F493729
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1407 | 558 | 1358 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10030423|Ga0307511_100304232 |
| Length | 226 |
| Sequence | MIAPILSQSEANLRYDISPLSNRGFNMTLRVSGKSISVGDALRGRVSERTEEVLRKYFDGNYSGHITLSKDGFGFRTDCALHLDSGITLEADSIAADAYASADQALLMIETRLRRYKSRLKDRSARKAHAASAAMAEMVAPTLDAPSYVIEAPAEGDEEMAGYSPVIIAEDTTSLKRLSVSEAVMELDLSGAACLIFQHGLSGRVNVIYRRADGNIGWIDPPAITA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 11 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 12 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 13 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 14 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 15 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 16 | 2791355199 | |||
| 17 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 18 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 19 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 20 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 21 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 22 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 23 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 24 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 25 | 2904699407 | |||
| 26 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 27 | 2906610324 | |||
| 28 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 29 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 30 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 31 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 32 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 33 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 34 | 2922425934 | |||
| 35 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 36 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 37 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 38 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 39 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 43 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 44 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 49 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 60 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 64 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 105 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 107 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 108 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 109 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 111 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 112 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 113 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 114 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 115 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 116 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 117 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 118 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 119 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 120 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 121 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 122 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 132 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 133 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 134 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 135 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 137 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 138 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 144 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 177 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 258 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 259 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 260 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 261 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 262 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 264 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 266 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 267 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 268 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 269 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 272 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 273 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 275 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 276 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 279 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 280 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 281 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 283 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 284 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 285 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 286 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 287 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 288 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 289 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 290 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 291 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 292 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 293 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 295 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 298 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 300 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 304 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 306 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 308 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 309 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 318 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 319 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 320 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 321 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 322 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 323 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 324 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 325 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 326 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 331 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 332 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 333 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 334 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 337 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 342 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 438 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 440 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 441 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 442 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 443 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 444 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 445 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 446 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 447 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 448 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 449 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 450 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 451 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 452 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 453 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 454 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 455 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 456 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 457 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 458 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 459 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 460 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 461 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 462 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 463 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 464 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 479 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 480 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 481 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 482 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 483 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 484 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 485 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 492 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 495 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 500 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 501 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 503 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 504 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 505 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 506 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 509 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 510 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 511 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 512 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 513 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 514 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 516 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 517 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 518 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 519 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 520 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 521 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 522 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 523 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 524 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 525 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 526 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 530 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 531 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 532 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 533 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 534 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 535 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 536 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 537 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 539 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 540 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 541 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 542 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 543 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 544 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 545 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 546 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 547 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 548 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 549 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 550 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 551 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 552 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 553 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 554 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 555 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 556 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 557 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 558 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.29 |
| Metatranscriptomes | 0.5 |
| Isolates | 3.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.94 |
| Nodule | 2.2 |
| Rhizoplane | 5.47 |
| Rhizosphere | 73.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003409 | 3300001979 | Bacteria | 6993 |
| 2 | JGI24739J22299_10008334 | 3300001989 | Bacteria | 3870 |
| 3 | JGI24750J21931_1058227 | 3300002070 | Bacteria | 614 |
| 4 | JGI24738J21930_10016956 | 3300002075 | Bacteria | 1533 |
| 5 | JGI24744J21845_10008176 | 3300002077 | Bacteria | 2159 |
| 6 | JGI25406J46586_10000544 | 3300003203 | Bacteria | 17662 |
| 7 | JGI25165J46597_1014034 | 3300003214 | Bacteria | 1094 |
| 8 | JGI25153J46596_10001259 | 3300003215 | Bacteria | 15228 |
| 9 | rootH2_10177666 | 3300003320 | Bacteria | 1291 |
| 10 | JGI25404J52841_10005893 | 3300003659 | Bacteria | 2542 |
| 11 | JGI25404J52841_10016958 | 3300003659 | Bacteria | 1579 |
| 12 | JGI25404J52841_10060516 | 3300003659 | Bacteria | 793 |
| 13 | Ga0055529_1017446 | 3300003763 | Bacteria | 900 |
| 14 | Ga0065715_10605089 | 3300005293 | Bacteria | 705 |
| 15 | Ga0065707_10246177 | 3300005295 | Bacteria | 1140 |
| 16 | Ga0070658_10027906 | 3300005327 | Bacteria | 4530 |
| 17 | Ga0070658_10070700 | 3300005327 | Bacteria | 2858 |
| 18 | Ga0070658_10335902 | 3300005327 | Bacteria | 1292 |
| 19 | Ga0070676_10252963 | 3300005328 | Bacteria | 1176 |
| 20 | Ga0070676_10401625 | 3300005328 | Bacteria | 954 |
| 21 | Ga0070676_10654818 | 3300005328 | Bacteria | 763 |
| 22 | Ga0070683_100008660 | 3300005329 | Bacteria | 8647 |
| 23 | Ga0070690_100015372 | 3300005330 | Bacteria | 4564 |
| 24 | Ga0070690_100350975 | 3300005330 | Bacteria | 1071 |
| 25 | Ga0070670_100350101 | 3300005331 | Bacteria | 1298 |
| 26 | Ga0070670_100415302 | 3300005331 | Bacteria | 1189 |
| 27 | Ga0070677_10046447 | 3300005333 | Bacteria | 1737 |
| 28 | Ga0068869_100039360 | 3300005334 | Bacteria | 3375 |
| 29 | Ga0068869_100834719 | 3300005334 | Bacteria | 794 |
| 30 | Ga0070666_10173558 | 3300005335 | Bacteria | 1510 |
| 31 | Ga0070680_100053673 | 3300005336 | Bacteria | 3290 |
| 32 | Ga0070680_100504353 | 3300005336 | Bacteria | 1035 |
| 33 | Ga0070682_100074395 | 3300005337 | Bacteria | 2182 |
| 34 | Ga0070682_100204035 | 3300005337 | Bacteria | 1396 |
| 35 | Ga0068868_100010934 | 3300005338 | Bacteria | 6589 |
| 36 | Ga0068868_100090493 | 3300005338 | Bacteria | 2464 |
| 37 | Ga0068868_100265700 | 3300005338 | Bacteria | 1448 |
| 38 | Ga0068868_100493970 | 3300005338 | Bacteria | 1071 |
| 39 | Ga0068868_100691666 | 3300005338 | Bacteria | 912 |
| 40 | Ga0070660_100001887 | 3300005339 | Bacteria | 14434 |
| 41 | Ga0070660_100309716 | 3300005339 | Bacteria | 1295 |
| 42 | Ga0070660_100357285 | 3300005339 | Bacteria | 1204 |
| 43 | Ga0070660_100489293 | 3300005339 | Bacteria | 1023 |
| 44 | Ga0070689_100559000 | 3300005340 | Bacteria | 987 |
| 45 | Ga0070689_100934831 | 3300005340 | Bacteria | 769 |
| 46 | Ga0070691_10017022 | 3300005341 | Bacteria | 3344 |
| 47 | Ga0070691_10184863 | 3300005341 | Bacteria | 1087 |
| 48 | Ga0070661_100085682 | 3300005344 | Bacteria | 2329 |
| 49 | Ga0070661_100095203 | 3300005344 | Bacteria | 2208 |
| 50 | Ga0070692_10286927 | 3300005345 | Bacteria | 1000 |
| 51 | Ga0070668_100070058 | 3300005347 | Bacteria | 2729 |
| 52 | Ga0070669_100047316 | 3300005353 | Bacteria | 3137 |
| 53 | Ga0070671_100135054 | 3300005355 | Bacteria | 2079 |
| 54 | Ga0070674_100033537 | 3300005356 | Bacteria | 3419 |
| 55 | Ga0070674_100200230 | 3300005356 | Bacteria | 1542 |
| 56 | Ga0070674_100746559 | 3300005356 | Bacteria | 841 |
| 57 | Ga0070673_100150385 | 3300005364 | Bacteria | 1971 |
| 58 | Ga0070673_100922543 | 3300005364 | Bacteria | 810 |
| 59 | Ga0070659_100058955 | 3300005366 | Bacteria | 3031 |
| 60 | Ga0070667_100035791 | 3300005367 | Bacteria | 4160 |
| 61 | Ga0070667_100043929 | 3300005367 | Bacteria | 3751 |
| 62 | Ga0070709_10002152 | 3300005434 | Bacteria | 10666 |
| 63 | Ga0070709_10003010 | 3300005434 | Bacteria | 9063 |
| 64 | Ga0070709_10004534 | 3300005434 | Bacteria | 7496 |
| 65 | Ga0070709_10007655 | 3300005434 | Bacteria | 5928 |
| 66 | Ga0070709_10052854 | 3300005434 | Bacteria | 2555 |
| 67 | Ga0070709_10241787 | 3300005434 | Bacteria | 1297 |
| 68 | Ga0070709_10449380 | 3300005434 | Bacteria | 971 |
| 69 | Ga0070709_10664771 | 3300005434 | Bacteria | 808 |
| 70 | Ga0070714_100009098 | 3300005435 | Bacteria | 7790 |
| 71 | Ga0070714_100024582 | 3300005435 | Bacteria | 4963 |
| 72 | Ga0070714_100136937 | 3300005435 | Bacteria | 2194 |
| 73 | Ga0070714_100554126 | 3300005435 | Bacteria | 1101 |
| 74 | Ga0070713_100007850 | 3300005436 | Bacteria | 7525 |
| 75 | Ga0070713_100013276 | 3300005436 | Bacteria | 6076 |
| 76 | Ga0070713_100052217 | 3300005436 | Bacteria | 3384 |
| 77 | Ga0070713_100068135 | 3300005436 | Bacteria | 2998 |
| 78 | Ga0070713_100096732 | 3300005436 | Bacteria | 2549 |
| 79 | Ga0070710_10002056 | 3300005437 | Bacteria | 9535 |
| 80 | Ga0070710_10003955 | 3300005437 | Bacteria | 7023 |
| 81 | Ga0070701_10151054 | 3300005438 | Bacteria | 1337 |
| 82 | Ga0070701_10158374 | 3300005438 | Bacteria | 1310 |
| 83 | Ga0070711_100008601 | 3300005439 | Bacteria | 6260 |
| 84 | Ga0070711_100009395 | 3300005439 | Bacteria | 6024 |
| 85 | Ga0070711_100009559 | 3300005439 | Bacteria | 5980 |
| 86 | Ga0070711_100010179 | 3300005439 | Bacteria | 5812 |
| 87 | Ga0070711_100064420 | 3300005439 | Bacteria | 2561 |
| 88 | Ga0070711_100125060 | 3300005439 | Bacteria | 1908 |
| 89 | Ga0070705_100409299 | 3300005440 | Bacteria | 1006 |
| 90 | Ga0070700_100145392 | 3300005441 | Bacteria | 1615 |
| 91 | Ga0070694_100597268 | 3300005444 | Bacteria | 888 |
| 92 | Ga0070708_100592873 | 3300005445 | Bacteria | 1045 |
| 93 | Ga0070663_100004161 | 3300005455 | Bacteria | 8454 |
| 94 | Ga0070663_100010152 | 3300005455 | Bacteria | 5859 |
| 95 | Ga0070663_100046873 | 3300005455 | Bacteria | 3060 |
| 96 | Ga0070663_100107587 | 3300005455 | Bacteria | 2090 |
| 97 | Ga0070663_100168450 | 3300005455 | Bacteria | 1691 |
| 98 | Ga0070663_100207406 | 3300005455 | Bacteria | 1533 |
| 99 | Ga0070663_100410769 | 3300005455 | Bacteria | 1108 |
| 100 | Ga0070663_100546548 | 3300005455 | Bacteria | 968 |
| 101 | Ga0070663_100757148 | 3300005455 | Bacteria | 830 |
