300048927 Ga0496124_0060903 Ga0496124_0060903_2184_2819 211
1271 3300049128 Ga0501308_015872 Ga0501308_015872_227_862 211
1272 3300049161 Ga0501305_002297 Ga0501305_002297_1363_1998 211
1273 3300049513 Ga0501290_005229 Ga0501290_005229_448_1083 211
1274 3300049517 Ga0501294_023272 Ga0501294_023272_13_648 211
1275 3300049520 Ga0501297_013979 Ga0501297_013979_161_796 211
1276 3300049521 Ga0501298_000356 Ga0501298_000356_2194_2829 211
1277 3300049528 Ga0501312_018081 Ga0501312_018081_354_989 211
1278 3300049568 Ga0501031_0057102 Ga0501031_0057102_1369_2004 211
1279 3300049568 Ga0501031_0143341 Ga0501031_0143341_789_1424 211
1280 3300049569 Ga0501032_0003107 Ga0501032_0003107_4461_5096 211
1281 3300049569 Ga0501032_0100156 Ga0501032_0100156_1165_1800 211
1282 3300049569 Ga0501032_0158192 Ga0501032_0158192_653_1291 211
1283 3300049570 Ga0501033_0053227 Ga0501033_0053227_1557_2201 211
1284 3300049570 Ga0501033_0128977 Ga0501033_0128977_1143_1778 211
1285 3300049571 Ga0501034_0003047 Ga0501034_0003047_8378_9022 211
1286 3300049571 Ga0501034_0053007 Ga0501034_0053007_2263_2898 211
1287 3300049571 Ga0501034_0109945 Ga0501034_0109945_811_1449 211
1288 3300049571 Ga0501034_0172210 Ga0501034_0172210_717_1355 211
1289 3300049571 Ga0501034_0172211 Ga0501034_0172211_581_1216 211
1290 3300049571 Ga0501034_0176165 Ga0501034_0176165_1238_1873 211
1291 3300049571 Ga0501034_0407042 Ga0501034_0407042_326_961 211
1292 3300049572 Ga0501036_0018493 Ga0501036_0018493_3811_4446 211
1293 3300049572 Ga0501036_0019548 Ga0501036_0019548_5002_5637 211
1294 3300049573 Ga0501037_0059018 Ga0501037_0059018_379_1020 211
1295 3300049573 Ga0501037_0147649 Ga0501037_0147649_400_1035 211
1296 3300049574 Ga0501038_0006357 Ga0501038_0006357_3387_4022 211
1297 3300049574 Ga0501038_0115360 Ga0501038_0115360_1167_1802 211
1298 3300049575 Ga0501039_0100166 Ga0501039_0100166_451_1086 211
1299 3300049575 Ga0501039_0186019 Ga0501039_0186019_93_728 211
1300 3300049579 Ga0501043_0011480 Ga0501043_0011480_1271_1906 211
1301 3300049579 Ga0501043_0064064 Ga0501043_0064064_1748_2386 211
1302 3300049579 Ga0501043_0084991 Ga0501043_0084991_247_888 211
1303 3300049579 Ga0501043_0104350 Ga0501043_0104350_857_1492 211
1304 3300049580 Ga0501046_0004991 Ga0501046_0004991_5584_6219 211
1305 3300049580 Ga0501046_0120690 Ga0501046_0120690_195_830 211
1306 3300049581 Ga0501047_0055644 Ga0501047_0055644_1502_2137 211
1307 3300049581 Ga0501047_0058871 Ga0501047_0058871_2408_3043 211
1308 3300049581 Ga0501047_0069981 Ga0501047_0069981_275_910 211
1309 3300049581 Ga0501047_0179502 Ga0501047_0179502_1068_1703 211
1310 3300049581 Ga0501047_0416610 Ga0501047_0416610_338_1078 211
1311 3300049581 Ga0501047_0679860 Ga0501047_0679860_118_756 211
1312 3300049581 Ga0501047_0814958 Ga0501047_0814958_78_725 211
1313 3300049582 Ga0501048_0009237 Ga0501048_0009237_3267_3902 211
1314 3300049583 Ga0501067_0038781 Ga0501067_0038781_469_1104 211
1315 3300049583 Ga0501067_0202777 Ga0501067_0202777_375_1010 211
