F493729

General Info

Members Datasets Scaffolds Average Seq Length
1407 558 1358 198

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10030423|Ga0307511_100304232
Length 226
Sequence MIAPILSQSEANLRYDISPLSNRGFNMTLRVSGKSISVGDALRGRVSERTEEVLRKYFDGNYSGHITLSKDGFGFRTDCALHLDSGITLEADSIAADAYASADQALLMIETRLRRYKSRLKDRSARKAHAASAAMAEMVAPTLDAPSYVIEAPAEGDEEMAGYSPVIIAEDTTSLKRLSVSEAVMELDLSGAACLIFQHGLSGRVNVIYRRADGNIGWIDPPAITA

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2791355199
17 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
21 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
22 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
23 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
24 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
25 2904699407
26 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
27 2906610324
28 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
29 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
30 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
31 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
32 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
33 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
34 2922425934
35 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
36 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
37 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
38 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
39 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
43 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
44 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
78 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
79 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
80 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
81 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
82 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
83 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
84 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
97 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
105 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
106 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
107 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
129 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
130 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
148 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
149 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
172 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
177 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
182 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
258 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
259 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
260 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
261 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
262 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
263 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
264 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
265 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
266 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
267 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
268 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
269 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
270 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
273 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
274 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
277 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
278 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
281 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
282 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
283 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
284 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
290 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
291 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
292 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
293 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
294 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
295 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
297 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
298 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
299 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
303 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
304 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
305 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
306 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
307 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
308 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
309 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
311 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
312 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
313 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
314 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
315 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
323 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
324 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
325 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
326 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
327 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
328 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
329 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
330 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
331 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
332 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
333 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
334 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
337 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
338 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
339 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
355 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
356 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
357 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
358 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
362 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
363 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
368 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
369 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
370 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
371 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
372 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
373 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
374 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
383 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
384 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
385 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
386 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
387 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
388 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
389 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
390 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
391 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
392 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
393 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
394 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
395 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
396 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
397 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
398 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
399 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
400 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
401 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
402 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
403 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
404 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
405 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
406 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
407 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
411 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
412 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
413 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
418 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
419 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
420 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
421 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
422 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
423 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
424 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
425 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
426 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
427 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
428 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
429 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
430 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
431 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
432 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
433 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
434 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
435 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
436 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
437 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
438 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
439 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
440 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
441 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
442 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
443 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
444 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
445 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
446 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
447 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
448 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
449 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
450 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
451 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
452 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
479 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
480 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
481 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
482 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
483 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
484 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
489 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
490 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
491 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
492 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
493 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
494 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
495 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
496 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
499 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
500 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
501 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
502 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
503 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
504 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
505 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
506 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
507 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
508 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
509 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
510 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
511 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
512 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
513 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
514 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
515 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
516 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
517 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
518 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
519 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
520 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
521 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
522 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
523 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
524 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
525 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
526 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
529 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
530 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
531 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
532 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
533 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
534 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
535 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
536 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
537 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
538 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
539 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
540 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
541 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
542 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
543 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
544 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
545 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
546 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
547 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
548 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
549 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
550 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
551 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
552 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
553 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
554 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
555 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
556 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
557 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
558 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.29
Metatranscriptomes 0.5
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.94
Nodule 2.2
Rhizoplane 5.47
Rhizosphere 73.63
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003409 3300001979 Bacteria 6993
2 JGI24739J22299_10008334 3300001989 Bacteria 3870
3 JGI24750J21931_1058227 3300002070 Bacteria 614
4 JGI24738J21930_10016956 3300002075 Bacteria 1533
5 JGI24744J21845_10008176 3300002077 Bacteria 2159
6 JGI25406J46586_10000544 3300003203 Bacteria 17662
7 JGI25165J46597_1014034 3300003214 Bacteria 1094
8 JGI25153J46596_10001259 3300003215 Bacteria 15228
9 rootH2_10177666 3300003320 Bacteria 1291
10 JGI25404J52841_10005893 3300003659 Bacteria 2542
11 JGI25404J52841_10016958 3300003659 Bacteria 1579
12 JGI25404J52841_10060516 3300003659 Bacteria 793
13 Ga0055529_1017446 3300003763 Bacteria 900
14 Ga0065715_10605089 3300005293 Bacteria 705
15 Ga0065707_10246177 3300005295 Bacteria 1140
16 Ga0070658_10027906 3300005327 Bacteria 4530
17 Ga0070658_10070700 3300005327 Bacteria 2858
18 Ga0070658_10335902 3300005327 Bacteria 1292
19 Ga0070676_10252963 3300005328 Bacteria 1176
20 Ga0070676_10401625 3300005328 Bacteria 954
21 Ga0070676_10654818 3300005328 Bacteria 763
22 Ga0070683_100008660 3300005329 Bacteria 8647
23 Ga0070690_100015372 3300005330 Bacteria 4564
24 Ga0070690_100350975 3300005330 Bacteria 1071
25 Ga0070670_100350101 3300005331 Bacteria 1298
26 Ga0070670_100415302 3300005331 Bacteria 1189
27 Ga0070677_10046447 3300005333 Bacteria 1737
28 Ga0068869_100039360 3300005334 Bacteria 3375
29 Ga0068869_100834719 3300005334 Bacteria 794
30 Ga0070666_10173558 3300005335 Bacteria 1510
31 Ga0070680_100053673 3300005336 Bacteria 3290
32 Ga0070680_100504353 3300005336 Bacteria 1035
33 Ga0070682_100074395 3300005337 Bacteria 2182
34 Ga0070682_100204035 3300005337 Bacteria 1396
35 Ga0068868_100010934 3300005338 Bacteria 6589
36 Ga0068868_100090493 3300005338 Bacteria 2464
37 Ga0068868_100265700 3300005338 Bacteria 1448
38 Ga0068868_100493970 3300005338 Bacteria 1071
39 Ga0068868_100691666 3300005338 Bacteria 912
40 Ga0070660_100001887 3300005339 Bacteria 14434
41 Ga0070660_100309716 3300005339 Bacteria 1295
42 Ga0070660_100357285 3300005339 Bacteria 1204
43 Ga0070660_100489293 3300005339 Bacteria 1023
44 Ga0070689_100559000 3300005340 Bacteria 987
45 Ga0070689_100934831 3300005340 Bacteria 769
46 Ga0070691_10017022 3300005341 Bacteria 3344
47 Ga0070691_10184863 3300005341 Bacteria 1087
48 Ga0070661_100085682 3300005344 Bacteria 2329
49 Ga0070661_100095203 3300005344 Bacteria 2208
50 Ga0070692_10286927 3300005345 Bacteria 1000
51 Ga0070668_100070058 3300005347 Bacteria 2729
52 Ga0070669_100047316 3300005353 Bacteria 3137
53 Ga0070671_100135054 3300005355 Bacteria 2079
54 Ga0070674_100033537 3300005356 Bacteria 3419
55 Ga0070674_100200230 3300005356 Bacteria 1542
56 Ga0070674_100746559 3300005356 Bacteria 841
57 Ga0070673_100150385 3300005364 Bacteria 1971
58 Ga0070673_100922543 3300005364 Bacteria 810
59 Ga0070659_100058955 3300005366 Bacteria 3031
60 Ga0070667_100035791 3300005367 Bacteria 4160
61 Ga0070667_100043929 3300005367 Bacteria 3751
62 Ga0070709_10002152 3300005434 Bacteria 10666
63 Ga0070709_10003010 3300005434 Bacteria 9063
64 Ga0070709_10004534 3300005434 Bacteria 7496
65 Ga0070709_10007655 3300005434 Bacteria 5928
66 Ga0070709_10052854 3300005434 Bacteria 2555
67 Ga0070709_10241787 3300005434 Bacteria 1297
68 Ga0070709_10449380 3300005434 Bacteria 971
69 Ga0070709_10664771 3300005434 Bacteria 808
70 Ga0070714_100009098 3300005435 Bacteria 7790
71 Ga0070714_100024582 3300005435 Bacteria 4963
72 Ga0070714_100136937 3300005435 Bacteria 2194
73 Ga0070714_100554126 3300005435 Bacteria 1101
74 Ga0070713_100007850 3300005436 Bacteria 7525
75 Ga0070713_100013276 3300005436 Bacteria 6076
76 Ga0070713_100052217 3300005436 Bacteria 3384
77 Ga0070713_100068135 3300005436 Bacteria 2998
78 Ga0070713_100096732 3300005436 Bacteria 2549
79 Ga0070710_10002056 3300005437 Bacteria 9535
80 Ga0070710_10003955 3300005437 Bacteria 7023
81 Ga0070701_10151054 3300005438 Bacteria 1337
82 Ga0070701_10158374 3300005438 Bacteria 1310
83 Ga0070711_100008601 3300005439 Bacteria 6260
84 Ga0070711_100009395 3300005439 Bacteria 6024
85 Ga0070711_100009559 3300005439 Bacteria 5980
86 Ga0070711_100010179 3300005439 Bacteria 5812
87 Ga0070711_100064420 3300005439 Bacteria 2561
88 Ga0070711_100125060 3300005439 Bacteria 1908
89 Ga0070705_100409299 3300005440 Bacteria 1006
90 Ga0070700_100145392 3300005441 Bacteria 1615
91 Ga0070694_100597268 3300005444 Bacteria 888
92 Ga0070708_100592873 3300005445 Bacteria 1045
93 Ga0070663_100004161 3300005455 Bacteria 8454
94 Ga0070663_100010152 3300005455 Bacteria 5859
95 Ga0070663_100046873 3300005455 Bacteria 3060
96 Ga0070663_100107587 3300005455 Bacteria 2090
97 Ga0070663_100168450 3300005455 Bacteria 1691
98 Ga0070663_100207406 3300005455 Bacteria 1533
99 Ga0070663_100410769 3300005455 Bacteria 1108
100 Ga0070663_100546548 3300005455 Bacteria 968
101 Ga0070663_100757148 3300005455 Bacteria 830
102 Ga0070678_100017953 3300005456 Bacteria 4572
103 Ga0070678_100099100 3300005456 Bacteria 2254
104 Ga0070678_100131001 3300005456 Bacteria 1992
105 Ga0070662_100029595 3300005457 Bacteria 3823
106 Ga0070662_100040728 3300005457 Bacteria 3309
107 Ga0070662_100264109 3300005457 Bacteria 1388
108 Ga0070662_100607869 3300005457 Bacteria 920
109 Ga0070681_10012313 3300005458 Bacteria 8481
110 Ga0070681_10013723 3300005458 Bacteria 8066
111 Ga0070681_10112709 3300005458 Bacteria 2659
112 Ga0070681_10598941 3300005458 Bacteria 1016
113 Ga0068867_100134523 3300005459 Bacteria 1925
114 Ga0068867_100187970 3300005459 Bacteria 1646
115 Ga0068867_100399618 3300005459 Bacteria 1159
116 Ga0070685_10085111 3300005466 Bacteria 1904
117 Ga0070706_100204182 3300005467 Bacteria 1846
118 Ga0070707_100065530 3300005468 Bacteria 3489
119 Ga0070698_100052755 3300005471 Bacteria 4135
120 Ga0070698_100070963 3300005471 Bacteria 3494
121 Ga0070698_101119659 3300005471 Bacteria 736
122 Ga0070679_100122653 3300005530 Bacteria 2582
123 Ga0070679_100165788 3300005530 Bacteria 2183
124 Ga0070679_100170516 3300005530 Bacteria 2149
125 Ga0070684_100003915 3300005535 Bacteria 11281
126 Ga0070684_100029211 3300005535 Bacteria 4671
127 Ga0070684_100585478 3300005535 Bacteria 1037