| 102 | Ga0070678_100017953 | 3300005456 | Bacteria | 4572 |
| 103 | Ga0070678_100099100 | 3300005456 | Bacteria | 2254 |
| 104 | Ga0070678_100131001 | 3300005456 | Bacteria | 1992 |
| 105 | Ga0070662_100029595 | 3300005457 | Bacteria | 3823 |
| 106 | Ga0070662_100040728 | 3300005457 | Bacteria | 3309 |
| 107 | Ga0070662_100264109 | 3300005457 | Bacteria | 1388 |
| 108 | Ga0070662_100607869 | 3300005457 | Bacteria | 920 |
| 109 | Ga0070681_10012313 | 3300005458 | Bacteria | 8481 |
| 110 | Ga0070681_10013723 | 3300005458 | Bacteria | 8066 |
| 111 | Ga0070681_10112709 | 3300005458 | Bacteria | 2659 |
| 112 | Ga0070681_10598941 | 3300005458 | Bacteria | 1016 |
| 113 | Ga0068867_100134523 | 3300005459 | Bacteria | 1925 |
| 114 | Ga0068867_100187970 | 3300005459 | Bacteria | 1646 |
| 115 | Ga0068867_100399618 | 3300005459 | Bacteria | 1159 |
| 116 | Ga0070685_10085111 | 3300005466 | Bacteria | 1904 |
| 117 | Ga0070706_100204182 | 3300005467 | Bacteria | 1846 |
| 118 | Ga0070707_100065530 | 3300005468 | Bacteria | 3489 |
| 119 | Ga0070698_100052755 | 3300005471 | Bacteria | 4135 |
| 120 | Ga0070698_100070963 | 3300005471 | Bacteria | 3494 |
| 121 | Ga0070698_101119659 | 3300005471 | Bacteria | 736 |
| 122 | Ga0070679_100122653 | 3300005530 | Bacteria | 2582 |
| 123 | Ga0070679_100165788 | 3300005530 | Bacteria | 2183 |
| 124 | Ga0070679_100170516 | 3300005530 | Bacteria | 2149 |
| 125 | Ga0070684_100003915 | 3300005535 | Bacteria | 11281 |
| 126 | Ga0070684_100029211 | 3300005535 | Bacteria | 4671 |
| 127 | Ga0070684_100585478 | 3300005535 | Bacteria | 1037 |
| 128 | Ga0070697_100385969 | 3300005536 | Bacteria | 1214 |
| 129 | Ga0068853_100001962 | 3300005539 | Bacteria | 15158 |
| 130 | Ga0068853_100008973 | 3300005539 | Bacteria | 8056 |
| 131 | Ga0068853_100032203 | 3300005539 | Bacteria | 4440 |
| 132 | Ga0068853_100110382 | 3300005539 | Bacteria | 2443 |
| 133 | Ga0068853_100362518 | 3300005539 | Bacteria | 1350 |
| 134 | Ga0068853_100490632 | 3300005539 | Bacteria | 1159 |
| 135 | Ga0068853_100571017 | 3300005539 | Bacteria | 1073 |
| 136 | Ga0070672_100777343 | 3300005543 | Bacteria | 841 |
| 137 | Ga0070672_100881879 | 3300005543 | Bacteria | 790 |
| 138 | Ga0070686_100064805 | 3300005544 | Bacteria | 2371 |
| 139 | Ga0070686_100481364 | 3300005544 | Bacteria | 960 |
| 140 | Ga0070693_100095118 | 3300005547 | Bacteria | 1804 |
| 141 | Ga0070665_100016864 | 3300005548 | Bacteria | 7324 |
| 142 | Ga0070665_100033743 | 3300005548 | Bacteria | 5148 |
| 143 | Ga0070665_100110444 | 3300005548 | Bacteria | 2752 |
| 144 | Ga0070665_100116082 | 3300005548 | Bacteria | 2680 |
| 145 | Ga0070665_100181177 | 3300005548 | Bacteria | 2107 |
| 146 | Ga0070665_100241790 | 3300005548 | Bacteria | 1806 |
| 147 | Ga0070665_100318507 | 3300005548 | Bacteria | 1559 |
| 148 | Ga0070665_100806783 | 3300005548 | Bacteria | 951 |
| 149 | Ga0070665_101263356 | 3300005548 | Bacteria | 749 |
| 150 | Ga0070704_100085572 | 3300005549 | Bacteria | 2334 |
| 151 | Ga0070704_100583121 | 3300005549 | Bacteria | 981 |
| 152 | Ga0068855_100021775 | 3300005563 | Bacteria | 7688 |
| 153 | Ga0068855_100061111 | 3300005563 | Bacteria | 4403 |
| 154 | Ga0068855_100114371 | 3300005563 | Bacteria | 3094 |
| 155 | Ga0068855_100167682 | 3300005563 | Bacteria | 2488 |
| 156 | Ga0068855_100170211 | 3300005563 | Bacteria | 2467 |
| 157 | Ga0068855_100217393 | 3300005563 | Bacteria | 2145 |
| 158 | Ga0068855_100221768 | 3300005563 | Bacteria | 2120 |
| 159 | Ga0068855_100319149 | 3300005563 | Bacteria | 1717 |
| 160 | Ga0070664_100010417 | 3300005564 | Bacteria | 7539 |
| 161 | Ga0070664_100076757 | 3300005564 | Bacteria | 2871 |
| 162 | Ga0070664_100203031 | 3300005564 | Bacteria | 1769 |
| 163 | Ga0068857_100022705 | 3300005577 | Bacteria | 5519 |
| 164 | Ga0068857_100053898 | 3300005577 | Bacteria | 3568 |
| 165 | Ga0068857_100149604 | 3300005577 | Bacteria | 2114 |
| 166 | Ga0068857_100243626 | 3300005577 | Bacteria | 1646 |
| 167 | Ga0068857_100476910 | 3300005577 | Bacteria | 1169 |
| 168 | Ga0068854_100003097 | 3300005578 | Bacteria | 10353 |
| 169 | Ga0068854_100157430 | 3300005578 | Bacteria | 1756 |
| 170 | Ga0068854_100689806 | 3300005578 | Bacteria | 880 |
| 171 | Ga0068854_101004209 | 3300005578 | Bacteria | 739 |
| 172 | Ga0068856_100023377 | 3300005614 | Bacteria | 6008 |
| 173 | Ga0068856_100161136 | 3300005614 | Bacteria | 2254 |
| 174 | Ga0068856_100237588 | 3300005614 | Bacteria | 1838 |
| 175 | Ga0068856_100628127 | 3300005614 | Bacteria | 1095 |
| 176 | Ga0070702_100765750 | 3300005615 | Bacteria | 743 |
| 177 | Ga0068852_100235724 | 3300005616 | Bacteria | 1746 |
| 178 | Ga0068852_100480421 | 3300005616 | Bacteria | 1235 |
| 179 | Ga0068852_100600808 | 3300005616 | Bacteria | 1104 |
| 180 | Ga0068852_101165377 | 3300005616 | Bacteria | 791 |
| 181 | Ga0068859_100061189 | 3300005617 | Bacteria | 3794 |
| 182 | Ga0068859_101038769 | 3300005617 | Bacteria | 900 |
| 183 | Ga0068864_100019747 | 3300005618 | Bacteria | 5635 |
| 184 | Ga0068864_100429224 | 3300005618 | Bacteria | 1260 |
| 185 | Ga0068864_100752973 | 3300005618 | Bacteria | 955 |
| 186 | Ga0068866_10233459 | 3300005718 | Bacteria | 1117 |
| 187 | Ga0068861_100063518 | 3300005719 | Bacteria | 2838 |
| 188 | Ga0068861_100255131 | 3300005719 | Bacteria | 1498 |
| 189 | Ga0068861_100314185 | 3300005719 | Bacteria | 1362 |
| 190 | Ga0068851_10004663 | 3300005834 | Bacteria | 6191 |
| 191 | Ga0068870_10076285 | 3300005840 | Bacteria | 1840 |
| 192 | Ga0068863_100164671 | 3300005841 | Bacteria | 2126 |
| 193 | Ga0068858_100027826 | 3300005842 | Bacteria | 5252 |
| 194 | Ga0068858_100097450 | 3300005842 | Bacteria | 2741 |
| 195 | Ga0068858_100194085 | 3300005842 | Bacteria | 1919 |
| 196 | Ga0068858_100365213 | 3300005842 | Bacteria | 1384 |
| 197 | Ga0068860_100001772 | 3300005843 | Bacteria | 22993 |
| 198 | Ga0068860_100056338 | 3300005843 | Bacteria | 3737 |
| 199 | Ga0068860_100295294 | 3300005843 | Bacteria | 1586 |
| 200 | Ga0068860_100426397 | 3300005843 | Bacteria | 1315 |
| 201 | Ga0068860_100453276 | 3300005843 | Bacteria | 1276 |
| 202 | Ga0068860_100733704 | 3300005843 | Bacteria | 999 |
| 203 | Ga0068862_100104509 | 3300005844 | Bacteria | 2481 |
| 204 | Ga0068862_100495819 | 3300005844 | Bacteria | 1158 |
| 205 | Ga0081540_1003529 | 3300005983 | Bacteria | 12327 |
| 206 | Ga0081540_1011557 | 3300005983 | Bacteria | 5897 |
| 207 | Ga0081540_1013255 | 3300005983 | Bacteria | 5370 |
| 208 | Ga0081540_1013296 | 3300005983 | Bacteria | 5358 |
| 209 | Ga0081540_1019386 | 3300005983 | Bacteria | 4136 |
| 210 | Ga0081540_1022881 | 3300005983 | Bacteria | 3677 |
| 211 | Ga0081540_1074578 | 3300005983 | Bacteria | 1554 |
| 212 | Ga0081540_1184040 | 3300005983 | Bacteria | 778 |
| 213 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 214 | Ga0070717_10009355 | 3300006028 | Bacteria | 7360 |
| 215 | Ga0070717_10070975 | 3300006028 | Bacteria | 2904 |
| 216 | Ga0075365_10011114 | 3300006038 | Bacteria | 5281 |
| 217 | Ga0075365_10012035 | 3300006038 | Bacteria | 5117 |
| 218 | Ga0075365_10016638 | 3300006038 | Bacteria | 4478 |
| 219 | Ga0075365_10173148 | 3300006038 | Bacteria | 1507 |
| 220 | Ga0075368_10054207 | 3300006042 | Bacteria | 1597 |
| 221 | Ga0075368_10162014 | 3300006042 | Bacteria | 937 |
| 222 | Ga0075363_100022751 | 3300006048 | Bacteria | 3171 |
| 223 | Ga0075363_100072285 | 3300006048 | Bacteria | 1875 |
| 224 | Ga0075364_10023981 | 3300006051 | Bacteria | 3868 |
| 225 | Ga0075364_10040350 | 3300006051 | Bacteria | 3027 |
| 226 | Ga0075364_10044309 | 3300006051 | Bacteria | 2894 |
| 227 | Ga0075364_10262713 | 3300006051 | Bacteria | 1173 |
| 228 | Ga0075364_10480288 | 3300006051 | Bacteria | 849 |
| 229 | Ga0075364_10498845 | 3300006051 | Bacteria | 832 |
| 230 | Ga0075364_10509418 | 3300006051 | Bacteria | 823 |
| 231 | Ga0070715_10008734 | 3300006163 | Bacteria | 3543 |
| 232 | Ga0070715_10010042 | 3300006163 | Bacteria | 3361 |
| 233 | Ga0070715_10386874 | 3300006163 | Bacteria | 774 |
| 234 | Ga0070716_100015200 | 3300006173 | Bacteria | 3950 |
| 235 | Ga0070716_100049904 | 3300006173 | Bacteria | 2373 |
| 236 | Ga0070716_100394929 | 3300006173 | Bacteria | 993 |
| 237 | Ga0070712_100004273 | 3300006175 | Bacteria | 8793 |
| 238 | Ga0070712_100039649 | 3300006175 | Bacteria | 3224 |
| 239 | Ga0070712_100138535 | 3300006175 | Bacteria | 1854 |
| 240 | Ga0070712_100186524 | 3300006175 | Bacteria | 1620 |
| 241 | Ga0070712_100738047 | 3300006175 | Bacteria | 842 |
| 242 | Ga0075362_10035670 | 3300006177 | Bacteria | 2172 |
| 243 | Ga0075362_10058983 | 3300006177 | Bacteria | 1732 |
| 244 | Ga0075362_10136571 | 3300006177 | Bacteria | 1170 |
| 245 | Ga0075362_10137371 | 3300006177 | Bacteria | 1166 |
| 246 | Ga0075362_10243342 | 3300006177 | Bacteria | 884 |
| 247 | Ga0075362_10315732 | 3300006177 | Bacteria | 778 |
| 248 | Ga0075367_10016372 | 3300006178 | Bacteria | 4049 |
| 249 | Ga0075367_10038366 | 3300006178 | Bacteria | 2788 |
| 250 | Ga0075367_10064515 | 3300006178 | Bacteria | 2191 |
| 251 | Ga0075367_10111628 | 3300006178 | Bacteria | 1678 |
| 252 | Ga0075367_10182297 | 3300006178 | Bacteria | 1309 |
| 253 | Ga0075367_10499585 | 3300006178 | Bacteria | 772 |
| 254 | Ga0075369_10021370 | 3300006186 | Bacteria | 2659 |
| 255 | Ga0075369_10066844 | 3300006186 | Bacteria | 1577 |
| 256 | Ga0075369_10108583 | 3300006186 | Bacteria | 1250 |
| 257 | Ga0075366_10075643 | 3300006195 | Bacteria | 2009 |
| 258 | Ga0075366_10143633 | 3300006195 | Bacteria | 1443 |
| 259 | Ga0075366_10183412 | 3300006195 | Bacteria | 1271 |
| 260 | Ga0075366_10194637 | 3300006195 | Bacteria | 1232 |
| 261 | Ga0097621_100020867 | 3300006237 | Bacteria | 5055 |
| 262 | Ga0097621_100088568 | 3300006237 | Bacteria | 2587 |
| 263 | Ga0097621_100549938 | 3300006237 | Bacteria | 1051 |
| 264 | Ga0097621_100568296 | 3300006237 | Bacteria | 1034 |
| 265 | Ga0075370_10127918 | 3300006353 | Bacteria | 1481 |
| 266 | Ga0075370_10146480 | 3300006353 | Bacteria | 1382 |
| 267 | Ga0075370_10420753 | 3300006353 | Bacteria | 803 |
| 268 | Ga0068871_100039067 | 3300006358 | Bacteria | 3795 |
| 269 | Ga0068871_100525902 | 3300006358 | Bacteria | 1069 |
| 270 | Ga0075428_100345035 | 3300006844 | Bacteria | 1598 |
| 271 | Ga0075434_100040143 | 3300006871 | Bacteria | 4636 |
| 272 | Ga0068865_100041444 | 3300006881 | Bacteria | 3133 |
| 273 | Ga0068865_100325690 | 3300006881 | Bacteria | 1237 |
| 274 | Ga0075436_100174245 | 3300006914 | Bacteria | 1519 |
| 275 | Ga0097620_100061189 | 3300006931 | Bacteria | 3794 |
| 276 | Ga0097620_101038793 | 3300006931 | Bacteria | 900 |
| 277 | Ga0099795_10017026 | 3300007788 | Bacteria | 2311 |
| 278 | Ga0099795_10046630 | 3300007788 | Bacteria | 1562 |
| 279 | Ga0099795_10176100 | 3300007788 | Bacteria | 891 |
| 280 | Ga0105250_10047595 | 3300009092 | Bacteria | 1720 |
| 281 | Ga0105240_10060689 | 3300009093 | Bacteria | 4713 |
| 282 | Ga0105240_10144055 | 3300009093 | Bacteria | 2845 |
| 283 | Ga0105240_10148867 | 3300009093 | Bacteria | 2790 |
| 284 | Ga0105240_10176227 | 3300009093 | Bacteria | 2528 |
| 285 | Ga0105240_10432883 | 3300009093 | Bacteria | 1476 |
| 286 | Ga0111539_10131772 | 3300009094 | Bacteria | 2927 |
| 287 | Ga0111539_10459047 | 3300009094 | Bacteria | 1484 |
| 288 | Ga0111539_10887303 | 3300009094 | Bacteria | 1037 |
| 289 | Ga0105245_10005676 | 3300009098 | Bacteria | 10968 |
| 290 | Ga0105245_10122484 | 3300009098 | Bacteria | 2431 |
| 291 | Ga0105245_10153912 | 3300009098 | Bacteria | 2176 |
| 292 | Ga0105245_10428517 | 3300009098 | Bacteria | 1327 |
| 293 | Ga0105245_11093473 | 3300009098 | Bacteria | 843 |
| 294 | Ga0105247_10022343 | 3300009101 | Bacteria | 3810 |
| 295 | Ga0105247_10121971 | 3300009101 | Bacteria | 1690 |
| 296 | Ga0114129_10062265 | 3300009147 | Bacteria | 5213 |
| 297 | Ga0114129_10571993 | 3300009147 | Bacteria | 1467 |
| 298 | Ga0105243_10186686 | 3300009148 | Bacteria | 1807 |
| 299 | Ga0105243_10728830 | 3300009148 | Bacteria | 970 |
| 300 | Ga0105243_11214354 | 3300009148 | Bacteria | 768 |
| 301 | Ga0105241_10002619 | 3300009174 | Bacteria | 13477 |
| 302 | Ga0105241_10063746 | 3300009174 | Bacteria | 2845 |
| 303 | Ga0105241_10233452 | 3300009174 | Bacteria | 1552 |
| 304 | Ga0105241_10299583 | 3300009174 | Bacteria | 1379 |
| 305 | Ga0105242_10286386 | 3300009176 | Bacteria | 1498 |
| 306 | Ga0105242_10490695 | 3300009176 | Bacteria | 1166 |
| 307 | Ga0105242_10647988 | 3300009176 | Bacteria | 1027 |
| 308 | Ga0105248_10046598 | 3300009177 | Bacteria | 4859 |
| 309 | Ga0105248_10129116 | 3300009177 | Bacteria | 2851 |
| 310 | Ga0105248_10129944 | 3300009177 | Bacteria | 2842 |
| 311 | Ga0105248_10208416 | 3300009177 | Bacteria | 2202 |
| 312 | Ga0105248_10424995 | 3300009177 | Bacteria | 1496 |
| 313 | Ga0105248_10447973 | 3300009177 | Bacteria | 1455 |
| 314 | Ga0105237_10006051 | 3300009545 | Bacteria | 13534 |
| 315 | Ga0105237_10026719 | 3300009545 | Bacteria | 5899 |
| 316 | Ga0105237_10074544 | 3300009545 | Bacteria | 3386 |
| 317 | Ga0105237_10077150 | 3300009545 | Bacteria | 3322 |
| 318 | Ga0105237_10089262 | 3300009545 | Bacteria | 3072 |
| 319 | Ga0105237_10116340 | 3300009545 | Bacteria | 2667 |
| 320 | Ga0105237_10132136 | 3300009545 | Bacteria | 2490 |
| 321 | Ga0105237_10135303 | 3300009545 | Bacteria | 2459 |
| 322 | Ga0105237_10245815 | 3300009545 | Bacteria | 1791 |
| 323 | Ga0105237_10361742 | 3300009545 | Bacteria | 1455 |
| 324 | Ga0105237_10800157 | 3300009545 | Bacteria | 949 |
| 325 | Ga0105238_10014911 | 3300009551 | Bacteria | 7866 |
| 326 | Ga0105238_10015293 | 3300009551 | Bacteria | 7772 |
| 327 | Ga0105238_10033085 | 3300009551 | Bacteria | 5260 |
| 328 | Ga0105238_10078708 | 3300009551 | Bacteria | 3287 |
| 329 | Ga0105238_10145140 | 3300009551 | Bacteria | 2350 |
| 330 | Ga0105238_10267196 | 3300009551 | Bacteria | 1691 |
| 331 | Ga0105238_10337524 | 3300009551 | Bacteria | 1495 |
| 332 | Ga0105238_10442227 | 3300009551 | Bacteria | 1296 |
| 333 | Ga0105238_11051484 | 3300009551 | Bacteria | 836 |
| 334 | Ga0105249_10455878 | 3300009553 | Bacteria | 1318 |
| 335 | Ga0105249_10621320 | 3300009553 | Bacteria | 1136 |
| 336 | Ga0105249_10672139 | 3300009553 | Bacteria | 1094 |
| 337 | Ga0105239_10049838 | 3300010375 | Bacteria | 4592 |
| 338 | Ga0105239_10082296 | 3300010375 | Bacteria | 3544 |
| 339 | Ga0105239_10121406 | 3300010375 | Bacteria | 2902 |
| 340 | Ga0105239_10174408 | 3300010375 | Bacteria | 2405 |
| 341 | Ga0105239_10583169 | 3300010375 | Bacteria | 1275 |
| 342 | Ga0105239_11495542 | 3300010375 | Bacteria | 780 |
| 343 | Ga0105246_10013246 | 3300011119 | Bacteria | 5165 |
| 344 | Ga0105246_10244219 | 3300011119 | Bacteria | 1421 |
| 345 | Ga0157370_10023008 | 3300013104 | Bacteria | 6194 |
| 346 | Ga0157370_10319212 | 3300013104 | Bacteria | 1433 |
| 347 | Ga0157369_10021320 | 3300013105 | Bacteria | 7247 |
| 348 | Ga0157369_10043225 | 3300013105 | Bacteria | 4912 |
| 349 | Ga0157369_10186347 | 3300013105 | Bacteria | 2182 |
| 350 | Ga0157369_10213203 | 3300013105 | Bacteria | 2024 |
| 351 | Ga0157374_10013103 | 3300013296 | Bacteria | 7232 |
| 352 | Ga0157374_10205285 | 3300013296 | Bacteria | 1931 |
| 353 | Ga0157374_10257282 | 3300013296 | Bacteria | 1719 |
| 354 | Ga0157374_11223248 | 3300013296 | Bacteria | 773 |
| 355 | Ga0157378_10027728 | 3300013297 | Bacteria | 4995 |
| 356 | Ga0157378_10038376 | 3300013297 | Bacteria | 4245 |
| 357 | Ga0157378_10264371 | 3300013297 | Bacteria | 1652 |
| 358 | Ga0163162_10012800 | 3300013306 | Bacteria | 8196 |
| 359 | Ga0163162_10387892 | 3300013306 | Bacteria | 1530 |
| 360 | Ga0157372_10246402 | 3300013307 | Bacteria | 2074 |
| 361 | Ga0157372_10854233 | 3300013307 | Bacteria | 1057 |
| 362 | Ga0157375_10017001 | 3300013308 | Bacteria | 6552 |
| 363 | Ga0157375_10275010 | 3300013308 | Bacteria | 1846 |
| 364 | Ga0157375_10496016 | 3300013308 | Bacteria | 1385 |
| 365 | Ga0163163_10006051 | 3300014325 | Bacteria | 10524 |
| 366 | Ga0163163_10070758 | 3300014325 | Bacteria | 3475 |
| 367 | Ga0163163_10094827 | 3300014325 | Bacteria | 3003 |
| 368 | Ga0163163_10860278 | 3300014325 | Bacteria | 970 |
| 369 | Ga0157380_10469602 | 3300014326 | Bacteria | 1214 |
| 370 | Ga0157380_10972443 | 3300014326 | Bacteria | 880 |
| 371 | Ga0157380_11451865 | 3300014326 | Bacteria | 738 |
| 372 | Ga0157377_10521161 | 3300014745 | Bacteria | 834 |
| 373 | Ga0157379_10179322 | 3300014968 | Bacteria | 1914 |
| 374 | Ga0157379_10232443 | 3300014968 | Bacteria | 1671 |
| 375 | Ga0157376_10053451 | 3300014969 | Bacteria | 3363 |
| 376 | Ga0157376_10099522 | 3300014969 | Bacteria | 2537 |
| 377 | Ga0163161_10059368 | 3300017792 | Bacteria | 2781 |
| 378 | Ga0163161_10504466 | 3300017792 | Bacteria | 986 |
| 379 | Ga0197907_10509530 | 3300020069 | Bacteria | 1625 |
| 380 | Ga0206356_11485400 | 3300020070 | Bacteria | 2316 |
| 381 | Ga0206350_11625858 | 3300020080 | Bacteria | 1335 |
| 382 | Ga0206354_10455357 | 3300020081 | Bacteria | 847 |
| 383 | Ga0213874_10062481 | 3300021377 | Bacteria | 1170 |
| 384 | Ga0213876_10005917 | 3300021384 | Bacteria | 6682 |
| 385 | Ga0213876_10060874 | 3300021384 | Bacteria | 1992 |
| 386 | Ga0224712_10027584 | 3300022467 | Bacteria | 2022 |
| 387 | Ga0224712_10032772 | 3300022467 | Bacteria | 1896 |
| 388 | Ga0224712_10221794 | 3300022467 | Bacteria | 866 |
| 389 | Ga0209026_1022660 | 3300025250 | Bacteria | 961 |
| 390 | Ga0209148_1038378 | 3300025254 | Bacteria | 674 |
| 391 | Ga0209233_1001331 | 3300025261 | Bacteria | 9844 |
| 392 | Ga0209233_1001687 | 3300025261 | Bacteria | 8574 |
| 393 | Ga0207666_1006949 | 3300025271 | Bacteria | 1479 |
| 394 | Ga0209455_1017269 | 3300025272 | Bacteria | 1520 |
| 395 | Ga0209564_1009367 | 3300025295 | Bacteria | 4672 |
| 396 | Ga0209758_1005955 | 3300025297 | Bacteria | 9036 |
| 397 | Ga0209758_1013259 | 3300025297 | Bacteria | 4516 |