1316 3300049586 Ga0501070_0025897 Ga0501070_0025897_1656_2291 211
1317 3300049586 Ga0501070_0186795 Ga0501070_0186795_662_1303 211
1318 3300049588 Ga0501072_0151976 Ga0501072_0151976_85_720 211
1319 3300049588 Ga0501072_0172464 Ga0501072_0172464_720_1355 211
1320 3300049589 Ga0501073_0001997 Ga0501073_0001997_6578_7213 211
1321 3300049590 Ga0501074_0025471 Ga0501074_0025471_1550_2185 211
1322 3300049649 Ga0501198_000395 Ga0501198_000395_3037_3672 211
1323 3300049651 Ga0501201_000318 Ga0501201_000318_992_1627 211
1324 3300049652 Ga0501202_005266 Ga0501202_005266_1411_2046 211
1325 3300049652 Ga0501202_032559 Ga0501202_032559_90_725 211
1326 3300049653 Ga0501206_000308 Ga0501206_000308_4037_4672 211
1327 3300049654 Ga0501207_002499 Ga0501207_002499_1698_2333 211
1328 3300049654 Ga0501207_003196 Ga0501207_003196_1200_1835 211
1329 3300049661 Ga0501217_000111 Ga0501217_000111_8561_9196 211
1330 3300049663 Ga0501223_000680 Ga0501223_000680_1904_2539 211
1331 3300049664 Ga0501224_000263 Ga0501224_000263_4025_4660 211
1332 3300049665 Ga0501227_073160 Ga0501227_073160_92_727 211
1333 3300049668 Ga0501233_006270 Ga0501233_006270_135_770 211
1334 3300049669 Ga0501235_000208 Ga0501235_000208_240_875 211
1335 3300049674 Ga0501242_000919 Ga0501242_000919_2125_2760 211
1336 3300049676 Ga0501246_004558 Ga0501246_004558_370_1005 211
1337 3300049681 Ga0501251_001644 Ga0501251_001644_1322_1957 211
1338 3300049682 Ga0501252_004478 Ga0501252_004478_147_782 211
1339 3300049683 Ga0501253_002910 Ga0501253_002910_1291_1926 211
1340 3300049686 Ga0501257_028946 Ga0501257_028946_434_1114 211
1341 3300049688 Ga0501259_000655 Ga0501259_000655_4671_5306 211
1342 3300049690 Ga0501261_000904 Ga0501261_000904_1341_1976 211
1343 3300049704 Ga0501221_000397 Ga0501221_000397_3837_4472 211
1344 3300049705 Ga0501225_0000233 Ga0501225_0000233_10672_11307 211
1345 3300049705 Ga0501225_0000726 Ga0501225_0000726_7545_8180 211
1346 3300049705 Ga0501225_0043241 Ga0501225_0043241_559_1194 211
1347 3300049707 Ga0501234_008232 Ga0501234_008232_773_1408 211
1348 3300049708 Ga0501245_000736 Ga0501245_000736_1851_2486 211
1349 3300049741 Ga0501079_0049102 Ga0501079_0049102_628_1263 211
1350 3300049742 Ga0501080_0197277 Ga0501080_0197277_564_1211 211
1351 3300049742 Ga0501080_0233226 Ga0501080_0233226_501_1145 211
1352 3300049742 Ga0501080_0444381 Ga0501080_0444381_413_1048 211
1353 3300049744 Ga0501083_0025529 Ga0501083_0025529_1445_2080 211
1354 3300049760 Ga0501263_005496 Ga0501263_005496_603_1238 211
1355 3300049761 Ga0501264_017328 Ga0501264_017328_31_666 211
1356 3300049765 Ga0501268_017270 Ga0501268_017270_199_834 211
1357 3300049767 Ga0501270_003552 Ga0501270_003552_354_989 211
1358 3300049767 Ga0501270_005178 Ga0501270_005178_355_990 211
1359 3300049767 Ga0501270_035267 Ga0501270_035267_25_660 211
1360 3300049767 Ga0501270_045688 Ga0501270_045688_126_761 211
1361 3300049769 Ga0501272_004052 Ga0501272_004052_554_1189 211
1362 3300049775 Ga0501279_015484 Ga0501279_015484_255_890 211