128 Ga0070697_100385969 3300005536 Bacteria 1214
129 Ga0068853_100001962 3300005539 Bacteria 15158
130 Ga0068853_100008973 3300005539 Bacteria 8056
131 Ga0068853_100032203 3300005539 Bacteria 4440
132 Ga0068853_100110382 3300005539 Bacteria 2443
133 Ga0068853_100362518 3300005539 Bacteria 1350
134 Ga0068853_100490632 3300005539 Bacteria 1159
135 Ga0068853_100571017 3300005539 Bacteria 1073
136 Ga0070672_100777343 3300005543 Bacteria 841
137 Ga0070672_100881879 3300005543 Bacteria 790
138 Ga0070686_100064805 3300005544 Bacteria 2371
139 Ga0070686_100481364 3300005544 Bacteria 960
140 Ga0070693_100095118 3300005547 Bacteria 1804
141 Ga0070665_100016864 3300005548 Bacteria 7324
142 Ga0070665_100033743 3300005548 Bacteria 5148
143 Ga0070665_100110444 3300005548 Bacteria 2752
144 Ga0070665_100116082 3300005548 Bacteria 2680
145 Ga0070665_100181177 3300005548 Bacteria 2107
146 Ga0070665_100241790 3300005548 Bacteria 1806
147 Ga0070665_100318507 3300005548 Bacteria 1559
148 Ga0070665_100806783 3300005548 Bacteria 951
149 Ga0070665_101263356 3300005548 Bacteria 749
150 Ga0070704_100085572 3300005549 Bacteria 2334
151 Ga0070704_100583121 3300005549 Bacteria 981
152 Ga0068855_100021775 3300005563 Bacteria 7688
153 Ga0068855_100061111 3300005563 Bacteria 4403
154 Ga0068855_100114371 3300005563 Bacteria 3094
155 Ga0068855_100167682 3300005563 Bacteria 2488
156 Ga0068855_100170211 3300005563 Bacteria 2467
157 Ga0068855_100217393 3300005563 Bacteria 2145
158 Ga0068855_100221768 3300005563 Bacteria 2120
159 Ga0068855_100319149 3300005563 Bacteria 1717
160 Ga0070664_100010417 3300005564 Bacteria 7539
161 Ga0070664_100076757 3300005564 Bacteria 2871
162 Ga0070664_100203031 3300005564 Bacteria 1769
163 Ga0068857_100022705 3300005577 Bacteria 5519
164 Ga0068857_100053898 3300005577 Bacteria 3568
165 Ga0068857_100149604 3300005577 Bacteria 2114
166 Ga0068857_100243626 3300005577 Bacteria 1646
167 Ga0068857_100476910 3300005577 Bacteria 1169
168 Ga0068854_100003097 3300005578 Bacteria 10353
169 Ga0068854_100157430 3300005578 Bacteria 1756
170 Ga0068854_100689806 3300005578 Bacteria 880
171 Ga0068854_101004209 3300005578 Bacteria 739
172 Ga0068856_100023377 3300005614 Bacteria 6008
173 Ga0068856_100161136 3300005614 Bacteria 2254
174 Ga0068856_100237588 3300005614 Bacteria 1838
175 Ga0068856_100628127 3300005614 Bacteria 1095
176 Ga0070702_100765750 3300005615 Bacteria 743
177 Ga0068852_100235724 3300005616 Bacteria 1746
178 Ga0068852_100480421 3300005616 Bacteria 1235
179 Ga0068852_100600808 3300005616 Bacteria 1104
180 Ga0068852_101165377 3300005616 Bacteria 791
181 Ga0068859_100061189 3300005617 Bacteria 3794
182 Ga0068859_101038769 3300005617 Bacteria 900
183 Ga0068864_100019747 3300005618 Bacteria 5635
184 Ga0068864_100429224 3300005618 Bacteria 1260
185 Ga0068864_100752973 3300005618 Bacteria 955
186 Ga0068866_10233459 3300005718 Bacteria 1117
187 Ga0068861_100063518 3300005719 Bacteria 2838
188 Ga0068861_100255131 3300005719 Bacteria 1498
189 Ga0068861_100314185 3300005719 Bacteria 1362
190 Ga0068851_10004663 3300005834 Bacteria 6191
191 Ga0068870_10076285 3300005840 Bacteria 1840
192 Ga0068863_100164671 3300005841 Bacteria 2126
193 Ga0068858_100027826 3300005842 Bacteria 5252
194 Ga0068858_100097450 3300005842 Bacteria 2741
195 Ga0068858_100194085 3300005842 Bacteria 1919
196 Ga0068858_100365213 3300005842 Bacteria 1384
197 Ga0068860_100001772 3300005843 Bacteria 22993
198 Ga0068860_100056338 3300005843 Bacteria 3737
199 Ga0068860_100295294 3300005843 Bacteria 1586
200 Ga0068860_100426397 3300005843 Bacteria 1315
201 Ga0068860_100453276 3300005843 Bacteria 1276
202 Ga0068860_100733704 3300005843 Bacteria 999
203 Ga0068862_100104509 3300005844 Bacteria 2481
204 Ga0068862_100495819 3300005844 Bacteria 1158
205 Ga0081540_1003529 3300005983 Bacteria 12327
206 Ga0081540_1011557 3300005983 Bacteria 5897
207 Ga0081540_1013255 3300005983 Bacteria 5370
208 Ga0081540_1013296 3300005983 Bacteria 5358
209 Ga0081540_1019386 3300005983 Bacteria 4136
210 Ga0081540_1022881 3300005983 Bacteria 3677
211 Ga0081540_1074578 3300005983 Bacteria 1554
212 Ga0081540_1184040 3300005983 Bacteria 778
213 Ga0081539_10000064 3300005985 Bacteria 247020
214 Ga0070717_10009355 3300006028 Bacteria 7360
215 Ga0070717_10070975 3300006028 Bacteria 2904
216 Ga0075365_10011114 3300006038 Bacteria 5281
217 Ga0075365_10012035 3300006038 Bacteria 5117
218 Ga0075365_10016638 3300006038 Bacteria 4478
219 Ga0075365_10173148 3300006038 Bacteria 1507
220 Ga0075368_10054207 3300006042 Bacteria 1597
221 Ga0075368_10162014 3300006042 Bacteria 937
222 Ga0075363_100022751 3300006048 Bacteria 3171
223 Ga0075363_100072285 3300006048 Bacteria 1875
224 Ga0075364_10023981 3300006051 Bacteria 3868
225 Ga0075364_10040350 3300006051 Bacteria 3027
226 Ga0075364_10044309 3300006051 Bacteria 2894
227 Ga0075364_10262713 3300006051 Bacteria 1173
228 Ga0075364_10480288 3300006051 Bacteria 849
229 Ga0075364_10498845 3300006051 Bacteria 832
230 Ga0075364_10509418 3300006051 Bacteria 823
231 Ga0070715_10008734 3300006163 Bacteria 3543
232 Ga0070715_10010042 3300006163 Bacteria 3361
233 Ga0070715_10386874 3300006163 Bacteria 774
234 Ga0070716_100015200 3300006173 Bacteria 3950
235 Ga0070716_100049904 3300006173 Bacteria 2373
236 Ga0070716_100394929 3300006173 Bacteria 993
237 Ga0070712_100004273 3300006175 Bacteria 8793
238 Ga0070712_100039649 3300006175 Bacteria 3224
239 Ga0070712_100138535 3300006175 Bacteria 1854
240 Ga0070712_100186524 3300006175 Bacteria 1620
241 Ga0070712_100738047 3300006175 Bacteria 842
242 Ga0075362_10035670 3300006177 Bacteria 2172
243 Ga0075362_10058983 3300006177 Bacteria 1732
244 Ga0075362_10136571 3300006177 Bacteria 1170
245 Ga0075362_10137371 3300006177 Bacteria 1166
246 Ga0075362_10243342 3300006177 Bacteria 884
247 Ga0075362_10315732 3300006177 Bacteria 778
248 Ga0075367_10016372 3300006178 Bacteria 4049
249 Ga0075367_10038366 3300006178 Bacteria 2788
250 Ga0075367_10064515 3300006178 Bacteria 2191
251 Ga0075367_10111628 3300006178 Bacteria 1678
252 Ga0075367_10182297 3300006178 Bacteria 1309
253 Ga0075367_10499585 3300006178 Bacteria 772
254 Ga0075369_10021370 3300006186 Bacteria 2659
255 Ga0075369_10066844 3300006186 Bacteria 1577
256 Ga0075369_10108583 3300006186 Bacteria 1250
257 Ga0075366_10075643 3300006195 Bacteria 2009
258 Ga0075366_10143633 3300006195 Bacteria 1443
259 Ga0075366_10183412 3300006195 Bacteria 1271
260 Ga0075366_10194637 3300006195 Bacteria 1232
261 Ga0097621_100020867 3300006237 Bacteria 5055
262 Ga0097621_100088568 3300006237 Bacteria 2587
263 Ga0097621_100549938 3300006237 Bacteria 1051
264 Ga0097621_100568296 3300006237 Bacteria 1034
265 Ga0075370_10127918 3300006353 Bacteria 1481
266 Ga0075370_10146480 3300006353 Bacteria 1382
267 Ga0075370_10420753 3300006353 Bacteria 803
268 Ga0068871_100039067 3300006358 Bacteria 3795
269 Ga0068871_100525902 3300006358 Bacteria 1069
270 Ga0075428_100345035 3300006844 Bacteria 1598
271 Ga0075434_100040143 3300006871 Bacteria 4636
272 Ga0068865_100041444 3300006881 Bacteria 3133
273 Ga0068865_100325690 3300006881 Bacteria 1237
274 Ga0075436_100174245 3300006914 Bacteria 1519
275 Ga0097620_100061189 3300006931 Bacteria 3794
276 Ga0097620_101038793 3300006931 Bacteria 900
277 Ga0099795_10017026 3300007788 Bacteria 2311
278 Ga0099795_10046630 3300007788 Bacteria 1562
279 Ga0099795_10176100 3300007788 Bacteria 891
280 Ga0105250_10047595 3300009092 Bacteria 1720
281 Ga0105240_10060689 3300009093 Bacteria 4713
282 Ga0105240_10144055 3300009093 Bacteria 2845
283 Ga0105240_10148867 3300009093 Bacteria 2790
284 Ga0105240_10176227 3300009093 Bacteria 2528
285 Ga0105240_10432883 3300009093 Bacteria 1476
286 Ga0111539_10131772 3300009094 Bacteria 2927
287 Ga0111539_10459047 3300009094 Bacteria 1484
288 Ga0111539_10887303 3300009094 Bacteria 1037
289 Ga0105245_10005676 3300009098 Bacteria 10968
290 Ga0105245_10122484 3300009098 Bacteria 2431
291 Ga0105245_10153912 3300009098 Bacteria 2176
292 Ga0105245_10428517 3300009098 Bacteria 1327
293 Ga0105245_11093473 3300009098 Bacteria 843
294 Ga0105247_10022343 3300009101 Bacteria 3810
295 Ga0105247_10121971 3300009101 Bacteria 1690
296 Ga0114129_10062265 3300009147 Bacteria 5213
297 Ga0114129_10571993 3300009147 Bacteria 1467
298 Ga0105243_10186686 3300009148 Bacteria 1807
299 Ga0105243_10728830 3300009148 Bacteria 970
300 Ga0105243_11214354 3300009148 Bacteria 768
301 Ga0105241_10002619 3300009174 Bacteria 13477
302 Ga0105241_10063746 3300009174 Bacteria 2845
303 Ga0105241_10233452 3300009174 Bacteria 1552
304 Ga0105241_10299583 3300009174 Bacteria 1379
305 Ga0105242_10286386 3300009176 Bacteria 1498
306 Ga0105242_10490695 3300009176 Bacteria 1166
307 Ga0105242_10647988 3300009176 Bacteria 1027
308 Ga0105248_10046598 3300009177 Bacteria 4859
309 Ga0105248_10129116 3300009177 Bacteria 2851
310 Ga0105248_10129944 3300009177 Bacteria 2842
311 Ga0105248_10208416 3300009177 Bacteria 2202
312 Ga0105248_10424995 3300009177 Bacteria 1496
313 Ga0105248_10447973 3300009177 Bacteria 1455
314 Ga0105237_10006051 3300009545 Bacteria 13534
315 Ga0105237_10026719 3300009545 Bacteria 5899
316 Ga0105237_10074544 3300009545 Bacteria 3386
317 Ga0105237_10077150 3300009545 Bacteria 3322
318 Ga0105237_10089262 3300009545 Bacteria 3072
319 Ga0105237_10116340 3300009545 Bacteria 2667
320 Ga0105237_10132136 3300009545 Bacteria 2490
321 Ga0105237_10135303 3300009545 Bacteria 2459
322 Ga0105237_10245815 3300009545 Bacteria 1791
323 Ga0105237_10361742 3300009545 Bacteria 1455
324 Ga0105237_10800157 3300009545 Bacteria 949
325 Ga0105238_10014911 3300009551 Bacteria 7866
326 Ga0105238_10015293 3300009551 Bacteria 7772
327 Ga0105238_10033085 3300009551 Bacteria 5260
328 Ga0105238_10078708 3300009551 Bacteria 3287
329 Ga0105238_10145140 3300009551 Bacteria 2350
330 Ga0105238_10267196 3300009551 Bacteria 1691
331 Ga0105238_10337524 3300009551 Bacteria 1495
332 Ga0105238_10442227 3300009551 Bacteria 1296
333 Ga0105238_11051484 3300009551 Bacteria 836
334 Ga0105249_10455878 3300009553 Bacteria 1318
335 Ga0105249_10621320 3300009553 Bacteria 1136
336 Ga0105249_10672139 3300009553 Bacteria 1094
337 Ga0105239_10049838 3300010375 Bacteria 4592
338 Ga0105239_10082296 3300010375 Bacteria 3544
339 Ga0105239_10121406 3300010375 Bacteria 2902
340 Ga0105239_10174408 3300010375 Bacteria 2405
341 Ga0105239_10583169 3300010375 Bacteria 1275
342 Ga0105239_11495542 3300010375 Bacteria 780
343 Ga0105246_10013246 3300011119 Bacteria 5165
344 Ga0105246_10244219 3300011119 Bacteria 1421
345 Ga0157370_10023008 3300013104 Bacteria 6194
346 Ga0157370_10319212 3300013104 Bacteria 1433
347 Ga0157369_10021320 3300013105 Bacteria 7247
348 Ga0157369_10043225 3300013105 Bacteria 4912
349 Ga0157369_10186347 3300013105 Bacteria 2182
350 Ga0157369_10213203 3300013105 Bacteria 2024
351 Ga0157374_10013103 3300013296 Bacteria 7232
352 Ga0157374_10205285 3300013296 Bacteria 1931
353 Ga0157374_10257282 3300013296 Bacteria 1719
354 Ga0157374_11223248 3300013296 Bacteria 773
355 Ga0157378_10027728 3300013297 Bacteria 4995
356 Ga0157378_10038376 3300013297 Bacteria 4245
357 Ga0157378_10264371 3300013297 Bacteria 1652
358 Ga0163162_10012800 3300013306 Bacteria 8196
359 Ga0163162_10387892 3300013306 Bacteria 1530
360 Ga0157372_10246402 3300013307 Bacteria 2074
361 Ga0157372_10854233 3300013307 Bacteria 1057
362 Ga0157375_10017001 3300013308 Bacteria 6552
363 Ga0157375_10275010 3300013308 Bacteria 1846
364 Ga0157375_10496016 3300013308 Bacteria 1385
365 Ga0163163_10006051 3300014325 Bacteria 10524
366 Ga0163163_10070758 3300014325 Bacteria 3475
367 Ga0163163_10094827 3300014325 Bacteria 3003
368 Ga0163163_10860278 3300014325 Bacteria 970
369 Ga0157380_10469602 3300014326 Bacteria 1214
370 Ga0157380_10972443 3300014326 Bacteria 880
371 Ga0157380_11451865 3300014326 Bacteria 738
372 Ga0157377_10521161 3300014745 Bacteria 834
373 Ga0157379_10179322 3300014968 Bacteria 1914
374 Ga0157379_10232443 3300014968 Bacteria 1671
375 Ga0157376_10053451 3300014969 Bacteria 3363
376 Ga0157376_10099522 3300014969 Bacteria 2537
377 Ga0163161_10059368 3300017792 Bacteria 2781
378 Ga0163161_10504466 3300017792 Bacteria 986
379 Ga0197907_10509530 3300020069 Bacteria 1625
380 Ga0206356_11485400 3300020070 Bacteria 2316
381 Ga0206350_11625858 3300020080 Bacteria 1335
382 Ga0206354_10455357 3300020081 Bacteria 847
383 Ga0213874_10062481 3300021377 Bacteria 1170
384 Ga0213876_10005917 3300021384 Bacteria 6682
385 Ga0213876_10060874 3300021384 Bacteria 1992
386 Ga0224712_10027584 3300022467 Bacteria 2022
387 Ga0224712_10032772 3300022467 Bacteria 1896
388 Ga0224712_10221794 3300022467 Bacteria 866
389 Ga0209026_1022660 3300025250 Bacteria 961
390 Ga0209148_1038378 3300025254 Bacteria 674
391 Ga0209233_1001331 3300025261 Bacteria 9844
392 Ga0209233_1001687 3300025261 Bacteria 8574
393 Ga0207666_1006949 3300025271 Bacteria 1479
394 Ga0209455_1017269 3300025272 Bacteria 1520
395 Ga0209564_1009367 3300025295 Bacteria 4672
396 Ga0209758_1005955 3300025297 Bacteria 9036
397 Ga0209758_1013259 3300025297 Bacteria 4516
398 Ga0207426_1023685 3300025302 Bacteria 2093
399 Ga0207697_10077680 3300025315 Bacteria 1396
400 Ga0207656_10035153 3300025321 Bacteria 2096
401 Ga0207696_1017234 3300025711 Bacteria 2397
402 Ga0207653_10007878 3300025885 Bacteria 3320
403 Ga0207682_10211738 3300025893 Bacteria 894
404 Ga0207692_10001232 3300025898 Bacteria 9502
405 Ga0207692_10005010 3300025898 Bacteria 5274
406 Ga0207642_10065958 3300025899 Bacteria 1703
407 Ga0207710_10060951 3300025900 Bacteria 1711
408 Ga0207710_10094049 3300025900 Bacteria 1407
409 Ga0207710_10094798 3300025900 Bacteria 1401
410 Ga0207680_10226086 3300025903 Bacteria 1285
411 Ga0207680_10435633 3300025903 Bacteria 929
412 Ga0207647_10006459 3300025904 Bacteria 8521
413 Ga0207647_10063994 3300025904 Bacteria 2236
414 Ga0207647_10095016 3300025904 Bacteria 1775
415 Ga0207647_10142703 3300025904 Bacteria 1403
416 Ga0207647_10230334 3300025904 Bacteria 1066
417 Ga0207685_10019369 3300025905 Bacteria 2242
418 Ga0207685_10132066 3300025905 Bacteria 1109
419 Ga0207699_10000345 3300025906 Bacteria 24666
420 Ga0207699_10001416 3300025906 Bacteria 11381
421 Ga0207699_10021261 3300025906 Bacteria 3495
422 Ga0207699_10032501 3300025906 Bacteria 2940
423 Ga0207699_10120490 3300025906 Bacteria 1696
424 Ga0207645_10209066 3300025907 Bacteria 1285
425 Ga0207643_10083781 3300025908 Bacteria 1850
426 Ga0207643_10095779 3300025908 Bacteria 1735
427 Ga0207705_10329758 3300025909 Bacteria 1173
428 Ga0207705_10660806 3300025909 Bacteria 813
429 Ga0207684_10133125 3300025910 Bacteria 2134
430 Ga0207654_10000175 3300025911 Bacteria 39744
431 Ga0207654_10021375 3300025911 Bacteria 3441
432 Ga0207654_10145018 3300025911 Bacteria 1518
433 Ga0207707_10005686 3300025912 Bacteria 10912
434 Ga0207707_10073543 3300025912 Bacteria 2981
435 Ga0207707_10086395 3300025912 Bacteria 2741
436 Ga0207695_10009236 3300025913 Bacteria 12220
437 Ga0207695_10023567 3300025913 Bacteria 6949
438 Ga0207695_10063142 3300025913 Bacteria 3819
439 Ga0207695_10074538 3300025913 Bacteria 3456
440 Ga0207695_10149702 3300025913 Bacteria 2274
441 Ga0207695_10270242 3300025913 Bacteria 1596
442 Ga0207695_10356734 3300025913 Bacteria 1349
443 Ga0207695_10486906 3300025913 Bacteria 1115
444 Ga0207671_10022642 3300025914 Bacteria 4747
445 Ga0207671_10043437 3300025914 Bacteria 3324
446 Ga0207671_10049571 3300025914 Bacteria 3109
447 Ga0207671_10067059 3300025914 Bacteria 2672
448 Ga0207671_10082020 3300025914 Bacteria 2419
449 Ga0207671_10089189 3300025914 Bacteria 2321
450 Ga0207671_10159264 3300025914 Bacteria 1747
451 Ga0207693_10006294 3300025915 Bacteria 9849
452 Ga0207693_10006492 3300025915 Bacteria 9684
453 Ga0207693_10008437 3300025915 Bacteria 8430
454 Ga0207693_10097562 3300025915 Bacteria 2304
455 Ga0207693_10177731 3300025915 Bacteria 1675
456 Ga0207693_10177757 3300025915 Bacteria 1674
457 Ga0207693_10718047 3300025915 Bacteria 773
458 Ga0207663_10000630 3300025916 Bacteria 15626
459 Ga0207663_10017753 3300025916 Bacteria 3972
460 Ga0207663_10018155 3300025916 Bacteria 3936
461 Ga0207663_10019112 3300025916 Bacteria 3852
462 Ga0207663_10298196 3300025916 Bacteria 1203
463 Ga0207663_10351355 3300025916 Bacteria 1116
464 Ga0207660_10002576 3300025917 Bacteria 11911
465 Ga0207660_10084430 3300025917 Bacteria 2341
466 Ga0207662_10419964 3300025918 Bacteria 910
467 Ga0207657_10008426 3300025919 Bacteria 10464
468 Ga0207657_10737779 3300025919 Bacteria 763
469 Ga0207649_10059456 3300025920 Bacteria 2398
470 Ga0207649_10233364 3300025920 Bacteria 1317
471 Ga0207649_10275874 3300025920 Bacteria 1220
472 Ga0207652_10071947 3300025921 Bacteria 3006
473 Ga0207652_10077264 3300025921 Bacteria 2905
474 Ga0207652_10126417 3300025921 Bacteria 2278
475 Ga0207652_10224532 3300025921 Bacteria 1692
476 Ga0207646_10042560 3300025922 Bacteria 4080
477 Ga0207646_10102577 3300025922 Bacteria 2565
478 Ga0207646_10528257 3300025922 Bacteria 1062
479 Ga0207681_10064653 3300025923 Bacteria 2527
480 Ga0207681_10295812 3300025923 Bacteria 1279
481 Ga0207681_10296300 3300025923 Bacteria 1278
482 Ga0207694_10000226 3300025924 Bacteria 54504
483 Ga0207694_10031304 3300025924 Bacteria 4062
484 Ga0207694_10044974 3300025924 Bacteria 3409
485 Ga0207694_10107579 3300025924 Bacteria 2215
486 Ga0207694_10253843 3300025924 Bacteria 1439
487 Ga0207694_10277853 3300025924 Bacteria 1375
488 Ga0207694_10400785 3300025924 Bacteria 1141
489 Ga0207694_10637512 3300025924 Bacteria 897
490 Ga0207650_10323459 3300025925 Bacteria 1263
491 Ga0207687_10005566 3300025927 Bacteria 8320
492 Ga0207687_10049015 3300025927 Bacteria 2935
493 Ga0207687_10824948 3300025927 Bacteria 792
494 Ga0207700_10005791 3300025928 Bacteria 7426
495 Ga0207700_10042068 3300025928 Bacteria 3347
496 Ga0207700_10055022 3300025928 Bacteria 2990
497 Ga0207700_10154910 3300025928 Bacteria 1897
498 Ga0207700_10262504 3300025928 Bacteria 1479
499 Ga0207664_10012691 3300025929 Bacteria 6030
500 Ga0207664_10055425 3300025929 Bacteria 3145
501 Ga0207664_10090021 3300025929 Bacteria 2514
502 Ga0207664_10501039 3300025929 Bacteria 1087
503 Ga0207664_10535075 3300025929 Bacteria 1051
504 Ga0207690_10545348 3300025932 Bacteria 942
505 Ga0207690_10588144 3300025932 Bacteria 908
506 Ga0207706_10010842 3300025933 Bacteria 8314
507 Ga0207706_10027953 3300025933 Bacteria 5040
508 Ga0207706_10174782 3300025933 Bacteria 1887
509 Ga0207706_10386475 3300025933 Bacteria 1214
510 Ga0207686_10042534 3300025934 Bacteria 2778
511 Ga0207686_10293076 3300025934 Bacteria 1206
512 Ga0207709_10073436 3300025935 Bacteria 2180
513 Ga0207709_10151555 3300025935 Bacteria 1606
514 Ga0207709_10308397 3300025935 Bacteria 1180
515 Ga0207670_10542773 3300025936 Bacteria 949
516 Ga0207669_10204873 3300025937 Bacteria 1435
517 Ga0207704_10110919 3300025938 Bacteria 1854
518 Ga0207704_10200058 3300025938 Bacteria 1461
519 Ga0207704_10618273 3300025938 Bacteria 889
520 Ga0207665_10000235 3300025939 Bacteria 37854
521 Ga0207665_10043799 3300025939 Bacteria 2993
522 Ga0207665_10056372 3300025939 Bacteria 2652
523 Ga0207665_10068941 3300025939 Bacteria 2410
524 Ga0207665_10216238 3300025939 Bacteria 1402
525 Ga0207665_10314709 3300025939 Bacteria 1173
526 Ga0207665_10942185 3300025939 Bacteria 686
527 Ga0207691_10231386 3300025940 Bacteria 1600
528 Ga0207691_10836975 3300025940 Bacteria 772
529 Ga0207711_10151349 3300025941 Bacteria 2094
530 Ga0207711_10465628 3300025941 Bacteria 1177
531 Ga0207711_10713241 3300025941 Bacteria 935
532 Ga0207689_10088583 3300025942 Bacteria 2542
533 Ga0207689_10768290 3300025942 Bacteria 813
534 Ga0207661_10001179 3300025944 Bacteria 17473
535 Ga0207661_10861235 3300025944 Bacteria 834
536 Ga0207679_10210950 3300025945 Bacteria 1628
537 Ga0207679_10384975 3300025945 Bacteria 1230
538 Ga0207679_10765975 3300025945 Bacteria 878
539 Ga0207667_10010444 3300025949 Bacteria 10851
540 Ga0207667_10026837 3300025949 Bacteria 6284
541 Ga0207667_10036093 3300025949 Bacteria 5301
542 Ga0207667_10043047 3300025949 Bacteria 4793
543 Ga0207667_10204076 3300025949 Bacteria 2028
544 Ga0207667_10237612 3300025949 Bacteria 1865
545 Ga0207667_10351657 3300025949 Bacteria 1503
546 Ga0207651_10063503 3300025960 Bacteria 2579
547 Ga0207712_10021518 3300025961 Bacteria 4235
548 Ga0207712_10044951 3300025961 Bacteria 3056
549 Ga0207712_10171223 3300025961 Bacteria 1697
550 Ga0207712_10534659 3300025961 Bacteria 1006
551 Ga0207712_10742493 3300025961 Bacteria 859
552 Ga0207668_10028136 3300025972 Bacteria 3671
553 Ga0207668_10069726 3300025972 Bacteria 2504
554 Ga0207668_10130886 3300025972 Bacteria 1915
555 Ga0207668_10154986 3300025972 Bacteria 1778
556 Ga0207640_10103485 3300025981 Bacteria 2002
557 Ga0207640_10332145 3300025981 Bacteria 1214
558 Ga0207640_10412030 3300025981 Bacteria 1103
559 Ga0207640_10533811 3300025981 Bacteria 983