| 398 | Ga0207426_1023685 | 3300025302 | Bacteria | 2093 |
| 399 | Ga0207697_10077680 | 3300025315 | Bacteria | 1396 |
| 400 | Ga0207656_10035153 | 3300025321 | Bacteria | 2096 |
| 401 | Ga0207696_1017234 | 3300025711 | Bacteria | 2397 |
| 402 | Ga0207653_10007878 | 3300025885 | Bacteria | 3320 |
| 403 | Ga0207682_10211738 | 3300025893 | Bacteria | 894 |
| 404 | Ga0207692_10001232 | 3300025898 | Bacteria | 9502 |
| 405 | Ga0207692_10005010 | 3300025898 | Bacteria | 5274 |
| 406 | Ga0207642_10065958 | 3300025899 | Bacteria | 1703 |
| 407 | Ga0207710_10060951 | 3300025900 | Bacteria | 1711 |
| 408 | Ga0207710_10094049 | 3300025900 | Bacteria | 1407 |
| 409 | Ga0207710_10094798 | 3300025900 | Bacteria | 1401 |
| 410 | Ga0207680_10226086 | 3300025903 | Bacteria | 1285 |
| 411 | Ga0207680_10435633 | 3300025903 | Bacteria | 929 |
| 412 | Ga0207647_10006459 | 3300025904 | Bacteria | 8521 |
| 413 | Ga0207647_10063994 | 3300025904 | Bacteria | 2236 |
| 414 | Ga0207647_10095016 | 3300025904 | Bacteria | 1775 |
| 415 | Ga0207647_10142703 | 3300025904 | Bacteria | 1403 |
| 416 | Ga0207647_10230334 | 3300025904 | Bacteria | 1066 |
| 417 | Ga0207685_10019369 | 3300025905 | Bacteria | 2242 |
| 418 | Ga0207685_10132066 | 3300025905 | Bacteria | 1109 |
| 419 | Ga0207699_10000345 | 3300025906 | Bacteria | 24666 |
| 420 | Ga0207699_10001416 | 3300025906 | Bacteria | 11381 |
| 421 | Ga0207699_10021261 | 3300025906 | Bacteria | 3495 |
| 422 | Ga0207699_10032501 | 3300025906 | Bacteria | 2940 |
| 423 | Ga0207699_10120490 | 3300025906 | Bacteria | 1696 |
| 424 | Ga0207645_10209066 | 3300025907 | Bacteria | 1285 |
| 425 | Ga0207643_10083781 | 3300025908 | Bacteria | 1850 |
| 426 | Ga0207643_10095779 | 3300025908 | Bacteria | 1735 |
| 427 | Ga0207705_10329758 | 3300025909 | Bacteria | 1173 |
| 428 | Ga0207705_10660806 | 3300025909 | Bacteria | 813 |
| 429 | Ga0207684_10133125 | 3300025910 | Bacteria | 2134 |
| 430 | Ga0207654_10000175 | 3300025911 | Bacteria | 39744 |
| 431 | Ga0207654_10021375 | 3300025911 | Bacteria | 3441 |
| 432 | Ga0207654_10145018 | 3300025911 | Bacteria | 1518 |
| 433 | Ga0207707_10005686 | 3300025912 | Bacteria | 10912 |
| 434 | Ga0207707_10073543 | 3300025912 | Bacteria | 2981 |
| 435 | Ga0207707_10086395 | 3300025912 | Bacteria | 2741 |
| 436 | Ga0207695_10009236 | 3300025913 | Bacteria | 12220 |
| 437 | Ga0207695_10023567 | 3300025913 | Bacteria | 6949 |
| 438 | Ga0207695_10063142 | 3300025913 | Bacteria | 3819 |
| 439 | Ga0207695_10074538 | 3300025913 | Bacteria | 3456 |
| 440 | Ga0207695_10149702 | 3300025913 | Bacteria | 2274 |
| 441 | Ga0207695_10270242 | 3300025913 | Bacteria | 1596 |
| 442 | Ga0207695_10356734 | 3300025913 | Bacteria | 1349 |
| 443 | Ga0207695_10486906 | 3300025913 | Bacteria | 1115 |
| 444 | Ga0207671_10022642 | 3300025914 | Bacteria | 4747 |
| 445 | Ga0207671_10043437 | 3300025914 | Bacteria | 3324 |
| 446 | Ga0207671_10049571 | 3300025914 | Bacteria | 3109 |
| 447 | Ga0207671_10067059 | 3300025914 | Bacteria | 2672 |
| 448 | Ga0207671_10082020 | 3300025914 | Bacteria | 2419 |
| 449 | Ga0207671_10089189 | 3300025914 | Bacteria | 2321 |
| 450 | Ga0207671_10159264 | 3300025914 | Bacteria | 1747 |
| 451 | Ga0207693_10006294 | 3300025915 | Bacteria | 9849 |
| 452 | Ga0207693_10006492 | 3300025915 | Bacteria | 9684 |
| 453 | Ga0207693_10008437 | 3300025915 | Bacteria | 8430 |
| 454 | Ga0207693_10097562 | 3300025915 | Bacteria | 2304 |
| 455 | Ga0207693_10177731 | 3300025915 | Bacteria | 1675 |
| 456 | Ga0207693_10177757 | 3300025915 | Bacteria | 1674 |
| 457 | Ga0207693_10718047 | 3300025915 | Bacteria | 773 |
| 458 | Ga0207663_10000630 | 3300025916 | Bacteria | 15626 |
| 459 | Ga0207663_10017753 | 3300025916 | Bacteria | 3972 |
| 460 | Ga0207663_10018155 | 3300025916 | Bacteria | 3936 |
| 461 | Ga0207663_10019112 | 3300025916 | Bacteria | 3852 |
| 462 | Ga0207663_10298196 | 3300025916 | Bacteria | 1203 |
| 463 | Ga0207663_10351355 | 3300025916 | Bacteria | 1116 |
| 464 | Ga0207660_10002576 | 3300025917 | Bacteria | 11911 |
| 465 | Ga0207660_10084430 | 3300025917 | Bacteria | 2341 |
| 466 | Ga0207662_10419964 | 3300025918 | Bacteria | 910 |
| 467 | Ga0207657_10008426 | 3300025919 | Bacteria | 10464 |
| 468 | Ga0207657_10737779 | 3300025919 | Bacteria | 763 |
| 469 | Ga0207649_10059456 | 3300025920 | Bacteria | 2398 |
| 470 | Ga0207649_10233364 | 3300025920 | Bacteria | 1317 |
| 471 | Ga0207649_10275874 | 3300025920 | Bacteria | 1220 |
| 472 | Ga0207652_10071947 | 3300025921 | Bacteria | 3006 |
| 473 | Ga0207652_10077264 | 3300025921 | Bacteria | 2905 |
| 474 | Ga0207652_10126417 | 3300025921 | Bacteria | 2278 |
| 475 | Ga0207652_10224532 | 3300025921 | Bacteria | 1692 |
| 476 | Ga0207646_10042560 | 3300025922 | Bacteria | 4080 |
| 477 | Ga0207646_10102577 | 3300025922 | Bacteria | 2565 |
| 478 | Ga0207646_10528257 | 3300025922 | Bacteria | 1062 |
| 479 | Ga0207681_10064653 | 3300025923 | Bacteria | 2527 |
| 480 | Ga0207681_10295812 | 3300025923 | Bacteria | 1279 |
| 481 | Ga0207681_10296300 | 3300025923 | Bacteria | 1278 |
| 482 | Ga0207694_10000226 | 3300025924 | Bacteria | 54504 |
| 483 | Ga0207694_10031304 | 3300025924 | Bacteria | 4062 |
| 484 | Ga0207694_10044974 | 3300025924 | Bacteria | 3409 |
| 485 | Ga0207694_10107579 | 3300025924 | Bacteria | 2215 |
| 486 | Ga0207694_10253843 | 3300025924 | Bacteria | 1439 |
| 487 | Ga0207694_10277853 | 3300025924 | Bacteria | 1375 |
| 488 | Ga0207694_10400785 | 3300025924 | Bacteria | 1141 |
| 489 | Ga0207694_10637512 | 3300025924 | Bacteria | 897 |
| 490 | Ga0207650_10323459 | 3300025925 | Bacteria | 1263 |
| 491 | Ga0207687_10005566 | 3300025927 | Bacteria | 8320 |
| 492 | Ga0207687_10049015 | 3300025927 | Bacteria | 2935 |
| 493 | Ga0207687_10824948 | 3300025927 | Bacteria | 792 |
| 494 | Ga0207700_10005791 | 3300025928 | Bacteria | 7426 |
| 495 | Ga0207700_10042068 | 3300025928 | Bacteria | 3347 |
| 496 | Ga0207700_10055022 | 3300025928 | Bacteria | 2990 |
| 497 | Ga0207700_10154910 | 3300025928 | Bacteria | 1897 |
| 498 | Ga0207700_10262504 | 3300025928 | Bacteria | 1479 |
| 499 | Ga0207664_10012691 | 3300025929 | Bacteria | 6030 |
| 500 | Ga0207664_10055425 | 3300025929 | Bacteria | 3145 |
| 501 | Ga0207664_10090021 | 3300025929 | Bacteria | 2514 |
| 502 | Ga0207664_10501039 | 3300025929 | Bacteria | 1087 |
| 503 | Ga0207664_10535075 | 3300025929 | Bacteria | 1051 |
| 504 | Ga0207690_10545348 | 3300025932 | Bacteria | 942 |
| 505 | Ga0207690_10588144 | 3300025932 | Bacteria | 908 |
| 506 | Ga0207706_10010842 | 3300025933 | Bacteria | 8314 |
| 507 | Ga0207706_10027953 | 3300025933 | Bacteria | 5040 |
| 508 | Ga0207706_10174782 | 3300025933 | Bacteria | 1887 |
| 509 | Ga0207706_10386475 | 3300025933 | Bacteria | 1214 |
| 510 | Ga0207686_10042534 | 3300025934 | Bacteria | 2778 |
| 511 | Ga0207686_10293076 | 3300025934 | Bacteria | 1206 |
| 512 | Ga0207709_10073436 | 3300025935 | Bacteria | 2180 |
| 513 | Ga0207709_10151555 | 3300025935 | Bacteria | 1606 |
| 514 | Ga0207709_10308397 | 3300025935 | Bacteria | 1180 |
| 515 | Ga0207670_10542773 | 3300025936 | Bacteria | 949 |
| 516 | Ga0207669_10204873 | 3300025937 | Bacteria | 1435 |
| 517 | Ga0207704_10110919 | 3300025938 | Bacteria | 1854 |
| 518 | Ga0207704_10200058 | 3300025938 | Bacteria | 1461 |
| 519 | Ga0207704_10618273 | 3300025938 | Bacteria | 889 |
| 520 | Ga0207665_10000235 | 3300025939 | Bacteria | 37854 |
| 521 | Ga0207665_10043799 | 3300025939 | Bacteria | 2993 |
| 522 | Ga0207665_10056372 | 3300025939 | Bacteria | 2652 |
| 523 | Ga0207665_10068941 | 3300025939 | Bacteria | 2410 |
| 524 | Ga0207665_10216238 | 3300025939 | Bacteria | 1402 |
| 525 | Ga0207665_10314709 | 3300025939 | Bacteria | 1173 |
| 526 | Ga0207665_10942185 | 3300025939 | Bacteria | 686 |
| 527 | Ga0207691_10231386 | 3300025940 | Bacteria | 1600 |
| 528 | Ga0207691_10836975 | 3300025940 | Bacteria | 772 |
| 529 | Ga0207711_10151349 | 3300025941 | Bacteria | 2094 |
| 530 | Ga0207711_10465628 | 3300025941 | Bacteria | 1177 |
| 531 | Ga0207711_10713241 | 3300025941 | Bacteria | 935 |
| 532 | Ga0207689_10088583 | 3300025942 | Bacteria | 2542 |
| 533 | Ga0207689_10768290 | 3300025942 | Bacteria | 813 |
| 534 | Ga0207661_10001179 | 3300025944 | Bacteria | 17473 |
| 535 | Ga0207661_10861235 | 3300025944 | Bacteria | 834 |
| 536 | Ga0207679_10210950 | 3300025945 | Bacteria | 1628 |
| 537 | Ga0207679_10384975 | 3300025945 | Bacteria | 1230 |
| 538 | Ga0207679_10765975 | 3300025945 | Bacteria | 878 |
| 539 | Ga0207667_10010444 | 3300025949 | Bacteria | 10851 |
| 540 | Ga0207667_10026837 | 3300025949 | Bacteria | 6284 |
| 541 | Ga0207667_10036093 | 3300025949 | Bacteria | 5301 |
| 542 | Ga0207667_10043047 | 3300025949 | Bacteria | 4793 |
| 543 | Ga0207667_10204076 | 3300025949 | Bacteria | 2028 |
| 544 | Ga0207667_10237612 | 3300025949 | Bacteria | 1865 |
| 545 | Ga0207667_10351657 | 3300025949 | Bacteria | 1503 |
| 546 | Ga0207651_10063503 | 3300025960 | Bacteria | 2579 |
| 547 | Ga0207712_10021518 | 3300025961 | Bacteria | 4235 |
| 548 | Ga0207712_10044951 | 3300025961 | Bacteria | 3056 |
| 549 | Ga0207712_10171223 | 3300025961 | Bacteria | 1697 |
| 550 | Ga0207712_10534659 | 3300025961 | Bacteria | 1006 |
| 551 | Ga0207712_10742493 | 3300025961 | Bacteria | 859 |
| 552 | Ga0207668_10028136 | 3300025972 | Bacteria | 3671 |
| 553 | Ga0207668_10069726 | 3300025972 | Bacteria | 2504 |
| 554 | Ga0207668_10130886 | 3300025972 | Bacteria | 1915 |
| 555 | Ga0207668_10154986 | 3300025972 | Bacteria | 1778 |
| 556 | Ga0207640_10103485 | 3300025981 | Bacteria | 2002 |
| 557 | Ga0207640_10332145 | 3300025981 | Bacteria | 1214 |
| 558 | Ga0207640_10412030 | 3300025981 | Bacteria | 1103 |
| 559 | Ga0207640_10533811 | 3300025981 | Bacteria | 983 |
| 560 | Ga0207658_10224895 | 3300025986 | Bacteria | 1581 |
| 561 | Ga0207677_10018303 | 3300026023 | Bacteria | 4201 |
| 562 | Ga0207677_10066110 | 3300026023 | Bacteria | 2526 |
| 563 | Ga0207677_10268183 | 3300026023 | Bacteria | 1395 |
| 564 | Ga0207677_10330932 | 3300026023 | Bacteria | 1269 |
| 565 | Ga0207677_10358701 | 3300026023 | Bacteria | 1224 |
| 566 | Ga0207677_10365751 | 3300026023 | Bacteria | 1213 |
| 567 | Ga0207703_10052106 | 3300026035 | Bacteria | 3321 |
| 568 | Ga0207703_10138552 | 3300026035 | Bacteria | 2109 |
| 569 | Ga0207703_10148388 | 3300026035 | Bacteria | 2042 |
| 570 | Ga0207703_10341235 | 3300026035 | Bacteria | 1377 |
| 571 | Ga0207703_10505914 | 3300026035 | Bacteria | 1134 |
| 572 | Ga0207639_10003564 | 3300026041 | Bacteria | 10458 |
| 573 | Ga0207639_10027664 | 3300026041 | Bacteria | 4133 |
| 574 | Ga0207639_10181804 | 3300026041 | Bacteria | 1789 |
| 575 | Ga0207639_10298966 | 3300026041 | Bacteria | 1422 |
| 576 | Ga0207639_10342291 | 3300026041 | Bacteria | 1333 |
| 577 | Ga0207639_10491344 | 3300026041 | Bacteria | 1120 |
| 578 | Ga0207639_10535287 | 3300026041 | Bacteria | 1074 |
| 579 | Ga0207678_10001940 | 3300026067 | Bacteria | 18878 |
| 580 | Ga0207678_10006070 | 3300026067 | Bacteria | 10746 |
| 581 | Ga0207678_10012005 | 3300026067 | Bacteria | 7607 |
| 582 | Ga0207678_10018042 | 3300026067 | Bacteria | 6201 |
| 583 | Ga0207678_10021243 | 3300026067 | Bacteria | 5691 |
| 584 | Ga0207678_10067680 | 3300026067 | Bacteria | 3065 |
| 585 | Ga0207678_10147102 | 3300026067 | Bacteria | 2011 |
| 586 | Ga0207678_10186384 | 3300026067 | Bacteria | 1772 |
| 587 | Ga0207678_10198597 | 3300026067 | Bacteria | 1714 |
| 588 | Ga0207678_10209662 | 3300026067 | Bacteria | 1667 |
| 589 | Ga0207678_10265187 | 3300026067 | Bacteria | 1472 |
| 590 | Ga0207678_10500536 | 3300026067 | Bacteria | 1059 |
| 591 | Ga0207678_10787624 | 3300026067 | Bacteria | 839 |
| 592 | Ga0207678_11077738 | 3300026067 | Bacteria | 711 |
| 593 | Ga0207708_10077611 | 3300026075 | Bacteria | 2549 |
| 594 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 595 | Ga0207702_10005413 | 3300026078 | Bacteria | 11174 |
| 596 | Ga0207702_10135424 | 3300026078 | Bacteria | 2222 |
| 597 | Ga0207641_10042216 | 3300026088 | Bacteria | 3825 |
| 598 | Ga0207641_10238933 | 3300026088 | Bacteria | 1692 |
| 599 | Ga0207641_10581130 | 3300026088 | Bacteria | 1095 |
| 600 | Ga0207648_10110568 | 3300026089 | Bacteria | 2412 |
| 601 | Ga0207648_10302732 | 3300026089 | Bacteria | 1434 |
| 602 | Ga0207648_10570318 | 3300026089 | Bacteria | 1041 |
| 603 | Ga0207648_10656876 | 3300026089 | Bacteria | 969 |
| 604 | Ga0207676_10210579 | 3300026095 | Bacteria | 1724 |
| 605 | Ga0207676_10611995 | 3300026095 | Bacteria | 1047 |
| 606 | Ga0207674_10042939 | 3300026116 | Bacteria | 4665 |
| 607 | Ga0207674_10043994 | 3300026116 | Bacteria | 4602 |
| 608 | Ga0207674_10153177 | 3300026116 | Bacteria | 2261 |
| 609 | Ga0207674_10330138 | 3300026116 | Bacteria | 1475 |
| 610 | Ga0207675_100048321 | 3300026118 | Bacteria | 3972 |
| 611 | Ga0207675_100356086 | 3300026118 | Bacteria | 1435 |
| 612 | Ga0207683_10019612 | 3300026121 | Bacteria | 5778 |
| 613 | Ga0207683_10130160 | 3300026121 | Bacteria | 2263 |
| 614 | Ga0207683_10918717 | 3300026121 | Bacteria | 813 |
| 615 | Ga0207698_10110712 | 3300026142 | Bacteria | 2301 |
| 616 | Ga0207698_10154328 | 3300026142 | Bacteria | 1998 |
| 617 | Ga0207698_10154808 | 3300026142 | Bacteria | 1995 |
| 618 | Ga0207698_10199312 | 3300026142 | Bacteria | 1791 |
| 619 | Ga0207698_10273543 | 3300026142 | Bacteria | 1558 |
| 620 | Ga0207698_11499305 | 3300026142 | Bacteria | 690 |
| 621 | Ga0207428_10134050 | 3300027907 | Bacteria | 1894 |
| 622 | Ga0268266_10006358 | 3300028379 | Bacteria | 10830 |
| 623 | Ga0268266_10011435 | 3300028379 | Bacteria | 7718 |
| 624 | Ga0268266_10016785 | 3300028379 | Bacteria | 6258 |
| 625 | Ga0268266_10056859 | 3300028379 | Bacteria | 3365 |
| 626 | Ga0268266_10365192 | 3300028379 | Bacteria | 1359 |
| 627 | Ga0268266_10382738 | 3300028379 | Bacteria | 1327 |
| 628 | Ga0268266_10454973 | 3300028379 | Bacteria | 1217 |
| 629 | Ga0268266_10674560 | 3300028379 | Bacteria | 995 |
| 630 | Ga0268265_10173023 | 3300028380 | Bacteria | 1847 |
| 631 | Ga0268265_10586375 | 3300028380 | Bacteria | 1063 |
| 632 | Ga0268264_10000157 | 3300028381 | Bacteria | 155163 |
| 633 | Ga0268264_10073977 | 3300028381 | Bacteria | 2893 |
| 634 | Ga0268264_10098422 | 3300028381 | Bacteria | 2537 |
| 635 | Ga0268264_10156300 | 3300028381 | Bacteria | 2050 |
| 636 | Ga0265319_1017504 | 3300028563 | Bacteria | 2723 |
| 637 | Ga0265334_10048114 | 3300028573 | Bacteria | 1643 |
| 638 | Ga0265323_10001788 | 3300028653 | Bacteria | 10202 |
| 639 | Ga0265336_10000420 | 3300028666 | Bacteria | 26307 |
| 640 | Ga0307517_10115849 | 3300028786 | Bacteria | 2009 |
| 641 | Ga0265338_10001474 | 3300028800 | Bacteria | 38131 |
| 642 | Ga0307511_10030423 | 3300030521 | Bacteria | 4851 |
| 643 | Ga0265330_10004307 | 3300031235 | Bacteria | 7236 |
| 644 | Ga0265330_10026213 | 3300031235 | Bacteria | 2638 |
| 645 | Ga0265325_10008214 | 3300031241 | Bacteria | 6179 |
| 646 | Ga0265340_10002797 | 3300031247 | Bacteria | 9929 |
| 647 | Ga0265339_10012970 | 3300031249 | Bacteria | 5067 |
| 648 | Ga0265339_10032327 | 3300031249 | Bacteria | 2952 |
| 649 | Ga0265339_10040989 | 3300031249 | Bacteria | 2572 |
| 650 | Ga0265331_10019262 | 3300031250 | Bacteria | 3526 |
| 651 | Ga0265331_10065109 | 3300031250 | Bacteria | 1715 |
| 652 | Ga0265331_10101792 | 3300031250 | Bacteria | 1321 |
| 653 | Ga0265331_10170726 | 3300031250 | Bacteria | 984 |
| 654 | Ga0307513_10109049 | 3300031456 | Bacteria | 2767 |
| 655 | Ga0307513_10851660 | 3300031456 | Bacteria | 618 |
| 656 | Ga0307509_10254585 | 3300031507 | Bacteria | 1536 |
| 657 | Ga0307509_10480241 | 3300031507 | Bacteria | 931 |
| 658 | Ga0307408_100058562 | 3300031548 | Bacteria | 2801 |
| 659 | Ga0307408_100658463 | 3300031548 | Bacteria | 937 |
| 660 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 661 | Ga0307508_10072490 | 3300031616 | Bacteria | 3019 |
| 662 | Ga0265314_10026224 | 3300031711 | Bacteria | 4381 |
| 663 | Ga0265342_10020736 | 3300031712 | Bacteria | 4208 |
| 664 | Ga0265342_10025879 | 3300031712 | Bacteria | 3683 |
| 665 | Ga0307516_10083745 | 3300031730 | Bacteria | 3029 |
| 666 | Ga0307516_10203445 | 3300031730 | Bacteria | 1698 |
| 667 | Ga0307413_10659436 | 3300031824 | Bacteria | 864 |
| 668 | Ga0307410_10544250 | 3300031852 | Bacteria | 961 |
| 669 | Ga0326468_10035826 | 3300031889 | Bacteria | 684 |
| 670 | Ga0307406_10478605 | 3300031901 | Bacteria | 1005 |
| 671 | Ga0307406_10794098 | 3300031901 | Bacteria | 798 |
| 672 | Ga0307407_10193402 | 3300031903 | Bacteria | 1358 |
| 673 | Ga0307407_10629871 | 3300031903 | Bacteria | 801 |
| 674 | Ga0307412_10417898 | 3300031911 | Bacteria | 1096 |
| 675 | Ga0307409_100060330 | 3300031995 | Bacteria | 2957 |
| 676 | Ga0307416_100216275 | 3300032002 | Bacteria | 1833 |
| 677 | Ga0307416_100396580 | 3300032002 | Bacteria | 1416 |
| 678 | Ga0307414_10451727 | 3300032004 | Bacteria | 1127 |
| 679 | Ga0307411_10064291 | 3300032005 | Bacteria | 2456 |
| 680 | Ga0307415_100126311 | 3300032126 | Bacteria | 1928 |
| 681 | Ga0307415_100126456 | 3300032126 | Bacteria | 1927 |
| 682 | Ga0307415_100138565 | 3300032126 | Bacteria | 1854 |
| 683 | Ga0307415_100266761 | 3300032126 | Bacteria | 1400 |
| 684 | Ga0307507_10075390 | 3300033179 | Bacteria | 3017 |
| 685 | Ga0307510_10003322 | 3300033180 | Bacteria | 18742 |
| 686 | Ga0307510_10137772 | 3300033180 | Bacteria | 2093 |
| 687 | Ga0307510_10150276 | 3300033180 | Bacteria | 1950 |
| 688 | Ga0315911_1000013 | 3300033442 | Bacteria | 239334 |
| 689 | Ga0316215_1000607 | 3300033544 | Bacteria | 3814 |
| 690 | Ga0373938_0048481 | 3300034957 | Bacteria | 964 |
| 691 | Ga0373926_0015030 | 3300035083 | Bacteria | 2636 |
| 692 | Ga0373926_0061857 | 3300035083 | Bacteria | 1366 |
| 693 | Ga0373934_0025321 | 3300035086 | Bacteria | 2297 |
| 694 | Ga0373934_0045393 | 3300035086 | Bacteria | 1737 |