1363 3300049822 Ga0501035_0003691 Ga0501035_0003691_10793_11428 211
1364 3300049822 Ga0501035_0009650 Ga0501035_0009650_6030_6665 211
1365 3300049822 Ga0501035_0194077 Ga0501035_0194077_1027_1662 211
1366 3300049822 Ga0501035_0595605 Ga0501035_0595605_67_705 211
1367 3300049823 Ga0501044_0010522 Ga0501044_0010522_3504_4139 211
1368 3300049823 Ga0501044_0013426 Ga0501044_0013426_116_760 211
1369 3300049823 Ga0501044_0033294 Ga0501044_0033294_1676_2317 211
1370 3300049823 Ga0501044_0039830 Ga0501044_0039830_2032_2667 211
1371 3300049823 Ga0501044_0050002 Ga0501044_0050002_1428_2063 211
1372 3300049824 Ga0501045_0086700 Ga0501045_0086700_243_878 211
1373 3300049851 Ga0501212_001186 Ga0501212_001186_1846_2481 211
1374 3300049851 Ga0501212_031808 Ga0501212_031808_67_702 211
1375 3300050493 nmdc:mga0k408_11749_c1 nmdc:mga0k408_11749_c1_1294_1932 211
1376 3300050493 nmdc:mga0k408_122202_c1 nmdc:mga0k408_122202_c1_702_1337 211
1377 3300050493 nmdc:mga0k408_13581_c1 nmdc:mga0k408_13581_c1_2586_3221 211
1378 3300050493 nmdc:mga0k408_18405_c1 nmdc:mga0k408_18405_c1_3048_3683 211
1379 3300050493 nmdc:mga0k408_94207_c1 nmdc:mga0k408_94207_c1_387_1022 211
1380 3300050507 nmdc:mga05p37_104364_c1 nmdc:mga05p37_104364_c1_507_1142 211
1381 3300050507 nmdc:mga05p37_167975_c1 nmdc:mga05p37_167975_c1_488_1123 211
1382 3300050507 nmdc:mga05p37_419314_c1 nmdc:mga05p37_419314_c1_539_1174 211
1383 3300050508 nmdc:mga09592_174407_c1 nmdc:mga09592_174407_c1_346_981 211
1384 3300050508 nmdc:mga09592_93411_c1 nmdc:mga09592_93411_c1_882_1517 211
1385 3300050509 nmdc:mga0qj67_27449_c1 nmdc:mga0qj67_27449_c1_2900_3535 211
1386 3300050510 nmdc:mga06r32_128331_c1 nmdc:mga06r32_128331_c1_1586_2221 211
1387 3300050511 nmdc:mga08y16_185540_c1 nmdc:mga08y16_185540_c1_52_687 211
1388 3300050511 nmdc:mga08y16_45049_c1 nmdc:mga08y16_45049_c1_2800_3435 211
1389 3300053085 Ga0495619_0164266 Ga0495619_0164266_380_1015 211
1390 3300053086 Ga0500578_0000060 Ga0500578_0000060_5513_6148 211
1391 3300053086 Ga0500578_0210606 Ga0500578_0210606_135_770 211
1392 3300053088 Ga0500644_0002545 Ga0500644_0002545_3525_4160 211
1393 3300053088 Ga0500644_0024560 Ga0500644_0024560_712_1347 211
1394 3300053090 Ga0500646_0008048 Ga0500646_0008048_700_1335 211
1395 3300053090 Ga0500646_0011263 Ga0500646_0011263_728_1366 211
1396 3300053092 Ga0500583_0000003 Ga0500583_0000003_210814_211455 211
1397 3300053092 Ga0500583_0000778 Ga0500583_0000778_3011_3646 211
1398 3300053093 Ga0500651_0418566 Ga0500651_0418566_28_663 211
1399 3300053098 Ga0500650_0210614 Ga0500650_0210614_13_648 211
1400 3300053108 Ga0500562_000024 Ga0500562_000024_54059_54694 211
1401 3300053129 Ga0500628_040824 Ga0500628_040824_302_937 211
1402 3300053130 Ga0500642_0014700 Ga0500642_0014700_237_950 211
1403 3300053131 Ga0500652_032801 Ga0500652_032801_655_1290 211
1404 3300053134 Ga0500658_0039328 Ga0500658_0039328_249_893 211
1405 3300053136 Ga0500559_0045793 Ga0500559_0045793_194_832 211
1406 3300053139 Ga0500568_0009995 Ga0500568_0009995_1916_2581 211