560 Ga0207658_10224895 3300025986 Bacteria 1581
561 Ga0207677_10018303 3300026023 Bacteria 4201
562 Ga0207677_10066110 3300026023 Bacteria 2526
563 Ga0207677_10268183 3300026023 Bacteria 1395
564 Ga0207677_10330932 3300026023 Bacteria 1269
565 Ga0207677_10358701 3300026023 Bacteria 1224
566 Ga0207677_10365751 3300026023 Bacteria 1213
567 Ga0207703_10052106 3300026035 Bacteria 3321
568 Ga0207703_10138552 3300026035 Bacteria 2109
569 Ga0207703_10148388 3300026035 Bacteria 2042
570 Ga0207703_10341235 3300026035 Bacteria 1377
571 Ga0207703_10505914 3300026035 Bacteria 1134
572 Ga0207639_10003564 3300026041 Bacteria 10458
573 Ga0207639_10027664 3300026041 Bacteria 4133
574 Ga0207639_10181804 3300026041 Bacteria 1789
575 Ga0207639_10298966 3300026041 Bacteria 1422
576 Ga0207639_10342291 3300026041 Bacteria 1333
577 Ga0207639_10491344 3300026041 Bacteria 1120
578 Ga0207639_10535287 3300026041 Bacteria 1074
579 Ga0207678_10001940 3300026067 Bacteria 18878
580 Ga0207678_10006070 3300026067 Bacteria 10746
581 Ga0207678_10012005 3300026067 Bacteria 7607
582 Ga0207678_10018042 3300026067 Bacteria 6201
583 Ga0207678_10021243 3300026067 Bacteria 5691
584 Ga0207678_10067680 3300026067 Bacteria 3065
585 Ga0207678_10147102 3300026067 Bacteria 2011
586 Ga0207678_10186384 3300026067 Bacteria 1772
587 Ga0207678_10198597 3300026067 Bacteria 1714
588 Ga0207678_10209662 3300026067 Bacteria 1667
589 Ga0207678_10265187 3300026067 Bacteria 1472
590 Ga0207678_10500536 3300026067 Bacteria 1059
591 Ga0207678_10787624 3300026067 Bacteria 839
592 Ga0207678_11077738 3300026067 Bacteria 711
593 Ga0207708_10077611 3300026075 Bacteria 2549
594 Ga0207702_10000004 3300026078 Bacteria 422182
595 Ga0207702_10005413 3300026078 Bacteria 11174
596 Ga0207702_10135424 3300026078 Bacteria 2222
597 Ga0207641_10042216 3300026088 Bacteria 3825
598 Ga0207641_10238933 3300026088 Bacteria 1692
599 Ga0207641_10581130 3300026088 Bacteria 1095
600 Ga0207648_10110568 3300026089 Bacteria 2412
601 Ga0207648_10302732 3300026089 Bacteria 1434
602 Ga0207648_10570318 3300026089 Bacteria 1041
603 Ga0207648_10656876 3300026089 Bacteria 969
604 Ga0207676_10210579 3300026095 Bacteria 1724
605 Ga0207676_10611995 3300026095 Bacteria 1047
606 Ga0207674_10042939 3300026116 Bacteria 4665
607 Ga0207674_10043994 3300026116 Bacteria 4602
608 Ga0207674_10153177 3300026116 Bacteria 2261
609 Ga0207674_10330138 3300026116 Bacteria 1475
610 Ga0207675_100048321 3300026118 Bacteria 3972
611 Ga0207675_100356086 3300026118 Bacteria 1435
612 Ga0207683_10019612 3300026121 Bacteria 5778
613 Ga0207683_10130160 3300026121 Bacteria 2263
614 Ga0207683_10918717 3300026121 Bacteria 813
615 Ga0207698_10110712 3300026142 Bacteria 2301
616 Ga0207698_10154328 3300026142 Bacteria 1998
617 Ga0207698_10154808 3300026142 Bacteria 1995
618 Ga0207698_10199312 3300026142 Bacteria 1791
619 Ga0207698_10273543 3300026142 Bacteria 1558
620 Ga0207698_11499305 3300026142 Bacteria 690
621 Ga0207428_10134050 3300027907 Bacteria 1894
622 Ga0268266_10006358 3300028379 Bacteria 10830
623 Ga0268266_10011435 3300028379 Bacteria 7718
624 Ga0268266_10016785 3300028379 Bacteria 6258
625 Ga0268266_10056859 3300028379 Bacteria 3365
626 Ga0268266_10365192 3300028379 Bacteria 1359
627 Ga0268266_10382738 3300028379 Bacteria 1327
628 Ga0268266_10454973 3300028379 Bacteria 1217
629 Ga0268266_10674560 3300028379 Bacteria 995
630 Ga0268265_10173023 3300028380 Bacteria 1847
631 Ga0268265_10586375 3300028380 Bacteria 1063
632 Ga0268264_10000157 3300028381 Bacteria 155163
633 Ga0268264_10073977 3300028381 Bacteria 2893
634 Ga0268264_10098422 3300028381 Bacteria 2537
635 Ga0268264_10156300 3300028381 Bacteria 2050
636 Ga0265319_1017504 3300028563 Bacteria 2723
637 Ga0265334_10048114 3300028573 Bacteria 1643
638 Ga0265323_10001788 3300028653 Bacteria 10202
639 Ga0265336_10000420 3300028666 Bacteria 26307
640 Ga0307517_10115849 3300028786 Bacteria 2009
641 Ga0265338_10001474 3300028800 Bacteria 38131
642 Ga0307511_10030423 3300030521 Bacteria 4851
643 Ga0265330_10004307 3300031235 Bacteria 7236
644 Ga0265330_10026213 3300031235 Bacteria 2638
645 Ga0265325_10008214 3300031241 Bacteria 6179
646 Ga0265340_10002797 3300031247 Bacteria 9929
647 Ga0265339_10012970 3300031249 Bacteria 5067
648 Ga0265339_10032327 3300031249 Bacteria 2952
649 Ga0265339_10040989 3300031249 Bacteria 2572
650 Ga0265331_10019262 3300031250 Bacteria 3526
651 Ga0265331_10065109 3300031250 Bacteria 1715
652 Ga0265331_10101792 3300031250 Bacteria 1321
653 Ga0265331_10170726 3300031250 Bacteria 984
654 Ga0307513_10109049 3300031456 Bacteria 2767
655 Ga0307513_10851660 3300031456 Bacteria 618
656 Ga0307509_10254585 3300031507 Bacteria 1536
657 Ga0307509_10480241 3300031507 Bacteria 931
658 Ga0307408_100058562 3300031548 Bacteria 2801
659 Ga0307408_100658463 3300031548 Bacteria 937
660 Ga0307508_10000002 3300031616 Bacteria 407635
661 Ga0307508_10072490 3300031616 Bacteria 3019
662 Ga0265314_10026224 3300031711 Bacteria 4381
663 Ga0265342_10020736 3300031712 Bacteria 4208
664 Ga0265342_10025879 3300031712 Bacteria 3683
665 Ga0307516_10083745 3300031730 Bacteria 3029
666 Ga0307516_10203445 3300031730 Bacteria 1698
667 Ga0307413_10659436 3300031824 Bacteria 864
668 Ga0307410_10544250 3300031852 Bacteria 961
669 Ga0326468_10035826 3300031889 Bacteria 684
670 Ga0307406_10478605 3300031901 Bacteria 1005
671 Ga0307406_10794098 3300031901 Bacteria 798
672 Ga0307407_10193402 3300031903 Bacteria 1358
673 Ga0307407_10629871 3300031903 Bacteria 801
674 Ga0307412_10417898 3300031911 Bacteria 1096
675 Ga0307409_100060330 3300031995 Bacteria 2957
676 Ga0307416_100216275 3300032002 Bacteria 1833
677 Ga0307416_100396580 3300032002 Bacteria 1416
678 Ga0307414_10451727 3300032004 Bacteria 1127
679 Ga0307411_10064291 3300032005 Bacteria 2456
680 Ga0307415_100126311 3300032126 Bacteria 1928
681 Ga0307415_100126456 3300032126 Bacteria 1927
682 Ga0307415_100138565 3300032126 Bacteria 1854
683 Ga0307415_100266761 3300032126 Bacteria 1400
684 Ga0307507_10075390 3300033179 Bacteria 3017
685 Ga0307510_10003322 3300033180 Bacteria 18742
686 Ga0307510_10137772 3300033180 Bacteria 2093
687 Ga0307510_10150276 3300033180 Bacteria 1950
688 Ga0315911_1000013 3300033442 Bacteria 239334
689 Ga0316215_1000607 3300033544 Bacteria 3814
690 Ga0373938_0048481 3300034957 Bacteria 964
691 Ga0373926_0015030 3300035083 Bacteria 2636
692 Ga0373926_0061857 3300035083 Bacteria 1366
693 Ga0373934_0025321 3300035086 Bacteria 2297
694 Ga0373934_0045393 3300035086 Bacteria 1737
695 Ga0373934_0076714 3300035086 Bacteria 1340
696 Ga0373944_0042552 3300035089 Bacteria 1409
697 Ga0373923_0004941 3300035111 Bacteria 4480
698 Ga0373923_0007011 3300035111 Bacteria 3935
699 Ga0373923_0022309 3300035111 Bacteria 2481
700 Ga0373923_0086521 3300035111 Bacteria 1366
701 Ga0373932_0060343 3300035112 Bacteria 1151
702 Ga0373932_0091145 3300035112 Bacteria 978
703 Ga0373936_0018178 3300035113 Bacteria 2713
704 Ga0373936_0027566 3300035113 Bacteria 2228
705 Ga0373941_0072388 3300035115 Bacteria 1147
706 Ga0373945_0055772 3300035116 Bacteria 1464
707 Ga0373945_0079242 3300035116 Bacteria 1256
708 Ga0373953_0000285 3300035117 Bacteria 13925
709 Ga0373953_0007996 3300035117 Bacteria 3571
710 Ga0373953_0017961 3300035117 Bacteria 2609
711 Ga0373953_0262520 3300035117 Bacteria 751
712 Ga0373954_0001351 3300035118 Bacteria 9881
713 Ga0373954_0071546 3300035118 Bacteria 1648
714 Ga0373954_0159753 3300035118 Bacteria 1102
715 Ga0373956_0010175 3300035119 Bacteria 3844
716 Ga0373956_0034088 3300035119 Bacteria 2241
717 Ga0373943_0004586 3300035170 Bacteria 6242
718 Ga0373943_0030353 3300035170 Bacteria 2557
719 Ga0373946_0003778 3300035171 Bacteria 5371
720 Ga0373946_0007562 3300035171 Bacteria 3976
721 Ga0373946_0020932 3300035171 Bacteria 2532
722 Ga0373946_0038771 3300035171 Bacteria 1942
723 Ga0373955_0000636 3300035172 Bacteria 15000
724 Ga0373955_0033718 3300035172 Bacteria 2698
725 Ga0373955_0040531 3300035172 Bacteria 2491
726 Ga0373955_0044277 3300035172 Bacteria 2396
727 Ga0373955_0248815 3300035172 Bacteria 1065
728 Ga0373955_0325075 3300035172 Bacteria 930
729 Ga0373942_0021003 3300035207 Bacteria 1644
730 Ga0373961_0065596 3300035241 Bacteria 1112
731 Ga0373961_0218800 3300035241 Bacteria 678
732 Ga0373962_0010144 3300035242 Bacteria 2343
733 Ga0373962_0063278 3300035242 Bacteria 1091
734 Ga0373924_0007304 3300035410 Bacteria 3985
735 Ga0373924_0009123 3300035410 Bacteria 3629
736 Ga0373924_0011229 3300035410 Bacteria 3321
737 Ga0373931_0025140 3300035691 Bacteria 3024
738 Ga0373935_0024695 3300035692 Bacteria 3701
739 Ga0373935_0161943 3300035692 Bacteria 1525
740 Ga0373935_0182935 3300035692 Bacteria 1440
741 Ga0373935_0255286 3300035692 Bacteria 1228
742 Ga0373935_0633926 3300035692 Bacteria 783
743 Ga0373927_0003270 3300035695 Bacteria 11653
744 Ga0373927_0010933 3300035695 Bacteria 6041
745 Ga0373927_0017399 3300035695 Bacteria 4730
746 Ga0373927_0023206 3300035695 Bacteria 4064
747 Ga0373927_0036122 3300035695 Bacteria 3214
748 Ga0373927_0089978 3300035695 Bacteria 1993
749 Ga0373927_0091690 3300035695 Bacteria 1974
750 Ga0373927_0105643 3300035695 Bacteria 1833
751 Ga0373927_0163931 3300035695 Bacteria 1456
752 Ga0373933_0000118 3300035724 Bacteria 51316
753 Ga0373933_0001611 3300035724 Bacteria 13201
754 Ga0373933_0139004 3300035724 Bacteria 1532
755 Ga0373933_0140542 3300035724 Bacteria 1524
756 Ga0373947_0000402 3300035725 Bacteria 24400
757 Ga0373947_0056172 3300035725 Bacteria 2379
758 Ga0373947_0056369 3300035725 Bacteria 2375
759 Ga0373947_0075893 3300035725 Bacteria 2070
760 Ga0373947_0187311 3300035725 Bacteria 1349
761 Ga0373947_0214690 3300035725 Bacteria 1263
762 Ga0373947_0272036 3300035725 Bacteria 1125
763 Ga0373937_0011438 3300036401 Bacteria 7787
764 Ga0373937_0030077 3300036401 Bacteria 4919
765 Ga0373937_0032584 3300036401 Bacteria 4728
766 Ga0373937_0096145 3300036401 Bacteria 2747
767 Ga0373937_0141108 3300036401 Bacteria 2254
768 Ga0373937_0351257 3300036401 Bacteria 1397
769 Ga0373925_0005137 3300037068 Bacteria 9807
770 Ga0373925_0043981 3300037068 Bacteria 3315
771 Ga0373925_0089135 3300037068 Bacteria 2356
772 Ga0373925_0121449 3300037068 Bacteria 2028
773 Ga0373925_0196788 3300037068 Bacteria 1601
774 Ga0373925_0538312 3300037068 Bacteria 960
775 Ga0395900_0037265 3300037418 Bacteria 5015
776 Ga0395900_0465600 3300037418 Bacteria 1218
777 Ga0395900_0756953 3300037418 Bacteria 901
778 Ga0395898_0024063 3300037466 Bacteria 6147
779 Ga0395898_0043238 3300037466 Bacteria 4440
780 Ga0395898_0053299 3300037466 Bacteria 3951
781 Ga0395898_0114600 3300037466 Bacteria 2583
782 Ga0395905_0012091 3300037471 Bacteria 8316
783 Ga0395905_0149916 3300037471 Bacteria 2194
784 Ga0395905_0247944 3300037471 Bacteria 1664
785 Ga0436364_0209479 3300037853 Bacteria 2309
786 Ga0436364_0393542 3300037853 Bacteria 1290
787 Ga0436364_0584170 3300037853 Bacteria 1804
788 Ga0436364_1349110 3300037853 Bacteria 1166
789 Ga0395901_0084617 3300038443 Bacteria 3315
790 Ga0395901_0129331 3300038443 Bacteria 2654
791 Ga0395901_0170499 3300038443 Bacteria 2284
792 Ga0436365_0029847 3300039437 Bacteria 1974
793 Ga0436365_0049558 3300039437 Bacteria 3346
794 Ga0436365_0229769 3300039437 Bacteria 1931
795 Ga0436365_1609765 3300039437 Bacteria 22154
796 Ga0436360_0450373 3300039438 Bacteria 1667
797 Ga0436360_0760184 3300039438 Bacteria 1089
798 Ga0436363_0152156 3300039450 Bacteria 700
799 Ga0436363_0766255 3300039450 Bacteria 1953
800 Ga0436363_0889462 3300039450 Bacteria 1332
801 Ga0436363_1542117 3300039450 Bacteria 5141
802 Ga0439465_0016189 3300041413 Bacteria 2326
803 Ga0439465_0031998 3300041413 Bacteria 1677
804 Ga0451797_0206793 3300041453 Bacteria 648
805 Ga0451800_0066149 3300041459 Bacteria 1078
806 Ga0451806_863455 3300041462 Bacteria 950
807 Ga0451807_0416485 3300041486 Bacteria 1497
808 Ga0451847_0193603 3300041503 Bacteria 898
809 Ga0451843_1567046 3300041509 Bacteria 777
810 Ga0439431_0010867 3300041997 Bacteria 2074
811 Ga0439458_0004914 3300042157 Bacteria 3035
812 Ga0466969_0151527 3300044656 Bacteria 1068
813 Ga0466969_0243047 3300044656 Bacteria 817
814 Ga0466961_0338894 3300044693 Bacteria 916
815 Ga0466964_0060085 3300044706 Bacteria 1580
816 Ga0466971_0190593 3300044719 Bacteria 966
817 Ga0466970_0088075 3300044765 Bacteria 1684
818 Ga0466970_0104496 3300044765 Bacteria 1544
819 Ga0466957_0020746 3300044842 Bacteria 3867
820 Ga0466957_0404481 3300044842 Bacteria 934
821 Ga0466959_0070021 3300045049 Bacteria 2541
822 Ga0466959_0073082 3300045049 Bacteria 2481
823 Ga0466959_0082582 3300045049 Bacteria 2315
824 Ga0466967_0074353 3300045976 Bacteria 3052
825 Ga0466967_0079574 3300045976 Bacteria 2955
826 Ga0466967_0194934 3300045976 Bacteria 1916
827 Ga0495617_017561 3300046452 Bacteria 2418
828 Ga0495617_066632 3300046452 Bacteria 1186
829 Ga0495592_0001817 3300046454 Bacteria 14995
830 Ga0495592_0036483 3300046454 Bacteria 3702
831 Ga0495592_0046637 3300046454 Bacteria 3230
832 Ga0495592_0084299 3300046454 Bacteria 2293
833 Ga0495603_0000826 3300046455 Bacteria 17795
834 Ga0495603_0007445 3300046455 Bacteria 6584
835 Ga0495603_0018817 3300046455 Bacteria 4181
836 Ga0495603_0337348 3300046455 Bacteria 865
837 Ga0495590_0036775 3300046457 Bacteria 1707
838 Ga0495590_0109499 3300046457 Bacteria 985
839 Ga0495629_0000337 3300046459 Bacteria 40017
840 Ga0495629_0000587 3300046459 Bacteria 29538
841 Ga0495629_0041783 3300046459 Bacteria 3224
842 Ga0495629_0111406 3300046459 Bacteria 1908
843 Ga0495629_0118206 3300046459 Bacteria 1847
844 Ga0495638_0120859 3300046460 Bacteria 1548
845 Ga0495638_0163843 3300046460 Bacteria 1280
846 Ga0495638_0230159 3300046460 Bacteria 1031
847 Ga0495638_0409562 3300046460 Bacteria 701
848 Ga0495641_0040198 3300046461 Bacteria 2176
849 Ga0495651_0006522 3300046462 Bacteria 8912
850 Ga0495651_0041339 3300046462 Bacteria 3581
851 Ga0495651_0047122 3300046462 Bacteria 3335
852 Ga0495651_0088850 3300046462 Bacteria 2321
853 Ga0495651_0203289 3300046462 Bacteria 1385
854 Ga0495651_0345161 3300046462 Bacteria 985
855 Ga0495653_0001248 3300046463 Bacteria 19668
856 Ga0495653_0043811 3300046463 Bacteria 3476
857 Ga0495653_0223262 3300046463 Bacteria 1265
858 Ga0495650_0038999 3300046471 Bacteria 2053
859 Ga0495650_0046877 3300046471 Bacteria 1811
860 Ga0495580_0002634 3300046472 Bacteria 15585
861 Ga0495580_0012056 3300046472 Bacteria 6654
862 Ga0495580_0514119 3300046472 Bacteria 798
863 Ga0495580_0631164 3300046472 Bacteria 706
864 Ga0495582_0000018 3300046473 Bacteria 93753
865 Ga0495605_0056857 3300046474 Bacteria 1886
866 Ga0495605_0076706 3300046474 Bacteria 1569
867 Ga0495639_0000272 3300046475 Bacteria 25666
868 Ga0495662_0000023 3300046476 Bacteria 54061
869 Ga0495664_0014728 3300046477 Bacteria 4437
870 Ga0495664_0020681 3300046477 Bacteria 3797
871 Ga0495664_0205258 3300046477 Bacteria 1194
872 Ga0495664_0236849 3300046477 Bacteria 1104
873 Ga0495584_0171909 3300046491 Bacteria 1101
874 Ga0495585_0112504 3300046492 Bacteria 1446
875 Ga0495585_0176527 3300046492 Bacteria 1100
876 Ga0495585_0235565 3300046492 Bacteria 918
877 Ga0495585_0293089 3300046492 Bacteria 801
878 Ga0495594_0000155 3300046499 Bacteria 32688
879 Ga0495594_0141619 3300046499 Bacteria 1364
880 Ga0495596_0012911 3300046500 Bacteria 3560
881 Ga0495596_0031573 3300046500 Bacteria 2115
882 Ga0495596_0101019 3300046500 Bacteria 1120
883 Ga0495607_0059800 3300046501 Bacteria 2171
884 Ga0495607_0092479 3300046501 Bacteria 1636
885 Ga0495583_0055178 3300046506 Bacteria 1796
886 Ga0495606_0005275 3300046507 Bacteria 12455
887 Ga0495606_0043701 3300046507 Bacteria 2985
888 Ga0495606_0087085 3300046507 Bacteria 1929
889 Ga0495608_0007746 3300046511 Bacteria 7562
890 Ga0495608_0153164 3300046511 Bacteria 1468
891 Ga0495608_0258598 3300046511 Bacteria 1084
892 Ga0495610_0080804 3300046512 Bacteria 1494
893 Ga0495616_0037073 3300046513 Bacteria 2511
894 Ga0495616_0144093 3300046513 Bacteria 1082
895 Ga0495616_0237347 3300046513 Bacteria 788
896 Ga0495618_0071100 3300046514 Bacteria 2213
897 Ga0495618_0094263 3300046514 Bacteria 1914
898 Ga0495618_0116963 3300046514 Bacteria 1707
899 Ga0495618_0222517 3300046514 Bacteria 1190
900 Ga0495620_0007418 3300046515 Bacteria 5955
901 Ga0495620_0139601 3300046515 Bacteria 948
902 Ga0495628_0022393 3300046516 Bacteria 5190
903 Ga0495628_0024841 3300046516 Bacteria 4901
904 Ga0495628_0026877 3300046516 Bacteria 4685
905 Ga0495630_0031482 3300046517 Bacteria 3950
906 Ga0495630_0058135 3300046517 Bacteria 2899
907 Ga0495630_0142692 3300046517 Bacteria 1821
908 Ga0495631_0046685 3300046518 Bacteria 1903
909 Ga0495631_0134945 3300046518 Bacteria 1060
910 Ga0495632_0033914 3300046519 Bacteria 2617
911 Ga0495632_0102235 3300046519 Bacteria 1350
912 Ga0495632_0142848 3300046519 Bacteria 1109
913 Ga0495632_0228634 3300046519 Bacteria 839
914 Ga0495637_0021828 3300046520 Bacteria 2929
915 Ga0495643_0302516 3300046522 Bacteria 728
916 Ga0495644_0021784 3300046523 Bacteria 2443
917 Ga0495644_0085613 3300046523 Bacteria 1188
918 Ga0495648_0025624 3300046524 Bacteria 3988
919 Ga0495648_0027801 3300046524 Bacteria 3779
920 Ga0495648_0031929 3300046524 Bacteria 3464
921 Ga0495648_0167663 3300046524 Bacteria 1129
922 Ga0495663_0029627 3300046525 Bacteria 1618
923 Ga0495642_0081369 3300046528 Bacteria 1364
924 Ga0495652_0010774 3300046529 Bacteria 8286
925 Ga0495652_0085591 3300046529 Bacteria 2590
926 Ga0495652_0108398 3300046529 Bacteria 2238
927 Ga0495652_0143100 3300046529 Bacteria 1878
928 Ga0495654_0011184 3300046530 Bacteria 4870
929 Ga0495654_0099145 3300046530 Bacteria 1343
930 Ga0495665_0006339 3300046531 Bacteria 6383
931 Ga0495665_0034243 3300046531 Bacteria 2716
932 Ga0495665_0169006 3300046531 Bacteria 1139
933 Ga0495640_0007630 3300046533 Bacteria 8504
934 Ga0495640_0012003 3300046533 Bacteria 6639
935 Ga0495640_0040271 3300046533 Bacteria 3273
936 Ga0495640_0040675 3300046533 Bacteria 3254
937 Ga0495640_0083233 3300046533 Bacteria 2123
938 Ga0495586_0296150 3300046535 Bacteria 927
939 Ga0495587_0006289 3300046536 Bacteria 7749
940 Ga0495587_0014194 3300046536 Bacteria 5001
941 Ga0495587_0241048 3300046536 Bacteria 1017
942 Ga0495598_0081760 3300046537 Bacteria 1038
943 Ga0495609_0043451 3300046538 Bacteria 2018
944 Ga0495621_0295376 3300046539 Bacteria 670
945 Ga0495597_0030293 3300046542 Bacteria 2466
946 Ga0495597_0043566 3300046542 Bacteria 1998
947 Ga0495645_0013917 3300046543 Bacteria 5702
948 Ga0495645_0019992 3300046543 Bacteria 4827
949 Ga0495645_0293170 3300046543 Bacteria 1065
950 Ga0495622_0001524 3300046557 Bacteria 11574
951 Ga0495622_0004148 3300046557 Bacteria 6756
952 Ga0495622_0015487 3300046557 Bacteria 3544
953 Ga0495622_0026065 3300046557 Bacteria 2731
954 Ga0495633_0027177 3300046558 Bacteria 2799
955 Ga0495633_0109096 3300046558 Bacteria 1283
956 Ga0495633_0175355 3300046558 Bacteria 987
957 Ga0495667_0000270 3300046559 Bacteria 33708
958 Ga0495667_0009948 3300046559 Bacteria 6441
959 Ga0495667_0032576 3300046559 Bacteria 3492
960 Ga0495667_0089365 3300046559 Bacteria 1997
961 Ga0495667_0246339 3300046559 Bacteria 1138
962 Ga0495656_0006193 3300046615 Bacteria 4186
963 Ga0495656_0089773 3300046615 Bacteria 1403
964 Ga0495656_0200390 3300046615 Bacteria 990
965 Ga0495656_0251103 3300046615 Bacteria 893
966 Ga0495668_0145460 3300046616 Bacteria 1297
967 Ga0495634_0001584 3300046642 Bacteria 19986
968 Ga0495634_0003421 3300046642 Bacteria 12744
969 Ga0495634_0100430 3300046642 Bacteria 1870
970 Ga0495634_0114548 3300046642 Bacteria 1731
971 Ga0495611_0155322 3300046648 Bacteria 1068
972 Ga0495611_0346005 3300046648 Bacteria 682
973 Ga0495625_0237869 3300046660 Bacteria 1187
974 Ga0495625_0249887 3300046660 Bacteria 1151
975 Ga0495625_0317425 3300046660 Bacteria 993
976 Ga0495625_0365479 3300046660 Bacteria 908
977 Ga0495635_0001043 3300046663 Bacteria 18376
978 Ga0495635_0001867 3300046663 Bacteria 14261
979 Ga0495635_0014465 3300046663 Bacteria 5520
980 Ga0495635_0145510 3300046663 Bacteria 1613
981 Ga0495659_0057557 3300046664 Bacteria 1428
982 Ga0495659_0176964 3300046664 Bacteria 867
983 Ga0495661_0181717 3300046665 Bacteria 1114
984 Ga0495588_0002125 3300046674 Bacteria 8499
985 Ga0495588_0008457 3300046674 Bacteria 4725
986 Ga0495588_0026572 3300046674 Bacteria 2891
987 Ga0495588_0127581 3300046674 Bacteria 1342
988 Ga0495657_0004611 3300046675 Bacteria 11006
989 Ga0495657_0011878 3300046675 Bacteria 6490
990 Ga0495657_0039530 3300046675 Bacteria 3240
991 Ga0495657_0150137 3300046675 Bacteria 1447
992 Ga0495599_0001005 3300046678 Bacteria 15850
993 Ga0495599_0008343 3300046678 Bacteria 6300
994 Ga0495599_0022444 3300046678 Bacteria 3940
995 Ga0495599_0067491 3300046678 Bacteria 2234
996 Ga0495599_0451552 3300046678 Bacteria 761
997 Ga0495623_0006560 3300046679 Bacteria 7577
998 Ga0495623_0046270 3300046679 Bacteria 2762