| 695 | Ga0373934_0076714 | 3300035086 | Bacteria | 1340 |
| 696 | Ga0373944_0042552 | 3300035089 | Bacteria | 1409 |
| 697 | Ga0373923_0004941 | 3300035111 | Bacteria | 4480 |
| 698 | Ga0373923_0007011 | 3300035111 | Bacteria | 3935 |
| 699 | Ga0373923_0022309 | 3300035111 | Bacteria | 2481 |
| 700 | Ga0373923_0086521 | 3300035111 | Bacteria | 1366 |
| 701 | Ga0373932_0060343 | 3300035112 | Bacteria | 1151 |
| 702 | Ga0373932_0091145 | 3300035112 | Bacteria | 978 |
| 703 | Ga0373936_0018178 | 3300035113 | Bacteria | 2713 |
| 704 | Ga0373936_0027566 | 3300035113 | Bacteria | 2228 |
| 705 | Ga0373941_0072388 | 3300035115 | Bacteria | 1147 |
| 706 | Ga0373945_0055772 | 3300035116 | Bacteria | 1464 |
| 707 | Ga0373945_0079242 | 3300035116 | Bacteria | 1256 |
| 708 | Ga0373953_0000285 | 3300035117 | Bacteria | 13925 |
| 709 | Ga0373953_0007996 | 3300035117 | Bacteria | 3571 |
| 710 | Ga0373953_0017961 | 3300035117 | Bacteria | 2609 |
| 711 | Ga0373953_0262520 | 3300035117 | Bacteria | 751 |
| 712 | Ga0373954_0001351 | 3300035118 | Bacteria | 9881 |
| 713 | Ga0373954_0071546 | 3300035118 | Bacteria | 1648 |
| 714 | Ga0373954_0159753 | 3300035118 | Bacteria | 1102 |
| 715 | Ga0373956_0010175 | 3300035119 | Bacteria | 3844 |
| 716 | Ga0373956_0034088 | 3300035119 | Bacteria | 2241 |
| 717 | Ga0373943_0004586 | 3300035170 | Bacteria | 6242 |
| 718 | Ga0373943_0030353 | 3300035170 | Bacteria | 2557 |
| 719 | Ga0373946_0003778 | 3300035171 | Bacteria | 5371 |
| 720 | Ga0373946_0007562 | 3300035171 | Bacteria | 3976 |
| 721 | Ga0373946_0020932 | 3300035171 | Bacteria | 2532 |
| 722 | Ga0373946_0038771 | 3300035171 | Bacteria | 1942 |
| 723 | Ga0373955_0000636 | 3300035172 | Bacteria | 15000 |
| 724 | Ga0373955_0033718 | 3300035172 | Bacteria | 2698 |
| 725 | Ga0373955_0040531 | 3300035172 | Bacteria | 2491 |
| 726 | Ga0373955_0044277 | 3300035172 | Bacteria | 2396 |
| 727 | Ga0373955_0248815 | 3300035172 | Bacteria | 1065 |
| 728 | Ga0373955_0325075 | 3300035172 | Bacteria | 930 |
| 729 | Ga0373942_0021003 | 3300035207 | Bacteria | 1644 |
| 730 | Ga0373961_0065596 | 3300035241 | Bacteria | 1112 |
| 731 | Ga0373961_0218800 | 3300035241 | Bacteria | 678 |
| 732 | Ga0373962_0010144 | 3300035242 | Bacteria | 2343 |
| 733 | Ga0373962_0063278 | 3300035242 | Bacteria | 1091 |
| 734 | Ga0373924_0007304 | 3300035410 | Bacteria | 3985 |
| 735 | Ga0373924_0009123 | 3300035410 | Bacteria | 3629 |
| 736 | Ga0373924_0011229 | 3300035410 | Bacteria | 3321 |
| 737 | Ga0373931_0025140 | 3300035691 | Bacteria | 3024 |
| 738 | Ga0373935_0024695 | 3300035692 | Bacteria | 3701 |
| 739 | Ga0373935_0161943 | 3300035692 | Bacteria | 1525 |
| 740 | Ga0373935_0182935 | 3300035692 | Bacteria | 1440 |
| 741 | Ga0373935_0255286 | 3300035692 | Bacteria | 1228 |
| 742 | Ga0373935_0633926 | 3300035692 | Bacteria | 783 |
| 743 | Ga0373927_0003270 | 3300035695 | Bacteria | 11653 |
| 744 | Ga0373927_0010933 | 3300035695 | Bacteria | 6041 |
| 745 | Ga0373927_0017399 | 3300035695 | Bacteria | 4730 |
| 746 | Ga0373927_0023206 | 3300035695 | Bacteria | 4064 |
| 747 | Ga0373927_0036122 | 3300035695 | Bacteria | 3214 |
| 748 | Ga0373927_0089978 | 3300035695 | Bacteria | 1993 |
| 749 | Ga0373927_0091690 | 3300035695 | Bacteria | 1974 |
| 750 | Ga0373927_0105643 | 3300035695 | Bacteria | 1833 |
| 751 | Ga0373927_0163931 | 3300035695 | Bacteria | 1456 |
| 752 | Ga0373933_0000118 | 3300035724 | Bacteria | 51316 |
| 753 | Ga0373933_0001611 | 3300035724 | Bacteria | 13201 |
| 754 | Ga0373933_0139004 | 3300035724 | Bacteria | 1532 |
| 755 | Ga0373933_0140542 | 3300035724 | Bacteria | 1524 |
| 756 | Ga0373947_0000402 | 3300035725 | Bacteria | 24400 |
| 757 | Ga0373947_0056172 | 3300035725 | Bacteria | 2379 |
| 758 | Ga0373947_0056369 | 3300035725 | Bacteria | 2375 |
| 759 | Ga0373947_0075893 | 3300035725 | Bacteria | 2070 |
| 760 | Ga0373947_0187311 | 3300035725 | Bacteria | 1349 |
| 761 | Ga0373947_0214690 | 3300035725 | Bacteria | 1263 |
| 762 | Ga0373947_0272036 | 3300035725 | Bacteria | 1125 |
| 763 | Ga0373937_0011438 | 3300036401 | Bacteria | 7787 |
| 764 | Ga0373937_0030077 | 3300036401 | Bacteria | 4919 |
| 765 | Ga0373937_0032584 | 3300036401 | Bacteria | 4728 |
| 766 | Ga0373937_0096145 | 3300036401 | Bacteria | 2747 |
| 767 | Ga0373937_0141108 | 3300036401 | Bacteria | 2254 |
| 768 | Ga0373937_0351257 | 3300036401 | Bacteria | 1397 |
| 769 | Ga0373925_0005137 | 3300037068 | Bacteria | 9807 |
| 770 | Ga0373925_0043981 | 3300037068 | Bacteria | 3315 |
| 771 | Ga0373925_0089135 | 3300037068 | Bacteria | 2356 |
| 772 | Ga0373925_0121449 | 3300037068 | Bacteria | 2028 |
| 773 | Ga0373925_0196788 | 3300037068 | Bacteria | 1601 |
| 774 | Ga0373925_0538312 | 3300037068 | Bacteria | 960 |
| 775 | Ga0395900_0037265 | 3300037418 | Bacteria | 5015 |
| 776 | Ga0395900_0465600 | 3300037418 | Bacteria | 1218 |
| 777 | Ga0395900_0756953 | 3300037418 | Bacteria | 901 |
| 778 | Ga0395898_0024063 | 3300037466 | Bacteria | 6147 |
| 779 | Ga0395898_0043238 | 3300037466 | Bacteria | 4440 |
| 780 | Ga0395898_0053299 | 3300037466 | Bacteria | 3951 |
| 781 | Ga0395898_0114600 | 3300037466 | Bacteria | 2583 |
| 782 | Ga0395905_0012091 | 3300037471 | Bacteria | 8316 |
| 783 | Ga0395905_0149916 | 3300037471 | Bacteria | 2194 |
| 784 | Ga0395905_0247944 | 3300037471 | Bacteria | 1664 |
| 785 | Ga0436364_0209479 | 3300037853 | Bacteria | 2309 |
| 786 | Ga0436364_0393542 | 3300037853 | Bacteria | 1290 |
| 787 | Ga0436364_0584170 | 3300037853 | Bacteria | 1804 |
| 788 | Ga0436364_1349110 | 3300037853 | Bacteria | 1166 |
| 789 | Ga0395901_0084617 | 3300038443 | Bacteria | 3315 |
| 790 | Ga0395901_0129331 | 3300038443 | Bacteria | 2654 |
| 791 | Ga0395901_0170499 | 3300038443 | Bacteria | 2284 |
| 792 | Ga0436365_0029847 | 3300039437 | Bacteria | 1974 |
| 793 | Ga0436365_0049558 | 3300039437 | Bacteria | 3346 |
| 794 | Ga0436365_0229769 | 3300039437 | Bacteria | 1931 |
| 795 | Ga0436365_1609765 | 3300039437 | Bacteria | 22154 |
| 796 | Ga0436360_0450373 | 3300039438 | Bacteria | 1667 |
| 797 | Ga0436360_0760184 | 3300039438 | Bacteria | 1089 |
| 798 | Ga0436363_0152156 | 3300039450 | Bacteria | 700 |
| 799 | Ga0436363_0766255 | 3300039450 | Bacteria | 1953 |
| 800 | Ga0436363_0889462 | 3300039450 | Bacteria | 1332 |
| 801 | Ga0436363_1542117 | 3300039450 | Bacteria | 5141 |
| 802 | Ga0439465_0016189 | 3300041413 | Bacteria | 2326 |
| 803 | Ga0439465_0031998 | 3300041413 | Bacteria | 1677 |
| 804 | Ga0451797_0206793 | 3300041453 | Bacteria | 648 |
| 805 | Ga0451800_0066149 | 3300041459 | Bacteria | 1078 |
| 806 | Ga0451806_863455 | 3300041462 | Bacteria | 950 |
| 807 | Ga0451807_0416485 | 3300041486 | Bacteria | 1497 |
| 808 | Ga0451847_0193603 | 3300041503 | Bacteria | 898 |
| 809 | Ga0451843_1567046 | 3300041509 | Bacteria | 777 |
| 810 | Ga0439431_0010867 | 3300041997 | Bacteria | 2074 |
| 811 | Ga0439458_0004914 | 3300042157 | Bacteria | 3035 |
| 812 | Ga0466969_0151527 | 3300044656 | Bacteria | 1068 |
| 813 | Ga0466969_0243047 | 3300044656 | Bacteria | 817 |
| 814 | Ga0466961_0338894 | 3300044693 | Bacteria | 916 |
| 815 | Ga0466964_0060085 | 3300044706 | Bacteria | 1580 |
| 816 | Ga0466971_0190593 | 3300044719 | Bacteria | 966 |
| 817 | Ga0466970_0088075 | 3300044765 | Bacteria | 1684 |
| 818 | Ga0466970_0104496 | 3300044765 | Bacteria | 1544 |
| 819 | Ga0466957_0020746 | 3300044842 | Bacteria | 3867 |
| 820 | Ga0466957_0404481 | 3300044842 | Bacteria | 934 |
| 821 | Ga0466959_0070021 | 3300045049 | Bacteria | 2541 |
| 822 | Ga0466959_0073082 | 3300045049 | Bacteria | 2481 |
| 823 | Ga0466959_0082582 | 3300045049 | Bacteria | 2315 |
| 824 | Ga0466967_0074353 | 3300045976 | Bacteria | 3052 |
| 825 | Ga0466967_0079574 | 3300045976 | Bacteria | 2955 |
| 826 | Ga0466967_0194934 | 3300045976 | Bacteria | 1916 |
| 827 | Ga0495617_017561 | 3300046452 | Bacteria | 2418 |
| 828 | Ga0495617_066632 | 3300046452 | Bacteria | 1186 |
| 829 | Ga0495592_0001817 | 3300046454 | Bacteria | 14995 |
| 830 | Ga0495592_0036483 | 3300046454 | Bacteria | 3702 |
| 831 | Ga0495592_0046637 | 3300046454 | Bacteria | 3230 |
| 832 | Ga0495592_0084299 | 3300046454 | Bacteria | 2293 |
| 833 | Ga0495603_0000826 | 3300046455 | Bacteria | 17795 |
| 834 | Ga0495603_0007445 | 3300046455 | Bacteria | 6584 |
| 835 | Ga0495603_0018817 | 3300046455 | Bacteria | 4181 |
| 836 | Ga0495603_0337348 | 3300046455 | Bacteria | 865 |
| 837 | Ga0495590_0036775 | 3300046457 | Bacteria | 1707 |
| 838 | Ga0495590_0109499 | 3300046457 | Bacteria | 985 |
| 839 | Ga0495629_0000337 | 3300046459 | Bacteria | 40017 |
| 840 | Ga0495629_0000587 | 3300046459 | Bacteria | 29538 |
| 841 | Ga0495629_0041783 | 3300046459 | Bacteria | 3224 |
| 842 | Ga0495629_0111406 | 3300046459 | Bacteria | 1908 |
| 843 | Ga0495629_0118206 | 3300046459 | Bacteria | 1847 |
| 844 | Ga0495638_0120859 | 3300046460 | Bacteria | 1548 |
| 845 | Ga0495638_0163843 | 3300046460 | Bacteria | 1280 |
| 846 | Ga0495638_0230159 | 3300046460 | Bacteria | 1031 |
| 847 | Ga0495638_0409562 | 3300046460 | Bacteria | 701 |
| 848 | Ga0495641_0040198 | 3300046461 | Bacteria | 2176 |
| 849 | Ga0495651_0006522 | 3300046462 | Bacteria | 8912 |
| 850 | Ga0495651_0041339 | 3300046462 | Bacteria | 3581 |
| 851 | Ga0495651_0047122 | 3300046462 | Bacteria | 3335 |
| 852 | Ga0495651_0088850 | 3300046462 | Bacteria | 2321 |
| 853 | Ga0495651_0203289 | 3300046462 | Bacteria | 1385 |
| 854 | Ga0495651_0345161 | 3300046462 | Bacteria | 985 |
| 855 | Ga0495653_0001248 | 3300046463 | Bacteria | 19668 |
| 856 | Ga0495653_0043811 | 3300046463 | Bacteria | 3476 |
| 857 | Ga0495653_0223262 | 3300046463 | Bacteria | 1265 |
| 858 | Ga0495650_0038999 | 3300046471 | Bacteria | 2053 |
| 859 | Ga0495650_0046877 | 3300046471 | Bacteria | 1811 |
| 860 | Ga0495580_0002634 | 3300046472 | Bacteria | 15585 |
| 861 | Ga0495580_0012056 | 3300046472 | Bacteria | 6654 |
| 862 | Ga0495580_0514119 | 3300046472 | Bacteria | 798 |
| 863 | Ga0495580_0631164 | 3300046472 | Bacteria | 706 |
| 864 | Ga0495582_0000018 | 3300046473 | Bacteria | 93753 |
| 865 | Ga0495605_0056857 | 3300046474 | Bacteria | 1886 |
| 866 | Ga0495605_0076706 | 3300046474 | Bacteria | 1569 |
| 867 | Ga0495639_0000272 | 3300046475 | Bacteria | 25666 |
| 868 | Ga0495662_0000023 | 3300046476 | Bacteria | 54061 |
| 869 | Ga0495664_0014728 | 3300046477 | Bacteria | 4437 |
| 870 | Ga0495664_0020681 | 3300046477 | Bacteria | 3797 |
| 871 | Ga0495664_0205258 | 3300046477 | Bacteria | 1194 |
| 872 | Ga0495664_0236849 | 3300046477 | Bacteria | 1104 |
| 873 | Ga0495584_0171909 | 3300046491 | Bacteria | 1101 |
| 874 | Ga0495585_0112504 | 3300046492 | Bacteria | 1446 |
| 875 | Ga0495585_0176527 | 3300046492 | Bacteria | 1100 |
| 876 | Ga0495585_0235565 | 3300046492 | Bacteria | 918 |
| 877 | Ga0495585_0293089 | 3300046492 | Bacteria | 801 |
| 878 | Ga0495594_0000155 | 3300046499 | Bacteria | 32688 |
| 879 | Ga0495594_0141619 | 3300046499 | Bacteria | 1364 |
| 880 | Ga0495596_0012911 | 3300046500 | Bacteria | 3560 |
| 881 | Ga0495596_0031573 | 3300046500 | Bacteria | 2115 |
| 882 | Ga0495596_0101019 | 3300046500 | Bacteria | 1120 |
| 883 | Ga0495607_0059800 | 3300046501 | Bacteria | 2171 |
| 884 | Ga0495607_0092479 | 3300046501 | Bacteria | 1636 |
| 885 | Ga0495583_0055178 | 3300046506 | Bacteria | 1796 |
| 886 | Ga0495606_0005275 | 3300046507 | Bacteria | 12455 |
| 887 | Ga0495606_0043701 | 3300046507 | Bacteria | 2985 |
| 888 | Ga0495606_0087085 | 3300046507 | Bacteria | 1929 |
| 889 | Ga0495608_0007746 | 3300046511 | Bacteria | 7562 |
| 890 | Ga0495608_0153164 | 3300046511 | Bacteria | 1468 |
| 891 | Ga0495608_0258598 | 3300046511 | Bacteria | 1084 |
| 892 | Ga0495610_0080804 | 3300046512 | Bacteria | 1494 |
| 893 | Ga0495616_0037073 | 3300046513 | Bacteria | 2511 |
| 894 | Ga0495616_0144093 | 3300046513 | Bacteria | 1082 |
| 895 | Ga0495616_0237347 | 3300046513 | Bacteria | 788 |
| 896 | Ga0495618_0071100 | 3300046514 | Bacteria | 2213 |
| 897 | Ga0495618_0094263 | 3300046514 | Bacteria | 1914 |
| 898 | Ga0495618_0116963 | 3300046514 | Bacteria | 1707 |
| 899 | Ga0495618_0222517 | 3300046514 | Bacteria | 1190 |
| 900 | Ga0495620_0007418 | 3300046515 | Bacteria | 5955 |
| 901 | Ga0495620_0139601 | 3300046515 | Bacteria | 948 |
| 902 | Ga0495628_0022393 | 3300046516 | Bacteria | 5190 |
| 903 | Ga0495628_0024841 | 3300046516 | Bacteria | 4901 |
| 904 | Ga0495628_0026877 | 3300046516 | Bacteria | 4685 |
| 905 | Ga0495630_0031482 | 3300046517 | Bacteria | 3950 |
| 906 | Ga0495630_0058135 | 3300046517 | Bacteria | 2899 |
| 907 | Ga0495630_0142692 | 3300046517 | Bacteria | 1821 |
| 908 | Ga0495631_0046685 | 3300046518 | Bacteria | 1903 |
| 909 | Ga0495631_0134945 | 3300046518 | Bacteria | 1060 |
| 910 | Ga0495632_0033914 | 3300046519 | Bacteria | 2617 |
| 911 | Ga0495632_0102235 | 3300046519 | Bacteria | 1350 |
| 912 | Ga0495632_0142848 | 3300046519 | Bacteria | 1109 |
| 913 | Ga0495632_0228634 | 3300046519 | Bacteria | 839 |
| 914 | Ga0495637_0021828 | 3300046520 | Bacteria | 2929 |
| 915 | Ga0495643_0302516 | 3300046522 | Bacteria | 728 |
| 916 | Ga0495644_0021784 | 3300046523 | Bacteria | 2443 |
| 917 | Ga0495644_0085613 | 3300046523 | Bacteria | 1188 |
| 918 | Ga0495648_0025624 | 3300046524 | Bacteria | 3988 |
| 919 | Ga0495648_0027801 | 3300046524 | Bacteria | 3779 |
| 920 | Ga0495648_0031929 | 3300046524 | Bacteria | 3464 |
| 921 | Ga0495648_0167663 | 3300046524 | Bacteria | 1129 |
| 922 | Ga0495663_0029627 | 3300046525 | Bacteria | 1618 |
| 923 | Ga0495642_0081369 | 3300046528 | Bacteria | 1364 |
| 924 | Ga0495652_0010774 | 3300046529 | Bacteria | 8286 |
| 925 | Ga0495652_0085591 | 3300046529 | Bacteria | 2590 |
| 926 | Ga0495652_0108398 | 3300046529 | Bacteria | 2238 |
| 927 | Ga0495652_0143100 | 3300046529 | Bacteria | 1878 |
| 928 | Ga0495654_0011184 | 3300046530 | Bacteria | 4870 |
| 929 | Ga0495654_0099145 | 3300046530 | Bacteria | 1343 |
| 930 | Ga0495665_0006339 | 3300046531 | Bacteria | 6383 |
| 931 | Ga0495665_0034243 | 3300046531 | Bacteria | 2716 |
| 932 | Ga0495665_0169006 | 3300046531 | Bacteria | 1139 |
| 933 | Ga0495640_0007630 | 3300046533 | Bacteria | 8504 |
| 934 | Ga0495640_0012003 | 3300046533 | Bacteria | 6639 |
| 935 | Ga0495640_0040271 | 3300046533 | Bacteria | 3273 |
| 936 | Ga0495640_0040675 | 3300046533 | Bacteria | 3254 |
| 937 | Ga0495640_0083233 | 3300046533 | Bacteria | 2123 |
| 938 | Ga0495586_0296150 | 3300046535 | Bacteria | 927 |
| 939 | Ga0495587_0006289 | 3300046536 | Bacteria | 7749 |
| 940 | Ga0495587_0014194 | 3300046536 | Bacteria | 5001 |
| 941 | Ga0495587_0241048 | 3300046536 | Bacteria | 1017 |
| 942 | Ga0495598_0081760 | 3300046537 | Bacteria | 1038 |
| 943 | Ga0495609_0043451 | 3300046538 | Bacteria | 2018 |
| 944 | Ga0495621_0295376 | 3300046539 | Bacteria | 670 |
| 945 | Ga0495597_0030293 | 3300046542 | Bacteria | 2466 |
| 946 | Ga0495597_0043566 | 3300046542 | Bacteria | 1998 |
| 947 | Ga0495645_0013917 | 3300046543 | Bacteria | 5702 |
| 948 | Ga0495645_0019992 | 3300046543 | Bacteria | 4827 |
| 949 | Ga0495645_0293170 | 3300046543 | Bacteria | 1065 |
| 950 | Ga0495622_0001524 | 3300046557 | Bacteria | 11574 |
| 951 | Ga0495622_0004148 | 3300046557 | Bacteria | 6756 |
| 952 | Ga0495622_0015487 | 3300046557 | Bacteria | 3544 |
| 953 | Ga0495622_0026065 | 3300046557 | Bacteria | 2731 |
| 954 | Ga0495633_0027177 | 3300046558 | Bacteria | 2799 |
| 955 | Ga0495633_0109096 | 3300046558 | Bacteria | 1283 |
| 956 | Ga0495633_0175355 | 3300046558 | Bacteria | 987 |
| 957 | Ga0495667_0000270 | 3300046559 | Bacteria | 33708 |
| 958 | Ga0495667_0009948 | 3300046559 | Bacteria | 6441 |
| 959 | Ga0495667_0032576 | 3300046559 | Bacteria | 3492 |
| 960 | Ga0495667_0089365 | 3300046559 | Bacteria | 1997 |
| 961 | Ga0495667_0246339 | 3300046559 | Bacteria | 1138 |
| 962 | Ga0495656_0006193 | 3300046615 | Bacteria | 4186 |
| 963 | Ga0495656_0089773 | 3300046615 | Bacteria | 1403 |
| 964 | Ga0495656_0200390 | 3300046615 | Bacteria | 990 |
| 965 | Ga0495656_0251103 | 3300046615 | Bacteria | 893 |
| 966 | Ga0495668_0145460 | 3300046616 | Bacteria | 1297 |
| 967 | Ga0495634_0001584 | 3300046642 | Bacteria | 19986 |
| 968 | Ga0495634_0003421 | 3300046642 | Bacteria | 12744 |
| 969 | Ga0495634_0100430 | 3300046642 | Bacteria | 1870 |
| 970 | Ga0495634_0114548 | 3300046642 | Bacteria | 1731 |
| 971 | Ga0495611_0155322 | 3300046648 | Bacteria | 1068 |
| 972 | Ga0495611_0346005 | 3300046648 | Bacteria | 682 |
| 973 | Ga0495625_0237869 | 3300046660 | Bacteria | 1187 |
| 974 | Ga0495625_0249887 | 3300046660 | Bacteria | 1151 |
| 975 | Ga0495625_0317425 | 3300046660 | Bacteria | 993 |
| 976 | Ga0495625_0365479 | 3300046660 | Bacteria | 908 |
| 977 | Ga0495635_0001043 | 3300046663 | Bacteria | 18376 |
| 978 | Ga0495635_0001867 | 3300046663 | Bacteria | 14261 |
| 979 | Ga0495635_0014465 | 3300046663 | Bacteria | 5520 |
| 980 | Ga0495635_0145510 | 3300046663 | Bacteria | 1613 |
| 981 | Ga0495659_0057557 | 3300046664 | Bacteria | 1428 |
| 982 | Ga0495659_0176964 | 3300046664 | Bacteria | 867 |
| 983 | Ga0495661_0181717 | 3300046665 | Bacteria | 1114 |
| 984 | Ga0495588_0002125 | 3300046674 | Bacteria | 8499 |
| 985 | Ga0495588_0008457 | 3300046674 | Bacteria | 4725 |
| 986 | Ga0495588_0026572 | 3300046674 | Bacteria | 2891 |
| 987 | Ga0495588_0127581 | 3300046674 | Bacteria | 1342 |
| 988 | Ga0495657_0004611 | 3300046675 | Bacteria | 11006 |
| 989 | Ga0495657_0011878 | 3300046675 | Bacteria | 6490 |
| 990 | Ga0495657_0039530 | 3300046675 | Bacteria | 3240 |
| 991 | Ga0495657_0150137 | 3300046675 | Bacteria | 1447 |
| 992 | Ga0495599_0001005 | 3300046678 | Bacteria | 15850 |
| 993 | Ga0495599_0008343 | 3300046678 | Bacteria | 6300 |
| 994 | Ga0495599_0022444 | 3300046678 | Bacteria | 3940 |
| 995 | Ga0495599_0067491 | 3300046678 | Bacteria | 2234 |
| 996 | Ga0495599_0451552 | 3300046678 | Bacteria | 761 |
| 997 | Ga0495623_0006560 | 3300046679 | Bacteria | 7577 |