1407 3300053146 Ga0500588_0006275 Ga0500588_0006275_1983_2618 211
1408 3300053146 Ga0500588_0040324 Ga0500588_0040324_79_714 211
1409 3300053150 Ga0500603_074465 Ga0500603_074465_194_832 211
1410 3300053151 Ga0500604_0003642 Ga0500604_0003642_707_1342 211
1411 3300053153 Ga0500616_0014014 Ga0500616_0014014_160_795 211
1412 3300053153 Ga0500616_0051744 Ga0500616_0051744_815_1450 211
1413 3300053153 Ga0500616_0093547 Ga0500616_0093547_322_957 211
1414 3300053153 Ga0500616_0105763 Ga0500616_0105763_514_1209 211
1415 3300053156 Ga0500622_0000604 Ga0500622_0000604_6720_7355 211
1416 3300053156 Ga0500622_0004624 Ga0500622_0004624_4249_4962 211
1417 3300053156 Ga0500622_0074416 Ga0500622_0074416_965_1603 211
1418 3300053177 Ga0500636_0254092 Ga0500636_0254092_23_658 211
1419 3300053727 Ga0500611_000008 Ga0500611_000008_105512_106147 211
1420 3300053727 Ga0500611_011533 Ga0500611_011533_507_1145 211
1421 3300053730 Ga0500645_008721 Ga0500645_008721_220_855 211
1422 3300053730 Ga0500645_036823 Ga0500645_036823_531_1166 211
1423 3300053730 Ga0500645_052634 Ga0500645_052634_412_1047 211
1424 3300061719 Ga0466962_0007361 Ga0466962_0007361_3199_3834 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

89

241

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cxy-assembly1.cif.gz_B structural insights into novel mechanisms of inhibition of the major b-carbonic anhydrase cafb from the pathogenic fungus aspergillus fumigatus (zinc-bound form) 0.9577 3 193
7cxx-assembly1.cif.gz_A structural insights into novel mechanisms of inhibition of the major b-carbonic anhydrase cafb from the pathogenic fungus aspergillus fumigatus (disulfide-bonded form) 0.9567 3 193
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9547 34 192
3e28-assembly5.cif.gz_E h. influenzae beta-carbonic anhydrase, variant y181f 0.9529 1 192
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.9524 35 191
ID Description Score Start End Superfamily
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9589 33 197 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9475 34 198 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.936 1 192 3.40.1050.10
af_O94255_95_324_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9166 7 194 3.40.1050.10
4o1jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9152 2 193 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A537J6W3-F1-model_v4 Carbonic anhydrase 0.9762 126 211 GO:0004089
GO:0008270
AF-A0A4Q3SBF0-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9728 39 209 GO:0004089
GO:0008270
GO:0015976
AF-L1I3H2-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9674 61 191 GO:0004089
GO:0008270
AF-H6WB75-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9659 3 193 GO:0004089
GO:0008270
GO:0015976
AF-A0A3B9UEE2-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9658 59 210 GO:0004089
GO:0008270
GO:0015976

Feature Viewer

pLDDT pTM Quality
93.52 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map