999 Ga0495623_0222681 3300046679 Bacteria 1074
1000 Ga0495623_0285788 3300046679 Bacteria 916
1001 Ga0495623_0303826 3300046679 Bacteria 881
1002 Ga0495646_0003477 3300046680 Bacteria 9804
1003 Ga0495646_0035772 3300046680 Bacteria 3079
1004 Ga0495646_0042753 3300046680 Bacteria 2779
1005 Ga0495646_0076876 3300046680 Bacteria 1954
1006 Ga0495646_0120665 3300046680 Bacteria 1484
1007 Ga0495647_0001870 3300046681 Bacteria 6539
1008 Ga0495647_0004481 3300046681 Bacteria 4541
1009 Ga0495658_0002067 3300046683 Bacteria 10172
1010 Ga0495658_0093310 3300046683 Bacteria 1786
1011 Ga0495658_0148356 3300046683 Bacteria 1439
1012 Ga0495658_0293974 3300046683 Bacteria 1027
1013 Ga0495669_0092929 3300046684 Bacteria 1395
1014 Ga0495669_0180049 3300046684 Bacteria 1007
1015 Ga0495669_0287533 3300046684 Bacteria 791
1016 Ga0495613_0036823 3300046689 Bacteria 3628
1017 Ga0495613_0049088 3300046689 Bacteria 3115
1018 Ga0495613_0228307 3300046689 Bacteria 1305
1019 Ga0495624_0001316 3300046690 Bacteria 19466
1020 Ga0495624_0163877 3300046690 Bacteria 1357
1021 Ga0495624_0257732 3300046690 Bacteria 1054
1022 Ga0495624_0437610 3300046690 Bacteria 784
1023 Ga0495670_0081732 3300046691 Bacteria 1646
1024 Ga0495670_0085016 3300046691 Bacteria 1614
1025 Ga0495670_0182182 3300046691 Bacteria 1109
1026 Ga0495671_0025305 3300046692 Bacteria 3086
1027 Ga0495671_0337478 3300046692 Bacteria 723
1028 Ga0495649_0179144 3300046694 Bacteria 1106
1029 Ga0495589_0258350 3300046794 Bacteria 813
1030 Ga0495600_0000400 3300046809 Bacteria 22448
1031 Ga0495600_0006537 3300046809 Bacteria 7093
1032 Ga0495600_0451479 3300046809 Bacteria 795
1033 Ga0495660_0021236 3300046810 Bacteria 3718
1034 Ga0495581_0002742 3300047315 Bacteria 10045
1035 Ga0495581_0035143 3300047315 Bacteria 2900
1036 Ga0495581_0057962 3300047315 Bacteria 2235
1037 Ga0495581_0097094 3300047315 Bacteria 1711
1038 Ga0495581_0105543 3300047315 Bacteria 1637
1039 Ga0495581_0152314 3300047315 Bacteria 1351
1040 Ga0495581_0244467 3300047315 Bacteria 1049
1041 Ga0495604_0001495 3300047317 Bacteria 19268
1042 Ga0495604_0015960 3300047317 Bacteria 5996
1043 Ga0495604_0076221 3300047317 Bacteria 2523
1044 Ga0495604_0218672 3300047317 Bacteria 1313
1045 Ga0495636_0117453 3300047318 Bacteria 1174
1046 Ga0495636_0235264 3300047318 Bacteria 844
1047 Ga0495674_0003018 3300047319 Bacteria 16393
1048 Ga0495674_0017831 3300047319 Bacteria 6609
1049 Ga0495674_0080034 3300047319 Bacteria 2804
1050 Ga0495674_0133524 3300047319 Bacteria 2090
1051 Ga0495674_0203816 3300047319 Bacteria 1640
1052 Ga0495674_0748515 3300047319 Bacteria 764
1053 Ga0495672_0161240 3300047320 Bacteria 1153
1054 Ga0495672_0168472 3300047320 Bacteria 1119
1055 Ga0495676_0039072 3300047321 Bacteria 3935
1056 Ga0495676_0066367 3300047321 Bacteria 2797
1057 Ga0495676_0316600 3300047321 Bacteria 1049
1058 Ga0495680_0002432 3300047322 Bacteria 19057
1059 Ga0495680_0030852 3300047322 Bacteria 4369
1060 Ga0495680_0037304 3300047322 Bacteria 3893
1061 Ga0495680_0505477 3300047322 Bacteria 820
1062 Ga0495683_0094536 3300047323 Bacteria 1444
1063 Ga0495683_0204472 3300047323 Bacteria 888
1064 Ga0495687_113427 3300047443 Bacteria 992
1065 Ga0495675_0013695 3300047444 Bacteria 5125
1066 Ga0495675_0074297 3300047444 Bacteria 2142
1067 Ga0495675_0180255 3300047444 Bacteria 1293
1068 Ga0495677_0010566 3300047445 Bacteria 3388
1069 Ga0495685_124879 3300047447 Bacteria 844
1070 Ga0495673_0018685 3300047469 Bacteria 3490
1071 Ga0495673_0103518 3300047469 Bacteria 1147
1072 Ga0495681_0132641 3300047470 Bacteria 1059
1073 Ga0495684_0000766 3300047471 Bacteria 25966
1074 Ga0495684_0058049 3300047471 Bacteria 2948
1075 Ga0495684_0315700 3300047471 Bacteria 1118
1076 Ga0495686_0073863 3300047472 Bacteria 2093
1077 Ga0495686_0186604 3300047472 Bacteria 1198
1078 Ga0495593_0000419 3300047673 Bacteria 23659
1079 Ga0495593_0006119 3300047673 Bacteria 7080
1080 Ga0495593_0075061 3300047673 Bacteria 1753
1081 Ga0495602_0041551 3300048088 Bacteria 4199
1082 Ga0495602_0053610 3300048088 Bacteria 3569
1083 Ga0495602_0066580 3300048088 Bacteria 3102
1084 Ga0495626_0023882 3300048091 Bacteria 3004
1085 Ga0496100_0095050 3300048903 Bacteria 2042
1086 Ga0496100_0098443 3300048903 Bacteria 2010
1087 Ga0496101_0002473 3300048904 Bacteria 11351
1088 Ga0496101_0074665 3300048904 Bacteria 2494
1089 Ga0496101_0114415 3300048904 Bacteria 2034
1090 Ga0496101_0135671 3300048904 Bacteria 1872
1091 Ga0496101_0228653 3300048904 Bacteria 1445
1092 Ga0496101_0390429 3300048904 Bacteria 1095
1093 Ga0496102_0002704 3300048905 Bacteria 15082
1094 Ga0496102_0023114 3300048905 Bacteria 5517
1095 Ga0496102_0061798 3300048905 Bacteria 3429
1096 Ga0496102_0136236 3300048905 Bacteria 2301
1097 Ga0496102_0178336 3300048905 Bacteria 2001
1098 Ga0496102_0214900 3300048905 Bacteria 1812
1099 Ga0496102_0407694 3300048905 Bacteria 1277
1100 Ga0496102_0642440 3300048905 Bacteria 984
1101 Ga0496103_0029149 3300048906 Bacteria 3353
1102 Ga0496103_0261204 3300048906 Bacteria 1114
1103 Ga0496103_0322189 3300048906 Bacteria 994
1104 Ga0496104_0064008 3300048907 Bacteria 3489
1105 Ga0496104_0304310 3300048907 Bacteria 1506
1106 Ga0496104_0348134 3300048907 Bacteria 1394
1107 Ga0496105_0003117 3300048908 Bacteria 12200
1108 Ga0496105_0005494 3300048908 Bacteria 9618
1109 Ga0496106_0000246 3300048909 Bacteria 37806
1110 Ga0496106_0007049 3300048909 Bacteria 8300
1111 Ga0496106_0086129 3300048909 Bacteria 2419
1112 Ga0496106_0263196 3300048909 Bacteria 1380
1113 Ga0496106_0492590 3300048909 Bacteria 985
1114 Ga0496107_0011607 3300048910 Bacteria 6141
1115 Ga0496107_0013421 3300048910 Bacteria 5726
1116 Ga0496107_0249969 3300048910 Bacteria 1319
1117 Ga0496108_0066705 3300048911 Bacteria 3035
1118 Ga0496108_0080000 3300048911 Bacteria 2767
1119 Ga0496108_0112602 3300048911 Bacteria 2328
1120 Ga0496108_0319669 3300048911 Bacteria 1353
1121 Ga0496108_0459755 3300048911 Bacteria 1112
1122 Ga0496109_0013738 3300048912 Bacteria 7035
1123 Ga0496109_0035286 3300048912 Bacteria 4510
1124 Ga0496109_0056868 3300048912 Bacteria 3569
1125 Ga0496109_0166750 3300048912 Bacteria 2065
1126 Ga0496109_0223495 3300048912 Bacteria 1771
1127 Ga0496109_0248378 3300048912 Bacteria 1675
1128 Ga0496110_0015748 3300048913 Bacteria 6301
1129 Ga0496110_0041605 3300048913 Bacteria 4010
1130 Ga0496110_0195641 3300048913 Bacteria 1836
1131 Ga0496110_0620550 3300048913 Bacteria 980
1132 Ga0496111_0012718 3300048914 Bacteria 5706
1133 Ga0496111_0022680 3300048914 Bacteria 4397
1134 Ga0496111_0401221 3300048914 Bacteria 1013
1135 Ga0496111_0415474 3300048914 Bacteria 994
1136 Ga0496111_0460995 3300048914 Bacteria 937
1137 Ga0496112_0000020 3300048915 Bacteria 169373
1138 Ga0496112_0055635 3300048915 Bacteria 3891
1139 Ga0496112_0082929 3300048915 Bacteria 3170
1140 Ga0496112_0230112 3300048915 Bacteria 1808
1141 Ga0496112_0251085 3300048915 Bacteria 1720
1142 Ga0496112_0345605 3300048915 Bacteria 1430
1143 Ga0496112_0440814 3300048915 Bacteria 1240
1144 Ga0496113_0005880 3300048916 Bacteria 7699
1145 Ga0496113_0034908 3300048916 Bacteria 3673
1146 Ga0496113_0330271 3300048916 Bacteria 1223
1147 Ga0496114_0070083 3300048917 Bacteria 2944
1148 Ga0496114_0088393 3300048917 Bacteria 2628
1149 Ga0496114_0111528 3300048917 Bacteria 2344
1150 Ga0496115_0001912 3300048918 Bacteria 14866
1151 Ga0496115_0011792 3300048918 Bacteria 6563
1152 Ga0496115_0085598 3300048918 Bacteria 2571
1153 Ga0496115_0107081 3300048918 Bacteria 2295
1154 Ga0496115_0210366 3300048918 Bacteria 1607
1155 Ga0496115_0465313 3300048918 Bacteria 1020
1156 Ga0496116_0003347 3300048919 Bacteria 15910
1157 Ga0496117_0090473 3300048920 Bacteria 1971
1158 Ga0496118_0017920 3300048921 Bacteria 6422
1159 Ga0496118_0050976 3300048921 Bacteria 3170
1160 Ga0496119_0038956 3300048922 Bacteria 3061
1161 Ga0496119_0146239 3300048922 Bacteria 1271
1162 Ga0496120_0051627 3300048923 Bacteria 2347
1163 Ga0496120_0081150 3300048923 Bacteria 1756
1164 Ga0496121_0000270 3300048924 Bacteria 108787
1165 Ga0496121_0000423 3300048924 Bacteria 83271
1166 Ga0496121_0047049 3300048924 Bacteria 3684
1167 Ga0496121_0053237 3300048924 Bacteria 3392
1168 Ga0496121_0067452 3300048924 Bacteria 2900
1169 Ga0496121_0116392 3300048924 Bacteria 2027
1170 Ga0496121_0175568 3300048924 Bacteria 1551
1171 Ga0496121_0205107 3300048924 Bacteria 1401
1172 Ga0496121_0214211 3300048924 Bacteria 1362
1173 Ga0496121_0217999 3300048924 Bacteria 1346
1174 Ga0496121_0432990 3300048924 Bacteria 852
1175 Ga0496122_0039972 3300048925 Bacteria 3735
1176 Ga0496122_0184717 3300048925 Bacteria 1238
1177 Ga0496123_0219349 3300048926 Bacteria 960
1178 Ga0496124_0000235 3300048927 Bacteria 107983
1179 Ga0496124_0077272 3300048927 Bacteria 2746
1180 Ga0496124_0343705 3300048927 Bacteria 1058
1181 Ga0496124_0407012 3300048927 Bacteria 942
1182 Ga0496125_0003766 3300048928 Bacteria 18045
1183 Ga0496125_0052271 3300048928 Bacteria 3360
1184 Ga0496125_0088205 3300048928 Bacteria 2339
1185 Ga0496125_0231529 3300048928 Bacteria 1181
1186 Ga0496126_0003857 3300048929 Bacteria 18525
1187 Ga0496126_0016873 3300048929 Bacteria 7289
1188 Ga0496126_0019515 3300048929 Bacteria 6674
1189 Ga0496126_0027355 3300048929 Bacteria 5448
1190 Ga0496126_0044316 3300048929 Bacteria 4097
1191 Ga0496126_0065690 3300048929 Bacteria 3246
1192 Ga0496126_0141839 3300048929 Bacteria 2067
1193 Ga0496126_0169818 3300048929 Bacteria 1859
1194 Ga0496126_0322827 3300048929 Bacteria 1268
1195 Ga0496126_0401718 3300048929 Bacteria 1111
1196 Ga0496126_0601363 3300048929 Bacteria 866
1197 Ga0496126_0655751 3300048929 Bacteria 820
1198 Ga0496126_0658476 3300048929 Bacteria 818
1199 Ga0496126_0831969 3300048929 Bacteria 706
1200 Ga0501036_0272301 3300049572 Bacteria 1417
1201 Ga0501037_0635601 3300049573 Bacteria 714
1202 Ga0501038_0684945 3300049574 Bacteria 769
1203 Ga0501042_0185244 3300049578 Bacteria 1502
1204 Ga0501046_0035061 3300049580 Bacteria 4045
1205 Ga0501047_0060047 3300049581 Bacteria 3671
1206 Ga0501067_0186178 3300049583 Bacteria 1156
1207 Ga0501069_0070442 3300049585 Bacteria 1959
1208 Ga0501070_0030863 3300049586 Bacteria 4489
1209 Ga0501071_0306364 3300049587 Bacteria 1205
1210 Ga0501079_0352151 3300049741 Bacteria 1154
1211 Ga0501080_0067890 3300049742 Bacteria 3316
1212 Ga0501035_0103083 3300049822 Bacteria 2503
1213 Ga0501035_0215165 3300049822 Bacteria 1643
1214 Ga0501044_0081215 3300049823 Bacteria 3282
1215 nmdc:mga03683_126265_c1 3300050489 Bacteria 1141
1216 nmdc:mga03683_12822_c1 3300050489 Bacteria 3070
1217 nmdc:mga03683_129023_c1 3300050489 Bacteria 1130
1218 nmdc:mga03683_305416_c1 3300050489 Bacteria 747
1219 nmdc:mga03n38_164641_c1 3300050490 Bacteria 1125
1220 nmdc:mga03n38_16625_c1 3300050490 Bacteria 2866
1221 nmdc:mga03n38_206422_c1 3300050490 Bacteria 1019
1222 nmdc:mga03n38_54485_c2 3300050490 Bacteria 1247
1223 nmdc:mga00v17_106581_c1 3300050491 Bacteria 1774
1224 nmdc:mga00v17_147525_c1 3300050491 Bacteria 1510
1225 nmdc:mga00v17_1725_c1 3300050491 Bacteria 11351
1226 nmdc:mga00v17_215758_c1 3300050491 Bacteria 1242
1227 nmdc:mga0yw44_143373_c1 3300050492 Bacteria 1554
1228 nmdc:mga0yw44_23370_c1 3300050492 Bacteria 3099
1229 nmdc:mga0yw44_245180_c1 3300050492 Bacteria 1192
1230 nmdc:mga0yw44_283734_c1 3300050492 Bacteria 1107
1231 nmdc:mga0yw44_41065_c1 3300050492 Bacteria 2752
1232 nmdc:mga0k408_149525_c1 3300050493 Bacteria 1391
1233 nmdc:mga0k408_16499_c1 3300050493 Bacteria 4099
1234 nmdc:mga0k408_287856_c1 3300050493 Bacteria 981
1235 nmdc:mga0k408_338027_c1 3300050493 Bacteria 898
1236 nmdc:mga0k408_445760_c1 3300050493 Bacteria 769
1237 nmdc:mga06z11_242617_c1 3300050494 Bacteria 1059
1238 nmdc:mga06z11_244322_c1 3300050494 Bacteria 1055
1239 nmdc:mga06z11_521349_c1 3300050494 Bacteria 721
1240 nmdc:mga06z11_79657_c1 3300050494 Bacteria 1754
1241 nmdc:mga06z11_81027_c1 3300050494 Bacteria 1742
1242 nmdc:mga06z11_93263_c1 3300050494 Bacteria 1639
1243 nmdc:mga07m45_349677_c1 3300050496 Bacteria 859
1244 nmdc:mga07m45_62754_c1 3300050496 Bacteria 2107
1245 nmdc:mga05p37_44315_c1 3300050507 Bacteria 5473
1246 nmdc:mga09592_163313_c1 3300050508 Bacteria 1924
1247 nmdc:mga08y16_1017078_c1 3300050511 Bacteria 808
1248 nmdc:mga08y16_78647_c1 3300050511 Bacteria 3438
1249 nmdc:mga0n895_263504_c1 3300050512 Bacteria 1749
1250 nmdc:mga0n895_38171_c1 3300050512 Bacteria 4652
1251 nmdc:mga0rr50_355652_c1 3300050513 Bacteria 1232
1252 nmdc:mga08x19_455809_c1 3300050514 Bacteria 900
1253 nmdc:mga08x19_70623_c1 3300050514 Bacteria 2275
1254 nmdc:mga0sz30_41661_c1 3300050516 Bacteria 1931
1255 nmdc:mga0sz30_47472_c1 3300050516 Bacteria 1815
1256 Ga0495601_0016608 3300053077 Bacteria 4462
1257 Ga0495601_0020415 3300053077 Bacteria 4046
1258 Ga0495601_0617826 3300053077 Bacteria 695
1259 Ga0495612_0052700 3300053078 Bacteria 1674
1260 Ga0495612_0072416 3300053078 Bacteria 1438
1261 Ga0495612_0119094 3300053078 Bacteria 1134
1262 Ga0495612_0363651 3300053078 Bacteria 654
1263 Ga0500635_0011050 3300053080 Bacteria 2556
1264 Ga0495655_0006062 3300053083 Bacteria 2175
1265 Ga0495595_0001138 3300053084 Bacteria 10300
1266 Ga0495595_0008097 3300053084 Bacteria 4309
1267 Ga0495595_0071265 3300053084 Bacteria 1643
1268 Ga0495619_0016127 3300053085 Bacteria 4729
1269 Ga0495619_0083455 3300053085 Bacteria 2155
1270 Ga0495619_0473933 3300053085 Bacteria 862
1271 Ga0500578_0085342 3300053086 Bacteria 2006
1272 Ga0500578_0100444 3300053086 Bacteria 1831
1273 Ga0500578_0157908 3300053086 Bacteria 1409
1274 Ga0500643_022492 3300053087 Bacteria 2027
1275 Ga0500644_0036728 3300053088 Bacteria 1596
1276 Ga0500644_0157458 3300053088 Bacteria 916
1277 Ga0500581_085417 3300053089 Bacteria 1569
1278 Ga0500646_0008172 3300053090 Bacteria 2675
1279 Ga0500647_0285023 3300053091 Bacteria 712
1280 Ga0500583_0085309 3300053092 Bacteria 1531
1281 Ga0500583_0147020 3300053092 Bacteria 1172
1282 Ga0500651_0002638 3300053093 Bacteria 9527
1283 Ga0500651_0015639 3300053093 Bacteria 4660
1284 Ga0500651_0049749 3300053093 Bacteria 2632
1285 Ga0500651_0055720 3300053093 Bacteria 2475
1286 Ga0500566_0000243 3300053094 Bacteria 29193
1287 Ga0500566_0006814 3300053094 Bacteria 6761
1288 Ga0500640_011728 3300053095 Bacteria 3578
1289 Ga0500641_0003009 3300053096 Bacteria 5967
1290 Ga0500641_0004785 3300053096 Bacteria 4792
1291 Ga0500641_0005288 3300053096 Bacteria 4570
1292 Ga0500641_0151696 3300053096 Bacteria 1000
1293 Ga0500648_022378 3300053097 Bacteria 3510
1294 Ga0500555_027690 3300053103 Bacteria 1616
1295 Ga0500556_0000006 3300053104 Bacteria 453982
1296 Ga0500562_012950 3300053108 Bacteria 2123
1297 Ga0500569_038305 3300053109 Bacteria 1390
1298 Ga0500572_002477 3300053111 Bacteria 4426
1299 Ga0500572_003577 3300053111 Bacteria 3538
1300 Ga0500592_000518 3300053116 Bacteria 6336
1301 Ga0500593_063406 3300053117 Bacteria 1619
1302 Ga0500594_0003603 3300053118 Bacteria 3412
1303 Ga0500595_001299 3300053119 Bacteria 13581
1304 Ga0500595_003367 3300053119 Bacteria 7488
1305 Ga0500595_007669 3300053119 Bacteria 4464
1306 Ga0500595_015071 3300053119 Bacteria 2910
1307 Ga0500597_055210 3300053120 Bacteria 1699
1308 Ga0500608_019283 3300053122 Bacteria 3124
1309 Ga0500608_024237 3300053122 Bacteria 2832
1310 Ga0500618_010251 3300053125 Bacteria 2520
1311 Ga0500621_196046 3300053126 Bacteria 719
1312 Ga0500628_157283 3300053129 Bacteria 639
1313 Ga0500642_0000004 3300053130 Bacteria 433122
1314 Ga0500642_0000056 3300053130 Bacteria 67746
1315 Ga0500642_0002295 3300053130 Bacteria 5587
1316 Ga0500642_0054062 3300053130 Bacteria 1781
1317 Ga0500652_008629 3300053131 Bacteria 3406
1318 Ga0500658_0051650 3300053134 Bacteria 1681
1319 Ga0500559_0000276 3300053136 Bacteria 39738
1320 Ga0500559_0000660 3300053136 Bacteria 23212
1321 Ga0500559_0011403 3300053136 Bacteria 3796
1322 Ga0500559_0049006 3300053136 Bacteria 1859
1323 Ga0500561_0026304 3300053137 Bacteria 1424
1324 Ga0500568_0003467 3300053139 Bacteria 8772
1325 Ga0500568_0041456 3300053139 Bacteria 1849
1326 Ga0500573_0008315 3300053140 Bacteria 5713
1327 Ga0500577_0032970 3300053142 Bacteria 1826
1328 Ga0500586_001407 3300053145 Bacteria 5061
1329 Ga0500589_045029 3300053147 Bacteria 2055
1330 Ga0500589_155532 3300053147 Bacteria 925
1331 Ga0500603_002895 3300053150 Bacteria 3716
1332 Ga0500603_007630 3300053150 Bacteria 2381
1333 Ga0500616_0000022 3300053153 Bacteria 460463
1334 Ga0500616_0000127 3300053153 Bacteria 134777
1335 Ga0500622_0002509 3300053156 Bacteria 13185
1336 Ga0500622_0109096 3300053156 Bacteria 1354
1337 Ga0500627_0052195 3300053158 Bacteria 1784
1338 Ga0500630_042577 3300053159 Bacteria 2215
1339 Ga0500633_0007947 3300053160 Bacteria 2706
1340 Ga0500634_0139465 3300053161 Bacteria 1150
1341 Ga0500639_011635 3300053163 Bacteria 4615
1342 Ga0500639_016672 3300053163 Bacteria 3873
1343 Ga0500636_0000766 3300053177 Bacteria 17335
1344 Ga0500636_0167483 3300053177 Bacteria 1191
1345 Ga0500636_0180298 3300053177 Bacteria 1134
1346 Ga0500636_0374509 3300053177 Bacteria 670
1347 Ga0500637_0016388 3300053178 Bacteria 3950
1348 Ga0500637_0162959 3300053178 Bacteria 1284
1349 Ga0500637_0203738 3300053178 Bacteria 1125
1350 Ga0500637_0446954 3300053178 Bacteria 656
1351 Ga0500570_021281 3300053724 Bacteria 3611
1352 Ga0500645_006753 3300053730 Bacteria 4064
1353 Ga0500645_023467 3300053730 Bacteria 1890
1354 Ga0500596_000520 3300053735 Bacteria 7265
1355 Ga0500596_001464 3300053735 Bacteria 4776
1356 Ga0500596_003829 3300053735 Bacteria 2817
1357 Ga0500601_001777 3300053737 Bacteria 2321
1358 Ga0501082_0424384 3300060353 Bacteria 1161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100691666 Ga0068868_1006916661 161
2 3300025972 Ga0207668_10069726 Ga0207668_100697262 161
3 3300026023 Ga0207677_10365751 Ga0207677_103657511 161
4 3300028379 Ga0268266_10011435 Ga0268266_100114355 161
5 3300048912 Ga0496109_0035286 Ga0496109_0035286_294_881 161
6 3300046522 Ga0495643_0302516 Ga0495643_0302516_209_715 168
7 3300046558 Ga0495633_0175355 Ga0495633_0175355_471_977 168
8 3300006177 Ga0075362_10315732 Ga0075362_103157321 179
9 3300005329 Ga0070683_100008660 Ga0070683_10000866010 180
10 3300005458 Ga0070681_10112709 Ga0070681_101127092 180
11 3300005530 Ga0070679_100165788 Ga0070679_1001657882 180
12 3300005535 Ga0070684_100003915 Ga0070684_10000391514 180
13 3300009093 Ga0105240_10176227 Ga0105240_101762272 180
14 3300025913 Ga0207695_10063142 Ga0207695_100631422 180
15 3300025921 Ga0207652_10126417 Ga0207652_101264172 180
16 3300025944 Ga0207661_10001179 Ga0207661_1000117921 180
17 3300006051 Ga0075364_10044309 Ga0075364_100443092 181
18 3300046460 Ga0495638_0409562 Ga0495638_0409562_15_563 181
19 3300048929 Ga0496126_0655751 Ga0496126_0655751_259_807 181
20 3300048929 Ga0496126_0658476 Ga0496126_0658476_248_796 181
21 3300050491 nmdc:mga00v17_147525_c1 nmdc:mga00v17_147525_c1_848_1453 181
22 3300053088 Ga0500644_0036728 Ga0500644_0036728_15_563 181
23 3300053129 Ga0500628_157283 Ga0500628_157283_14_562 181
24 3300005336 Ga0070680_100053673 Ga0070680_1000536733 183
25 3300005458 Ga0070681_10013723 Ga0070681_100137238 183
26 3300005530 Ga0070679_100122653 Ga0070679_1001226531 183
27 3300005539 Ga0068853_100490632 Ga0068853_1004906322 183
28 3300005563 Ga0068855_100167682 Ga0068855_1001676824 183
29 3300006358 Ga0068871_100525902 Ga0068871_1005259022 183
30 3300009093 Ga0105240_10144055 Ga0105240_101440551 183
31 3300009093 Ga0105240_10432883 Ga0105240_104328832 183
32 3300009545 Ga0105237_10132136 Ga0105237_101321363 183
33 3300013104 Ga0157370_10319212 Ga0157370_103192121 183
34 3300013105 Ga0157369_10043225 Ga0157369_100432252 183
35 3300013307 Ga0157372_10854233 Ga0157372_108542332 183
36 3300020069 Ga0197907_10509530 Ga0197907_105095302 183
37 3300020080 Ga0206350_11625858 Ga0206350_116258582 183
38 3300022467 Ga0224712_10032772 Ga0224712_100327722 183
39 3300025904 Ga0207647_10142703 Ga0207647_101427032 183
40 3300025912 Ga0207707_10086395 Ga0207707_100863955 183
41 3300025913 Ga0207695_10023567 Ga0207695_100235672 183
42 3300025913 Ga0207695_10486906 Ga0207695_104869061 183
43 3300025914 Ga0207671_10067059 Ga0207671_100670592 183
44 3300025921 Ga0207652_10071947 Ga0207652_100719472 183
45 3300025949 Ga0207667_10036093 Ga0207667_100360934 183
46 3300026142 Ga0207698_11499305 Ga0207698_114993051 183
47 3300037068 Ga0373925_0121449 Ga0373925_0121449_339_941 183
48 3300048918 Ga0496115_0107081 Ga0496115_0107081_1250_1861 183
49 3300048918 Ga0496115_0465313 Ga0496115_0465313_285_887 183
50 3300003215 JGI25153J46596_10001259 JGI25153J46596_1000125914 184
51 3300005983 Ga0081540_1019386 Ga0081540_10193863 184
52 3300013296 Ga0157374_10205285 Ga0157374_102052852 184
53 3300020081 Ga0206354_10455357 Ga0206354_104553571 184
54 3300025297 Ga0209758_1005955 Ga0209758_10059555 184
55 3300037853 Ga0436364_1349110 Ga0436364_1349110_374_973 184
56 3300042157 Ga0439458_0004914 Ga0439458_0004914_469_1071 184