| 998 | Ga0495623_0046270 | 3300046679 | Bacteria | 2762 |
| 999 | Ga0495623_0222681 | 3300046679 | Bacteria | 1074 |
| 1000 | Ga0495623_0285788 | 3300046679 | Bacteria | 916 |
| 1001 | Ga0495623_0303826 | 3300046679 | Bacteria | 881 |
| 1002 | Ga0495646_0003477 | 3300046680 | Bacteria | 9804 |
| 1003 | Ga0495646_0035772 | 3300046680 | Bacteria | 3079 |
| 1004 | Ga0495646_0042753 | 3300046680 | Bacteria | 2779 |
| 1005 | Ga0495646_0076876 | 3300046680 | Bacteria | 1954 |
| 1006 | Ga0495646_0120665 | 3300046680 | Bacteria | 1484 |
| 1007 | Ga0495647_0001870 | 3300046681 | Bacteria | 6539 |
| 1008 | Ga0495647_0004481 | 3300046681 | Bacteria | 4541 |
| 1009 | Ga0495658_0002067 | 3300046683 | Bacteria | 10172 |
| 1010 | Ga0495658_0093310 | 3300046683 | Bacteria | 1786 |
| 1011 | Ga0495658_0148356 | 3300046683 | Bacteria | 1439 |
| 1012 | Ga0495658_0293974 | 3300046683 | Bacteria | 1027 |
| 1013 | Ga0495669_0092929 | 3300046684 | Bacteria | 1395 |
| 1014 | Ga0495669_0180049 | 3300046684 | Bacteria | 1007 |
| 1015 | Ga0495669_0287533 | 3300046684 | Bacteria | 791 |
| 1016 | Ga0495613_0036823 | 3300046689 | Bacteria | 3628 |
| 1017 | Ga0495613_0049088 | 3300046689 | Bacteria | 3115 |
| 1018 | Ga0495613_0228307 | 3300046689 | Bacteria | 1305 |
| 1019 | Ga0495624_0001316 | 3300046690 | Bacteria | 19466 |
| 1020 | Ga0495624_0163877 | 3300046690 | Bacteria | 1357 |
| 1021 | Ga0495624_0257732 | 3300046690 | Bacteria | 1054 |
| 1022 | Ga0495624_0437610 | 3300046690 | Bacteria | 784 |
| 1023 | Ga0495670_0081732 | 3300046691 | Bacteria | 1646 |
| 1024 | Ga0495670_0085016 | 3300046691 | Bacteria | 1614 |
| 1025 | Ga0495670_0182182 | 3300046691 | Bacteria | 1109 |
| 1026 | Ga0495671_0025305 | 3300046692 | Bacteria | 3086 |
| 1027 | Ga0495671_0337478 | 3300046692 | Bacteria | 723 |
| 1028 | Ga0495649_0179144 | 3300046694 | Bacteria | 1106 |
| 1029 | Ga0495589_0258350 | 3300046794 | Bacteria | 813 |
| 1030 | Ga0495600_0000400 | 3300046809 | Bacteria | 22448 |
| 1031 | Ga0495600_0006537 | 3300046809 | Bacteria | 7093 |
| 1032 | Ga0495600_0451479 | 3300046809 | Bacteria | 795 |
| 1033 | Ga0495660_0021236 | 3300046810 | Bacteria | 3718 |
| 1034 | Ga0495581_0002742 | 3300047315 | Bacteria | 10045 |
| 1035 | Ga0495581_0035143 | 3300047315 | Bacteria | 2900 |
| 1036 | Ga0495581_0057962 | 3300047315 | Bacteria | 2235 |
| 1037 | Ga0495581_0097094 | 3300047315 | Bacteria | 1711 |
| 1038 | Ga0495581_0105543 | 3300047315 | Bacteria | 1637 |
| 1039 | Ga0495581_0152314 | 3300047315 | Bacteria | 1351 |
| 1040 | Ga0495581_0244467 | 3300047315 | Bacteria | 1049 |
| 1041 | Ga0495604_0001495 | 3300047317 | Bacteria | 19268 |
| 1042 | Ga0495604_0015960 | 3300047317 | Bacteria | 5996 |
| 1043 | Ga0495604_0076221 | 3300047317 | Bacteria | 2523 |
| 1044 | Ga0495604_0218672 | 3300047317 | Bacteria | 1313 |
| 1045 | Ga0495636_0117453 | 3300047318 | Bacteria | 1174 |
| 1046 | Ga0495636_0235264 | 3300047318 | Bacteria | 844 |
| 1047 | Ga0495674_0003018 | 3300047319 | Bacteria | 16393 |
| 1048 | Ga0495674_0017831 | 3300047319 | Bacteria | 6609 |
| 1049 | Ga0495674_0080034 | 3300047319 | Bacteria | 2804 |
| 1050 | Ga0495674_0133524 | 3300047319 | Bacteria | 2090 |
| 1051 | Ga0495674_0203816 | 3300047319 | Bacteria | 1640 |
| 1052 | Ga0495674_0748515 | 3300047319 | Bacteria | 764 |
| 1053 | Ga0495672_0161240 | 3300047320 | Bacteria | 1153 |
| 1054 | Ga0495672_0168472 | 3300047320 | Bacteria | 1119 |
| 1055 | Ga0495676_0039072 | 3300047321 | Bacteria | 3935 |
| 1056 | Ga0495676_0066367 | 3300047321 | Bacteria | 2797 |
| 1057 | Ga0495676_0316600 | 3300047321 | Bacteria | 1049 |
| 1058 | Ga0495680_0002432 | 3300047322 | Bacteria | 19057 |
| 1059 | Ga0495680_0030852 | 3300047322 | Bacteria | 4369 |
| 1060 | Ga0495680_0037304 | 3300047322 | Bacteria | 3893 |
| 1061 | Ga0495680_0505477 | 3300047322 | Bacteria | 820 |
| 1062 | Ga0495683_0094536 | 3300047323 | Bacteria | 1444 |
| 1063 | Ga0495683_0204472 | 3300047323 | Bacteria | 888 |
| 1064 | Ga0495687_113427 | 3300047443 | Bacteria | 992 |
| 1065 | Ga0495675_0013695 | 3300047444 | Bacteria | 5125 |
| 1066 | Ga0495675_0074297 | 3300047444 | Bacteria | 2142 |
| 1067 | Ga0495675_0180255 | 3300047444 | Bacteria | 1293 |
| 1068 | Ga0495677_0010566 | 3300047445 | Bacteria | 3388 |
| 1069 | Ga0495685_124879 | 3300047447 | Bacteria | 844 |
| 1070 | Ga0495673_0018685 | 3300047469 | Bacteria | 3490 |
| 1071 | Ga0495673_0103518 | 3300047469 | Bacteria | 1147 |
| 1072 | Ga0495681_0132641 | 3300047470 | Bacteria | 1059 |
| 1073 | Ga0495684_0000766 | 3300047471 | Bacteria | 25966 |
| 1074 | Ga0495684_0058049 | 3300047471 | Bacteria | 2948 |
| 1075 | Ga0495684_0315700 | 3300047471 | Bacteria | 1118 |
| 1076 | Ga0495686_0073863 | 3300047472 | Bacteria | 2093 |
| 1077 | Ga0495686_0186604 | 3300047472 | Bacteria | 1198 |
| 1078 | Ga0495593_0000419 | 3300047673 | Bacteria | 23659 |
| 1079 | Ga0495593_0006119 | 3300047673 | Bacteria | 7080 |
| 1080 | Ga0495593_0075061 | 3300047673 | Bacteria | 1753 |
| 1081 | Ga0495602_0041551 | 3300048088 | Bacteria | 4199 |
| 1082 | Ga0495602_0053610 | 3300048088 | Bacteria | 3569 |
| 1083 | Ga0495602_0066580 | 3300048088 | Bacteria | 3102 |
| 1084 | Ga0495626_0023882 | 3300048091 | Bacteria | 3004 |
| 1085 | Ga0496100_0095050 | 3300048903 | Bacteria | 2042 |
| 1086 | Ga0496100_0098443 | 3300048903 | Bacteria | 2010 |
| 1087 | Ga0496101_0002473 | 3300048904 | Bacteria | 11351 |
| 1088 | Ga0496101_0074665 | 3300048904 | Bacteria | 2494 |
| 1089 | Ga0496101_0114415 | 3300048904 | Bacteria | 2034 |
| 1090 | Ga0496101_0135671 | 3300048904 | Bacteria | 1872 |
| 1091 | Ga0496101_0228653 | 3300048904 | Bacteria | 1445 |
| 1092 | Ga0496101_0390429 | 3300048904 | Bacteria | 1095 |
| 1093 | Ga0496102_0002704 | 3300048905 | Bacteria | 15082 |
| 1094 | Ga0496102_0023114 | 3300048905 | Bacteria | 5517 |
| 1095 | Ga0496102_0061798 | 3300048905 | Bacteria | 3429 |
| 1096 | Ga0496102_0136236 | 3300048905 | Bacteria | 2301 |
| 1097 | Ga0496102_0178336 | 3300048905 | Bacteria | 2001 |
| 1098 | Ga0496102_0214900 | 3300048905 | Bacteria | 1812 |
| 1099 | Ga0496102_0407694 | 3300048905 | Bacteria | 1277 |
| 1100 | Ga0496102_0642440 | 3300048905 | Bacteria | 984 |
| 1101 | Ga0496103_0029149 | 3300048906 | Bacteria | 3353 |
| 1102 | Ga0496103_0261204 | 3300048906 | Bacteria | 1114 |
| 1103 | Ga0496103_0322189 | 3300048906 | Bacteria | 994 |
| 1104 | Ga0496104_0064008 | 3300048907 | Bacteria | 3489 |
| 1105 | Ga0496104_0304310 | 3300048907 | Bacteria | 1506 |
| 1106 | Ga0496104_0348134 | 3300048907 | Bacteria | 1394 |
| 1107 | Ga0496105_0003117 | 3300048908 | Bacteria | 12200 |
| 1108 | Ga0496105_0005494 | 3300048908 | Bacteria | 9618 |
| 1109 | Ga0496106_0000246 | 3300048909 | Bacteria | 37806 |
| 1110 | Ga0496106_0007049 | 3300048909 | Bacteria | 8300 |
| 1111 | Ga0496106_0086129 | 3300048909 | Bacteria | 2419 |
| 1112 | Ga0496106_0263196 | 3300048909 | Bacteria | 1380 |
| 1113 | Ga0496106_0492590 | 3300048909 | Bacteria | 985 |
| 1114 | Ga0496107_0011607 | 3300048910 | Bacteria | 6141 |
| 1115 | Ga0496107_0013421 | 3300048910 | Bacteria | 5726 |
| 1116 | Ga0496107_0249969 | 3300048910 | Bacteria | 1319 |
| 1117 | Ga0496108_0066705 | 3300048911 | Bacteria | 3035 |
| 1118 | Ga0496108_0080000 | 3300048911 | Bacteria | 2767 |
| 1119 | Ga0496108_0112602 | 3300048911 | Bacteria | 2328 |
| 1120 | Ga0496108_0319669 | 3300048911 | Bacteria | 1353 |
| 1121 | Ga0496108_0459755 | 3300048911 | Bacteria | 1112 |
| 1122 | Ga0496109_0013738 | 3300048912 | Bacteria | 7035 |
| 1123 | Ga0496109_0035286 | 3300048912 | Bacteria | 4510 |
| 1124 | Ga0496109_0056868 | 3300048912 | Bacteria | 3569 |
| 1125 | Ga0496109_0166750 | 3300048912 | Bacteria | 2065 |
| 1126 | Ga0496109_0223495 | 3300048912 | Bacteria | 1771 |
| 1127 | Ga0496109_0248378 | 3300048912 | Bacteria | 1675 |
| 1128 | Ga0496110_0015748 | 3300048913 | Bacteria | 6301 |
| 1129 | Ga0496110_0041605 | 3300048913 | Bacteria | 4010 |
| 1130 | Ga0496110_0195641 | 3300048913 | Bacteria | 1836 |
| 1131 | Ga0496110_0620550 | 3300048913 | Bacteria | 980 |
| 1132 | Ga0496111_0012718 | 3300048914 | Bacteria | 5706 |
| 1133 | Ga0496111_0022680 | 3300048914 | Bacteria | 4397 |
| 1134 | Ga0496111_0401221 | 3300048914 | Bacteria | 1013 |
| 1135 | Ga0496111_0415474 | 3300048914 | Bacteria | 994 |
| 1136 | Ga0496111_0460995 | 3300048914 | Bacteria | 937 |
| 1137 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 1138 | Ga0496112_0055635 | 3300048915 | Bacteria | 3891 |
| 1139 | Ga0496112_0082929 | 3300048915 | Bacteria | 3170 |
| 1140 | Ga0496112_0230112 | 3300048915 | Bacteria | 1808 |
| 1141 | Ga0496112_0251085 | 3300048915 | Bacteria | 1720 |
| 1142 | Ga0496112_0345605 | 3300048915 | Bacteria | 1430 |
| 1143 | Ga0496112_0440814 | 3300048915 | Bacteria | 1240 |
| 1144 | Ga0496113_0005880 | 3300048916 | Bacteria | 7699 |
| 1145 | Ga0496113_0034908 | 3300048916 | Bacteria | 3673 |
| 1146 | Ga0496113_0330271 | 3300048916 | Bacteria | 1223 |
| 1147 | Ga0496114_0070083 | 3300048917 | Bacteria | 2944 |
| 1148 | Ga0496114_0088393 | 3300048917 | Bacteria | 2628 |
| 1149 | Ga0496114_0111528 | 3300048917 | Bacteria | 2344 |
| 1150 | Ga0496115_0001912 | 3300048918 | Bacteria | 14866 |
| 1151 | Ga0496115_0011792 | 3300048918 | Bacteria | 6563 |
| 1152 | Ga0496115_0085598 | 3300048918 | Bacteria | 2571 |
| 1153 | Ga0496115_0107081 | 3300048918 | Bacteria | 2295 |
| 1154 | Ga0496115_0210366 | 3300048918 | Bacteria | 1607 |
| 1155 | Ga0496115_0465313 | 3300048918 | Bacteria | 1020 |
| 1156 | Ga0496116_0003347 | 3300048919 | Bacteria | 15910 |
| 1157 | Ga0496117_0090473 | 3300048920 | Bacteria | 1971 |
| 1158 | Ga0496118_0017920 | 3300048921 | Bacteria | 6422 |
| 1159 | Ga0496118_0050976 | 3300048921 | Bacteria | 3170 |
| 1160 | Ga0496119_0038956 | 3300048922 | Bacteria | 3061 |
| 1161 | Ga0496119_0146239 | 3300048922 | Bacteria | 1271 |
| 1162 | Ga0496120_0051627 | 3300048923 | Bacteria | 2347 |
| 1163 | Ga0496120_0081150 | 3300048923 | Bacteria | 1756 |
| 1164 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 1165 | Ga0496121_0000423 | 3300048924 | Bacteria | 83271 |
| 1166 | Ga0496121_0047049 | 3300048924 | Bacteria | 3684 |
| 1167 | Ga0496121_0053237 | 3300048924 | Bacteria | 3392 |
| 1168 | Ga0496121_0067452 | 3300048924 | Bacteria | 2900 |
| 1169 | Ga0496121_0116392 | 3300048924 | Bacteria | 2027 |
| 1170 | Ga0496121_0175568 | 3300048924 | Bacteria | 1551 |
| 1171 | Ga0496121_0205107 | 3300048924 | Bacteria | 1401 |
| 1172 | Ga0496121_0214211 | 3300048924 | Bacteria | 1362 |
| 1173 | Ga0496121_0217999 | 3300048924 | Bacteria | 1346 |
| 1174 | Ga0496121_0432990 | 3300048924 | Bacteria | 852 |
| 1175 | Ga0496122_0039972 | 3300048925 | Bacteria | 3735 |
| 1176 | Ga0496122_0184717 | 3300048925 | Bacteria | 1238 |
| 1177 | Ga0496123_0219349 | 3300048926 | Bacteria | 960 |
| 1178 | Ga0496124_0000235 | 3300048927 | Bacteria | 107983 |
| 1179 | Ga0496124_0077272 | 3300048927 | Bacteria | 2746 |
| 1180 | Ga0496124_0343705 | 3300048927 | Bacteria | 1058 |
| 1181 | Ga0496124_0407012 | 3300048927 | Bacteria | 942 |
| 1182 | Ga0496125_0003766 | 3300048928 | Bacteria | 18045 |
| 1183 | Ga0496125_0052271 | 3300048928 | Bacteria | 3360 |
| 1184 | Ga0496125_0088205 | 3300048928 | Bacteria | 2339 |
| 1185 | Ga0496125_0231529 | 3300048928 | Bacteria | 1181 |
| 1186 | Ga0496126_0003857 | 3300048929 | Bacteria | 18525 |
| 1187 | Ga0496126_0016873 | 3300048929 | Bacteria | 7289 |
| 1188 | Ga0496126_0019515 | 3300048929 | Bacteria | 6674 |
| 1189 | Ga0496126_0027355 | 3300048929 | Bacteria | 5448 |
| 1190 | Ga0496126_0044316 | 3300048929 | Bacteria | 4097 |
| 1191 | Ga0496126_0065690 | 3300048929 | Bacteria | 3246 |
| 1192 | Ga0496126_0141839 | 3300048929 | Bacteria | 2067 |
| 1193 | Ga0496126_0169818 | 3300048929 | Bacteria | 1859 |
| 1194 | Ga0496126_0322827 | 3300048929 | Bacteria | 1268 |
| 1195 | Ga0496126_0401718 | 3300048929 | Bacteria | 1111 |
| 1196 | Ga0496126_0601363 | 3300048929 | Bacteria | 866 |
| 1197 | Ga0496126_0655751 | 3300048929 | Bacteria | 820 |
| 1198 | Ga0496126_0658476 | 3300048929 | Bacteria | 818 |
| 1199 | Ga0496126_0831969 | 3300048929 | Bacteria | 706 |
| 1200 | Ga0501036_0272301 | 3300049572 | Bacteria | 1417 |
| 1201 | Ga0501037_0635601 | 3300049573 | Bacteria | 714 |
| 1202 | Ga0501038_0684945 | 3300049574 | Bacteria | 769 |
| 1203 | Ga0501042_0185244 | 3300049578 | Bacteria | 1502 |
| 1204 | Ga0501046_0035061 | 3300049580 | Bacteria | 4045 |
| 1205 | Ga0501047_0060047 | 3300049581 | Bacteria | 3671 |
| 1206 | Ga0501067_0186178 | 3300049583 | Bacteria | 1156 |
| 1207 | Ga0501069_0070442 | 3300049585 | Bacteria | 1959 |
| 1208 | Ga0501070_0030863 | 3300049586 | Bacteria | 4489 |
| 1209 | Ga0501071_0306364 | 3300049587 | Bacteria | 1205 |
| 1210 | Ga0501079_0352151 | 3300049741 | Bacteria | 1154 |
| 1211 | Ga0501080_0067890 | 3300049742 | Bacteria | 3316 |
| 1212 | Ga0501035_0103083 | 3300049822 | Bacteria | 2503 |
| 1213 | Ga0501035_0215165 | 3300049822 | Bacteria | 1643 |
| 1214 | Ga0501044_0081215 | 3300049823 | Bacteria | 3282 |
| 1215 | nmdc:mga03683_126265_c1 | 3300050489 | Bacteria | 1141 |
| 1216 | nmdc:mga03683_12822_c1 | 3300050489 | Bacteria | 3070 |
| 1217 | nmdc:mga03683_129023_c1 | 3300050489 | Bacteria | 1130 |
| 1218 | nmdc:mga03683_305416_c1 | 3300050489 | Bacteria | 747 |
| 1219 | nmdc:mga03n38_164641_c1 | 3300050490 | Bacteria | 1125 |
| 1220 | nmdc:mga03n38_16625_c1 | 3300050490 | Bacteria | 2866 |
| 1221 | nmdc:mga03n38_206422_c1 | 3300050490 | Bacteria | 1019 |
| 1222 | nmdc:mga03n38_54485_c2 | 3300050490 | Bacteria | 1247 |
| 1223 | nmdc:mga00v17_106581_c1 | 3300050491 | Bacteria | 1774 |
| 1224 | nmdc:mga00v17_147525_c1 | 3300050491 | Bacteria | 1510 |
| 1225 | nmdc:mga00v17_1725_c1 | 3300050491 | Bacteria | 11351 |
| 1226 | nmdc:mga00v17_215758_c1 | 3300050491 | Bacteria | 1242 |
| 1227 | nmdc:mga0yw44_143373_c1 | 3300050492 | Bacteria | 1554 |
| 1228 | nmdc:mga0yw44_23370_c1 | 3300050492 | Bacteria | 3099 |
| 1229 | nmdc:mga0yw44_245180_c1 | 3300050492 | Bacteria | 1192 |
| 1230 | nmdc:mga0yw44_283734_c1 | 3300050492 | Bacteria | 1107 |
| 1231 | nmdc:mga0yw44_41065_c1 | 3300050492 | Bacteria | 2752 |
| 1232 | nmdc:mga0k408_149525_c1 | 3300050493 | Bacteria | 1391 |
| 1233 | nmdc:mga0k408_16499_c1 | 3300050493 | Bacteria | 4099 |
| 1234 | nmdc:mga0k408_287856_c1 | 3300050493 | Bacteria | 981 |
| 1235 | nmdc:mga0k408_338027_c1 | 3300050493 | Bacteria | 898 |
| 1236 | nmdc:mga0k408_445760_c1 | 3300050493 | Bacteria | 769 |
| 1237 | nmdc:mga06z11_242617_c1 | 3300050494 | Bacteria | 1059 |
| 1238 | nmdc:mga06z11_244322_c1 | 3300050494 | Bacteria | 1055 |
| 1239 | nmdc:mga06z11_521349_c1 | 3300050494 | Bacteria | 721 |
| 1240 | nmdc:mga06z11_79657_c1 | 3300050494 | Bacteria | 1754 |
| 1241 | nmdc:mga06z11_81027_c1 | 3300050494 | Bacteria | 1742 |
| 1242 | nmdc:mga06z11_93263_c1 | 3300050494 | Bacteria | 1639 |
| 1243 | nmdc:mga07m45_349677_c1 | 3300050496 | Bacteria | 859 |
| 1244 | nmdc:mga07m45_62754_c1 | 3300050496 | Bacteria | 2107 |
| 1245 | nmdc:mga05p37_44315_c1 | 3300050507 | Bacteria | 5473 |
| 1246 | nmdc:mga09592_163313_c1 | 3300050508 | Bacteria | 1924 |
| 1247 | nmdc:mga08y16_1017078_c1 | 3300050511 | Bacteria | 808 |
| 1248 | nmdc:mga08y16_78647_c1 | 3300050511 | Bacteria | 3438 |
| 1249 | nmdc:mga0n895_263504_c1 | 3300050512 | Bacteria | 1749 |
| 1250 | nmdc:mga0n895_38171_c1 | 3300050512 | Bacteria | 4652 |
| 1251 | nmdc:mga0rr50_355652_c1 | 3300050513 | Bacteria | 1232 |
| 1252 | nmdc:mga08x19_455809_c1 | 3300050514 | Bacteria | 900 |
| 1253 | nmdc:mga08x19_70623_c1 | 3300050514 | Bacteria | 2275 |
| 1254 | nmdc:mga0sz30_41661_c1 | 3300050516 | Bacteria | 1931 |
| 1255 | nmdc:mga0sz30_47472_c1 | 3300050516 | Bacteria | 1815 |
| 1256 | Ga0495601_0016608 | 3300053077 | Bacteria | 4462 |
| 1257 | Ga0495601_0020415 | 3300053077 | Bacteria | 4046 |
| 1258 | Ga0495601_0617826 | 3300053077 | Bacteria | 695 |
| 1259 | Ga0495612_0052700 | 3300053078 | Bacteria | 1674 |
| 1260 | Ga0495612_0072416 | 3300053078 | Bacteria | 1438 |
| 1261 | Ga0495612_0119094 | 3300053078 | Bacteria | 1134 |
| 1262 | Ga0495612_0363651 | 3300053078 | Bacteria | 654 |
| 1263 | Ga0500635_0011050 | 3300053080 | Bacteria | 2556 |
| 1264 | Ga0495655_0006062 | 3300053083 | Bacteria | 2175 |
| 1265 | Ga0495595_0001138 | 3300053084 | Bacteria | 10300 |
| 1266 | Ga0495595_0008097 | 3300053084 | Bacteria | 4309 |
| 1267 | Ga0495595_0071265 | 3300053084 | Bacteria | 1643 |
| 1268 | Ga0495619_0016127 | 3300053085 | Bacteria | 4729 |
| 1269 | Ga0495619_0083455 | 3300053085 | Bacteria | 2155 |
| 1270 | Ga0495619_0473933 | 3300053085 | Bacteria | 862 |
| 1271 | Ga0500578_0085342 | 3300053086 | Bacteria | 2006 |
| 1272 | Ga0500578_0100444 | 3300053086 | Bacteria | 1831 |
| 1273 | Ga0500578_0157908 | 3300053086 | Bacteria | 1409 |
| 1274 | Ga0500643_022492 | 3300053087 | Bacteria | 2027 |
| 1275 | Ga0500644_0036728 | 3300053088 | Bacteria | 1596 |
| 1276 | Ga0500644_0157458 | 3300053088 | Bacteria | 916 |
| 1277 | Ga0500581_085417 | 3300053089 | Bacteria | 1569 |
| 1278 | Ga0500646_0008172 | 3300053090 | Bacteria | 2675 |
| 1279 | Ga0500647_0285023 | 3300053091 | Bacteria | 712 |
| 1280 | Ga0500583_0085309 | 3300053092 | Bacteria | 1531 |
| 1281 | Ga0500583_0147020 | 3300053092 | Bacteria | 1172 |
| 1282 | Ga0500651_0002638 | 3300053093 | Bacteria | 9527 |
| 1283 | Ga0500651_0015639 | 3300053093 | Bacteria | 4660 |
| 1284 | Ga0500651_0049749 | 3300053093 | Bacteria | 2632 |
| 1285 | Ga0500651_0055720 | 3300053093 | Bacteria | 2475 |
| 1286 | Ga0500566_0000243 | 3300053094 | Bacteria | 29193 |
| 1287 | Ga0500566_0006814 | 3300053094 | Bacteria | 6761 |
| 1288 | Ga0500640_011728 | 3300053095 | Bacteria | 3578 |
| 1289 | Ga0500641_0003009 | 3300053096 | Bacteria | 5967 |
| 1290 | Ga0500641_0004785 | 3300053096 | Bacteria | 4792 |