57 3300046460 Ga0495638_0120859 Ga0495638_0120859_708_1310 184
58 3300046648 Ga0495611_0155322 Ga0495611_0155322_305_907 184
59 3300050489 nmdc:mga03683_129023_c1 nmdc:mga03683_129023_c1_153_755 184
60 3300053096 Ga0500641_0151696 Ga0500641_0151696_238_840 184
61 3300053142 Ga0500577_0032970 Ga0500577_0032970_508_1110 184
62 3300053161 Ga0500634_0139465 Ga0500634_0139465_478_1080 184
63 3300025302 Ga0207426_1023685 Ga0207426_10236852 185
64 3300026089 Ga0207648_10656876 Ga0207648_106568762 185
65 3300046454 Ga0495592_0036483 Ga0495592_0036483_2322_2921 185
66 3300046462 Ga0495651_0041339 Ga0495651_0041339_116_715 185
67 3300046463 Ga0495653_0043811 Ga0495653_0043811_2298_2897 185
68 3300046511 Ga0495608_0258598 Ga0495608_0258598_254_853 185
69 3300046516 Ga0495628_0026877 Ga0495628_0026877_2420_3019 185
70 3300046529 Ga0495652_0143100 Ga0495652_0143100_451_1050 185
71 3300046533 Ga0495640_0040271 Ga0495640_0040271_516_1115 185
72 3300046536 Ga0495587_0014194 Ga0495587_0014194_3623_4222 185
73 3300046675 Ga0495657_0011878 Ga0495657_0011878_2327_2926 185
74 3300046678 Ga0495599_0022444 Ga0495599_0022444_2657_3256 185
75 3300046680 Ga0495646_0042753 Ga0495646_0042753_841_1440 185
76 3300046689 Ga0495613_0228307 Ga0495613_0228307_293_892 185
77 3300046809 Ga0495600_0006537 Ga0495600_0006537_6467_7066 185
78 3300047317 Ga0495604_0001495 Ga0495604_0001495_8489_9088 185
79 3300047319 Ga0495674_0133524 Ga0495674_0133524_1302_1901 185
80 3300047322 Ga0495680_0030852 Ga0495680_0030852_2743_3342 185
81 3300047444 Ga0495675_0013695 Ga0495675_0013695_306_905 185
82 3300048088 Ga0495602_0041551 Ga0495602_0041551_816_1415 185
83 3300049741 Ga0501079_0352151 Ga0501079_0352151_88_690 185
84 3300053085 Ga0495619_0083455 Ga0495619_0083455_668_1267 185
85 3300003659 JGI25404J52841_10016958 JGI25404J52841_100169582 186
86 3300005983 Ga0081540_1011557 Ga0081540_10115576 186
87 3300044706 Ga0466964_0060085 Ga0466964_0060085_901_1503 186
88 3300044765 Ga0466970_0104496 Ga0466970_0104496_545_1147 186
89 3300045049 Ga0466959_0070021 Ga0466959_0070021_1922_2524 186
90 3300049580 Ga0501046_0035061 Ga0501046_0035061_1786_2388 187
91 3300049586 Ga0501070_0030863 Ga0501070_0030863_1951_2553 187
92 3300049742 Ga0501080_0067890 Ga0501080_0067890_733_1335 187
93 3300049822 Ga0501035_0103083 Ga0501035_0103083_578_1174 187
94 3300049822 Ga0501035_0215165 Ga0501035_0215165_75_677 187
95 3300049823 Ga0501044_0081215 Ga0501044_0081215_2230_2832 187
96 3300050492 nmdc:mga0yw44_283734_c1 nmdc:mga0yw44_283734_c1_174_785 187
97 3300006028 Ga0070717_10070975 Ga0070717_100709753 190
98 3300037418 Ga0395900_0465600 Ga0395900_0465600_95_709 190
99 3300037471 Ga0395905_0012091 Ga0395905_0012091_3708_4322 190
100 3300049572 Ga0501036_0272301 Ga0501036_0272301_111_713 190
101 3300049573 Ga0501037_0635601 Ga0501037_0635601_37_639 190
102 3300049574 Ga0501038_0684945 Ga0501038_0684945_156_758 190
103 3300049578 Ga0501042_0185244 Ga0501042_0185244_751_1353 190
104 3300049587 Ga0501071_0306364 Ga0501071_0306364_343_945 190
105 3300060353 Ga0501082_0424384 Ga0501082_0424384_26_628 190
106 3300025911 Ga0207654_10145018 Ga0207654_101450182 191
107 iso_pu_bacteria 2513237141 2513888670 191
108 iso_pu_bacteria 8006984368 8006990825 191
109 3300005841 Ga0068863_100164671 Ga0068863_1001646712 192
110 3300006237 Ga0097621_100088568 Ga0097621_1000885684 192
111 3300009101 Ga0105247_10022343 Ga0105247_100223432 192
112 3300009101 Ga0105247_10121971 Ga0105247_101219711 192
113 3300009545 Ga0105237_10116340 Ga0105237_101163403 192
114 3300025900 Ga0207710_10060951 Ga0207710_100609512 192
115 3300026035 Ga0207703_10138552 Ga0207703_101385522 192
116 3300026088 Ga0207641_10238933 Ga0207641_102389332 192
117 3300041503 Ga0451847_0193603 Ga0451847_0193603_180_782 192
118 3300048909 Ga0496106_0000246 Ga0496106_0000246_31168_31770 192
119 3300048921 Ga0496118_0017920 Ga0496118_0017920_3902_4504 192
120 3300048923 Ga0496120_0051627 Ga0496120_0051627_709_1314 192
121 3300048923 Ga0496120_0081150 Ga0496120_0081150_392_994 192
122 3300048924 Ga0496121_0000423 Ga0496121_0000423_5878_6480 192
123 3300048924 Ga0496121_0067452 Ga0496121_0067452_1166_1768 192
124 3300048927 Ga0496124_0000235 Ga0496124_0000235_91999_92601 192
125 3300048928 Ga0496125_0088205 Ga0496125_0088205_71_673 192
126 3300048929 Ga0496126_0003857 Ga0496126_0003857_2310_2912 192
127 3300048929 Ga0496126_0169818 Ga0496126_0169818_503_1105 192
128 3300053097 Ga0500648_022378 Ga0500648_022378_998_1600 192
129 3300053136 Ga0500559_0011403 Ga0500559_0011403_1735_2337 192
130 3300053140 Ga0500573_0008315 Ga0500573_0008315_1779_2381 192
131 3300053177 Ga0500636_0167483 Ga0500636_0167483_578_1180 192
132 3300053735 Ga0500596_000520 Ga0500596_000520_1308_1910 192
133 iso_pu_bacteria 2906626472 2906633389 192
134 iso_pu_bacteria 8016583857 8016586480 192
135 3300002075 JGI24738J21930_10016956 JGI24738J21930_100169561 193
136 3300005457 Ga0070662_100264109 Ga0070662_1002641092 193
137 3300005548 Ga0070665_100016864 Ga0070665_1000168642 193
138 3300006048 Ga0075363_100072285 Ga0075363_1000722852 193
139 3300006051 Ga0075364_10262713 Ga0075364_102627131 193
140 3300014325 Ga0163163_10070758 Ga0163163_100707583 193
141 3300025933 Ga0207706_10174782 Ga0207706_101747823 193
142 3300026067 Ga0207678_10006070 Ga0207678_1000607011 193
143 3300028379 Ga0268266_10006358 Ga0268266_100063586 193
144 3300041413 Ga0439465_0031998 Ga0439465_0031998_515_1117 193
145 3300048904 Ga0496101_0135671 Ga0496101_0135671_78_680 193
146 3300048907 Ga0496104_0064008 Ga0496104_0064008_2008_2610 193
147 3300050490 nmdc:mga03n38_16625_c1 nmdc:mga03n38_16625_c1_1955_2557 193
148 3300050491 nmdc:mga00v17_215758_c1 nmdc:mga00v17_215758_c1_353_955 193
149 3300053130 Ga0500642_0000056 Ga0500642_0000056_12973_13572 193
150 iso_pu_bacteria 2513237094 2513639825 193
151 iso_pu_bacteria 2513237104 2513719793 193
152 iso_pu_bacteria 8006926726 8006928550 193
153 3300005436 Ga0070713_100052217 Ga0070713_1000522172 194
154 3300005455 Ga0070663_100207406 Ga0070663_1002074062 194
155 3300005563 Ga0068855_100170211 Ga0068855_1001702112 194
156 3300005614 Ga0068856_100161136 Ga0068856_1001611362 194
157 3300006175 Ga0070712_100138535 Ga0070712_1001385352 194
158 3300013104 Ga0157370_10023008 Ga0157370_100230085 194
159 3300013105 Ga0157369_10021320 Ga0157369_100213203 194
160 3300013297 Ga0157378_10027728 Ga0157378_100277282 194
161 3300013307 Ga0157372_10246402 Ga0157372_102464022 194
162 3300020070 Ga0206356_11485400 Ga0206356_114854004 194
163 3300022467 Ga0224712_10221794 Ga0224712_102217941 194
164 3300025913 Ga0207695_10074538 Ga0207695_100745384 194
165 3300025915 Ga0207693_10097562 Ga0207693_100975622 194
166 3300025928 Ga0207700_10154910 Ga0207700_101549101 194
167 3300025949 Ga0207667_10204076 Ga0207667_102040762 194
168 3300026067 Ga0207678_11077738 Ga0207678_110777381 194
169 3300026078 Ga0207702_10135424 Ga0207702_101354242 194
170 3300037418 Ga0395900_0037265 Ga0395900_0037265_3117_3716 194
171 3300037466 Ga0395898_0024063 Ga0395898_0024063_5352_5951 194
172 3300038443 Ga0395901_0084617 Ga0395901_0084617_1962_2561 194
173 3300048912 Ga0496109_0223495 Ga0496109_0223495_91_690 194
174 3300002070 JGI24750J21931_1058227 JGI24750J21931_10582271 195
175 3300003214 JGI25165J46597_1014034 JGI25165J46597_10140341 195
176 3300003763 Ga0055529_1017446 Ga0055529_10174461 195
177 3300005295 Ga0065707_10246177 Ga0065707_102461772 195
178 3300005328 Ga0070676_10252963 Ga0070676_102529632 195
179 3300005328 Ga0070676_10401625 Ga0070676_104016251 195
180 3300005330 Ga0070690_100350975 Ga0070690_1003509751 195
181 3300005334 Ga0068869_100039360 Ga0068869_1000393601 195
182 3300005335 Ga0070666_10173558 Ga0070666_101735582 195
183 3300005337 Ga0070682_100074395 Ga0070682_1000743952 195
184 3300005338 Ga0068868_100265700 Ga0068868_1002657001 195
185 3300005339 Ga0070660_100357285 Ga0070660_1003572852 195
186 3300005340 Ga0070689_100934831 Ga0070689_1009348311 195
187 3300005344 Ga0070661_100095203 Ga0070661_1000952032 195
188 3300005356 Ga0070674_100200230 Ga0070674_1002002302 195
189 3300005364 Ga0070673_100922543 Ga0070673_1009225431 195
190 3300005367 Ga0070667_100043929 Ga0070667_1000439293 195
191 3300005438 Ga0070701_10151054 Ga0070701_101510542 195
192 3300005440 Ga0070705_100409299 Ga0070705_1004092992 195
193 3300005441 Ga0070700_100145392 Ga0070700_1001453922 195
194 3300005444 Ga0070694_100597268 Ga0070694_1005972681 195
195 3300005445 Ga0070708_100592873 Ga0070708_1005928732 195
196 3300005455 Ga0070663_100410769 Ga0070663_1004107691 195
197 3300005456 Ga0070678_100131001 Ga0070678_1001310012 195
198 3300005457 Ga0070662_100029595 Ga0070662_1000295952 195
199 3300005471 Ga0070698_100052755 Ga0070698_1000527553 195
200 3300005539 Ga0068853_100110382 Ga0068853_1001103822 195
201 3300005543 Ga0070672_100777343 Ga0070672_1007773431 195
202 3300005548 Ga0070665_100110444 Ga0070665_1001104442 195
203 3300005548 Ga0070665_100318507 Ga0070665_1003185072 195
204 3300005549 Ga0070704_100085572 Ga0070704_1000855723 195
205 3300005564 Ga0070664_100076757 Ga0070664_1000767573 195
206 3300005578 Ga0068854_100689806 Ga0068854_1006898061 195
207 3300005616 Ga0068852_100600808 Ga0068852_1006008081 195
208 3300005617 Ga0068859_101038769 Ga0068859_1010387691 195
209 3300005618 Ga0068864_100752973 Ga0068864_1007529732 195
210 3300005719 Ga0068861_100255131 Ga0068861_1002551312 195
211 3300005719 Ga0068861_100314185 Ga0068861_1003141851 195
212 3300005842 Ga0068858_100097450 Ga0068858_1000974503 195
213 3300005843 Ga0068860_100295294 Ga0068860_1002952941 195
214 3300005843 Ga0068860_100426397 Ga0068860_1004263971 195
215 3300005844 Ga0068862_100104509 Ga0068862_1001045092 195
216 3300005844 Ga0068862_100495819 Ga0068862_1004958192 195
217 3300005983 Ga0081540_1003529 Ga0081540_10035295 195
218 3300006038 Ga0075365_10011114 Ga0075365_100111145 195
219 3300006038 Ga0075365_10016638 Ga0075365_100166384 195
220 3300006042 Ga0075368_10162014 Ga0075368_101620142 195
221 3300006051 Ga0075364_10480288 Ga0075364_104802881 195
222 3300006177 Ga0075362_10035670 Ga0075362_100356702 195
223 3300006177 Ga0075362_10136571 Ga0075362_101365711 195
224 3300006177 Ga0075362_10243342 Ga0075362_102433421 195
225 3300006178 Ga0075367_10111628 Ga0075367_101116281 195
226 3300006178 Ga0075367_10182297 Ga0075367_101822972 195
227 3300006178 Ga0075367_10499585 Ga0075367_104995851 195
228 3300006186 Ga0075369_10066844 Ga0075369_100668442 195
229 3300006195 Ga0075366_10075643 Ga0075366_100756432 195
230 3300006195 Ga0075366_10183412 Ga0075366_101834122 195
231 3300006353 Ga0075370_10146480 Ga0075370_101464802 195
232 3300006353 Ga0075370_10420753 Ga0075370_104207531 195
233 3300006844 Ga0075428_100345035 Ga0075428_1003450352 195
234 3300006881 Ga0068865_100325690 Ga0068865_1003256902 195
235 3300006931 Ga0097620_101038793 Ga0097620_1010387931 195
236 3300007788 Ga0099795_10046630 Ga0099795_100466302 195
237 3300009092 Ga0105250_10047595 Ga0105250_100475952 195
238 3300009094 Ga0111539_10459047 Ga0111539_104590471 195
239 3300009147 Ga0114129_10062265 Ga0114129_100622653 195
240 3300009174 Ga0105241_10233452 Ga0105241_102334522 195
241 3300009176 Ga0105242_10490695 Ga0105242_104906952 195
242 3300009177 Ga0105248_10129944 Ga0105248_101299442 195
243 3300009545 Ga0105237_10361742 Ga0105237_103617422 195
244 3300009553 Ga0105249_10455878 Ga0105249_104558782 195
245 3300010375 Ga0105239_10583169 Ga0105239_105831692 195
246 3300010375 Ga0105239_11495542 Ga0105239_114955421 195
247 3300013296 Ga0157374_10257282 Ga0157374_102572822 195
248 3300014325 Ga0163163_10860278 Ga0163163_108602782 195
249 3300014326 Ga0157380_10972443 Ga0157380_109724431 195
250 3300014968 Ga0157379_10179322 Ga0157379_101793223 195
251 3300017792 Ga0163161_10504466 Ga0163161_105044661 195
252 3300025254 Ga0209148_1038378 Ga0209148_10383781 195
253 3300025261 Ga0209233_1001687 Ga0209233_10016874 195
254 3300025272 Ga0209455_1017269 Ga0209455_10172692 195
255 3300025297 Ga0209758_1013259 Ga0209758_10132593 195
256 3300025711 Ga0207696_1017234 Ga0207696_10172341 195
257 3300025885 Ga0207653_10007878 Ga0207653_100078781 195
258 3300025900 Ga0207710_10094798 Ga0207710_100947982 195
259 3300025908 Ga0207643_10083781 Ga0207643_100837812 195
260 3300025920 Ga0207649_10059456 Ga0207649_100594562 195
261 3300025923 Ga0207681_10064653 Ga0207681_100646532 195
262 3300025923 Ga0207681_10296300 Ga0207681_102963001 195
263 3300025933 Ga0207706_10027953 Ga0207706_100279534 195
264 3300025935 Ga0207709_10308397 Ga0207709_103083972 195
265 3300025938 Ga0207704_10200058 Ga0207704_102000582 195
266 3300025940 Ga0207691_10231386 Ga0207691_102313862 195
267 3300025945 Ga0207679_10765975 Ga0207679_107659752 195
268 3300025961 Ga0207712_10021518 Ga0207712_100215182 195
269 3300025961 Ga0207712_10534659 Ga0207712_105346592 195
270 3300025972 Ga0207668_10028136 Ga0207668_100281364 195
271 3300025981 Ga0207640_10412030 Ga0207640_104120301 195
272 3300026023 Ga0207677_10066110 Ga0207677_100661101 195
273 3300026035 Ga0207703_10505914 Ga0207703_105059142 195
274 3300026041 Ga0207639_10181804 Ga0207639_101818041 195
275 3300026041 Ga0207639_10535287 Ga0207639_105352871 195
276 3300026067 Ga0207678_10265187 Ga0207678_102651872 195
277 3300026067 Ga0207678_10787624 Ga0207678_107876241 195
278 3300026075 Ga0207708_10077611 Ga0207708_100776113 195
279 3300026088 Ga0207641_10581130 Ga0207641_105811301 195
280 3300026121 Ga0207683_10918717 Ga0207683_109187171 195
281 3300028380 Ga0268265_10173023 Ga0268265_101730231 195
282 3300028381 Ga0268264_10073977 Ga0268264_100739772 195
283 3300028381 Ga0268264_10098422 Ga0268264_100984221 195
284 3300028786 Ga0307517_10115849 Ga0307517_101158492 195
285 3300031249 Ga0265339_10012970 Ga0265339_100129706 195
286 3300031456 Ga0307513_10851660 Ga0307513_108516601 195
287 3300031507 Ga0307509_10254585 Ga0307509_102545852 195
288 3300031852 Ga0307410_10544250 Ga0307410_105442501 195
289 3300031889 Ga0326468_10035826 Ga0326468_100358261 195
290 3300031901 Ga0307406_10478605 Ga0307406_104786051 195
291 3300031903 Ga0307407_10193402 Ga0307407_101934021 195
292 3300031903 Ga0307407_10629871 Ga0307407_106298711 195
293 3300031995 Ga0307409_100060330 Ga0307409_1000603303 195
294 3300032002 Ga0307416_100216275 Ga0307416_1002162752 195
295 3300032002 Ga0307416_100396580 Ga0307416_1003965802 195
296 3300032004 Ga0307414_10451727 Ga0307414_104517272 195
297 3300032005 Ga0307411_10064291 Ga0307411_100642912 195
298 3300032126 Ga0307415_100126311 Ga0307415_1001263112 195
299 3300032126 Ga0307415_100126456 Ga0307415_1001264562 195
300 3300032126 Ga0307415_100138565 Ga0307415_1001385653 195
301 3300033180 Ga0307510_10003322 Ga0307510_1000332215 195
302 3300034957 Ga0373938_0048481 Ga0373938_0048481_185_772 195
303 3300035112 Ga0373932_0060343 Ga0373932_0060343_297_884 195
304 3300035241 Ga0373961_0065596 Ga0373961_0065596_71_658 195
305 3300035695 Ga0373927_0091690 Ga0373927_0091690_568_1155 195
306 3300035725 Ga0373947_0272036 Ga0373947_0272036_261_848 195
307 3300039437 Ga0436365_0049558 Ga0436365_0049558_2586_3173 195
308 3300039450 Ga0436363_1542117 Ga0436363_1542117_3297_3884 195
309 3300041413 Ga0439465_0016189 Ga0439465_0016189_1722_2309 195
310 3300041453 Ga0451797_0206793 Ga0451797_0206793_12_599 195
311 3300041486 Ga0451807_0416485 Ga0451807_0416485_802_1389 195
312 3300041997 Ga0439431_0010867 Ga0439431_0010867_1026_1613 195
313 3300044656 Ga0466969_0243047 Ga0466969_0243047_77_679 195
314 3300044719 Ga0466971_0190593 Ga0466971_0190593_139_726 195
315 3300044842 Ga0466957_0404481 Ga0466957_0404481_148_735 195
316 3300045976 Ga0466967_0074353 Ga0466967_0074353_1240_1827 195
317 3300046452 Ga0495617_017561 Ga0495617_017561_1356_1943 195
318 3300046452 Ga0495617_066632 Ga0495617_066632_275_862 195
319 3300046455 Ga0495603_0018817 Ga0495603_0018817_570_1157 195
320 3300046457 Ga0495590_0036775 Ga0495590_0036775_291_878 195
321 3300046459 Ga0495629_0118206 Ga0495629_0118206_85_672 195
322 3300046460 Ga0495638_0163843 Ga0495638_0163843_337_924 195
323 3300046460 Ga0495638_0230159 Ga0495638_0230159_82_669 195
324 3300046461 Ga0495641_0040198 Ga0495641_0040198_568_1155 195
325 3300046471 Ga0495650_0038999 Ga0495650_0038999_381_968 195
326 3300046471 Ga0495650_0046877 Ga0495650_0046877_911_1498 195
327 3300046474 Ga0495605_0076706 Ga0495605_0076706_510_1097 195
328 3300046492 Ga0495585_0112504 Ga0495585_0112504_288_875 195
329 3300046492 Ga0495585_0176527 Ga0495585_0176527_500_1087 195
330 3300046492 Ga0495585_0235565 Ga0495585_0235565_24_611 195
331 3300046492 Ga0495585_0293089 Ga0495585_0293089_14_601 195
332 3300046500 Ga0495596_0012911 Ga0495596_0012911_2546_3133 195
333 3300046500 Ga0495596_0101019 Ga0495596_0101019_311_898 195
334 3300046501 Ga0495607_0092479 Ga0495607_0092479_288_875 195
335 3300046506 Ga0495583_0055178 Ga0495583_0055178_353_940 195
336 3300046512 Ga0495610_0080804 Ga0495610_0080804_451_1038 195
337 3300046513 Ga0495616_0144093 Ga0495616_0144093_481_1068 195
338 3300046518 Ga0495631_0046685 Ga0495631_0046685_1207_1794 195
339 3300046518 Ga0495631_0134945 Ga0495631_0134945_271_858 195
340 3300046519 Ga0495632_0102235 Ga0495632_0102235_284_871 195
341 3300046519 Ga0495632_0142848 Ga0495632_0142848_365_952 195
342 3300046519 Ga0495632_0228634 Ga0495632_0228634_201_788 195
343 3300046523 Ga0495644_0021784 Ga0495644_0021784_287_874 195
344 3300046523 Ga0495644_0085613 Ga0495644_0085613_301_888 195
345 3300046525 Ga0495663_0029627 Ga0495663_0029627_720_1307 195
346 3300046528 Ga0495642_0081369 Ga0495642_0081369_287_874 195
347 3300046530 Ga0495654_0099145 Ga0495654_0099145_357_944 195
348 3300046537 Ga0495598_0081760 Ga0495598_0081760_430_1017 195
349 3300046539 Ga0495621_0295376 Ga0495621_0295376_12_599 195
350 3300046542 Ga0495597_0030293 Ga0495597_0030293_469_1056 195
351 3300046557 Ga0495622_0015487 Ga0495622_0015487_501_1088 195
352 3300046558 Ga0495633_0027177 Ga0495633_0027177_1872_2459 195
353 3300046558 Ga0495633_0109096 Ga0495633_0109096_433_1020 195
354 3300046615 Ga0495656_0006193 Ga0495656_0006193_1682_2269 195
355 3300046615 Ga0495656_0200390 Ga0495656_0200390_331_918 195
356 3300046615 Ga0495656_0251103 Ga0495656_0251103_236_823 195
357 3300046616 Ga0495668_0145460 Ga0495668_0145460_351_938 195
358 3300046648 Ga0495611_0346005 Ga0495611_0346005_68_655 195
359 3300046660 Ga0495625_0249887 Ga0495625_0249887_341_928 195
360 3300046664 Ga0495659_0057557 Ga0495659_0057557_523_1110 195
361 3300046664 Ga0495659_0176964 Ga0495659_0176964_238_825 195
362 3300046665 Ga0495661_0181717 Ga0495661_0181717_306_893 195
363 3300046674 Ga0495588_0008457 Ga0495588_0008457_3750_4337 195
364 3300046684 Ga0495669_0180049 Ga0495669_0180049_107_694 195
365 3300046684 Ga0495669_0287533 Ga0495669_0287533_94_681 195
366 3300046690 Ga0495624_0437610 Ga0495624_0437610_22_609 195
367 3300046691 Ga0495670_0081732 Ga0495670_0081732_307_894 195
368 3300046691 Ga0495670_0182182 Ga0495670_0182182_496_1083 195
369 3300046692 Ga0495671_0025305 Ga0495671_0025305_351_938 195
370 3300046692 Ga0495671_0337478 Ga0495671_0337478_61_648 195
371 3300046809 Ga0495600_0451479 Ga0495600_0451479_136_723 195
372 3300047315 Ga0495581_0152314 Ga0495581_0152314_199_786 195
373 3300047315 Ga0495581_0244467 Ga0495581_0244467_155_742 195
374 3300047318 Ga0495636_0117453 Ga0495636_0117453_562_1149 195
375 3300047318 Ga0495636_0235264 Ga0495636_0235264_189_776 195
376 3300047320 Ga0495672_0168472 Ga0495672_0168472_505_1092 195
377 3300047323 Ga0495683_0094536 Ga0495683_0094536_376_963 195
378 3300047323 Ga0495683_0204472 Ga0495683_0204472_123_710 195
379 3300047443 Ga0495687_113427 Ga0495687_113427_290_877 195
380 3300047447 Ga0495685_124879 Ga0495685_124879_47_634 195
381 3300047469 Ga0495673_0103518 Ga0495673_0103518_359_946 195
382 3300047470 Ga0495681_0132641 Ga0495681_0132641_187_774 195
383 3300048906 Ga0496103_0261204 Ga0496103_0261204_125_712 195
384 3300048911 Ga0496108_0112602 Ga0496108_0112602_27_614 195
385 3300048911 Ga0496108_0459755 Ga0496108_0459755_361_948 195
386 3300048914 Ga0496111_0415474 Ga0496111_0415474_363_950 195
387 3300048922 Ga0496119_0146239 Ga0496119_0146239_635_1222 195
388 3300048924 Ga0496121_0047049 Ga0496121_0047049_1121_1708 195
389 3300048924 Ga0496121_0432990 Ga0496121_0432990_189_776 195
390 3300048927 Ga0496124_0343705 Ga0496124_0343705_313_900 195
391 3300048928 Ga0496125_0231529 Ga0496125_0231529_253_840 195
392 3300048929 Ga0496126_0027355 Ga0496126_0027355_2291_2878 195
393 3300048929 Ga0496126_0322827 Ga0496126_0322827_420_1007 195
394 3300050489 nmdc:mga03683_12822_c1 nmdc:mga03683_12822_c1_1299_1886 195
395 3300050489 nmdc:mga03683_305416_c1 nmdc:mga03683_305416_c1_126_713 195
396 3300050490 nmdc:mga03n38_164641_c1 nmdc:mga03n38_164641_c1_282_869 195
397 3300050492 nmdc:mga0yw44_143373_c1 nmdc:mga0yw44_143373_c1_623_1210 195
398 3300050492 nmdc:mga0yw44_23370_c1 nmdc:mga0yw44_23370_c1_1826_2413 195
399 3300050493 nmdc:mga0k408_16499_c1 nmdc:mga0k408_16499_c1_1224_1811 195
400 3300050493 nmdc:mga0k408_287856_c1 nmdc:mga0k408_287856_c1_41_628 195
401 3300050493 nmdc:mga0k408_338027_c1 nmdc:mga0k408_338027_c1_244_831 195
402 3300050493 nmdc:mga0k408_445760_c1 nmdc:mga0k408_445760_c1_121_708 195
403 3300050494 nmdc:mga06z11_242617_c1 nmdc:mga06z11_242617_c1_337_924 195
404 3300050494 nmdc:mga06z11_521349_c1 nmdc:mga06z11_521349_c1_28_615 195
405 3300050507 nmdc:mga05p37_44315_c1 nmdc:mga05p37_44315_c1_1089_1676 195
406 3300050508 nmdc:mga09592_163313_c1 nmdc:mga09592_163313_c1_50_637 195
407 3300050511 nmdc:mga08y16_1017078_c1 nmdc:mga08y16_1017078_c1_198_785 195
408 3300050516 nmdc:mga0sz30_47472_c1 nmdc:mga0sz30_47472_c1_602_1189 195
409 3300053086 Ga0500578_0157908 Ga0500578_0157908_464_1051 195
410 3300053088 Ga0500644_0157458 Ga0500644_0157458_294_881 195
411 3300053092 Ga0500583_0147020 Ga0500583_0147020_329_916 195
412 3300053093 Ga0500651_0055720 Ga0500651_0055720_858_1445 195
413 3300053096 Ga0500641_0004785 Ga0500641_0004785_3381_3968 195
414 3300053096 Ga0500641_0005288 Ga0500641_0005288_1027_1617 195
415 3300053108 Ga0500562_012950 Ga0500562_012950_965_1552 195
416 3300053119 Ga0500595_003367 Ga0500595_003367_3569_4156 195
417 3300053120 Ga0500597_055210 Ga0500597_055210_1009_1596 195
418 3300053126 Ga0500621_196046 Ga0500621_196046_42_629 195
419 3300053130 Ga0500642_0054062 Ga0500642_0054062_888_1475 195
420 3300053137 Ga0500561_0026304 Ga0500561_0026304_822_1409 195
421 3300053147 Ga0500589_045029 Ga0500589_045029_1419_2006 195
422 3300053156 Ga0500622_0109096 Ga0500622_0109096_605_1192 195
423 3300053158 Ga0500627_0052195 Ga0500627_0052195_1057_1644 195
424 3300053178 Ga0500637_0162959 Ga0500637_0162959_378_965 195
425 3300053730 Ga0500645_006753 Ga0500645_006753_1875_2462 195
426 iso_pu_bacteria 2513237096 2513661519 195
427 iso_pu_bacteria 2513237137 2513860480 195
428 iso_pu_bacteria 2513237145 2513923218 195
429 iso_pu_bacteria 2517572143 2517888737 195
430 iso_pu_bacteria 2524023228 2524538839 195
431 iso_pu_bacteria 2667528175 2671119913 195
432 iso_pu_bacteria 2728368998 2728754900 195
433 iso_pu_bacteria 2791355197 2793067559 195
434 iso_pu_bacteria 2903748898 2903756365 195
435 iso_pu_bacteria 2904699407 2904708831 195
436 iso_pu_bacteria 2906610324 2906613770 195
437 iso_pu_bacteria 2906635258 2906640079 195
438 iso_pu_bacteria 2906660503 2906667473 195
439 iso_pu_bacteria 2908739725 2908747330 195
440 iso_pu_bacteria 2922425934 2922434386 195
441 iso_pu_bacteria 2935630451 2935635482 195
442 iso_pu_bacteria 2941507105 2941512221 195
443 iso_pu_bacteria 2941515067 2941519922 195
444 iso_pu_bacteria 2941523033 2941528137 195
445 iso_pu_bacteria 3005474847 3005474969 195
446 iso_pu_bacteria 8006933436 8006936355 195
447 iso_pu_bacteria 8006973647 8006976324 195
448 iso_pu_bacteria 8019555841 8019562301 195
449 iso_pu_bacteria 8019565922 8019572372 195
450 3300005327 Ga0070658_10335902 Ga0070658_103359022 196
451 3300005331 Ga0070670_100415302 Ga0070670_1004153021 196
452 3300005334 Ga0068869_100834719 Ga0068869_1008347192 196
453 3300005338 Ga0068868_100493970 Ga0068868_1004939701 196
454 3300005455 Ga0070663_100046873 Ga0070663_1000468732 196
455 3300005456 Ga0070678_100017953 Ga0070678_1000179532 196
456 3300005535 Ga0070684_100585478 Ga0070684_1005854782 196
457 3300005548 Ga0070665_100116082 Ga0070665_1001160822 196
458 3300005564 Ga0070664_100010417 Ga0070664_1000104171 196
459 3300005618 Ga0068864_100019747 Ga0068864_1000197479 196
460 3300006237 Ga0097621_100020867 Ga0097621_1000208673 196
461 3300009098 Ga0105245_10005676 Ga0105245_100056763 196
462 3300009177 Ga0105248_10129116 Ga0105248_101291161 196
463 3300009551 Ga0105238_10337524 Ga0105238_103375242 196
464 3300010375 Ga0105239_10174408 Ga0105239_101744081 196
465 3300011119 Ga0105246_10013246 Ga0105246_100132463 196
466 3300013296 Ga0157374_10013103 Ga0157374_1001310310 196
467 3300013306 Ga0163162_10012800 Ga0163162_100128002 196
468 3300013308 Ga0157375_10017001 Ga0157375_100170018 196
469 3300014325 Ga0163163_10006051 Ga0163163_1000605111 196
470 3300014968 Ga0157379_10232443 Ga0157379_102324432 196
471 3300014969 Ga0157376_10053451 Ga0157376_100534512 196
472 3300025909 Ga0207705_10329758 Ga0207705_103297581 196
473 3300025924 Ga0207694_10277853 Ga0207694_102778531 196
474 3300025927 Ga0207687_10005566 Ga0207687_100055666 196
475 3300025938 Ga0207704_10618273 Ga0207704_106182731 196
476 3300025939 Ga0207665_10942185 Ga0207665_109421851 196
477 3300025942 Ga0207689_10768290 Ga0207689_107682901 196
478 3300025945 Ga0207679_10210950 Ga0207679_102109503 196
479 3300026023 Ga0207677_10330932 Ga0207677_103309322 196
480 3300026035 Ga0207703_10341235 Ga0207703_103412352 196
481 3300026067 Ga0207678_10067680 Ga0207678_100676804 196
482 3300026095 Ga0207676_10210579 Ga0207676_102105792 196
483 3300026121 Ga0207683_10019612 Ga0207683_100196123 196
484 3300028379 Ga0268266_10454973 Ga0268266_104549731 196
485 3300039438 Ga0436360_0450373 Ga0436360_0450373_198_788 196
486 3300048903 Ga0496100_0098443 Ga0496100_0098443_767_1357 196
487 3300048904 Ga0496101_0002473 Ga0496101_0002473_6455_7045 196
488 3300048905 Ga0496102_0002704 Ga0496102_0002704_1836_2426 196
489 3300048906 Ga0496103_0029149 Ga0496103_0029149_2503_3093 196
490 3300048907 Ga0496104_0304310 Ga0496104_0304310_499_1089 196
491 3300048908 Ga0496105_0003117 Ga0496105_0003117_428_1018 196
492 3300048909 Ga0496106_0007049 Ga0496106_0007049_7616_8206 196
493 3300048910 Ga0496107_0011607 Ga0496107_0011607_12_602 196
494 3300048911 Ga0496108_0080000 Ga0496108_0080000_522_1112 196
495 3300048912 Ga0496109_0013738 Ga0496109_0013738_1391_1981 196
496 3300048913 Ga0496110_0041605 Ga0496110_0041605_2638_3228 196
497 3300048914 Ga0496111_0012718 Ga0496111_0012718_4834_5424 196
498 3300048915 Ga0496112_0055635 Ga0496112_0055635_1162_1752 196
499 3300048916 Ga0496113_0005880 Ga0496113_0005880_5383_5973 196
500 3300048917 Ga0496114_0088393 Ga0496114_0088393_1518_2108 196
501 3300048918 Ga0496115_0001912 Ga0496115_0001912_8703_9293 196
502 3300053083 Ga0495655_0006062 Ga0495655_0006062_1285_1875 196
503 iso_pu_bacteria 2513237098 2513674674 196
504 iso_pu_bacteria 2524023210 2524467408 196
505 iso_pu_bacteria 2602042107 2603858419 196
506 iso_pu_bacteria 2721755755 2723841545 196
507 iso_pu_bacteria 2791355199 2793079223 196
508 iso_pu_bacteria 2824704595 2824709436 196
509 iso_pu_bacteria 2824753945 2824757724 196
510 iso_pu_bacteria 2824763712 2824768764 196
511 iso_pu_bacteria 2876808645 2876813376 196
512 iso_pu_bacteria 2879110137 2879113071 196
513 iso_pu_bacteria 2889033259 2889035609 196
514 iso_pu_bacteria 2893066018 2893067269 196
515 iso_pu_bacteria 2904711408 2904713074 196
516 iso_pu_bacteria 2922361189 2922364088 196
517 iso_pu_bacteria 2922386360 2922392664 196
518 iso_pu_bacteria 8006964411 8006969267 196
519 iso_pu_bacteria 8056673599 8056675644 196
520 iso_pu_bacteria 8056681323 8056687490 196
521 3300044693 Ga0466961_0338894 Ga0466961_0338894_71_670 197
522 3300005434 Ga0070709_10052854 Ga0070709_100528543 198
523 3300025250 Ga0209026_1022660 Ga0209026_10226602 198
524 3300039437 Ga0436365_0229769 Ga0436365_0229769_345_941 198
525 3300039450 Ga0436363_0889462 Ga0436363_0889462_212_808 198
526 3300050494 nmdc:mga06z11_79657_c1 nmdc:mga06z11_79657_c1_541_1137 198
527 3300005328 Ga0070676_10654818 Ga0070676_106548181 199
528 3300005367 Ga0070667_100035791 Ga0070667_1000357912 199
529 3300005434 Ga0070709_10002152 Ga0070709_1000215210 199
530 3300005435 Ga0070714_100136937 Ga0070714_1001369372 199
531 3300005436 Ga0070713_100068135 Ga0070713_1000681354 199
532 3300005439 Ga0070711_100008601 Ga0070711_1000086016 199
533 3300005455 Ga0070663_100757148 Ga0070663_1007571481 199
534 3300005457 Ga0070662_100607869 Ga0070662_1006078691 199
535 3300005548 Ga0070665_100241790 Ga0070665_1002417902 199
536 3300006042 Ga0075368_10054207 Ga0075368_100542072 199
537 3300006048 Ga0075363_100022751 Ga0075363_1000227513 199
538 3300006051 Ga0075364_10509418 Ga0075364_105094181 199
539 3300006175 Ga0070712_100738047 Ga0070712_1007380471 199
540 3300006353 Ga0075370_10127918 Ga0075370_101279182 199
541 3300009551 Ga0105238_11051484 Ga0105238_110514841 199
542 3300009553 Ga0105249_10672139 Ga0105249_106721391 199
543 3300010375 Ga0105239_10121406 Ga0105239_101214063 199
544 3300013296 Ga0157374_11223248 Ga0157374_112232481 199
545 3300014326 Ga0157380_11451865 Ga0157380_114518651 199
546 3300014745 Ga0157377_10521161 Ga0157377_105211612 199
547 3300025261 Ga0209233_1001331 Ga0209233_100133112 199
548 3300025903 Ga0207680_10226086 Ga0207680_102260862 199
549 3300025904 Ga0207647_10063994 Ga0207647_100639942 199
550 3300025906 Ga0207699_10032501 Ga0207699_100325012 199
551 3300025908 Ga0207643_10095779 Ga0207643_100957792 199
552 3300025915 Ga0207693_10718047 Ga0207693_107180471 199
553 3300025916 Ga0207663_10018155 Ga0207663_100181552 199
554 3300025928 Ga0207700_10055022 Ga0207700_100550223 199
555 3300025929 Ga0207664_10055425 Ga0207664_100554253 199
556 3300025939 Ga0207665_10056372 Ga0207665_100563724 199
557 3300025961 Ga0207712_10742493 Ga0207712_107424932 199
558 3300026067 Ga0207678_10209662 Ga0207678_102096622 199
559 3300028379 Ga0268266_10365192 Ga0268266_103651922 199
560 3300031250 Ga0265331_10065109 Ga0265331_100651093 199
561 3300031456 Ga0307513_10109049 Ga0307513_101090492 199
562 3300033442 Ga0315911_1000013 Ga0315911_100001376 199
563 3300037853 Ga0436364_0584170 Ga0436364_0584170_792_1391 199
564 3300046513 Ga0495616_0237347 Ga0495616_0237347_177_776 199
565 3300046524 Ga0495648_0167663 Ga0495648_0167663_333_932 199
566 3300046660 Ga0495625_0237869 Ga0495625_0237869_184_783 199
567 3300046679 Ga0495623_0285788 Ga0495623_0285788_199_798 199
568 3300048924 Ga0496121_0217999 Ga0496121_0217999_567_1166 199
569 3300048929 Ga0496126_0019515 Ga0496126_0019515_3780_4382 199
570 3300048929 Ga0496126_0601363 Ga0496126_0601363_131_730 199
571 3300048929 Ga0496126_0831969 Ga0496126_0831969_70_669 199
572 3300050494 nmdc:mga06z11_244322_c1 nmdc:mga06z11_244322_c1_49_648 199
573 3300050496 nmdc:mga07m45_349677_c1 nmdc:mga07m45_349677_c1_28_630 199
574 3300002077 JGI24744J21845_10008176 JGI24744J21845_100081763 200
575 3300003320 rootH2_10177666 rootH2_101776661 200
576 3300003659 JGI25404J52841_10005893 JGI25404J52841_100058933 200
577 3300003659 JGI25404J52841_10060516 JGI25404J52841_100605161 200
578 3300005293 Ga0065715_10605089 Ga0065715_106050891 200
579 3300005330 Ga0070690_100015372 Ga0070690_1000153723 200
580 3300005331 Ga0070670_100350101 Ga0070670_1003501012 200
581 3300005333 Ga0070677_10046447 Ga0070677_100464472 200
582 3300005337 Ga0070682_100204035 Ga0070682_1002040351 200
583 3300005338 Ga0068868_100010934 Ga0068868_10001093410 200
584 3300005338 Ga0068868_100090493 Ga0068868_1000904932 200
585 3300005339 Ga0070660_100309716 Ga0070660_1003097162 200
586 3300005339 Ga0070660_100489293 Ga0070660_1004892932 200
587 3300005340 Ga0070689_100559000 Ga0070689_1005590001 200
588 3300005341 Ga0070691_10184863 Ga0070691_101848631 200
589 3300005345 Ga0070692_10286927 Ga0070692_102869272 200
590 3300005347 Ga0070668_100070058 Ga0070668_1000700583 200
591 3300005353 Ga0070669_100047316 Ga0070669_1000473163 200
592 3300005355 Ga0070671_100135054 Ga0070671_1001350543 200
593 3300005356 Ga0070674_100033537 Ga0070674_1000335374 200
594 3300005356 Ga0070674_100746559 Ga0070674_1007465591 200
595 3300005364 Ga0070673_100150385 Ga0070673_1001503851 200
596 3300005434 Ga0070709_10003010 Ga0070709_100030102 200
597 3300005434 Ga0070709_10004534 Ga0070709_100045341 200
598 3300005434 Ga0070709_10241787 Ga0070709_102417872 200
599 3300005434 Ga0070709_10664771 Ga0070709_106647711 200
600 3300005435 Ga0070714_100009098 Ga0070714_1000090982 200
601 3300005435 Ga0070714_100554126 Ga0070714_1005541261 200
602 3300005436 Ga0070713_100096732 Ga0070713_1000967322 200
603 3300005437 Ga0070710_10002056 Ga0070710_100020565 200
604 3300005438 Ga0070701_10158374 Ga0070701_101583741 200
605 3300005439 Ga0070711_100009395 Ga0070711_1000093956 200
606 3300005439 Ga0070711_100010179 Ga0070711_1000101796 200
607 3300005439 Ga0070711_100064420 Ga0070711_1000644202 200
608 3300005455 Ga0070663_100004161 Ga0070663_1000041612 200
609 3300005455 Ga0070663_100168450 Ga0070663_1001684503 200
610 3300005456 Ga0070678_100099100 Ga0070678_1000991002 200
611 3300005457 Ga0070662_100040728 Ga0070662_1000407283 200
612 3300005458 Ga0070681_10012313 Ga0070681_100123132 200
613 3300005459 Ga0068867_100134523 Ga0068867_1001345232 200
614 3300005459 Ga0068867_100187970 Ga0068867_1001879702 200
615 3300005459 Ga0068867_100399618 Ga0068867_1003996181 200
616 3300005466 Ga0070685_10085111 Ga0070685_100851112 200
617 3300005467 Ga0070706_100204182 Ga0070706_1002041822 200
618 3300005468 Ga0070707_100065530 Ga0070707_1000655303 200
619 3300005471 Ga0070698_100070963 Ga0070698_1000709633 200
620 3300005539 Ga0068853_100362518 Ga0068853_1003625182 200
621 3300005543 Ga0070672_100881879 Ga0070672_1008818791 200
622 3300005544 Ga0070686_100064805 Ga0070686_1000648053 200
623 3300005544 Ga0070686_100481364 Ga0070686_1004813642 200
624 3300005547 Ga0070693_100095118 Ga0070693_1000951182 200
625 3300005548 Ga0070665_100033743 Ga0070665_1000337433 200
626 3300005548 Ga0070665_100181177 Ga0070665_1001811772 200
627 3300005548 Ga0070665_100806783 Ga0070665_1008067831 200
628 3300005548 Ga0070665_101263356 Ga0070665_1012633562 200
629 3300005549 Ga0070704_100583121 Ga0070704_1005831211 200
630 3300005563 Ga0068855_100114371 Ga0068855_1001143712 200
631 3300005563 Ga0068855_100221768 Ga0068855_1002217684 200
632 3300005564 Ga0070664_100203031 Ga0070664_1002030313 200
633 3300005577 Ga0068857_100053898 Ga0068857_1000538983 200
634 3300005577 Ga0068857_100149604 Ga0068857_1001496042 200
635 3300005577 Ga0068857_100476910 Ga0068857_1004769102 200
636 3300005578 Ga0068854_101004209 Ga0068854_1010042091 200
637 3300005614 Ga0068856_100237588 Ga0068856_1002375882 200
638 3300005615 Ga0070702_100765750 Ga0070702_1007657501 200
639 3300005616 Ga0068852_100480421 Ga0068852_1004804212 200
640 3300005617 Ga0068859_100061189 Ga0068859_1000611895 200
641 3300005618 Ga0068864_100429224 Ga0068864_1004292242 200
642 3300005718 Ga0068866_10233459 Ga0068866_102334591 200
643 3300005719 Ga0068861_100063518 Ga0068861_1000635183 200
644 3300005842 Ga0068858_100027826 Ga0068858_1000278264 200
645 3300005842 Ga0068858_100194085 Ga0068858_1001940852 200
646 3300005842 Ga0068858_100365213 Ga0068858_1003652132 200
647 3300005843 Ga0068860_100001772 Ga0068860_1000017728 200
648 3300005843 Ga0068860_100056338 Ga0068860_1000563382 200
649 3300005843 Ga0068860_100453276 Ga0068860_1004532761 200
650 3300005843 Ga0068860_100733704 Ga0068860_1007337041 200
651 3300005983 Ga0081540_1013255 Ga0081540_10132555 200
652 3300005983 Ga0081540_1013296 Ga0081540_10132965 200
653 3300005983 Ga0081540_1022881 Ga0081540_10228812 200
654 3300005983 Ga0081540_1074578 Ga0081540_10745782 200
655 3300005983 Ga0081540_1184040 Ga0081540_11840401 200
656 3300006038 Ga0075365_10012035 Ga0075365_100120358 200
657 3300006038 Ga0075365_10173148 Ga0075365_101731482 200
658 3300006051 Ga0075364_10023981 Ga0075364_100239811 200
659 3300006051 Ga0075364_10040350 Ga0075364_100403503 200
660 3300006051 Ga0075364_10498845 Ga0075364_104988451 200
661 3300006163 Ga0070715_10010042 Ga0070715_100100421 200
662 3300006173 Ga0070716_100049904 Ga0070716_1000499042 200
663 3300006173 Ga0070716_100394929 Ga0070716_1003949291 200
664 3300006175 Ga0070712_100004273 Ga0070712_1000042736 200
665 3300006175 Ga0070712_100039649 Ga0070712_1000396495 200
666 3300006177 Ga0075362_10058983 Ga0075362_100589833 200
667 3300006177 Ga0075362_10137371 Ga0075362_101373711 200
668 3300006178 Ga0075367_10016372 Ga0075367_100163722 200
669 3300006178 Ga0075367_10038366 Ga0075367_100383662 200
670 3300006178 Ga0075367_10064515 Ga0075367_100645152 200
671 3300006186 Ga0075369_10021370 Ga0075369_100213701 200
672 3300006186 Ga0075369_10108583 Ga0075369_101085831 200
673 3300006195 Ga0075366_10143633 Ga0075366_101436332 200
674 3300006195 Ga0075366_10194637 Ga0075366_101946371 200
675 3300006237 Ga0097621_100549938 Ga0097621_1005499381 200
676 3300006237 Ga0097621_100568296 Ga0097621_1005682961 200
677 3300006358 Ga0068871_100039067 Ga0068871_1000390672 200
678 3300006871 Ga0075434_100040143 Ga0075434_1000401432 200
679 3300006881 Ga0068865_100041444 Ga0068865_1000414443 200
680 3300006914 Ga0075436_100174245 Ga0075436_1001742452 200
681 3300006931 Ga0097620_100061189 Ga0097620_1000611895 200
682 3300007788 Ga0099795_10176100 Ga0099795_101761001 200
683 3300009094 Ga0111539_10131772 Ga0111539_101317722 200
684 3300009094 Ga0111539_10887303 Ga0111539_108873032 200
685 3300009098 Ga0105245_10122484 Ga0105245_101224842 200
686 3300009098 Ga0105245_10153912 Ga0105245_101539122 200
687 3300009098 Ga0105245_11093473 Ga0105245_110934732 200
688 3300009147 Ga0114129_10571993 Ga0114129_105719932 200
689 3300009148 Ga0105243_10186686 Ga0105243_101866862 200
690 3300009148 Ga0105243_10728830 Ga0105243_107288301 200
691 3300009148 Ga0105243_11214354 Ga0105243_112143541 200
692 3300009174 Ga0105241_10063746 Ga0105241_100637463 200
693 3300009174 Ga0105241_10299583 Ga0105241_102995832 200
694 3300009176 Ga0105242_10286386 Ga0105242_102863862 200
695 3300009176 Ga0105242_10647988 Ga0105242_106479882 200
696 3300009177 Ga0105248_10046598 Ga0105248_100465982 200
697 3300009177 Ga0105248_10208416 Ga0105248_102084162 200
698 3300009177 Ga0105248_10424995 Ga0105248_104249952 200
699 3300009177 Ga0105248_10447973 Ga0105248_104479732 200
700 3300009545 Ga0105237_10026719 Ga0105237_100267198 200
701 3300009545 Ga0105237_10074544 Ga0105237_100745442 200
702 3300009545 Ga0105237_10077150 Ga0105237_100771506 200
703 3300009545 Ga0105237_10245815 Ga0105237_102458152 200
704 3300009545 Ga0105237_10800157 Ga0105237_108001571 200
705 3300009551 Ga0105238_10033085 Ga0105238_100330853 200
706 3300009551 Ga0105238_10145140 Ga0105238_101451402 200
707 3300009551 Ga0105238_10267196 Ga0105238_102671962 200
708 3300009553 Ga0105249_10621320 Ga0105249_106213201 200
709 3300010375 Ga0105239_10082296 Ga0105239_100822966 200
710 3300011119 Ga0105246_10244219 Ga0105246_102442192 200
711 3300013297 Ga0157378_10038376 Ga0157378_100383762 200
712 3300013297 Ga0157378_10264371 Ga0157378_102643712 200
713 3300013306 Ga0163162_10387892 Ga0163162_103878922 200
714 3300013308 Ga0157375_10275010 Ga0157375_102750102 200
715 3300013308 Ga0157375_10496016 Ga0157375_104960162 200
716 3300014325 Ga0163163_10094827 Ga0163163_100948272 200
717 3300014326 Ga0157380_10469602 Ga0157380_104696022 200
718 3300014969 Ga0157376_10099522 Ga0157376_100995223 200
719 3300017792 Ga0163161_10059368 Ga0163161_100593683 200
720 3300021377 Ga0213874_10062481 Ga0213874_100624811 200
721 3300021384 Ga0213876_10005917 Ga0213876_100059172 200
722 3300021384 Ga0213876_10060874 Ga0213876_100608742 200
723 3300025271 Ga0207666_1006949 Ga0207666_10069491 200
724 3300025295 Ga0209564_1009367 Ga0209564_10093673 200
725 3300025315 Ga0207697_10077680 Ga0207697_100776802 200
726 3300025893 Ga0207682_10211738 Ga0207682_102117381 200
727 3300025898 Ga0207692_10001232 Ga0207692_100012329 200
728 3300025899 Ga0207642_10065958 Ga0207642_100659582 200
729 3300025900 Ga0207710_10094049 Ga0207710_100940492 200
730 3300025903 Ga0207680_10435633 Ga0207680_104356331 200
731 3300025904 Ga0207647_10095016 Ga0207647_100950162 200
732 3300025904 Ga0207647_10230334 Ga0207647_102303342 200
733 3300025905 Ga0207685_10132066 Ga0207685_101320662 200
734 3300025906 Ga0207699_10000345 Ga0207699_100003456 200
735 3300025906 Ga0207699_10021261 Ga0207699_100212617 200
736 3300025906 Ga0207699_10120490 Ga0207699_101204902 200
737 3300025907 Ga0207645_10209066 Ga0207645_102090661 200
738 3300025910 Ga0207684_10133125 Ga0207684_101331252 200
739 3300025911 Ga0207654_10021375 Ga0207654_100213753 200
740 3300025912 Ga0207707_10073543 Ga0207707_100735432 200
741 3300025913 Ga0207695_10356734 Ga0207695_103567342 200
742 3300025914 Ga0207671_10022642 Ga0207671_100226421 200
743 3300025914 Ga0207671_10043437 Ga0207671_100434376 200
744 3300025914 Ga0207671_10082020 Ga0207671_100820202 200
745 3300025914 Ga0207671_10159264 Ga0207671_101592642 200
746 3300025915 Ga0207693_10006294 Ga0207693_100062946 200
747 3300025915 Ga0207693_10008437 Ga0207693_100084372 200
748 3300025915 Ga0207693_10177731 Ga0207693_101777312 200
749 3300025916 Ga0207663_10017753 Ga0207663_100177533 200
750 3300025916 Ga0207663_10019112 Ga0207663_100191125 200
751 3300025916 Ga0207663_10351355 Ga0207663_103513552 200
752 3300025918 Ga0207662_10419964 Ga0207662_104199642 200