| 1291 | Ga0500641_0005288 | 3300053096 | Bacteria | 4570 |
| 1292 | Ga0500641_0151696 | 3300053096 | Bacteria | 1000 |
| 1293 | Ga0500648_022378 | 3300053097 | Bacteria | 3510 |
| 1294 | Ga0500555_027690 | 3300053103 | Bacteria | 1616 |
| 1295 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 1296 | Ga0500562_012950 | 3300053108 | Bacteria | 2123 |
| 1297 | Ga0500569_038305 | 3300053109 | Bacteria | 1390 |
| 1298 | Ga0500572_002477 | 3300053111 | Bacteria | 4426 |
| 1299 | Ga0500572_003577 | 3300053111 | Bacteria | 3538 |
| 1300 | Ga0500592_000518 | 3300053116 | Bacteria | 6336 |
| 1301 | Ga0500593_063406 | 3300053117 | Bacteria | 1619 |
| 1302 | Ga0500594_0003603 | 3300053118 | Bacteria | 3412 |
| 1303 | Ga0500595_001299 | 3300053119 | Bacteria | 13581 |
| 1304 | Ga0500595_003367 | 3300053119 | Bacteria | 7488 |
| 1305 | Ga0500595_007669 | 3300053119 | Bacteria | 4464 |
| 1306 | Ga0500595_015071 | 3300053119 | Bacteria | 2910 |
| 1307 | Ga0500597_055210 | 3300053120 | Bacteria | 1699 |
| 1308 | Ga0500608_019283 | 3300053122 | Bacteria | 3124 |
| 1309 | Ga0500608_024237 | 3300053122 | Bacteria | 2832 |
| 1310 | Ga0500618_010251 | 3300053125 | Bacteria | 2520 |
| 1311 | Ga0500621_196046 | 3300053126 | Bacteria | 719 |
| 1312 | Ga0500628_157283 | 3300053129 | Bacteria | 639 |
| 1313 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 1314 | Ga0500642_0000056 | 3300053130 | Bacteria | 67746 |
| 1315 | Ga0500642_0002295 | 3300053130 | Bacteria | 5587 |
| 1316 | Ga0500642_0054062 | 3300053130 | Bacteria | 1781 |
| 1317 | Ga0500652_008629 | 3300053131 | Bacteria | 3406 |
| 1318 | Ga0500658_0051650 | 3300053134 | Bacteria | 1681 |
| 1319 | Ga0500559_0000276 | 3300053136 | Bacteria | 39738 |
| 1320 | Ga0500559_0000660 | 3300053136 | Bacteria | 23212 |
| 1321 | Ga0500559_0011403 | 3300053136 | Bacteria | 3796 |
| 1322 | Ga0500559_0049006 | 3300053136 | Bacteria | 1859 |
| 1323 | Ga0500561_0026304 | 3300053137 | Bacteria | 1424 |
| 1324 | Ga0500568_0003467 | 3300053139 | Bacteria | 8772 |
| 1325 | Ga0500568_0041456 | 3300053139 | Bacteria | 1849 |
| 1326 | Ga0500573_0008315 | 3300053140 | Bacteria | 5713 |
| 1327 | Ga0500577_0032970 | 3300053142 | Bacteria | 1826 |
| 1328 | Ga0500586_001407 | 3300053145 | Bacteria | 5061 |
| 1329 | Ga0500589_045029 | 3300053147 | Bacteria | 2055 |
| 1330 | Ga0500589_155532 | 3300053147 | Bacteria | 925 |
| 1331 | Ga0500603_002895 | 3300053150 | Bacteria | 3716 |
| 1332 | Ga0500603_007630 | 3300053150 | Bacteria | 2381 |
| 1333 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1334 | Ga0500616_0000127 | 3300053153 | Bacteria | 134777 |
| 1335 | Ga0500622_0002509 | 3300053156 | Bacteria | 13185 |
| 1336 | Ga0500622_0109096 | 3300053156 | Bacteria | 1354 |
| 1337 | Ga0500627_0052195 | 3300053158 | Bacteria | 1784 |
| 1338 | Ga0500630_042577 | 3300053159 | Bacteria | 2215 |
| 1339 | Ga0500633_0007947 | 3300053160 | Bacteria | 2706 |
| 1340 | Ga0500634_0139465 | 3300053161 | Bacteria | 1150 |
| 1341 | Ga0500639_011635 | 3300053163 | Bacteria | 4615 |
| 1342 | Ga0500639_016672 | 3300053163 | Bacteria | 3873 |
| 1343 | Ga0500636_0000766 | 3300053177 | Bacteria | 17335 |
| 1344 | Ga0500636_0167483 | 3300053177 | Bacteria | 1191 |
| 1345 | Ga0500636_0180298 | 3300053177 | Bacteria | 1134 |
| 1346 | Ga0500636_0374509 | 3300053177 | Bacteria | 670 |
| 1347 | Ga0500637_0016388 | 3300053178 | Bacteria | 3950 |
| 1348 | Ga0500637_0162959 | 3300053178 | Bacteria | 1284 |
| 1349 | Ga0500637_0203738 | 3300053178 | Bacteria | 1125 |
| 1350 | Ga0500637_0446954 | 3300053178 | Bacteria | 656 |
| 1351 | Ga0500570_021281 | 3300053724 | Bacteria | 3611 |
| 1352 | Ga0500645_006753 | 3300053730 | Bacteria | 4064 |
| 1353 | Ga0500645_023467 | 3300053730 | Bacteria | 1890 |
| 1354 | Ga0500596_000520 | 3300053735 | Bacteria | 7265 |
| 1355 | Ga0500596_001464 | 3300053735 | Bacteria | 4776 |
| 1356 | Ga0500596_003829 | 3300053735 | Bacteria | 2817 |
| 1357 | Ga0500601_001777 | 3300053737 | Bacteria | 2321 |
| 1358 | Ga0501082_0424384 | 3300060353 | Bacteria | 1161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100691666 | Ga0068868_1006916661 | 161 |
| 2 | 3300025972 | Ga0207668_10069726 | Ga0207668_100697262 | 161 |
| 3 | 3300026023 | Ga0207677_10365751 | Ga0207677_103657511 | 161 |
| 4 | 3300028379 | Ga0268266_10011435 | Ga0268266_100114355 | 161 |
| 5 | 3300048912 | Ga0496109_0035286 | Ga0496109_0035286_294_881 | 161 |
| 6 | 3300046522 | Ga0495643_0302516 | Ga0495643_0302516_209_715 | 168 |
| 7 | 3300046558 | Ga0495633_0175355 | Ga0495633_0175355_471_977 | 168 |
| 8 | 3300006177 | Ga0075362_10315732 | Ga0075362_103157321 | 179 |
| 9 | 3300005329 | Ga0070683_100008660 | Ga0070683_10000866010 | 180 |
| 10 | 3300005458 | Ga0070681_10112709 | Ga0070681_101127092 | 180 |
| 11 | 3300005530 | Ga0070679_100165788 | Ga0070679_1001657882 | 180 |
| 12 | 3300005535 | Ga0070684_100003915 | Ga0070684_10000391514 | 180 |
| 13 | 3300009093 | Ga0105240_10176227 | Ga0105240_101762272 | 180 |
| 14 | 3300025913 | Ga0207695_10063142 | Ga0207695_100631422 | 180 |
| 15 | 3300025921 | Ga0207652_10126417 | Ga0207652_101264172 | 180 |
| 16 | 3300025944 | Ga0207661_10001179 | Ga0207661_1000117921 | 180 |
| 17 | 3300006051 | Ga0075364_10044309 | Ga0075364_100443092 | 181 |
| 18 | 3300046460 | Ga0495638_0409562 | Ga0495638_0409562_15_563 | 181 |
| 19 | 3300048929 | Ga0496126_0655751 | Ga0496126_0655751_259_807 | 181 |
| 20 | 3300048929 | Ga0496126_0658476 | Ga0496126_0658476_248_796 | 181 |
| 21 | 3300050491 | nmdc:mga00v17_147525_c1 | nmdc:mga00v17_147525_c1_848_1453 | 181 |
| 22 | 3300053088 | Ga0500644_0036728 | Ga0500644_0036728_15_563 | 181 |
| 23 | 3300053129 | Ga0500628_157283 | Ga0500628_157283_14_562 | 181 |
| 24 | 3300005336 | Ga0070680_100053673 | Ga0070680_1000536733 | 183 |
| 25 | 3300005458 | Ga0070681_10013723 | Ga0070681_100137238 | 183 |
| 26 | 3300005530 | Ga0070679_100122653 | Ga0070679_1001226531 | 183 |
| 27 | 3300005539 | Ga0068853_100490632 | Ga0068853_1004906322 | 183 |
| 28 | 3300005563 | Ga0068855_100167682 | Ga0068855_1001676824 | 183 |
| 29 | 3300006358 | Ga0068871_100525902 | Ga0068871_1005259022 | 183 |
| 30 | 3300009093 | Ga0105240_10144055 | Ga0105240_101440551 | 183 |
| 31 | 3300009093 | Ga0105240_10432883 | Ga0105240_104328832 | 183 |
| 32 | 3300009545 | Ga0105237_10132136 | Ga0105237_101321363 | 183 |
| 33 | 3300013104 | Ga0157370_10319212 | Ga0157370_103192121 | 183 |
| 34 | 3300013105 | Ga0157369_10043225 | Ga0157369_100432252 | 183 |
| 35 | 3300013307 | Ga0157372_10854233 | Ga0157372_108542332 | 183 |
| 36 | 3300020069 | Ga0197907_10509530 | Ga0197907_105095302 | 183 |
| 37 | 3300020080 | Ga0206350_11625858 | Ga0206350_116258582 | 183 |
| 38 | 3300022467 | Ga0224712_10032772 | Ga0224712_100327722 | 183 |
| 39 | 3300025904 | Ga0207647_10142703 | Ga0207647_101427032 | 183 |
| 40 | 3300025912 | Ga0207707_10086395 | Ga0207707_100863955 | 183 |
| 41 | 3300025913 | Ga0207695_10023567 | Ga0207695_100235672 | 183 |
| 42 | 3300025913 | Ga0207695_10486906 | Ga0207695_104869061 | 183 |
| 43 | 3300025914 | Ga0207671_10067059 | Ga0207671_100670592 | 183 |
| 44 | 3300025921 | Ga0207652_10071947 | Ga0207652_100719472 | 183 |
| 45 | 3300025949 | Ga0207667_10036093 | Ga0207667_100360934 | 183 |
| 46 | 3300026142 | Ga0207698_11499305 | Ga0207698_114993051 | 183 |
| 47 | 3300037068 | Ga0373925_0121449 | Ga0373925_0121449_339_941 | 183 |
| 48 | 3300048918 | Ga0496115_0107081 | Ga0496115_0107081_1250_1861 | 183 |
| 49 | 3300048918 | Ga0496115_0465313 | Ga0496115_0465313_285_887 | 183 |
| 50 | 3300003215 | JGI25153J46596_10001259 | JGI25153J46596_1000125914 | 184 |
| 51 | 3300005983 | Ga0081540_1019386 | Ga0081540_10193863 | 184 |
| 52 | 3300013296 | Ga0157374_10205285 | Ga0157374_102052852 | 184 |
| 53 | 3300020081 | Ga0206354_10455357 | Ga0206354_104553571 | 184 |
| 54 | 3300025297 | Ga0209758_1005955 | Ga0209758_10059555 | 184 |
| 55 | 3300037853 | Ga0436364_1349110 | Ga0436364_1349110_374_973 | 184 |
| 56 | 3300042157 | Ga0439458_0004914 | Ga0439458_0004914_469_1071 | 184 |
| 57 | 3300046460 | Ga0495638_0120859 | Ga0495638_0120859_708_1310 | 184 |
| 58 | 3300046648 | Ga0495611_0155322 | Ga0495611_0155322_305_907 | 184 |
| 59 | 3300050489 | nmdc:mga03683_129023_c1 | nmdc:mga03683_129023_c1_153_755 | 184 |
| 60 | 3300053096 | Ga0500641_0151696 | Ga0500641_0151696_238_840 | 184 |
| 61 | 3300053142 | Ga0500577_0032970 | Ga0500577_0032970_508_1110 | 184 |
| 62 | 3300053161 | Ga0500634_0139465 | Ga0500634_0139465_478_1080 | 184 |
| 63 | 3300025302 | Ga0207426_1023685 | Ga0207426_10236852 | 185 |
| 64 | 3300026089 | Ga0207648_10656876 | Ga0207648_106568762 | 185 |
| 65 | 3300046454 | Ga0495592_0036483 | Ga0495592_0036483_2322_2921 | 185 |
| 66 | 3300046462 | Ga0495651_0041339 | Ga0495651_0041339_116_715 | 185 |
| 67 | 3300046463 | Ga0495653_0043811 | Ga0495653_0043811_2298_2897 | 185 |
| 68 | 3300046511 | Ga0495608_0258598 | Ga0495608_0258598_254_853 | 185 |
| 69 | 3300046516 | Ga0495628_0026877 | Ga0495628_0026877_2420_3019 | 185 |
| 70 | 3300046529 | Ga0495652_0143100 | Ga0495652_0143100_451_1050 | 185 |
| 71 | 3300046533 | Ga0495640_0040271 | Ga0495640_0040271_516_1115 | 185 |
| 72 | 3300046536 | Ga0495587_0014194 | Ga0495587_0014194_3623_4222 | 185 |
| 73 | 3300046675 | Ga0495657_0011878 | Ga0495657_0011878_2327_2926 | 185 |
| 74 | 3300046678 | Ga0495599_0022444 | Ga0495599_0022444_2657_3256 | 185 |
| 75 | 3300046680 | Ga0495646_0042753 | Ga0495646_0042753_841_1440 | 185 |
| 76 | 3300046689 | Ga0495613_0228307 | Ga0495613_0228307_293_892 | 185 |
| 77 | 3300046809 | Ga0495600_0006537 | Ga0495600_0006537_6467_7066 | 185 |
| 78 | 3300047317 | Ga0495604_0001495 | Ga0495604_0001495_8489_9088 | 185 |
| 79 | 3300047319 | Ga0495674_0133524 | Ga0495674_0133524_1302_1901 | 185 |
| 80 | 3300047322 | Ga0495680_0030852 | Ga0495680_0030852_2743_3342 | 185 |
| 81 | 3300047444 | Ga0495675_0013695 | Ga0495675_0013695_306_905 | 185 |
| 82 | 3300048088 | Ga0495602_0041551 | Ga0495602_0041551_816_1415 | 185 |
| 83 | 3300049741 | Ga0501079_0352151 | Ga0501079_0352151_88_690 | 185 |
| 84 | 3300053085 | Ga0495619_0083455 | Ga0495619_0083455_668_1267 | 185 |
| 85 | 3300003659 | JGI25404J52841_10016958 | JGI25404J52841_100169582 | 186 |
| 86 | 3300005983 | Ga0081540_1011557 | Ga0081540_10115576 | 186 |
| 87 | 3300044706 | Ga0466964_0060085 | Ga0466964_0060085_901_1503 | 186 |
| 88 | 3300044765 | Ga0466970_0104496 | Ga0466970_0104496_545_1147 | 186 |
| 89 | 3300045049 | Ga0466959_0070021 | Ga0466959_0070021_1922_2524 | 186 |
| 90 | 3300049580 | Ga0501046_0035061 | Ga0501046_0035061_1786_2388 | 187 |
| 91 | 3300049586 | Ga0501070_0030863 | Ga0501070_0030863_1951_2553 | 187 |
| 92 | 3300049742 | Ga0501080_0067890 | Ga0501080_0067890_733_1335 | 187 |
| 93 | 3300049822 | Ga0501035_0103083 | Ga0501035_0103083_578_1174 | 187 |
| 94 | 3300049822 | Ga0501035_0215165 | Ga0501035_0215165_75_677 | 187 |
| 95 | 3300049823 | Ga0501044_0081215 | Ga0501044_0081215_2230_2832 | 187 |
| 96 | 3300050492 | nmdc:mga0yw44_283734_c1 | nmdc:mga0yw44_283734_c1_174_785 | 187 |
| 97 | 3300006028 | Ga0070717_10070975 | Ga0070717_100709753 | 190 |
| 98 | 3300037418 | Ga0395900_0465600 | Ga0395900_0465600_95_709 | 190 |
| 99 | 3300037471 | Ga0395905_0012091 | Ga0395905_0012091_3708_4322 | 190 |
| 100 | 3300049572 | Ga0501036_0272301 | Ga0501036_0272301_111_713 | 190 |
| 101 | 3300049573 | Ga0501037_0635601 | Ga0501037_0635601_37_639 | 190 |
| 102 | 3300049574 | Ga0501038_0684945 | Ga0501038_0684945_156_758 | 190 |
| 103 | 3300049578 | Ga0501042_0185244 | Ga0501042_0185244_751_1353 | 190 |
| 104 | 3300049587 | Ga0501071_0306364 | Ga0501071_0306364_343_945 | 190 |
| 105 | 3300060353 | Ga0501082_0424384 | Ga0501082_0424384_26_628 | 190 |
| 106 | 3300025911 | Ga0207654_10145018 | Ga0207654_101450182 | 191 |
| 107 | iso_pu_bacteria | 2513237141 | 2513888670 | 191 |
| 108 | iso_pu_bacteria | 8006984368 | 8006990825 | 191 |
| 109 | 3300005841 | Ga0068863_100164671 | Ga0068863_1001646712 | 192 |
| 110 | 3300006237 | Ga0097621_100088568 | Ga0097621_1000885684 | 192 |
| 111 | 3300009101 | Ga0105247_10022343 | Ga0105247_100223432 | 192 |
| 112 | 3300009101 | Ga0105247_10121971 | Ga0105247_101219711 | 192 |
| 113 | 3300009545 | Ga0105237_10116340 | Ga0105237_101163403 | 192 |
| 114 | 3300025900 | Ga0207710_10060951 | Ga0207710_100609512 | 192 |
| 115 | 3300026035 | Ga0207703_10138552 | Ga0207703_101385522 | 192 |
| 116 | 3300026088 | Ga0207641_10238933 | Ga0207641_102389332 | 192 |
| 117 | 3300041503 | Ga0451847_0193603 | Ga0451847_0193603_180_782 | 192 |
| 118 | 3300048909 | Ga0496106_0000246 | Ga0496106_0000246_31168_31770 | 192 |
| 119 | 3300048921 | Ga0496118_0017920 | Ga0496118_0017920_3902_4504 | 192 |
| 120 | 3300048923 | Ga0496120_0051627 | Ga0496120_0051627_709_1314 | 192 |
| 121 | 3300048923 | Ga0496120_0081150 | Ga0496120_0081150_392_994 | 192 |
| 122 | 3300048924 | Ga0496121_0000423 | Ga0496121_0000423_5878_6480 | 192 |
| 123 | 3300048924 | Ga0496121_0067452 | Ga0496121_0067452_1166_1768 | 192 |
| 124 | 3300048927 | Ga0496124_0000235 | Ga0496124_0000235_91999_92601 | 192 |
| 125 | 3300048928 | Ga0496125_0088205 | Ga0496125_0088205_71_673 | 192 |
| 126 | 3300048929 | Ga0496126_0003857 | Ga0496126_0003857_2310_2912 | 192 |
| 127 | 3300048929 | Ga0496126_0169818 | Ga0496126_0169818_503_1105 | 192 |
| 128 | 3300053097 | Ga0500648_022378 | Ga0500648_022378_998_1600 | 192 |
| 129 | 3300053136 | Ga0500559_0011403 | Ga0500559_0011403_1735_2337 | 192 |
| 130 | 3300053140 | Ga0500573_0008315 | Ga0500573_0008315_1779_2381 | 192 |
| 131 | 3300053177 | Ga0500636_0167483 | Ga0500636_0167483_578_1180 | 192 |
| 132 | 3300053735 | Ga0500596_000520 | Ga0500596_000520_1308_1910 | 192 |
| 133 | iso_pu_bacteria | 2906626472 | 2906633389 | 192 |
| 134 | iso_pu_bacteria | 8016583857 | 8016586480 | 192 |
| 135 | 3300002075 | JGI24738J21930_10016956 | JGI24738J21930_100169561 | 193 |
| 136 | 3300005457 | Ga0070662_100264109 | Ga0070662_1002641092 | 193 |
| 137 | 3300005548 | Ga0070665_100016864 | Ga0070665_1000168642 | 193 |
| 138 | 3300006048 | Ga0075363_100072285 | Ga0075363_1000722852 | 193 |
| 139 | 3300006051 | Ga0075364_10262713 | Ga0075364_102627131 | 193 |
| 140 | 3300014325 | Ga0163163_10070758 | Ga0163163_100707583 | 193 |
| 141 | 3300025933 | Ga0207706_10174782 | Ga0207706_101747823 | 193 |
| 142 | 3300026067 | Ga0207678_10006070 | Ga0207678_1000607011 | 193 |
| 143 | 3300028379 | Ga0268266_10006358 | Ga0268266_100063586 | 193 |
| 144 | 3300041413 | Ga0439465_0031998 | Ga0439465_0031998_515_1117 | 193 |
| 145 | 3300048904 | Ga0496101_0135671 | Ga0496101_0135671_78_680 | 193 |
| 146 | 3300048907 | Ga0496104_0064008 | Ga0496104_0064008_2008_2610 | 193 |
| 147 | 3300050490 | nmdc:mga03n38_16625_c1 | nmdc:mga03n38_16625_c1_1955_2557 | 193 |
| 148 | 3300050491 | nmdc:mga00v17_215758_c1 | nmdc:mga00v17_215758_c1_353_955 | 193 |
| 149 | 3300053130 | Ga0500642_0000056 | Ga0500642_0000056_12973_13572 | 193 |
| 150 | iso_pu_bacteria | 2513237094 | 2513639825 | 193 |
| 151 | iso_pu_bacteria | 2513237104 | 2513719793 | 193 |
| 152 | iso_pu_bacteria | 8006926726 | 8006928550 | 193 |
| 153 | 3300005436 | Ga0070713_100052217 | Ga0070713_1000522172 | 194 |
| 154 | 3300005455 | Ga0070663_100207406 | Ga0070663_1002074062 | 194 |
| 155 | 3300005563 | Ga0068855_100170211 | Ga0068855_1001702112 | 194 |
| 156 | 3300005614 | Ga0068856_100161136 | Ga0068856_1001611362 | 194 |
| 157 | 3300006175 | Ga0070712_100138535 | Ga0070712_1001385352 | 194 |
| 158 | 3300013104 | Ga0157370_10023008 | Ga0157370_100230085 | 194 |
| 159 | 3300013105 | Ga0157369_10021320 | Ga0157369_100213203 | 194 |
| 160 | 3300013297 | Ga0157378_10027728 | Ga0157378_100277282 | 194 |
| 161 | 3300013307 | Ga0157372_10246402 | Ga0157372_102464022 | 194 |
| 162 | 3300020070 | Ga0206356_11485400 | Ga0206356_114854004 | 194 |
| 163 | 3300022467 | Ga0224712_10221794 | Ga0224712_102217941 | 194 |
| 164 | 3300025913 | Ga0207695_10074538 | Ga0207695_100745384 | 194 |
| 165 | 3300025915 | Ga0207693_10097562 | Ga0207693_100975622 | 194 |
| 166 | 3300025928 | Ga0207700_10154910 | Ga0207700_101549101 | 194 |
| 167 | 3300025949 | Ga0207667_10204076 | Ga0207667_102040762 | 194 |
| 168 | 3300026067 | Ga0207678_11077738 | Ga0207678_110777381 | 194 |
| 169 | 3300026078 | Ga0207702_10135424 | Ga0207702_101354242 | 194 |
| 170 | 3300037418 | Ga0395900_0037265 | Ga0395900_0037265_3117_3716 | 194 |
| 171 | 3300037466 | Ga0395898_0024063 | Ga0395898_0024063_5352_5951 | 194 |
| 172 | 3300038443 | Ga0395901_0084617 | Ga0395901_0084617_1962_2561 | 194 |
| 173 | 3300048912 | Ga0496109_0223495 | Ga0496109_0223495_91_690 | 194 |
| 174 | 3300002070 | JGI24750J21931_1058227 | JGI24750J21931_10582271 | 195 |
| 175 | 3300003214 | JGI25165J46597_1014034 | JGI25165J46597_10140341 | 195 |
| 176 | 3300003763 | Ga0055529_1017446 | Ga0055529_10174461 | 195 |
| 177 | 3300005295 | Ga0065707_10246177 | Ga0065707_102461772 | 195 |
| 178 | 3300005328 | Ga0070676_10252963 | Ga0070676_102529632 | 195 |
| 179 | 3300005328 | Ga0070676_10401625 | Ga0070676_104016251 | 195 |
| 180 | 3300005330 | Ga0070690_100350975 | Ga0070690_1003509751 | 195 |
| 181 | 3300005334 | Ga0068869_100039360 | Ga0068869_1000393601 | 195 |
| 182 | 3300005335 | Ga0070666_10173558 | Ga0070666_101735582 | 195 |
| 183 | 3300005337 | Ga0070682_100074395 | Ga0070682_1000743952 | 195 |
| 184 | 3300005338 | Ga0068868_100265700 | Ga0068868_1002657001 | 195 |
| 185 | 3300005339 | Ga0070660_100357285 | Ga0070660_1003572852 | 195 |
| 186 | 3300005340 | Ga0070689_100934831 | Ga0070689_1009348311 | 195 |
| 187 | 3300005344 | Ga0070661_100095203 | Ga0070661_1000952032 | 195 |
| 188 | 3300005356 | Ga0070674_100200230 | Ga0070674_1002002302 | 195 |
| 189 | 3300005364 | Ga0070673_100922543 | Ga0070673_1009225431 | 195 |
| 190 | 3300005367 | Ga0070667_100043929 | Ga0070667_1000439293 | 195 |