753 3300025919 Ga0207657_10737779 Ga0207657_107377791 200
754 3300025921 Ga0207652_10224532 Ga0207652_102245322 200
755 3300025922 Ga0207646_10102577 Ga0207646_101025772 200
756 3300025922 Ga0207646_10528257 Ga0207646_105282571 200
757 3300025923 Ga0207681_10295812 Ga0207681_102958122 200
758 3300025924 Ga0207694_10107579 Ga0207694_101075792 200
759 3300025924 Ga0207694_10253843 Ga0207694_102538431 200
760 3300025924 Ga0207694_10400785 Ga0207694_104007852 200
761 3300025924 Ga0207694_10637512 Ga0207694_106375121 200
762 3300025925 Ga0207650_10323459 Ga0207650_103234592 200
763 3300025927 Ga0207687_10049015 Ga0207687_100490152 200
764 3300025927 Ga0207687_10824948 Ga0207687_108249481 200
765 3300025928 Ga0207700_10262504 Ga0207700_102625042 200
766 3300025929 Ga0207664_10090021 Ga0207664_100900212 200
767 3300025929 Ga0207664_10501039 Ga0207664_105010391 200
768 3300025929 Ga0207664_10535075 Ga0207664_105350751 200
769 3300025932 Ga0207690_10588144 Ga0207690_105881442 200
770 3300025933 Ga0207706_10010842 Ga0207706_100108427 200
771 3300025933 Ga0207706_10386475 Ga0207706_103864752 200
772 3300025934 Ga0207686_10042534 Ga0207686_100425341 200
773 3300025934 Ga0207686_10293076 Ga0207686_102930762 200
774 3300025935 Ga0207709_10073436 Ga0207709_100734362 200
775 3300025935 Ga0207709_10151555 Ga0207709_101515552 200
776 3300025936 Ga0207670_10542773 Ga0207670_105427731 200
777 3300025937 Ga0207669_10204873 Ga0207669_102048731 200
778 3300025938 Ga0207704_10110919 Ga0207704_101109192 200
779 3300025939 Ga0207665_10043799 Ga0207665_100437992 200
780 3300025939 Ga0207665_10068941 Ga0207665_100689412 200
781 3300025939 Ga0207665_10216238 Ga0207665_102162381 200
782 3300025939 Ga0207665_10314709 Ga0207665_103147092 200
783 3300025940 Ga0207691_10836975 Ga0207691_108369751 200
784 3300025941 Ga0207711_10151349 Ga0207711_101513491 200
785 3300025941 Ga0207711_10465628 Ga0207711_104656282 200
786 3300025941 Ga0207711_10713241 Ga0207711_107132412 200
787 3300025942 Ga0207689_10088583 Ga0207689_100885832 200
788 3300025944 Ga0207661_10861235 Ga0207661_108612351 200
789 3300025945 Ga0207679_10384975 Ga0207679_103849752 200
790 3300025949 Ga0207667_10351657 Ga0207667_103516572 200
791 3300025960 Ga0207651_10063503 Ga0207651_100635031 200
792 3300025961 Ga0207712_10044951 Ga0207712_100449513 200
793 3300025961 Ga0207712_10171223 Ga0207712_101712232 200
794 3300025972 Ga0207668_10130886 Ga0207668_101308862 200
795 3300025972 Ga0207668_10154986 Ga0207668_101549862 200
796 3300025986 Ga0207658_10224895 Ga0207658_102248952 200
797 3300026023 Ga0207677_10018303 Ga0207677_100183032 200
798 3300026023 Ga0207677_10268183 Ga0207677_102681832 200
799 3300026035 Ga0207703_10052106 Ga0207703_100521063 200
800 3300026035 Ga0207703_10148388 Ga0207703_101483882 200
801 3300026041 Ga0207639_10298966 Ga0207639_102989662 200
802 3300026041 Ga0207639_10491344 Ga0207639_104913441 200
803 3300026067 Ga0207678_10001940 Ga0207678_1000194016 200
804 3300026067 Ga0207678_10012005 Ga0207678_100120053 200
805 3300026067 Ga0207678_10186384 Ga0207678_101863842 200
806 3300026067 Ga0207678_10198597 Ga0207678_101985972 200
807 3300026088 Ga0207641_10042216 Ga0207641_100422163 200
808 3300026089 Ga0207648_10110568 Ga0207648_101105682 200
809 3300026089 Ga0207648_10302732 Ga0207648_103027322 200
810 3300026089 Ga0207648_10570318 Ga0207648_105703181 200
811 3300026095 Ga0207676_10611995 Ga0207676_106119951 200
812 3300026116 Ga0207674_10153177 Ga0207674_101531771 200
813 3300026116 Ga0207674_10330138 Ga0207674_103301382 200
814 3300026118 Ga0207675_100048321 Ga0207675_1000483212 200
815 3300026118 Ga0207675_100356086 Ga0207675_1003560862 200
816 3300026121 Ga0207683_10130160 Ga0207683_101301603 200
817 3300026142 Ga0207698_10110712 Ga0207698_101107122 200
818 3300026142 Ga0207698_10154808 Ga0207698_101548082 200
819 3300027907 Ga0207428_10134050 Ga0207428_101340501 200
820 3300028379 Ga0268266_10016785 Ga0268266_100167853 200
821 3300028379 Ga0268266_10056859 Ga0268266_100568593 200
822 3300028379 Ga0268266_10382738 Ga0268266_103827382 200
823 3300028379 Ga0268266_10674560 Ga0268266_106745601 200
824 3300028380 Ga0268265_10586375 Ga0268265_105863751 200
825 3300028381 Ga0268264_10000157 Ga0268264_1000015746 200
826 3300028381 Ga0268264_10156300 Ga0268264_101563002 200
827 3300028563 Ga0265319_1017504 Ga0265319_10175042 200
828 3300028653 Ga0265323_10001788 Ga0265323_100017887 200
829 3300028666 Ga0265336_10000420 Ga0265336_1000042012 200
830 3300028800 Ga0265338_10001474 Ga0265338_1000147419 200
831 3300030521 Ga0307511_10030423 Ga0307511_100304232 200
832 3300031249 Ga0265339_10040989 Ga0265339_100409891 200
833 3300031250 Ga0265331_10101792 Ga0265331_101017922 200
834 3300031507 Ga0307509_10480241 Ga0307509_104802411 200
835 3300031548 Ga0307408_100058562 Ga0307408_1000585622 200
836 3300031548 Ga0307408_100658463 Ga0307408_1006584632 200
837 3300031616 Ga0307508_10000002 Ga0307508_10000002135 200
838 3300031616 Ga0307508_10072490 Ga0307508_100724902 200
839 3300031711 Ga0265314_10026224 Ga0265314_100262241 200
840 3300031712 Ga0265342_10020736 Ga0265342_100207364 200
841 3300031730 Ga0307516_10083745 Ga0307516_100837454 200
842 3300031730 Ga0307516_10203445 Ga0307516_102034452 200
843 3300031824 Ga0307413_10659436 Ga0307413_106594362 200
844 3300031901 Ga0307406_10794098 Ga0307406_107940981 200
845 3300031911 Ga0307412_10417898 Ga0307412_104178981 200
846 3300033179 Ga0307507_10075390 Ga0307507_100753902 200
847 3300033180 Ga0307510_10137772 Ga0307510_101377722 200
848 3300033180 Ga0307510_10150276 Ga0307510_101502762 200
849 3300033544 Ga0316215_1000607 Ga0316215_10006072 200
850 3300035083 Ga0373926_0015030 Ga0373926_0015030_229_831 200
851 3300035089 Ga0373944_0042552 Ga0373944_0042552_51_653 200
852 3300035111 Ga0373923_0022309 Ga0373923_0022309_1782_2384 200
853 3300035112 Ga0373932_0091145 Ga0373932_0091145_276_878 200
854 3300035113 Ga0373936_0018178 Ga0373936_0018178_680_1282 200
855 3300035115 Ga0373941_0072388 Ga0373941_0072388_307_909 200
856 3300035116 Ga0373945_0055772 Ga0373945_0055772_744_1346 200
857 3300035116 Ga0373945_0079242 Ga0373945_0079242_524_1126 200
858 3300035117 Ga0373953_0017961 Ga0373953_0017961_835_1437 200
859 3300035118 Ga0373954_0071546 Ga0373954_0071546_847_1449 200
860 3300035170 Ga0373943_0030353 Ga0373943_0030353_272_874 200
861 3300035171 Ga0373946_0007562 Ga0373946_0007562_1361_1963 200
862 3300035171 Ga0373946_0020932 Ga0373946_0020932_1315_1917 200
863 3300035172 Ga0373955_0033718 Ga0373955_0033718_605_1207 200
864 3300035207 Ga0373942_0021003 Ga0373942_0021003_256_858 200
865 3300035241 Ga0373961_0218800 Ga0373961_0218800_65_667 200
866 3300035242 Ga0373962_0010144 Ga0373962_0010144_211_813 200
867 3300035242 Ga0373962_0063278 Ga0373962_0063278_468_1070 200
868 3300035410 Ga0373924_0009123 Ga0373924_0009123_1728_2330 200
869 3300035691 Ga0373931_0025140 Ga0373931_0025140_1259_1861 200
870 3300035692 Ga0373935_0161943 Ga0373935_0161943_42_722 200
871 3300035692 Ga0373935_0182935 Ga0373935_0182935_215_817 200
872 3300035695 Ga0373927_0010933 Ga0373927_0010933_2396_3076 200
873 3300035695 Ga0373927_0036122 Ga0373927_0036122_1767_2372 200
874 3300035695 Ga0373927_0089978 Ga0373927_0089978_263_865 200
875 3300035695 Ga0373927_0105643 Ga0373927_0105643_801_1403 200
876 3300035695 Ga0373927_0163931 Ga0373927_0163931_171_773 200
877 3300035724 Ga0373933_0000118 Ga0373933_0000118_21262_21864 200
878 3300035725 Ga0373947_0056369 Ga0373947_0056369_832_1434 200
879 3300035725 Ga0373947_0075893 Ga0373947_0075893_1269_1871 200
880 3300035725 Ga0373947_0214690 Ga0373947_0214690_77_757 200
881 3300037068 Ga0373925_0043981 Ga0373925_0043981_2615_3295 200
882 3300037068 Ga0373925_0196788 Ga0373925_0196788_77_679 200
883 3300037418 Ga0395900_0756953 Ga0395900_0756953_59_661 200
884 3300037466 Ga0395898_0043238 Ga0395898_0043238_2567_3169 200
885 3300037466 Ga0395898_0053299 Ga0395898_0053299_203_805 200
886 3300037466 Ga0395898_0114600 Ga0395898_0114600_1411_2013 200
887 3300037471 Ga0395905_0149916 Ga0395905_0149916_337_939 200
888 3300037471 Ga0395905_0247944 Ga0395905_0247944_334_936 200
889 3300037853 Ga0436364_0209479 Ga0436364_0209479_169_771 200
890 3300037853 Ga0436364_0393542 Ga0436364_0393542_658_1260 200
891 3300038443 Ga0395901_0129331 Ga0395901_0129331_886_1488 200
892 3300038443 Ga0395901_0170499 Ga0395901_0170499_144_746 200
893 3300039437 Ga0436365_0029847 Ga0436365_0029847_1344_1946 200
894 3300039437 Ga0436365_1609765 Ga0436365_1609765_6747_7349 200
895 3300039438 Ga0436360_0760184 Ga0436360_0760184_36_638 200
896 3300039450 Ga0436363_0152156 Ga0436363_0152156_79_681 200
897 3300039450 Ga0436363_0766255 Ga0436363_0766255_985_1587 200
898 3300041459 Ga0451800_0066149 Ga0451800_0066149_283_885 200
899 3300044656 Ga0466969_0151527 Ga0466969_0151527_290_892 200
900 3300044765 Ga0466970_0088075 Ga0466970_0088075_395_997 200
901 3300045049 Ga0466959_0073082 Ga0466959_0073082_1410_2012 200
902 3300045049 Ga0466959_0082582 Ga0466959_0082582_1626_2228 200
903 3300045976 Ga0466967_0079574 Ga0466967_0079574_59_664 200
904 3300046454 Ga0495592_0046637 Ga0495592_0046637_672_1274 200
905 3300046455 Ga0495603_0337348 Ga0495603_0337348_200_802 200
906 3300046457 Ga0495590_0109499 Ga0495590_0109499_259_864 200
907 3300046459 Ga0495629_0041783 Ga0495629_0041783_657_1262 200
908 3300046462 Ga0495651_0203289 Ga0495651_0203289_85_687 200
909 3300046472 Ga0495580_0012056 Ga0495580_0012056_1391_1993 200
910 3300046472 Ga0495580_0631164 Ga0495580_0631164_94_696 200
911 3300046474 Ga0495605_0056857 Ga0495605_0056857_1165_1770 200
912 3300046477 Ga0495664_0014728 Ga0495664_0014728_1383_1985 200
913 3300046477 Ga0495664_0020681 Ga0495664_0020681_541_1143 200
914 3300046491 Ga0495584_0171909 Ga0495584_0171909_414_1016 200
915 3300046500 Ga0495596_0031573 Ga0495596_0031573_830_1435 200
916 3300046501 Ga0495607_0059800 Ga0495607_0059800_510_1115 200
917 3300046507 Ga0495606_0043701 Ga0495606_0043701_1017_1622 200
918 3300046507 Ga0495606_0087085 Ga0495606_0087085_827_1429 200
919 3300046513 Ga0495616_0037073 Ga0495616_0037073_781_1386 200
920 3300046514 Ga0495618_0222517 Ga0495618_0222517_538_1140 200
921 3300046515 Ga0495620_0007418 Ga0495620_0007418_4585_5190 200
922 3300046515 Ga0495620_0139601 Ga0495620_0139601_147_749 200
923 3300046517 Ga0495630_0058135 Ga0495630_0058135_2143_2745 200
924 3300046517 Ga0495630_0142692 Ga0495630_0142692_662_1264 200
925 3300046519 Ga0495632_0033914 Ga0495632_0033914_904_1509 200
926 3300046520 Ga0495637_0021828 Ga0495637_0021828_674_1279 200
927 3300046524 Ga0495648_0031929 Ga0495648_0031929_1645_2250 200
928 3300046530 Ga0495654_0011184 Ga0495654_0011184_4127_4732 200
929 3300046531 Ga0495665_0034243 Ga0495665_0034243_464_1066 200
930 3300046533 Ga0495640_0040675 Ga0495640_0040675_1782_2384 200
931 3300046535 Ga0495586_0296150 Ga0495586_0296150_292_894 200
932 3300046538 Ga0495609_0043451 Ga0495609_0043451_549_1154 200
933 3300046542 Ga0495597_0043566 Ga0495597_0043566_463_1068 200
934 3300046543 Ga0495645_0293170 Ga0495645_0293170_237_839 200
935 3300046557 Ga0495622_0004148 Ga0495622_0004148_4083_4688 200
936 3300046557 Ga0495622_0026065 Ga0495622_0026065_730_1410 200
937 3300046559 Ga0495667_0089365 Ga0495667_0089365_331_933 200
938 3300046615 Ga0495656_0089773 Ga0495656_0089773_81_683 200
939 3300046642 Ga0495634_0114548 Ga0495634_0114548_928_1530 200
940 3300046660 Ga0495625_0317425 Ga0495625_0317425_122_724 200
941 3300046660 Ga0495625_0365479 Ga0495625_0365479_39_644 200
942 3300046663 Ga0495635_0145510 Ga0495635_0145510_812_1414 200
943 3300046674 Ga0495588_0026572 Ga0495588_0026572_1575_2180 200
944 3300046674 Ga0495588_0127581 Ga0495588_0127581_381_983 200
945 3300046678 Ga0495599_0451552 Ga0495599_0451552_83_685 200
946 3300046680 Ga0495646_0035772 Ga0495646_0035772_1217_1819 200
947 3300046681 Ga0495647_0004481 Ga0495647_0004481_3364_3966 200
948 3300046683 Ga0495658_0093310 Ga0495658_0093310_377_979 200
949 3300046684 Ga0495669_0092929 Ga0495669_0092929_539_1141 200
950 3300046690 Ga0495624_0163877 Ga0495624_0163877_114_716 200
951 3300046690 Ga0495624_0257732 Ga0495624_0257732_35_637 200
952 3300046691 Ga0495670_0085016 Ga0495670_0085016_156_761 200
953 3300046694 Ga0495649_0179144 Ga0495649_0179144_229_831 200
954 3300046794 Ga0495589_0258350 Ga0495589_0258350_39_641 200
955 3300046810 Ga0495660_0021236 Ga0495660_0021236_1563_2168 200
956 3300047315 Ga0495581_0057962 Ga0495581_0057962_1614_2216 200
957 3300047315 Ga0495581_0097094 Ga0495581_0097094_413_1015 200
958 3300047315 Ga0495581_0105543 Ga0495581_0105543_917_1519 200
959 3300047317 Ga0495604_0076221 Ga0495604_0076221_1483_2085 200
960 3300047317 Ga0495604_0218672 Ga0495604_0218672_337_939 200
961 3300047319 Ga0495674_0017831 Ga0495674_0017831_5266_5868 200
962 3300047319 Ga0495674_0748515 Ga0495674_0748515_140_742 200
963 3300047320 Ga0495672_0161240 Ga0495672_0161240_159_761 200
964 3300047321 Ga0495676_0316600 Ga0495676_0316600_301_903 200
965 3300047445 Ga0495677_0010566 Ga0495677_0010566_285_887 200
966 3300047472 Ga0495686_0073863 Ga0495686_0073863_689_1294 200
967 3300047673 Ga0495593_0075061 Ga0495593_0075061_427_1029 200
968 3300048091 Ga0495626_0023882 Ga0495626_0023882_1627_2232 200
969 3300048903 Ga0496100_0095050 Ga0496100_0095050_246_848 200
970 3300048904 Ga0496101_0074665 Ga0496101_0074665_1633_2235 200
971 3300048904 Ga0496101_0114415 Ga0496101_0114415_413_1015 200
972 3300048904 Ga0496101_0228653 Ga0496101_0228653_766_1368 200
973 3300048904 Ga0496101_0390429 Ga0496101_0390429_322_924 200
974 3300048905 Ga0496102_0023114 Ga0496102_0023114_2620_3222 200
975 3300048905 Ga0496102_0061798 Ga0496102_0061798_1579_2181 200
976 3300048905 Ga0496102_0136236 Ga0496102_0136236_742_1344 200
977 3300048905 Ga0496102_0178336 Ga0496102_0178336_1010_1612 200
978 3300048905 Ga0496102_0214900 Ga0496102_0214900_53_655 200
979 3300048905 Ga0496102_0407694 Ga0496102_0407694_15_617 200
980 3300048905 Ga0496102_0642440 Ga0496102_0642440_85_690 200
981 3300048906 Ga0496103_0322189 Ga0496103_0322189_127_729 200
982 3300048907 Ga0496104_0348134 Ga0496104_0348134_200_802 200
983 3300048908 Ga0496105_0005494 Ga0496105_0005494_7540_8142 200
984 3300048909 Ga0496106_0086129 Ga0496106_0086129_236_838 200
985 3300048909 Ga0496106_0263196 Ga0496106_0263196_163_765 200
986 3300048909 Ga0496106_0492590 Ga0496106_0492590_52_654 200
987 3300048910 Ga0496107_0013421 Ga0496107_0013421_1452_2054 200
988 3300048910 Ga0496107_0249969 Ga0496107_0249969_697_1299 200
989 3300048911 Ga0496108_0066705 Ga0496108_0066705_1614_2216 200
990 3300048911 Ga0496108_0319669 Ga0496108_0319669_401_1003 200
991 3300048912 Ga0496109_0056868 Ga0496109_0056868_2341_2943 200
992 3300048912 Ga0496109_0166750 Ga0496109_0166750_846_1448 200
993 3300048912 Ga0496109_0248378 Ga0496109_0248378_477_1079 200
994 3300048913 Ga0496110_0015748 Ga0496110_0015748_2685_3287 200
995 3300048913 Ga0496110_0620550 Ga0496110_0620550_175_777 200
996 3300048914 Ga0496111_0022680 Ga0496111_0022680_1153_1755 200
997 3300048914 Ga0496111_0401221 Ga0496111_0401221_95_697 200
998 3300048915 Ga0496112_0082929 Ga0496112_0082929_2169_2771 200
999 3300048915 Ga0496112_0251085 Ga0496112_0251085_69_671 200
1000 3300048915 Ga0496112_0440814 Ga0496112_0440814_200_802 200
1001 3300048916 Ga0496113_0034908 Ga0496113_0034908_2732_3334 200
1002 3300048916 Ga0496113_0330271 Ga0496113_0330271_299_904 200
1003 3300048917 Ga0496114_0070083 Ga0496114_0070083_2003_2605 200
1004 3300048917 Ga0496114_0111528 Ga0496114_0111528_323_925 200
1005 3300048918 Ga0496115_0011792 Ga0496115_0011792_2564_3166 200
1006 3300048918 Ga0496115_0210366 Ga0496115_0210366_80_682 200
1007 3300048919 Ga0496116_0003347 Ga0496116_0003347_11551_12156 200
1008 3300048920 Ga0496117_0090473 Ga0496117_0090473_1289_1894 200
1009 3300048921 Ga0496118_0050976 Ga0496118_0050976_276_881 200
1010 3300048922 Ga0496119_0038956 Ga0496119_0038956_462_1067 200
1011 3300048924 Ga0496121_0053237 Ga0496121_0053237_2450_3052 200
1012 3300048924 Ga0496121_0116392 Ga0496121_0116392_360_965 200
1013 3300048924 Ga0496121_0175568 Ga0496121_0175568_339_941 200
1014 3300048924 Ga0496121_0205107 Ga0496121_0205107_461_1063 200
1015 3300048924 Ga0496121_0214211 Ga0496121_0214211_230_838 200
1016 3300048925 Ga0496122_0039972 Ga0496122_0039972_3003_3605 200
1017 3300048925 Ga0496122_0184717 Ga0496122_0184717_139_744 200
1018 3300048926 Ga0496123_0219349 Ga0496123_0219349_130_735 200
1019 3300048927 Ga0496124_0077272 Ga0496124_0077272_377_982 200
1020 3300048927 Ga0496124_0407012 Ga0496124_0407012_232_837 200
1021 3300048928 Ga0496125_0003766 Ga0496125_0003766_4007_4612 200
1022 3300048928 Ga0496125_0052271 Ga0496125_0052271_2672_3277 200
1023 3300048929 Ga0496126_0016873 Ga0496126_0016873_2855_3457 200
1024 3300048929 Ga0496126_0065690 Ga0496126_0065690_988_1590 200
1025 3300048929 Ga0496126_0401718 Ga0496126_0401718_118_720 200
1026 3300049583 Ga0501067_0186178 Ga0501067_0186178_400_1002 200
1027 3300049585 Ga0501069_0070442 Ga0501069_0070442_891_1493 200
1028 3300050489 nmdc:mga03683_126265_c1 nmdc:mga03683_126265_c1_466_1068 200
1029 3300050490 nmdc:mga03n38_206422_c1 nmdc:mga03n38_206422_c1_255_860 200
1030 3300050490 nmdc:mga03n38_54485_c2 nmdc:mga03n38_54485_c2_583_1185 200
1031 3300050491 nmdc:mga00v17_106581_c1 nmdc:mga00v17_106581_c1_52_654 200
1032 3300050491 nmdc:mga00v17_1725_c1 nmdc:mga00v17_1725_c1_10546_11151 200
1033 3300050492 nmdc:mga0yw44_245180_c1 nmdc:mga0yw44_245180_c1_213_818 200
1034 3300050493 nmdc:mga0k408_149525_c1 nmdc:mga0k408_149525_c1_613_1215 200
1035 3300050494 nmdc:mga06z11_81027_c1 nmdc:mga06z11_81027_c1_813_1415 200
1036 3300050494 nmdc:mga06z11_93263_c1 nmdc:mga06z11_93263_c1_648_1253 200
1037 3300050496 nmdc:mga07m45_62754_c1 nmdc:mga07m45_62754_c1_232_834 200
1038 3300050511 nmdc:mga08y16_78647_c1 nmdc:mga08y16_78647_c1_919_1521 200
1039 3300050512 nmdc:mga0n895_263504_c1 nmdc:mga0n895_263504_c1_994_1596 200
1040 3300050512 nmdc:mga0n895_38171_c1 nmdc:mga0n895_38171_c1_3356_4021 200
1041 3300050513 nmdc:mga0rr50_355652_c1 nmdc:mga0rr50_355652_c1_498_1100 200
1042 3300050514 nmdc:mga08x19_70623_c1 nmdc:mga08x19_70623_c1_592_1257 200
1043 3300050516 nmdc:mga0sz30_41661_c1 nmdc:mga0sz30_41661_c1_489_1094 200
1044 3300053077 Ga0495601_0016608 Ga0495601_0016608_3447_4049 200
1045 3300053078 Ga0495612_0052700 Ga0495612_0052700_873_1475 200
1046 3300053080 Ga0500635_0011050 Ga0500635_0011050_839_1519 200
1047 3300053084 Ga0495595_0071265 Ga0495595_0071265_233_835 200
1048 3300053085 Ga0495619_0473933 Ga0495619_0473933_94_696 200
1049 3300053086 Ga0500578_0085342 Ga0500578_0085342_264_869 200
1050 3300053087 Ga0500643_022492 Ga0500643_022492_472_1077 200
1051 3300053089 Ga0500581_085417 Ga0500581_085417_434_1039 200
1052 3300053090 Ga0500646_0008172 Ga0500646_0008172_1297_1902 200
1053 3300053091 Ga0500647_0285023 Ga0500647_0285023_22_624 200
1054 3300053093 Ga0500651_0015639 Ga0500651_0015639_3420_4025 200
1055 3300053093 Ga0500651_0049749 Ga0500651_0049749_1773_2378 200
1056 3300053094 Ga0500566_0000243 Ga0500566_0000243_9438_10040 200
1057 3300053094 Ga0500566_0006814 Ga0500566_0006814_2699_3304 200
1058 3300053095 Ga0500640_011728 Ga0500640_011728_414_1016 200
1059 3300053096 Ga0500641_0003009 Ga0500641_0003009_654_1259 200
1060 3300053103 Ga0500555_027690 Ga0500555_027690_513_1118 200
1061 3300053104 Ga0500556_0000006 Ga0500556_0000006_430231_430836 200
1062 3300053109 Ga0500569_038305 Ga0500569_038305_687_1292 200
1063 3300053111 Ga0500572_002477 Ga0500572_002477_2996_3598 200
1064 3300053111 Ga0500572_003577 Ga0500572_003577_1662_2264 200
1065 3300053116 Ga0500592_000518 Ga0500592_000518_4823_5428 200
1066 3300053117 Ga0500593_063406 Ga0500593_063406_418_1023 200
1067 3300053119 Ga0500595_015071 Ga0500595_015071_918_1598 200
1068 3300053122 Ga0500608_019283 Ga0500608_019283_978_1583 200
1069 3300053122 Ga0500608_024237 Ga0500608_024237_915_1517 200
1070 3300053125 Ga0500618_010251 Ga0500618_010251_1171_1776 200
1071 3300053130 Ga0500642_0000004 Ga0500642_0000004_23152_23757 200
1072 3300053131 Ga0500652_008629 Ga0500652_008629_18_623 200
1073 3300053134 Ga0500658_0051650 Ga0500658_0051650_708_1313 200
1074 3300053136 Ga0500559_0000276 Ga0500559_0000276_28241_28846 200
1075 3300053136 Ga0500559_0000660 Ga0500559_0000660_20858_21460 200
1076 3300053136 Ga0500559_0049006 Ga0500559_0049006_1085_1687 200
1077 3300053139 Ga0500568_0003467 Ga0500568_0003467_711_1316 200
1078 3300053145 Ga0500586_001407 Ga0500586_001407_4068_4673 200
1079 3300053147 Ga0500589_155532 Ga0500589_155532_170_775 200
1080 3300053150 Ga0500603_002895 Ga0500603_002895_974_1576 200
1081 3300053150 Ga0500603_007630 Ga0500603_007630_764_1444 200
1082 3300053153 Ga0500616_0000022 Ga0500616_0000022_436675_437280 200
1083 3300053156 Ga0500622_0002509 Ga0500622_0002509_2387_2992 200
1084 3300053159 Ga0500630_042577 Ga0500630_042577_882_1484 200
1085 3300053160 Ga0500633_0007947 Ga0500633_0007947_287_892 200
1086 3300053163 Ga0500639_011635 Ga0500639_011635_1578_2180 200
1087 3300053163 Ga0500639_016672 Ga0500639_016672_1690_2292 200
1088 3300053177 Ga0500636_0000766 Ga0500636_0000766_2809_3414 200
1089 3300053177 Ga0500636_0180298 Ga0500636_0180298_12_614 200
1090 3300053177 Ga0500636_0374509 Ga0500636_0374509_54_656 200
1091 3300053178 Ga0500637_0016388 Ga0500637_0016388_2614_3219 200
1092 3300053178 Ga0500637_0203738 Ga0500637_0203738_414_1016 200
1093 3300053178 Ga0500637_0446954 Ga0500637_0446954_34_636 200
1094 3300053724 Ga0500570_021281 Ga0500570_021281_2259_2864 200
1095 3300053730 Ga0500645_023467 Ga0500645_023467_1130_1735 200
1096 3300053735 Ga0500596_001464 Ga0500596_001464_333_935 200
1097 3300053735 Ga0500596_003829 Ga0500596_003829_1689_2291 200
1098 3300053737 Ga0500601_001777 Ga0500601_001777_994_1596 200
1099 3300003203 JGI25406J46586_10000544 JGI25406J46586_1000054410 201
1100 3300005327 Ga0070658_10027906 Ga0070658_100279062 201
1101 3300005336 Ga0070680_100504353 Ga0070680_1005043532 201
1102 3300005339 Ga0070660_100001887 Ga0070660_1000018874 201
1103 3300005341 Ga0070691_10017022 Ga0070691_100170222 201
1104 3300005344 Ga0070661_100085682 Ga0070661_1000856822 201
1105 3300005455 Ga0070663_100546548 Ga0070663_1005465481 201
1106 3300005458 Ga0070681_10598941 Ga0070681_105989411 201
1107 3300005530 Ga0070679_100170516 Ga0070679_1001705162 201
1108 3300005535 Ga0070684_100029211 Ga0070684_1000292116 201
1109 3300005539 Ga0068853_100001962 Ga0068853_10000196211 201
1110 3300005539 Ga0068853_100571017 Ga0068853_1005710171 201
1111 3300005563 Ga0068855_100061111 Ga0068855_1000611112 201
1112 3300005577 Ga0068857_100243626 Ga0068857_1002436262 201
1113 3300005985 Ga0081539_10000064 Ga0081539_10000064143 201
1114 3300006163 Ga0070715_10386874 Ga0070715_103868741 201
1115 3300009098 Ga0105245_10428517 Ga0105245_104285171 201
1116 3300009545 Ga0105237_10006051 Ga0105237_1000605111 201
1117 3300009551 Ga0105238_10014911 Ga0105238_1001491110 201
1118 3300013105 Ga0157369_10213203 Ga0157369_102132032 201
1119 3300025321 Ga0207656_10035153 Ga0207656_100351533 201
1120 3300025912 Ga0207707_10005686 Ga0207707_100056862 201
1121 3300025913 Ga0207695_10149702 Ga0207695_101497023 201
1122 3300025914 Ga0207671_10049571 Ga0207671_100495715 201
1123 3300025917 Ga0207660_10002576 Ga0207660_100025762 201
1124 3300025919 Ga0207657_10008426 Ga0207657_100084268 201
1125 3300025920 Ga0207649_10275874 Ga0207649_102758742 201
1126 3300025921 Ga0207652_10077264 Ga0207652_100772643 201
1127 3300025924 Ga0207694_10044974 Ga0207694_100449741 201
1128 3300025949 Ga0207667_10010444 Ga0207667_100104442 201
1129 3300026041 Ga0207639_10003564 Ga0207639_100035642 201
1130 3300026067 Ga0207678_10500536 Ga0207678_105005361 201
1131 3300026142 Ga0207698_10273543 Ga0207698_102735432 201
1132 3300031235 Ga0265330_10004307 Ga0265330_100043074 201
1133 3300031235 Ga0265330_10026213 Ga0265330_100262132 201
1134 3300031241 Ga0265325_10008214 Ga0265325_100082141 201
1135 3300031247 Ga0265340_10002797 Ga0265340_100027975 201
1136 3300031249 Ga0265339_10032327 Ga0265339_100323272 201
1137 3300031250 Ga0265331_10019262 Ga0265331_100192622 201
1138 3300031250 Ga0265331_10170726 Ga0265331_101707261 201
1139 3300031712 Ga0265342_10025879 Ga0265342_100258792 201
1140 3300041462 Ga0451806_863455 Ga0451806_863455_240_845 201
1141 3300046507 Ga0495606_0005275 Ga0495606_0005275_2399_3007 201
1142 3300046524 Ga0495648_0027801 Ga0495648_0027801_2337_2945 201
1143 3300048915 Ga0496112_0000020 Ga0496112_0000020_153896_154504 201
1144 3300048924 Ga0496121_0000270 Ga0496121_0000270_95581_96186 201
1145 3300048929 Ga0496126_0044316 Ga0496126_0044316_3442_4047 201
1146 3300050514 nmdc:mga08x19_455809_c1 nmdc:mga08x19_455809_c1_163_768 201
1147 3300053119 Ga0500595_007669 Ga0500595_007669_3126_3731 201
1148 3300053139 Ga0500568_0041456 Ga0500568_0041456_709_1314 201
1149 3300053153 Ga0500616_0000127 Ga0500616_0000127_2650_3264 201
1150 3300005327 Ga0070658_10070700 Ga0070658_100707002 202
1151 3300005439 Ga0070711_100125060 Ga0070711_1001250602 202
1152 3300005455 Ga0070663_100107587 Ga0070663_1001075872 202
1153 3300005471 Ga0070698_101119659 Ga0070698_1011196591 202
1154 3300005536 Ga0070697_100385969 Ga0070697_1003859692 202
1155 3300005563 Ga0068855_100217393 Ga0068855_1002173932 202
1156 3300005614 Ga0068856_100628127 Ga0068856_1006281271 202
1157 3300006175 Ga0070712_100186524 Ga0070712_1001865242 202
1158 3300007788 Ga0099795_10017026 Ga0099795_100170263 202
1159 3300009093 Ga0105240_10148867 Ga0105240_101488672 202
1160 3300009551 Ga0105238_10442227 Ga0105238_104422271 202
1161 3300022467 Ga0224712_10027584 Ga0224712_100275842 202
1162 3300025909 Ga0207705_10660806 Ga0207705_106608061 202
1163 3300025913 Ga0207695_10270242 Ga0207695_102702422 202
1164 3300025915 Ga0207693_10177757 Ga0207693_101777572 202
1165 3300025916 Ga0207663_10298196 Ga0207663_102981962 202
1166 3300025922 Ga0207646_10042560 Ga0207646_100425601 202
1167 3300025949 Ga0207667_10237612 Ga0207667_102376122 202
1168 3300025981 Ga0207640_10103485 Ga0207640_101034851 202
1169 3300026023 Ga0207677_10358701 Ga0207677_103587012 202
1170 3300026067 Ga0207678_10021243 Ga0207678_100212433 202
1171 3300026067 Ga0207678_10147102 Ga0207678_101471022 202
1172 3300028573 Ga0265334_10048114 Ga0265334_100481143 202
1173 3300032126 Ga0307415_100266761 Ga0307415_1002667612 202
1174 3300035083 Ga0373926_0061857 Ga0373926_0061857_399_1007 202
1175 3300035086 Ga0373934_0025321 Ga0373934_0025321_913_1521 202
1176 3300035086 Ga0373934_0045393 Ga0373934_0045393_183_791 202
1177 3300035086 Ga0373934_0076714 Ga0373934_0076714_14_622 202
1178 3300035111 Ga0373923_0004941 Ga0373923_0004941_3538_4146 202
1179 3300035111 Ga0373923_0007011 Ga0373923_0007011_1033_1641 202
1180 3300035111 Ga0373923_0086521 Ga0373923_0086521_711_1319 202
1181 3300035113 Ga0373936_0027566 Ga0373936_0027566_1602_2210 202
1182 3300035117 Ga0373953_0000285 Ga0373953_0000285_6186_6794 202
1183 3300035117 Ga0373953_0007996 Ga0373953_0007996_767_1375 202
1184 3300035117 Ga0373953_0262520 Ga0373953_0262520_123_731 202
1185 3300035118 Ga0373954_0001351 Ga0373954_0001351_6099_6707 202
1186 3300035118 Ga0373954_0159753 Ga0373954_0159753_49_657 202
1187 3300035119 Ga0373956_0010175 Ga0373956_0010175_2668_3276 202
1188 3300035119 Ga0373956_0034088 Ga0373956_0034088_436_1044 202
1189 3300035170 Ga0373943_0004586 Ga0373943_0004586_4272_4880 202
1190 3300035171 Ga0373946_0003778 Ga0373946_0003778_267_875 202
1191 3300035171 Ga0373946_0038771 Ga0373946_0038771_458_1066 202
1192 3300035172 Ga0373955_0000636 Ga0373955_0000636_8389_8997 202
1193 3300035172 Ga0373955_0040531 Ga0373955_0040531_452_1060 202
1194 3300035172 Ga0373955_0044277 Ga0373955_0044277_208_816 202
1195 3300035172 Ga0373955_0248815 Ga0373955_0248815_409_1017 202
1196 3300035172 Ga0373955_0325075 Ga0373955_0325075_190_798 202
1197 3300035410 Ga0373924_0007304 Ga0373924_0007304_181_789 202
1198 3300035410 Ga0373924_0011229 Ga0373924_0011229_1075_1683 202
1199 3300035692 Ga0373935_0024695 Ga0373935_0024695_1156_1764 202
1200 3300035692 Ga0373935_0255286 Ga0373935_0255286_475_1083 202
1201 3300035692 Ga0373935_0633926 Ga0373935_0633926_76_684 202
1202 3300035695 Ga0373927_0003270 Ga0373927_0003270_4086_4694 202
1203 3300035695 Ga0373927_0017399 Ga0373927_0017399_61_669 202
1204 3300035695 Ga0373927_0023206 Ga0373927_0023206_756_1364 202
1205 3300035724 Ga0373933_0001611 Ga0373933_0001611_10950_11558 202
1206 3300035724 Ga0373933_0139004 Ga0373933_0139004_668_1276 202
1207 3300035724 Ga0373933_0140542 Ga0373933_0140542_236_844 202
1208 3300035725 Ga0373947_0000402 Ga0373947_0000402_11915_12523 202
1209 3300035725 Ga0373947_0056172 Ga0373947_0056172_211_819 202
1210 3300035725 Ga0373947_0187311 Ga0373947_0187311_166_774 202
1211 3300036401 Ga0373937_0011438 Ga0373937_0011438_6548_7156 202
1212 3300036401 Ga0373937_0030077 Ga0373937_0030077_4225_4833 202
1213 3300036401 Ga0373937_0032584 Ga0373937_0032584_1776_2384 202
1214 3300036401 Ga0373937_0096145 Ga0373937_0096145_1727_2335 202
1215 3300036401 Ga0373937_0141108 Ga0373937_0141108_985_1593 202
1216 3300037068 Ga0373925_0005137 Ga0373925_0005137_553_1161 202
1217 3300037068 Ga0373925_0089135 Ga0373925_0089135_885_1493 202
1218 3300037068 Ga0373925_0538312 Ga0373925_0538312_336_944 202
1219 3300041509 Ga0451843_1567046 Ga0451843_1567046_85_696 202
1220 3300044842 Ga0466957_0020746 Ga0466957_0020746_260_868 202
1221 3300045976 Ga0466967_0194934 Ga0466967_0194934_739_1350 202
1222 3300046454 Ga0495592_0001817 Ga0495592_0001817_4567_5175 202
1223 3300046454 Ga0495592_0084299 Ga0495592_0084299_1231_1839 202
1224 3300046455 Ga0495603_0000826 Ga0495603_0000826_16869_17477 202
1225 3300046455 Ga0495603_0007445 Ga0495603_0007445_5108_5716 202
1226 3300046459 Ga0495629_0000337 Ga0495629_0000337_33434_34042 202
1227 3300046459 Ga0495629_0000587 Ga0495629_0000587_16820_17428 202
1228 3300046459 Ga0495629_0111406 Ga0495629_0111406_799_1407 202
1229 3300046462 Ga0495651_0006522 Ga0495651_0006522_6660_7268 202
1230 3300046462 Ga0495651_0047122 Ga0495651_0047122_40_648 202
1231 3300046462 Ga0495651_0088850 Ga0495651_0088850_132_740 202
1232 3300046462 Ga0495651_0345161 Ga0495651_0345161_110_718 202
1233 3300046463 Ga0495653_0001248 Ga0495653_0001248_5723_6331 202
1234 3300046463 Ga0495653_0223262 Ga0495653_0223262_225_833 202
1235 3300046472 Ga0495580_0002634 Ga0495580_0002634_3911_4519 202
1236 3300046472 Ga0495580_0514119 Ga0495580_0514119_140_748 202
1237 3300046473 Ga0495582_0000018 Ga0495582_0000018_71115_71723 202
1238 3300046475 Ga0495639_0000272 Ga0495639_0000272_3156_3764 202
1239 3300046476 Ga0495662_0000023 Ga0495662_0000023_49911_50519 202
1240 3300046477 Ga0495664_0205258 Ga0495664_0205258_247_855 202
1241 3300046477 Ga0495664_0236849 Ga0495664_0236849_342_950 202
1242 3300046499 Ga0495594_0000155 Ga0495594_0000155_15212_15820 202
1243 3300046499 Ga0495594_0141619 Ga0495594_0141619_556_1164 202
1244 3300046511 Ga0495608_0007746 Ga0495608_0007746_6773_7381 202
1245 3300046511 Ga0495608_0153164 Ga0495608_0153164_76_684 202
1246 3300046514 Ga0495618_0071100 Ga0495618_0071100_1444_2052 202
1247 3300046514 Ga0495618_0094263 Ga0495618_0094263_698_1306 202
1248 3300046514 Ga0495618_0116963 Ga0495618_0116963_1065_1673 202
1249 3300046516 Ga0495628_0022393 Ga0495628_0022393_1807_2415 202
1250 3300046516 Ga0495628_0024841 Ga0495628_0024841_4080_4688 202
1251 3300046517 Ga0495630_0031482 Ga0495630_0031482_2329_2937 202
1252 3300046524 Ga0495648_0025624 Ga0495648_0025624_2696_3304 202
1253 3300046529 Ga0495652_0010774 Ga0495652_0010774_7088_7696 202
1254 3300046529 Ga0495652_0085591 Ga0495652_0085591_948_1556 202
1255 3300046529 Ga0495652_0108398 Ga0495652_0108398_428_1036 202
1256 3300046531 Ga0495665_0006339 Ga0495665_0006339_2067_2675 202
1257 3300046531 Ga0495665_0169006 Ga0495665_0169006_122_730 202
1258 3300046533 Ga0495640_0007630 Ga0495640_0007630_5839_6447 202
1259 3300046533 Ga0495640_0012003 Ga0495640_0012003_3028_3636 202
1260 3300046533 Ga0495640_0083233 Ga0495640_0083233_284_892 202
1261 3300046536 Ga0495587_0006289 Ga0495587_0006289_7088_7696 202
1262 3300046536 Ga0495587_0241048 Ga0495587_0241048_126_734 202
1263 3300046543 Ga0495645_0013917 Ga0495645_0013917_3900_4508 202
1264 3300046543 Ga0495645_0019992 Ga0495645_0019992_3210_3818 202
1265 3300046557 Ga0495622_0001524 Ga0495622_0001524_3864_4472 202
1266 3300046559 Ga0495667_0000270 Ga0495667_0000270_21087_21695 202
1267 3300046559 Ga0495667_0009948 Ga0495667_0009948_3460_4068 202
1268 3300046559 Ga0495667_0032576 Ga0495667_0032576_2565_3173 202
1269 3300046559 Ga0495667_0246339 Ga0495667_0246339_212_820 202
1270 3300046642 Ga0495634_0001584 Ga0495634_0001584_2195_2803 202
1271 3300046642 Ga0495634_0003421 Ga0495634_0003421_3702_4310 202
1272 3300046642 Ga0495634_0100430 Ga0495634_0100430_286_894 202
1273 3300046663 Ga0495635_0001043 Ga0495635_0001043_6078_6686 202
1274 3300046663 Ga0495635_0001867 Ga0495635_0001867_1942_2550 202
1275 3300046663 Ga0495635_0014465 Ga0495635_0014465_2490_3098 202
1276 3300046674 Ga0495588_0002125 Ga0495588_0002125_1674_2282 202
1277 3300046675 Ga0495657_0004611 Ga0495657_0004611_4654_5262 202
1278 3300046675 Ga0495657_0039530 Ga0495657_0039530_720_1328 202
1279 3300046675 Ga0495657_0150137 Ga0495657_0150137_663_1271 202
1280 3300046678 Ga0495599_0001005 Ga0495599_0001005_7755_8363 202
1281 3300046678 Ga0495599_0008343 Ga0495599_0008343_2967_3575 202
1282 3300046678 Ga0495599_0067491 Ga0495599_0067491_1333_1941 202
1283 3300046679 Ga0495623_0006560 Ga0495623_0006560_6788_7396 202
1284 3300046679 Ga0495623_0046270 Ga0495623_0046270_561_1169 202
1285 3300046679 Ga0495623_0222681 Ga0495623_0222681_240_848 202
1286 3300046679 Ga0495623_0303826 Ga0495623_0303826_51_659 202
1287 3300046680 Ga0495646_0003477 Ga0495646_0003477_983_1591 202
1288 3300046680 Ga0495646_0076876 Ga0495646_0076876_70_678 202
1289 3300046680 Ga0495646_0120665 Ga0495646_0120665_487_1095 202
1290 3300046681 Ga0495647_0001870 Ga0495647_0001870_1842_2450 202
1291 3300046683 Ga0495658_0002067 Ga0495658_0002067_4213_4821 202
1292 3300046683 Ga0495658_0148356 Ga0495658_0148356_175_783 202
1293 3300046683 Ga0495658_0293974 Ga0495658_0293974_74_682 202
1294 3300046689 Ga0495613_0036823 Ga0495613_0036823_2044_2652 202
1295 3300046689 Ga0495613_0049088 Ga0495613_0049088_1176_1784 202
1296 3300046690 Ga0495624_0001316 Ga0495624_0001316_2043_2651 202
1297 3300046809 Ga0495600_0000400 Ga0495600_0000400_16304_16912 202
1298 3300047315 Ga0495581_0002742 Ga0495581_0002742_2196_2804 202
1299 3300047315 Ga0495581_0035143 Ga0495581_0035143_139_747 202
1300 3300047317 Ga0495604_0015960 Ga0495604_0015960_4900_5508 202
1301 3300047319 Ga0495674_0003018 Ga0495674_0003018_13416_14024 202
1302 3300047319 Ga0495674_0080034 Ga0495674_0080034_1456_2064 202
1303 3300047319 Ga0495674_0203816 Ga0495674_0203816_935_1543 202
1304 3300047321 Ga0495676_0039072 Ga0495676_0039072_740_1348 202
1305 3300047321 Ga0495676_0066367 Ga0495676_0066367_1711_2319 202
1306 3300047322 Ga0495680_0002432 Ga0495680_0002432_6662_7270 202
1307 3300047322 Ga0495680_0037304 Ga0495680_0037304_1968_2576 202
1308 3300047322 Ga0495680_0505477 Ga0495680_0505477_101_709 202
1309 3300047444 Ga0495675_0074297 Ga0495675_0074297_589_1197 202
1310 3300047444 Ga0495675_0180255 Ga0495675_0180255_632_1240 202
1311 3300047469 Ga0495673_0018685 Ga0495673_0018685_366_974 202
1312 3300047471 Ga0495684_0000766 Ga0495684_0000766_5976_6584 202
1313 3300047471 Ga0495684_0058049 Ga0495684_0058049_1876_2484 202
1314 3300047471 Ga0495684_0315700 Ga0495684_0315700_270_878 202
1315 3300047673 Ga0495593_0000419 Ga0495593_0000419_16869_17477 202
1316 3300047673 Ga0495593_0006119 Ga0495593_0006119_4902_5510 202
1317 3300048088 Ga0495602_0053610 Ga0495602_0053610_504_1112 202
1318 3300048088 Ga0495602_0066580 Ga0495602_0066580_2446_3054 202
1319 3300048913 Ga0496110_0195641 Ga0496110_0195641_798_1406 202
1320 3300048914 Ga0496111_0460995 Ga0496111_0460995_74_682 202
1321 3300048915 Ga0496112_0230112 Ga0496112_0230112_740_1348 202
1322 3300048918 Ga0496115_0085598 Ga0496115_0085598_242_850 202
1323 3300048929 Ga0496126_0141839 Ga0496126_0141839_833_1444 202
1324 3300049581 Ga0501047_0060047 Ga0501047_0060047_552_1163 202
1325 3300050492 nmdc:mga0yw44_41065_c1 nmdc:mga0yw44_41065_c1_1115_1726 202
1326 3300053077 Ga0495601_0020415 Ga0495601_0020415_3258_3866 202
1327 3300053077 Ga0495601_0617826 Ga0495601_0617826_19_627 202
1328 3300053078 Ga0495612_0072416 Ga0495612_0072416_796_1404 202
1329 3300053078 Ga0495612_0119094 Ga0495612_0119094_280_888 202
1330 3300053078 Ga0495612_0363651 Ga0495612_0363651_22_630 202
1331 3300053084 Ga0495595_0001138 Ga0495595_0001138_9142_9750 202
1332 3300053084 Ga0495595_0008097 Ga0495595_0008097_1206_1814 202
1333 3300053085 Ga0495619_0016127 Ga0495619_0016127_491_1099 202
1334 3300053086 Ga0500578_0100444 Ga0500578_0100444_365_982 203
1335 3300053092 Ga0500583_0085309 Ga0500583_0085309_488_1105 203
1336 3300053093 Ga0500651_0002638 Ga0500651_0002638_6168_6785 203
1337 3300053118 Ga0500594_0003603 Ga0500594_0003603_206_823 203
1338 3300053119 Ga0500595_001299 Ga0500595_001299_503_1120 203
1339 3300053130 Ga0500642_0002295 Ga0500642_0002295_4263_4880 203
1340 3300005366 Ga0070659_100058955 Ga0070659_1000589553 204
1341 3300005563 Ga0068855_100319149 Ga0068855_1003191492 204
1342 3300013105 Ga0157369_10186347 Ga0157369_101863472 204
1343 3300025917 Ga0207660_10084430 Ga0207660_100844302 204
1344 3300025932 Ga0207690_10545348 Ga0207690_105453482 204
1345 3300026142 Ga0207698_10154328 Ga0207698_101543282 204
1346 3300047472 Ga0495686_0186604 Ga0495686_0186604_527_1144 204
1347 3300048915 Ga0496112_0345605 Ga0496112_0345605_642_1256 204
1348 3300001989 JGI24739J22299_10008334 JGI24739J22299_100083347 205
1349 3300005455 Ga0070663_100010152 Ga0070663_1000101525 205
1350 3300005539 Ga0068853_100032203 Ga0068853_1000322034 205
1351 3300005563 Ga0068855_100021775 Ga0068855_1000217759 205
1352 3300005577 Ga0068857_100022705 Ga0068857_1000227055 205
1353 3300005578 Ga0068854_100157430 Ga0068854_1001574302 205
1354 3300005614 Ga0068856_100023377 Ga0068856_1000233775 205
1355 3300005616 Ga0068852_100235724 Ga0068852_1002357242 205
1356 3300009545 Ga0105237_10089262 Ga0105237_100892622 205
1357 3300009551 Ga0105238_10078708 Ga0105238_100787082 205
1358 3300010375 Ga0105239_10049838 Ga0105239_100498382 205
1359 3300025904 Ga0207647_10006459 Ga0207647_100064598 205
1360 3300025914 Ga0207671_10089189 Ga0207671_100891892 205
1361 3300025920 Ga0207649_10233364 Ga0207649_102333642 205
1362 3300025924 Ga0207694_10031304 Ga0207694_100313043 205
1363 3300025949 Ga0207667_10043047 Ga0207667_100430472 205
1364 3300025981 Ga0207640_10533811 Ga0207640_105338112 205
1365 3300026041 Ga0207639_10342291 Ga0207639_103422911 205
1366 3300026067 Ga0207678_10018042 Ga0207678_100180423 205
1367 3300026078 Ga0207702_10005413 Ga0207702_100054135 205
1368 3300026116 Ga0207674_10042939 Ga0207674_100429394 205
1369 3300026142 Ga0207698_10199312 Ga0207698_101993122 205
1370 3300005434 Ga0070709_10449380 Ga0070709_104493801 206
1371 3300005436 Ga0070713_100007850 Ga0070713_1000078505 206
1372 3300005840 Ga0068870_10076285 Ga0068870_100762851 206
1373 3300025928 Ga0207700_10005791 Ga0207700_100057916 206
1374 3300005434 Ga0070709_10007655 Ga0070709_100076558 207
1375 3300005435 Ga0070714_100024582 Ga0070714_1000245826 207
1376 3300005436 Ga0070713_100013276 Ga0070713_1000132763 207
1377 3300005437 Ga0070710_10003955 Ga0070710_100039556 207
1378 3300005439 Ga0070711_100009559 Ga0070711_1000095592 207
1379 3300006028 Ga0070717_10009355 Ga0070717_100093558 207
1380 3300006163 Ga0070715_10008734 Ga0070715_100087342 207
1381 3300006173 Ga0070716_100015200 Ga0070716_1000152003 207
1382 3300025898 Ga0207692_10005010 Ga0207692_100050105 207
1383 3300025905 Ga0207685_10019369 Ga0207685_100193692 207
1384 3300025915 Ga0207693_10006492 Ga0207693_100064926 207
1385 3300025916 Ga0207663_10000630 Ga0207663_100006306 207
1386 3300025928 Ga0207700_10042068 Ga0207700_100420682 207
1387 3300025929 Ga0207664_10012691 Ga0207664_100126911 207
1388 3300025939 Ga0207665_10000235 Ga0207665_1000023532 207
1389 3300036401 Ga0373937_0351257 Ga0373937_0351257_347_973 207
1390 3300001979 JGI24740J21852_10003409 JGI24740J21852_100034099 209
1391 3300005539 Ga0068853_100008973 Ga0068853_1000089739 209
1392 3300005578 Ga0068854_100003097 Ga0068854_1000030978 209
1393 3300005616 Ga0068852_101165377 Ga0068852_1011653771 209
1394 3300005834 Ga0068851_10004663 Ga0068851_100046636 209
1395 3300009093 Ga0105240_10060689 Ga0105240_100606892 209
1396 3300009174 Ga0105241_10002619 Ga0105241_100026195 209
1397 3300009545 Ga0105237_10135303 Ga0105237_101353032 209
1398 3300009551 Ga0105238_10015293 Ga0105238_100152934 209
1399 3300025906 Ga0207699_10001416 Ga0207699_100014169 209
1400 3300025911 Ga0207654_10000175 Ga0207654_100001757 209
1401 3300025913 Ga0207695_10009236 Ga0207695_1000923610 209
1402 3300025924 Ga0207694_10000226 Ga0207694_1000022621 209
1403 3300025949 Ga0207667_10026837 Ga0207667_100268377 209
1404 3300025981 Ga0207640_10332145 Ga0207640_103321452 209
1405 3300026041 Ga0207639_10027664 Ga0207639_100276641 209
1406 3300026078 Ga0207702_10000004 Ga0207702_10000004322 209
1407 3300026116 Ga0207674_10043994 Ga0207674_100439944 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16321

Ribosom_S30AE_C

Sigma 54 modulation/S30EA ribosomal protein C terminus

163

217

0.98

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

29

121

0.93

Feature Viewer

pLDDT pTM Quality
72.59 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map