| 191 | 3300005438 | Ga0070701_10151054 | Ga0070701_101510542 | 195 |
| 192 | 3300005440 | Ga0070705_100409299 | Ga0070705_1004092992 | 195 |
| 193 | 3300005441 | Ga0070700_100145392 | Ga0070700_1001453922 | 195 |
| 194 | 3300005444 | Ga0070694_100597268 | Ga0070694_1005972681 | 195 |
| 195 | 3300005445 | Ga0070708_100592873 | Ga0070708_1005928732 | 195 |
| 196 | 3300005455 | Ga0070663_100410769 | Ga0070663_1004107691 | 195 |
| 197 | 3300005456 | Ga0070678_100131001 | Ga0070678_1001310012 | 195 |
| 198 | 3300005457 | Ga0070662_100029595 | Ga0070662_1000295952 | 195 |
| 199 | 3300005471 | Ga0070698_100052755 | Ga0070698_1000527553 | 195 |
| 200 | 3300005539 | Ga0068853_100110382 | Ga0068853_1001103822 | 195 |
| 201 | 3300005543 | Ga0070672_100777343 | Ga0070672_1007773431 | 195 |
| 202 | 3300005548 | Ga0070665_100110444 | Ga0070665_1001104442 | 195 |
| 203 | 3300005548 | Ga0070665_100318507 | Ga0070665_1003185072 | 195 |
| 204 | 3300005549 | Ga0070704_100085572 | Ga0070704_1000855723 | 195 |
| 205 | 3300005564 | Ga0070664_100076757 | Ga0070664_1000767573 | 195 |
| 206 | 3300005578 | Ga0068854_100689806 | Ga0068854_1006898061 | 195 |
| 207 | 3300005616 | Ga0068852_100600808 | Ga0068852_1006008081 | 195 |
| 208 | 3300005617 | Ga0068859_101038769 | Ga0068859_1010387691 | 195 |
| 209 | 3300005618 | Ga0068864_100752973 | Ga0068864_1007529732 | 195 |
| 210 | 3300005719 | Ga0068861_100255131 | Ga0068861_1002551312 | 195 |
| 211 | 3300005719 | Ga0068861_100314185 | Ga0068861_1003141851 | 195 |
| 212 | 3300005842 | Ga0068858_100097450 | Ga0068858_1000974503 | 195 |
| 213 | 3300005843 | Ga0068860_100295294 | Ga0068860_1002952941 | 195 |
| 214 | 3300005843 | Ga0068860_100426397 | Ga0068860_1004263971 | 195 |
| 215 | 3300005844 | Ga0068862_100104509 | Ga0068862_1001045092 | 195 |
| 216 | 3300005844 | Ga0068862_100495819 | Ga0068862_1004958192 | 195 |
| 217 | 3300005983 | Ga0081540_1003529 | Ga0081540_10035295 | 195 |
| 218 | 3300006038 | Ga0075365_10011114 | Ga0075365_100111145 | 195 |
| 219 | 3300006038 | Ga0075365_10016638 | Ga0075365_100166384 | 195 |
| 220 | 3300006042 | Ga0075368_10162014 | Ga0075368_101620142 | 195 |
| 221 | 3300006051 | Ga0075364_10480288 | Ga0075364_104802881 | 195 |
| 222 | 3300006177 | Ga0075362_10035670 | Ga0075362_100356702 | 195 |
| 223 | 3300006177 | Ga0075362_10136571 | Ga0075362_101365711 | 195 |
| 224 | 3300006177 | Ga0075362_10243342 | Ga0075362_102433421 | 195 |
| 225 | 3300006178 | Ga0075367_10111628 | Ga0075367_101116281 | 195 |
| 226 | 3300006178 | Ga0075367_10182297 | Ga0075367_101822972 | 195 |
| 227 | 3300006178 | Ga0075367_10499585 | Ga0075367_104995851 | 195 |
| 228 | 3300006186 | Ga0075369_10066844 | Ga0075369_100668442 | 195 |
| 229 | 3300006195 | Ga0075366_10075643 | Ga0075366_100756432 | 195 |
| 230 | 3300006195 | Ga0075366_10183412 | Ga0075366_101834122 | 195 |
| 231 | 3300006353 | Ga0075370_10146480 | Ga0075370_101464802 | 195 |
| 232 | 3300006353 | Ga0075370_10420753 | Ga0075370_104207531 | 195 |
| 233 | 3300006844 | Ga0075428_100345035 | Ga0075428_1003450352 | 195 |
| 234 | 3300006881 | Ga0068865_100325690 | Ga0068865_1003256902 | 195 |
| 235 | 3300006931 | Ga0097620_101038793 | Ga0097620_1010387931 | 195 |
| 236 | 3300007788 | Ga0099795_10046630 | Ga0099795_100466302 | 195 |
| 237 | 3300009092 | Ga0105250_10047595 | Ga0105250_100475952 | 195 |
| 238 | 3300009094 | Ga0111539_10459047 | Ga0111539_104590471 | 195 |
| 239 | 3300009147 | Ga0114129_10062265 | Ga0114129_100622653 | 195 |
| 240 | 3300009174 | Ga0105241_10233452 | Ga0105241_102334522 | 195 |
| 241 | 3300009176 | Ga0105242_10490695 | Ga0105242_104906952 | 195 |
| 242 | 3300009177 | Ga0105248_10129944 | Ga0105248_101299442 | 195 |
| 243 | 3300009545 | Ga0105237_10361742 | Ga0105237_103617422 | 195 |
| 244 | 3300009553 | Ga0105249_10455878 | Ga0105249_104558782 | 195 |
| 245 | 3300010375 | Ga0105239_10583169 | Ga0105239_105831692 | 195 |
| 246 | 3300010375 | Ga0105239_11495542 | Ga0105239_114955421 | 195 |
| 247 | 3300013296 | Ga0157374_10257282 | Ga0157374_102572822 | 195 |
| 248 | 3300014325 | Ga0163163_10860278 | Ga0163163_108602782 | 195 |
| 249 | 3300014326 | Ga0157380_10972443 | Ga0157380_109724431 | 195 |
| 250 | 3300014968 | Ga0157379_10179322 | Ga0157379_101793223 | 195 |
| 251 | 3300017792 | Ga0163161_10504466 | Ga0163161_105044661 | 195 |
| 252 | 3300025254 | Ga0209148_1038378 | Ga0209148_10383781 | 195 |
| 253 | 3300025261 | Ga0209233_1001687 | Ga0209233_10016874 | 195 |
| 254 | 3300025272 | Ga0209455_1017269 | Ga0209455_10172692 | 195 |
| 255 | 3300025297 | Ga0209758_1013259 | Ga0209758_10132593 | 195 |
| 256 | 3300025711 | Ga0207696_1017234 | Ga0207696_10172341 | 195 |
| 257 | 3300025885 | Ga0207653_10007878 | Ga0207653_100078781 | 195 |
| 258 | 3300025900 | Ga0207710_10094798 | Ga0207710_100947982 | 195 |
| 259 | 3300025908 | Ga0207643_10083781 | Ga0207643_100837812 | 195 |
| 260 | 3300025920 | Ga0207649_10059456 | Ga0207649_100594562 | 195 |
| 261 | 3300025923 | Ga0207681_10064653 | Ga0207681_100646532 | 195 |
| 262 | 3300025923 | Ga0207681_10296300 | Ga0207681_102963001 | 195 |
| 263 | 3300025933 | Ga0207706_10027953 | Ga0207706_100279534 | 195 |
| 264 | 3300025935 | Ga0207709_10308397 | Ga0207709_103083972 | 195 |
| 265 | 3300025938 | Ga0207704_10200058 | Ga0207704_102000582 | 195 |
| 266 | 3300025940 | Ga0207691_10231386 | Ga0207691_102313862 | 195 |
| 267 | 3300025945 | Ga0207679_10765975 | Ga0207679_107659752 | 195 |
| 268 | 3300025961 | Ga0207712_10021518 | Ga0207712_100215182 | 195 |
| 269 | 3300025961 | Ga0207712_10534659 | Ga0207712_105346592 | 195 |
| 270 | 3300025972 | Ga0207668_10028136 | Ga0207668_100281364 | 195 |
| 271 | 3300025981 | Ga0207640_10412030 | Ga0207640_104120301 | 195 |
| 272 | 3300026023 | Ga0207677_10066110 | Ga0207677_100661101 | 195 |
| 273 | 3300026035 | Ga0207703_10505914 | Ga0207703_105059142 | 195 |
| 274 | 3300026041 | Ga0207639_10181804 | Ga0207639_101818041 | 195 |
| 275 | 3300026041 | Ga0207639_10535287 | Ga0207639_105352871 | 195 |
| 276 | 3300026067 | Ga0207678_10265187 | Ga0207678_102651872 | 195 |
| 277 | 3300026067 | Ga0207678_10787624 | Ga0207678_107876241 | 195 |
| 278 | 3300026075 | Ga0207708_10077611 | Ga0207708_100776113 | 195 |
| 279 | 3300026088 | Ga0207641_10581130 | Ga0207641_105811301 | 195 |
| 280 | 3300026121 | Ga0207683_10918717 | Ga0207683_109187171 | 195 |
| 281 | 3300028380 | Ga0268265_10173023 | Ga0268265_101730231 | 195 |
| 282 | 3300028381 | Ga0268264_10073977 | Ga0268264_100739772 | 195 |
| 283 | 3300028381 | Ga0268264_10098422 | Ga0268264_100984221 | 195 |
| 284 | 3300028786 | Ga0307517_10115849 | Ga0307517_101158492 | 195 |
| 285 | 3300031249 | Ga0265339_10012970 | Ga0265339_100129706 | 195 |
| 286 | 3300031456 | Ga0307513_10851660 | Ga0307513_108516601 | 195 |
| 287 | 3300031507 | Ga0307509_10254585 | Ga0307509_102545852 | 195 |
| 288 | 3300031852 | Ga0307410_10544250 | Ga0307410_105442501 | 195 |
| 289 | 3300031889 | Ga0326468_10035826 | Ga0326468_100358261 | 195 |
| 290 | 3300031901 | Ga0307406_10478605 | Ga0307406_104786051 | 195 |
| 291 | 3300031903 | Ga0307407_10193402 | Ga0307407_101934021 | 195 |
| 292 | 3300031903 | Ga0307407_10629871 | Ga0307407_106298711 | 195 |
| 293 | 3300031995 | Ga0307409_100060330 | Ga0307409_1000603303 | 195 |
| 294 | 3300032002 | Ga0307416_100216275 | Ga0307416_1002162752 | 195 |
| 295 | 3300032002 | Ga0307416_100396580 | Ga0307416_1003965802 | 195 |
| 296 | 3300032004 | Ga0307414_10451727 | Ga0307414_104517272 | 195 |
| 297 | 3300032005 | Ga0307411_10064291 | Ga0307411_100642912 | 195 |
| 298 | 3300032126 | Ga0307415_100126311 | Ga0307415_1001263112 | 195 |
| 299 | 3300032126 | Ga0307415_100126456 | Ga0307415_1001264562 | 195 |
| 300 | 3300032126 | Ga0307415_100138565 | Ga0307415_1001385653 | 195 |
| 301 | 3300033180 | Ga0307510_10003322 | Ga0307510_1000332215 | 195 |
| 302 | 3300034957 | Ga0373938_0048481 | Ga0373938_0048481_185_772 | 195 |
| 303 | 3300035112 | Ga0373932_0060343 | Ga0373932_0060343_297_884 | 195 |
| 304 | 3300035241 | Ga0373961_0065596 | Ga0373961_0065596_71_658 | 195 |
| 305 | 3300035695 | Ga0373927_0091690 | Ga0373927_0091690_568_1155 | 195 |
| 306 | 3300035725 | Ga0373947_0272036 | Ga0373947_0272036_261_848 | 195 |
| 307 | 3300039437 | Ga0436365_0049558 | Ga0436365_0049558_2586_3173 | 195 |
| 308 | 3300039450 | Ga0436363_1542117 | Ga0436363_1542117_3297_3884 | 195 |
| 309 | 3300041413 | Ga0439465_0016189 | Ga0439465_0016189_1722_2309 | 195 |
| 310 | 3300041453 | Ga0451797_0206793 | Ga0451797_0206793_12_599 | 195 |
| 311 | 3300041486 | Ga0451807_0416485 | Ga0451807_0416485_802_1389 | 195 |
| 312 | 3300041997 | Ga0439431_0010867 | Ga0439431_0010867_1026_1613 | 195 |
| 313 | 3300044656 | Ga0466969_0243047 | Ga0466969_0243047_77_679 | 195 |
| 314 | 3300044719 | Ga0466971_0190593 | Ga0466971_0190593_139_726 | 195 |
| 315 | 3300044842 | Ga0466957_0404481 | Ga0466957_0404481_148_735 | 195 |
| 316 | 3300045976 | Ga0466967_0074353 | Ga0466967_0074353_1240_1827 | 195 |
| 317 | 3300046452 | Ga0495617_017561 | Ga0495617_017561_1356_1943 | 195 |
| 318 | 3300046452 | Ga0495617_066632 | Ga0495617_066632_275_862 | 195 |
| 319 | 3300046455 | Ga0495603_0018817 | Ga0495603_0018817_570_1157 | 195 |
| 320 | 3300046457 | Ga0495590_0036775 | Ga0495590_0036775_291_878 | 195 |
| 321 | 3300046459 | Ga0495629_0118206 | Ga0495629_0118206_85_672 | 195 |
| 322 | 3300046460 | Ga0495638_0163843 | Ga0495638_0163843_337_924 | 195 |
| 323 | 3300046460 | Ga0495638_0230159 | Ga0495638_0230159_82_669 | 195 |
| 324 | 3300046461 | Ga0495641_0040198 | Ga0495641_0040198_568_1155 | 195 |
| 325 | 3300046471 | Ga0495650_0038999 | Ga0495650_0038999_381_968 | 195 |
| 326 | 3300046471 | Ga0495650_0046877 | Ga0495650_0046877_911_1498 | 195 |
| 327 | 3300046474 | Ga0495605_0076706 | Ga0495605_0076706_510_1097 | 195 |
| 328 | 3300046492 | Ga0495585_0112504 | Ga0495585_0112504_288_875 | 195 |
| 329 | 3300046492 | Ga0495585_0176527 | Ga0495585_0176527_500_1087 | 195 |
| 330 | 3300046492 | Ga0495585_0235565 | Ga0495585_0235565_24_611 | 195 |
| 331 | 3300046492 | Ga0495585_0293089 | Ga0495585_0293089_14_601 | 195 |
| 332 | 3300046500 | Ga0495596_0012911 | Ga0495596_0012911_2546_3133 | 195 |
| 333 | 3300046500 | Ga0495596_0101019 | Ga0495596_0101019_311_898 | 195 |
| 334 | 3300046501 | Ga0495607_0092479 | Ga0495607_0092479_288_875 | 195 |
| 335 | 3300046506 | Ga0495583_0055178 | Ga0495583_0055178_353_940 | 195 |
| 336 | 3300046512 | Ga0495610_0080804 | Ga0495610_0080804_451_1038 | 195 |
| 337 | 3300046513 | Ga0495616_0144093 | Ga0495616_0144093_481_1068 | 195 |
| 338 | 3300046518 | Ga0495631_0046685 | Ga0495631_0046685_1207_1794 | 195 |
| 339 | 3300046518 | Ga0495631_0134945 | Ga0495631_0134945_271_858 | 195 |
| 340 | 3300046519 | Ga0495632_0102235 | Ga0495632_0102235_284_871 | 195 |
| 341 | 3300046519 | Ga0495632_0142848 | Ga0495632_0142848_365_952 | 195 |
| 342 | 3300046519 | Ga0495632_0228634 | Ga0495632_0228634_201_788 | 195 |
| 343 | 3300046523 | Ga0495644_0021784 | Ga0495644_0021784_287_874 | 195 |
| 344 | 3300046523 | Ga0495644_0085613 | Ga0495644_0085613_301_888 | 195 |
| 345 | 3300046525 | Ga0495663_0029627 | Ga0495663_0029627_720_1307 | 195 |
| 346 | 3300046528 | Ga0495642_0081369 | Ga0495642_0081369_287_874 | 195 |
| 347 | 3300046530 | Ga0495654_0099145 | Ga0495654_0099145_357_944 | 195 |
| 348 | 3300046537 | Ga0495598_0081760 | Ga0495598_0081760_430_1017 | 195 |
| 349 | 3300046539 | Ga0495621_0295376 | Ga0495621_0295376_12_599 | 195 |
| 350 | 3300046542 | Ga0495597_0030293 | Ga0495597_0030293_469_1056 | 195 |
| 351 | 3300046557 | Ga0495622_0015487 | Ga0495622_0015487_501_1088 | 195 |
| 352 | 3300046558 | Ga0495633_0027177 | Ga0495633_0027177_1872_2459 | 195 |
| 353 | 3300046558 | Ga0495633_0109096 | Ga0495633_0109096_433_1020 | 195 |
| 354 | 3300046615 | Ga0495656_0006193 | Ga0495656_0006193_1682_2269 | 195 |
| 355 | 3300046615 | Ga0495656_0200390 | Ga0495656_0200390_331_918 | 195 |
| 356 | 3300046615 | Ga0495656_0251103 | Ga0495656_0251103_236_823 | 195 |
| 357 | 3300046616 | Ga0495668_0145460 | Ga0495668_0145460_351_938 | 195 |
| 358 | 3300046648 | Ga0495611_0346005 | Ga0495611_0346005_68_655 | 195 |
| 359 | 3300046660 | Ga0495625_0249887 | Ga0495625_0249887_341_928 | 195 |
| 360 | 3300046664 | Ga0495659_0057557 | Ga0495659_0057557_523_1110 | 195 |
| 361 | 3300046664 | Ga0495659_0176964 | Ga0495659_0176964_238_825 | 195 |
| 362 | 3300046665 | Ga0495661_0181717 | Ga0495661_0181717_306_893 | 195 |
| 363 | 3300046674 | Ga0495588_0008457 | Ga0495588_0008457_3750_4337 | 195 |
| 364 | 3300046684 | Ga0495669_0180049 | Ga0495669_0180049_107_694 | 195 |
| 365 | 3300046684 | Ga0495669_0287533 | Ga0495669_0287533_94_681 | 195 |
| 366 | 3300046690 | Ga0495624_0437610 | Ga0495624_0437610_22_609 | 195 |
| 367 | 3300046691 | Ga0495670_0081732 | Ga0495670_0081732_307_894 | 195 |
| 368 | 3300046691 | Ga0495670_0182182 | Ga0495670_0182182_496_1083 | 195 |
| 369 | 3300046692 | Ga0495671_0025305 | Ga0495671_0025305_351_938 | 195 |
| 370 | 3300046692 | Ga0495671_0337478 | Ga0495671_0337478_61_648 | 195 |
| 371 | 3300046809 | Ga0495600_0451479 | Ga0495600_0451479_136_723 | 195 |
| 372 | 3300047315 | Ga0495581_0152314 | Ga0495581_0152314_199_786 | 195 |
| 373 | 3300047315 | Ga0495581_0244467 | Ga0495581_0244467_155_742 | 195 |
| 374 | 3300047318 | Ga0495636_0117453 | Ga0495636_0117453_562_1149 | 195 |
| 375 | 3300047318 | Ga0495636_0235264 | Ga0495636_0235264_189_776 | 195 |
| 376 | 3300047320 | Ga0495672_0168472 | Ga0495672_0168472_505_1092 | 195 |
| 377 | 3300047323 | Ga0495683_0094536 | Ga0495683_0094536_376_963 | 195 |
| 378 | 3300047323 | Ga0495683_0204472 | Ga0495683_0204472_123_710 | 195 |
| 379 | 3300047443 | Ga0495687_113427 | Ga0495687_113427_290_877 | 195 |
| 380 | 3300047447 | Ga0495685_124879 | Ga0495685_124879_47_634 | 195 |
| 381 | 3300047469 | Ga0495673_0103518 | Ga0495673_0103518_359_946 | 195 |
| 382 | 3300047470 | Ga0495681_0132641 | Ga0495681_0132641_187_774 | 195 |
| 383 | 3300048906 | Ga0496103_0261204 | Ga0496103_0261204_125_712 | 195 |
| 384 | 3300048911 | Ga0496108_0112602 | Ga0496108_0112602_27_614 | 195 |
| 385 | 3300048911 | Ga0496108_0459755 | Ga0496108_0459755_361_948 | 195 |
| 386 | 3300048914 | Ga0496111_0415474 | Ga0496111_0415474_363_950 | 195 |
| 387 | 3300048922 | Ga0496119_0146239 | Ga0496119_0146239_635_1222 | 195 |
| 388 | 3300048924 | Ga0496121_0047049 | Ga0496121_0047049_1121_1708 | 195 |
| 389 | 3300048924 | Ga0496121_0432990 | Ga0496121_0432990_189_776 | 195 |
| 390 | 3300048927 | Ga0496124_0343705 | Ga0496124_0343705_313_900 | 195 |
| 391 | 3300048928 | Ga0496125_0231529 | Ga0496125_0231529_253_840 | 195 |
| 392 | 3300048929 | Ga0496126_0027355 | Ga0496126_0027355_2291_2878 | 195 |
| 393 | 3300048929 | Ga0496126_0322827 | Ga0496126_0322827_420_1007 | 195 |
| 394 | 3300050489 | nmdc:mga03683_12822_c1 | nmdc:mga03683_12822_c1_1299_1886 | 195 |
| 395 | 3300050489 | nmdc:mga03683_305416_c1 | nmdc:mga03683_305416_c1_126_713 | 195 |
| 396 | 3300050490 | nmdc:mga03n38_164641_c1 | nmdc:mga03n38_164641_c1_282_869 | 195 |
| 397 | 3300050492 | nmdc:mga0yw44_143373_c1 | nmdc:mga0yw44_143373_c1_623_1210 | 195 |
| 398 | 3300050492 | nmdc:mga0yw44_23370_c1 | nmdc:mga0yw44_23370_c1_1826_2413 | 195 |
| 399 | 3300050493 | nmdc:mga0k408_16499_c1 | nmdc:mga0k408_16499_c1_1224_1811 | 195 |
| 400 | 3300050493 | nmdc:mga0k408_287856_c1 | nmdc:mga0k408_287856_c1_41_628 | 195 |
| 401 | 3300050493 | nmdc:mga0k408_338027_c1 | nmdc:mga0k408_338027_c1_244_831 | 195 |
| 402 | 3300050493 | nmdc:mga0k408_445760_c1 | nmdc:mga0k408_445760_c1_121_708 | 195 |
| 403 | 3300050494 | nmdc:mga06z11_242617_c1 | nmdc:mga06z11_242617_c1_337_924 | 195 |
| 404 | 3300050494 | nmdc:mga06z11_521349_c1 | nmdc:mga06z11_521349_c1_28_615 | 195 |
| 405 | 3300050507 | nmdc:mga05p37_44315_c1 | nmdc:mga05p37_44315_c1_1089_1676 | 195 |
| 406 | 3300050508 | nmdc:mga09592_163313_c1 | nmdc:mga09592_163313_c1_50_637 | 195 |
| 407 | 3300050511 | nmdc:mga08y16_1017078_c1 | nmdc:mga08y16_1017078_c1_198_785 | 195 |
| 408 | 3300050516 | nmdc:mga0sz30_47472_c1 | nmdc:mga0sz30_47472_c1_602_1189 | 195 |
| 409 | 3300053086 | Ga0500578_0157908 | Ga0500578_0157908_464_1051 | 195 |
| 410 | 3300053088 | Ga0500644_0157458 | Ga0500644_0157458_294_881 | 195 |
| 411 | 3300053092 | Ga0500583_0147020 | Ga0500583_0147020_329_916 | 195 |
| 412 | 3300053093 | Ga0500651_0055720 | Ga0500651_0055720_858_1445 | 195 |
| 413 | 3300053096 | Ga0500641_0004785 | Ga0500641_0004785_3381_3968 | 195 |
| 414 | 3300053096 | Ga0500641_0005288 | Ga0500641_0005288_1027_1617 | 195 |
| 415 | 3300053108 | Ga0500562_012950 | Ga0500562_012950_965_1552 | 195 |
| 416 | 3300053119 | Ga0500595_003367 | Ga0500595_003367_3569_4156 | 195 |
| 417 | 3300053120 | Ga0500597_055210 | Ga0500597_055210_1009_1596 | 195 |
| 418 | 3300053126 | Ga0500621_196046 | Ga0500621_196046_42_629 | 195 |
| 419 | 3300053130 | Ga0500642_0054062 | Ga0500642_0054062_888_1475 | 195 |
| 420 | 3300053137 | Ga0500561_0026304 | Ga0500561_0026304_822_1409 | 195 |
| 421 | 3300053147 | Ga0500589_045029 | Ga0500589_045029_1419_2006 | 195 |
| 422 | 3300053156 | Ga0500622_0109096 | Ga0500622_0109096_605_1192 | 195 |
| 423 | 3300053158 | Ga0500627_0052195 | Ga0500627_0052195_1057_1644 | 195 |
| 424 | 3300053178 | Ga0500637_0162959 | Ga0500637_0162959_378_965 | 195 |
| 425 | 3300053730 | Ga0500645_006753 | Ga0500645_006753_1875_2462 | 195 |
| 426 | iso_pu_bacteria | 2513237096 | 2513661519 | 195 |
| 427 | iso_pu_bacteria | 2513237137 | 2513860480 | 195 |
| 428 | iso_pu_bacteria | 2513237145 | 2513923218 | 195 |
| 429 | iso_pu_bacteria | 2517572143 | 2517888737 | 195 |
| 430 | iso_pu_bacteria | 2524023228 | 2524538839 | 195 |
| 431 | iso_pu_bacteria | 2667528175 | 2671119913 | 195 |
| 432 | iso_pu_bacteria | 2728368998 | 2728754900 | 195 |
| 433 | iso_pu_bacteria | 2791355197 | 2793067559 | 195 |
| 434 | iso_pu_bacteria | 2903748898 | 2903756365 | 195 |
| 435 | iso_pu_bacteria | 2904699407 | 2904708831 | 195 |
| 436 | iso_pu_bacteria | 2906610324 | 2906613770 | 195 |
| 437 | iso_pu_bacteria | 2906635258 | 2906640079 | 195 |
| 438 | iso_pu_bacteria | 2906660503 | 2906667473 | 195 |
| 439 | iso_pu_bacteria | 2908739725 | 2908747330 | 195 |
| 440 | iso_pu_bacteria | 2922425934 | 2922434386 | 195 |
| 441 | iso_pu_bacteria | 2935630451 | 2935635482 | 195 |
| 442 | iso_pu_bacteria | 2941507105 | 2941512221 | 195 |
| 443 | iso_pu_bacteria | 2941515067 | 2941519922 | 195 |
| 444 | iso_pu_bacteria | 2941523033 | 2941528137 | 195 |
| 445 | iso_pu_bacteria | 3005474847 | 3005474969 | 195 |
| 446 | iso_pu_bacteria | 8006933436 | 8006936355 | 195 |
| 447 | iso_pu_bacteria | 8006973647 | 8006976324 | 195 |
| 448 | iso_pu_bacteria | 8019555841 | 8019562301 | 195 |
| 449 | iso_pu_bacteria | 8019565922 | 8019572372 | 195 |
| 450 | 3300005327 | Ga0070658_10335902 | Ga0070658_103359022 | 196 |
| 451 | 3300005331 | Ga0070670_100415302 | Ga0070670_1004153021 | 196 |
| 452 | 3300005334 | Ga0068869_100834719 | Ga0068869_1008347192 | 196 |
| 453 | 3300005338 | Ga0068868_100493970 | Ga0068868_1004939701 | 196 |
| 454 | 3300005455 | Ga0070663_100046873 | Ga0070663_1000468732 | 196 |
| 455 | 3300005456 | Ga0070678_100017953 | Ga0070678_1000179532 | 196 |
| 456 | 3300005535 | Ga0070684_100585478 | Ga0070684_1005854782 | 196 |
| 457 | 3300005548 | Ga0070665_100116082 | Ga0070665_1001160822 | 196 |
| 458 | 3300005564 | Ga0070664_100010417 | Ga0070664_1000104171 | 196 |
| 459 | 3300005618 | Ga0068864_100019747 | Ga0068864_1000197479 | 196 |
| 460 | 3300006237 | Ga0097621_100020867 | Ga0097621_1000208673 | 196 |
| 461 | 3300009098 | Ga0105245_10005676 | Ga0105245_100056763 | 196 |
| 462 | 3300009177 | Ga0105248_10129116 | Ga0105248_101291161 | 196 |
| 463 | 3300009551 | Ga0105238_10337524 | Ga0105238_103375242 | 196 |
| 464 | 3300010375 | Ga0105239_10174408 | Ga0105239_101744081 | 196 |
| 465 | 3300011119 | Ga0105246_10013246 | Ga0105246_100132463 | 196 |
| 466 | 3300013296 | Ga0157374_10013103 | Ga0157374_1001310310 | 196 |
| 467 | 3300013306 | Ga0163162_10012800 | Ga0163162_100128002 | 196 |
| 468 | 3300013308 | Ga0157375_10017001 | Ga0157375_100170018 | 196 |
| 469 | 3300014325 | Ga0163163_10006051 | Ga0163163_1000605111 | 196 |
| 470 | 3300014968 | Ga0157379_10232443 | Ga0157379_102324432 | 196 |
| 471 | 3300014969 | Ga0157376_10053451 | Ga0157376_100534512 | 196 |
| 472 | 3300025909 | Ga0207705_10329758 | Ga0207705_103297581 | 196 |
| 473 | 3300025924 | Ga0207694_10277853 | Ga0207694_102778531 | 196 |
| 474 | 3300025927 | Ga0207687_10005566 | Ga0207687_100055666 | 196 |
| 475 | 3300025938 | Ga0207704_10618273 | Ga0207704_106182731 | 196 |
| 476 | 3300025939 | Ga0207665_10942185 | Ga0207665_109421851 | 196 |
| 477 | 3300025942 | Ga0207689_10768290 | Ga0207689_107682901 | 196 |
| 478 | 3300025945 | Ga0207679_10210950 | Ga0207679_102109503 | 196 |
| 479 | 3300026023 | Ga0207677_10330932 | Ga0207677_103309322 | 196 |
| 480 | 3300026035 | Ga0207703_10341235 | Ga0207703_103412352 | 196 |
| 481 | 3300026067 | Ga0207678_10067680 | Ga0207678_100676804 | 196 |
| 482 | 3300026095 | Ga0207676_10210579 | Ga0207676_102105792 | 196 |
| 483 | 3300026121 | Ga0207683_10019612 | Ga0207683_100196123 | 196 |
| 484 | 3300028379 | Ga0268266_10454973 | Ga0268266_104549731 | 196 |
| 485 | 3300039438 | Ga0436360_0450373 | Ga0436360_0450373_198_788 | 196 |
| 486 | 3300048903 | Ga0496100_0098443 | Ga0496100_0098443_767_1357 | 196 |
| 487 | 3300048904 | Ga0496101_0002473 | Ga0496101_0002473_6455_7045 | 196 |
| 488 | 3300048905 | Ga0496102_0002704 | Ga0496102_0002704_1836_2426 | 196 |
| 489 | 3300048906 | Ga0496103_0029149 | Ga0496103_0029149_2503_3093 | 196 |
| 490 | 3300048907 | Ga0496104_0304310 | Ga0496104_0304310_499_1089 | 196 |
| 491 | 3300048908 | Ga0496105_0003117 | Ga0496105_0003117_428_1018 | 196 |
| 492 | 3300048909 | Ga0496106_0007049 | Ga0496106_0007049_7616_8206 | 196 |
| 493 | 3300048910 | Ga0496107_0011607 | Ga0496107_0011607_12_602 | 196 |
| 494 | 3300048911 | Ga0496108_0080000 | Ga0496108_0080000_522_1112 | 196 |
| 495 | 3300048912 | Ga0496109_0013738 | Ga0496109_0013738_1391_1981 | 196 |
| 496 | 3300048913 | Ga0496110_0041605 | Ga0496110_0041605_2638_3228 | 196 |
| 497 | 3300048914 | Ga0496111_0012718 | Ga0496111_0012718_4834_5424 | 196 |
| 498 | 3300048915 | Ga0496112_0055635 | Ga0496112_0055635_1162_1752 | 196 |
| 499 | 3300048916 | Ga0496113_0005880 | Ga0496113_0005880_5383_5973 | 196 |
| 500 | 3300048917 | Ga0496114_0088393 | Ga0496114_0088393_1518_2108 | 196 |
| 501 | 3300048918 | Ga0496115_0001912 | Ga0496115_0001912_8703_9293 | 196 |
| 502 | 3300053083 | Ga0495655_0006062 | Ga0495655_0006062_1285_1875 | 196 |
| 503 | iso_pu_bacteria | 2513237098 | 2513674674 | 196 |
| 504 | iso_pu_bacteria | 2524023210 | 2524467408 | 196 |
| 505 | iso_pu_bacteria | 2602042107 | 2603858419 | 196 |
| 506 | iso_pu_bacteria | 2721755755 | 2723841545 | 196 |
| 507 | iso_pu_bacteria | 2791355199 | 2793079223 | 196 |
| 508 | iso_pu_bacteria | 2824704595 | 2824709436 | 196 |
| 509 | iso_pu_bacteria | 2824753945 | 2824757724 | 196 |
| 510 | iso_pu_bacteria | 2824763712 | 2824768764 | 196 |
| 511 | iso_pu_bacteria | 2876808645 | 2876813376 | 196 |
| 512 | iso_pu_bacteria | 2879110137 | 2879113071 | 196 |
| 513 | iso_pu_bacteria | 2889033259 | 2889035609 | 196 |
| 514 | iso_pu_bacteria | 2893066018 | 2893067269 | 196 |
| 515 | iso_pu_bacteria | 2904711408 | 2904713074 | 196 |
| 516 | iso_pu_bacteria | 2922361189 | 2922364088 | 196 |
| 517 | iso_pu_bacteria | 2922386360 | 2922392664 | 196 |
| 518 | iso_pu_bacteria | 8006964411 | 8006969267 | 196 |
| 519 | iso_pu_bacteria | 8056673599 | 8056675644 | 196 |
| 520 | iso_pu_bacteria | 8056681323 | 8056687490 | 196 |
| 521 | 3300044693 | Ga0466961_0338894 | Ga0466961_0338894_71_670 | 197 |
| 522 | 3300005434 | Ga0070709_10052854 | Ga0070709_100528543 | 198 |
| 523 | 3300025250 | Ga0209026_1022660 | Ga0209026_10226602 | 198 |
| 524 | 3300039437 | Ga0436365_0229769 | Ga0436365_0229769_345_941 | 198 |
| 525 | 3300039450 | Ga0436363_0889462 | Ga0436363_0889462_212_808 | 198 |
| 526 | 3300050494 | nmdc:mga06z11_79657_c1 | nmdc:mga06z11_79657_c1_541_1137 | 198 |
| 527 | 3300005328 | Ga0070676_10654818 | Ga0070676_106548181 | 199 |
| 528 | 3300005367 | Ga0070667_100035791 | Ga0070667_1000357912 | 199 |
| 529 | 3300005434 | Ga0070709_10002152 | Ga0070709_1000215210 | 199 |
| 530 | 3300005435 | Ga0070714_100136937 | Ga0070714_1001369372 | 199 |
| 531 | 3300005436 | Ga0070713_100068135 | Ga0070713_1000681354 | 199 |
| 532 | 3300005439 | Ga0070711_100008601 | Ga0070711_1000086016 | 199 |
| 533 | 3300005455 | Ga0070663_100757148 | Ga0070663_1007571481 | 199 |
| 534 | 3300005457 | Ga0070662_100607869 | Ga0070662_1006078691 | 199 |
| 535 | 3300005548 | Ga0070665_100241790 | Ga0070665_1002417902 | 199 |
| 536 | 3300006042 | Ga0075368_10054207 | Ga0075368_100542072 | 199 |
| 537 | 3300006048 | Ga0075363_100022751 | Ga0075363_1000227513 | 199 |
| 538 | 3300006051 | Ga0075364_10509418 | Ga0075364_105094181 | 199 |
| 539 | 3300006175 | Ga0070712_100738047 | Ga0070712_1007380471 | 199 |
| 540 | 3300006353 | Ga0075370_10127918 | Ga0075370_101279182 | 199 |
| 541 | 3300009551 | Ga0105238_11051484 | Ga0105238_110514841 | 199 |
| 542 | 3300009553 | Ga0105249_10672139 | Ga0105249_106721391 | 199 |
| 543 | 3300010375 | Ga0105239_10121406 | Ga0105239_101214063 | 199 |
| 544 | 3300013296 | Ga0157374_11223248 | Ga0157374_112232481 | 199 |
| 545 | 3300014326 | Ga0157380_11451865 | Ga0157380_114518651 | 199 |
| 546 | 3300014745 | Ga0157377_10521161 | Ga0157377_105211612 | 199 |
| 547 | 3300025261 | Ga0209233_1001331 | Ga0209233_100133112 | 199 |
| 548 | 3300025903 | Ga0207680_10226086 | Ga0207680_102260862 | 199 |
| 549 | 3300025904 | Ga0207647_10063994 | Ga0207647_100639942 | 199 |
| 550 | 3300025906 | Ga0207699_10032501 | Ga0207699_100325012 | 199 |
| 551 | 3300025908 | Ga0207643_10095779 | Ga0207643_100957792 | 199 |
| 552 | 3300025915 | Ga0207693_10718047 | Ga0207693_107180471 | 199 |
| 553 | 3300025916 | Ga0207663_10018155 | Ga0207663_100181552 | 199 |
| 554 | 3300025928 | Ga0207700_10055022 | Ga0207700_100550223 | 199 |
| 555 | 3300025929 | Ga0207664_10055425 | Ga0207664_100554253 | 199 |
| 556 | 3300025939 | Ga0207665_10056372 | Ga0207665_100563724 | 199 |
| 557 | 3300025961 | Ga0207712_10742493 | Ga0207712_107424932 | 199 |
| 558 | 3300026067 | Ga0207678_10209662 | Ga0207678_102096622 | 199 |
| 559 | 3300028379 | Ga0268266_10365192 | Ga0268266_103651922 | 199 |
| 560 | 3300031250 | Ga0265331_10065109 | Ga0265331_100651093 | 199 |
| 561 | 3300031456 | Ga0307513_10109049 | Ga0307513_101090492 | 199 |
| 562 | 3300033442 | Ga0315911_1000013 | Ga0315911_100001376 | 199 |
| 563 | 3300037853 | Ga0436364_0584170 | Ga0436364_0584170_792_1391 | 199 |
| 564 | 3300046513 | Ga0495616_0237347 | Ga0495616_0237347_177_776 | 199 |
| 565 | 3300046524 | Ga0495648_0167663 | Ga0495648_0167663_333_932 | 199 |
| 566 | 3300046660 | Ga0495625_0237869 | Ga0495625_0237869_184_783 | 199 |
| 567 | 3300046679 | Ga0495623_0285788 | Ga0495623_0285788_199_798 | 199 |
| 568 | 3300048924 | Ga0496121_0217999 | Ga0496121_0217999_567_1166 | 199 |
| 569 | 3300048929 | Ga0496126_0019515 | Ga0496126_0019515_3780_4382 | 199 |
| 570 | 3300048929 | Ga0496126_0601363 | Ga0496126_0601363_131_730 | 199 |
| 571 | 3300048929 | Ga0496126_0831969 | Ga0496126_0831969_70_669 | 199 |
| 572 | 3300050494 | nmdc:mga06z11_244322_c1 | nmdc:mga06z11_244322_c1_49_648 | 199 |
| 573 | 3300050496 | nmdc:mga07m45_349677_c1 | nmdc:mga07m45_349677_c1_28_630 | 199 |
| 574 | 3300002077 | JGI24744J21845_10008176 | JGI24744J21845_100081763 | 200 |
| 575 | 3300003320 | rootH2_10177666 | rootH2_101776661 | 200 |
| 576 | 3300003659 | JGI25404J52841_10005893 | JGI25404J52841_100058933 | 200 |
| 577 | 3300003659 | JGI25404J52841_10060516 | JGI25404J52841_100605161 | 200 |
| 578 | 3300005293 | Ga0065715_10605089 | Ga0065715_106050891 | 200 |
| 579 | 3300005330 | Ga0070690_100015372 | Ga0070690_1000153723 | 200 |
| 580 | 3300005331 | Ga0070670_100350101 | Ga0070670_1003501012 | 200 |
| 581 | 3300005333 | Ga0070677_10046447 | Ga0070677_100464472 | 200 |
| 582 | 3300005337 | Ga0070682_100204035 | Ga0070682_1002040351 | 200 |
| 583 | 3300005338 | Ga0068868_100010934 | Ga0068868_10001093410 | 200 |
| 584 | 3300005338 | Ga0068868_100090493 | Ga0068868_1000904932 | 200 |
| 585 | 3300005339 | Ga0070660_100309716 | Ga0070660_1003097162 | 200 |
| 586 | 3300005339 | Ga0070660_100489293 | Ga0070660_1004892932 | 200 |
| 587 | 3300005340 | Ga0070689_100559000 | Ga0070689_1005590001 | 200 |
| 588 | 3300005341 | Ga0070691_10184863 | Ga0070691_101848631 | 200 |
| 589 | 3300005345 | Ga0070692_10286927 | Ga0070692_102869272 | 200 |
| 590 | 3300005347 | Ga0070668_100070058 | Ga0070668_1000700583 | 200 |
| 591 | 3300005353 | Ga0070669_100047316 | Ga0070669_1000473163 | 200 |
| 592 | 3300005355 | Ga0070671_100135054 | Ga0070671_1001350543 | 200 |
| 593 | 3300005356 | Ga0070674_100033537 | Ga0070674_1000335374 | 200 |
| 594 | 3300005356 | Ga0070674_100746559 | Ga0070674_1007465591 | 200 |
| 595 | 3300005364 | Ga0070673_100150385 | Ga0070673_1001503851 | 200 |
| 596 | 3300005434 | Ga0070709_10003010 | Ga0070709_100030102 | 200 |
| 597 | 3300005434 | Ga0070709_10004534 | Ga0070709_100045341 | 200 |
| 598 | 3300005434 | Ga0070709_10241787 | Ga0070709_102417872 | 200 |
| 599 | 3300005434 | Ga0070709_10664771 | Ga0070709_106647711 | 200 |
| 600 | 3300005435 | Ga0070714_100009098 | Ga0070714_1000090982 | 200 |
| 601 | 3300005435 | Ga0070714_100554126 | Ga0070714_1005541261 | 200 |
| 602 | 3300005436 | Ga0070713_100096732 | Ga0070713_1000967322 | 200 |
| 603 | 3300005437 | Ga0070710_10002056 | Ga0070710_100020565 | 200 |
| 604 | 3300005438 | Ga0070701_10158374 | Ga0070701_101583741 | 200 |
| 605 | 3300005439 | Ga0070711_100009395 | Ga0070711_1000093956 | 200 |
| 606 | 3300005439 | Ga0070711_100010179 | Ga0070711_1000101796 | 200 |
| 607 | 3300005439 | Ga0070711_100064420 | Ga0070711_1000644202 | 200 |
| 608 | 3300005455 | Ga0070663_100004161 | Ga0070663_1000041612 | 200 |
| 609 | 3300005455 | Ga0070663_100168450 | Ga0070663_1001684503 | 200 |
| 610 | 3300005456 | Ga0070678_100099100 | Ga0070678_1000991002 | 200 |
| 611 | 3300005457 | Ga0070662_100040728 | Ga0070662_1000407283 | 200 |
| 612 | 3300005458 | Ga0070681_10012313 | Ga0070681_100123132 | 200 |
| 613 | 3300005459 | Ga0068867_100134523 | Ga0068867_1001345232 | 200 |
| 614 | 3300005459 | Ga0068867_100187970 | Ga0068867_1001879702 | 200 |
| 615 | 3300005459 | Ga0068867_100399618 | Ga0068867_1003996181 | 200 |
| 616 | 3300005466 | Ga0070685_10085111 | Ga0070685_100851112 | 200 |
| 617 | 3300005467 | Ga0070706_100204182 | Ga0070706_1002041822 | 200 |
| 618 | 3300005468 | Ga0070707_100065530 | Ga0070707_1000655303 | 200 |
| 619 | 3300005471 | Ga0070698_100070963 | Ga0070698_1000709633 | 200 |
| 620 | 3300005539 | Ga0068853_100362518 | Ga0068853_1003625182 | 200 |
| 621 | 3300005543 | Ga0070672_100881879 | Ga0070672_1008818791 | 200 |
| 622 | 3300005544 | Ga0070686_100064805 | Ga0070686_1000648053 | 200 |
| 623 | 3300005544 | Ga0070686_100481364 | Ga0070686_1004813642 | 200 |
| 624 | 3300005547 | Ga0070693_100095118 | Ga0070693_1000951182 | 200 |
| 625 | 3300005548 | Ga0070665_100033743 | Ga0070665_1000337433 | 200 |
| 626 | 3300005548 | Ga0070665_100181177 | Ga0070665_1001811772 | 200 |
| 627 | 3300005548 | Ga0070665_100806783 | Ga0070665_1008067831 | 200 |
| 628 | 3300005548 | Ga0070665_101263356 | Ga0070665_1012633562 | 200 |
| 629 | 3300005549 | Ga0070704_100583121 | Ga0070704_1005831211 | 200 |
| 630 | 3300005563 | Ga0068855_100114371 | Ga0068855_1001143712 | 200 |
| 631 | 3300005563 | Ga0068855_100221768 | Ga0068855_1002217684 | 200 |
| 632 | 3300005564 | Ga0070664_100203031 | Ga0070664_1002030313 | 200 |
| 633 | 3300005577 | Ga0068857_100053898 | Ga0068857_1000538983 | 200 |
| 634 | 3300005577 | Ga0068857_100149604 | Ga0068857_1001496042 | 200 |
| 635 | 3300005577 | Ga0068857_100476910 | Ga0068857_1004769102 | 200 |
| 636 | 3300005578 | Ga0068854_101004209 | Ga0068854_1010042091 | 200 |
| 637 | 3300005614 | Ga0068856_100237588 | Ga0068856_1002375882 | 200 |
| 638 | 3300005615 | Ga0070702_100765750 | Ga0070702_1007657501 | 200 |
| 639 | 3300005616 | Ga0068852_100480421 | Ga0068852_1004804212 | 200 |
| 640 | 3300005617 | Ga0068859_100061189 | Ga0068859_1000611895 | 200 |
| 641 | 3300005618 | Ga0068864_100429224 | Ga0068864_1004292242 | 200 |
| 642 | 3300005718 | Ga0068866_10233459 | Ga0068866_102334591 | 200 |
| 643 | 3300005719 | Ga0068861_100063518 | Ga0068861_1000635183 | 200 |
| 644 | 3300005842 | Ga0068858_100027826 | Ga0068858_1000278264 | 200 |
| 645 | 3300005842 | Ga0068858_100194085 | Ga0068858_1001940852 | 200 |
| 646 | 3300005842 | Ga0068858_100365213 | Ga0068858_1003652132 | 200 |
| 647 | 3300005843 | Ga0068860_100001772 | Ga0068860_1000017728 | 200 |
| 648 | 3300005843 | Ga0068860_100056338 | Ga0068860_1000563382 | 200 |
| 649 | 3300005843 | Ga0068860_100453276 | Ga0068860_1004532761 | 200 |
| 650 | 3300005843 | Ga0068860_100733704 | Ga0068860_1007337041 | 200 |
| 651 | 3300005983 | Ga0081540_1013255 | Ga0081540_10132555 | 200 |
| 652 | 3300005983 | Ga0081540_1013296 | Ga0081540_10132965 | 200 |
| 653 | 3300005983 | Ga0081540_1022881 | Ga0081540_10228812 | 200 |
| 654 | 3300005983 | Ga0081540_1074578 | Ga0081540_10745782 | 200 |
| 655 | 3300005983 | Ga0081540_1184040 | Ga0081540_11840401 | 200 |
| 656 | 3300006038 | Ga0075365_10012035 | Ga0075365_100120358 | 200 |
| 657 | 3300006038 | Ga0075365_10173148 | Ga0075365_101731482 | 200 |
| 658 | 3300006051 | Ga0075364_10023981 | Ga0075364_100239811 | 200 |
| 659 | 3300006051 | Ga0075364_10040350 | Ga0075364_100403503 | 200 |
| 660 | 3300006051 | Ga0075364_10498845 | Ga0075364_104988451 | 200 |
| 661 | 3300006163 | Ga0070715_10010042 | Ga0070715_100100421 | 200 |
| 662 | 3300006173 | Ga0070716_100049904 | Ga0070716_1000499042 | 200 |
| 663 | 3300006173 | Ga0070716_100394929 | Ga0070716_1003949291 | 200 |
| 664 | 3300006175 | Ga0070712_100004273 | Ga0070712_1000042736 | 200 |
| 665 | 3300006175 | Ga0070712_100039649 | Ga0070712_1000396495 | 200 |
| 666 | 3300006177 | Ga0075362_10058983 | Ga0075362_100589833 | 200 |
| 667 | 3300006177 | Ga0075362_10137371 | Ga0075362_101373711 | 200 |
| 668 | 3300006178 | Ga0075367_10016372 | Ga0075367_100163722 | 200 |
| 669 | 3300006178 | Ga0075367_10038366 | Ga0075367_100383662 | 200 |
| 670 | 3300006178 | Ga0075367_10064515 | Ga0075367_100645152 | 200 |
| 671 | 3300006186 | Ga0075369_10021370 | Ga0075369_100213701 | 200 |
| 672 | 3300006186 | Ga0075369_10108583 | Ga0075369_101085831 | 200 |
| 673 | 3300006195 | Ga0075366_10143633 | Ga0075366_101436332 | 200 |
| 674 | 3300006195 | Ga0075366_10194637 | Ga0075366_101946371 | 200 |
| 675 | 3300006237 | Ga0097621_100549938 | Ga0097621_1005499381 | 200 |
| 676 | 3300006237 | Ga0097621_100568296 | Ga0097621_1005682961 | 200 |
| 677 | 3300006358 | Ga0068871_100039067 | Ga0068871_1000390672 | 200 |
| 678 | 3300006871 | Ga0075434_100040143 | Ga0075434_1000401432 | 200 |
| 679 | 3300006881 | Ga0068865_100041444 | Ga0068865_1000414443 | 200 |
| 680 | 3300006914 | Ga0075436_100174245 | Ga0075436_1001742452 | 200 |
| 681 | 3300006931 | Ga0097620_100061189 | Ga0097620_1000611895 | 200 |
| 682 | 3300007788 | Ga0099795_10176100 | Ga0099795_101761001 | 200 |
| 683 | 3300009094 | Ga0111539_10131772 | Ga0111539_101317722 | 200 |
| 684 | 3300009094 | Ga0111539_10887303 | Ga0111539_108873032 | 200 |
| 685 | 3300009098 | Ga0105245_10122484 | Ga0105245_101224842 | 200 |
| 686 | 3300009098 | Ga0105245_10153912 | Ga0105245_101539122 | 200 |
| 687 | 3300009098 | Ga0105245_11093473 | Ga0105245_110934732 | 200 |
| 688 | 3300009147 | Ga0114129_10571993 | Ga0114129_105719932 | 200 |
| 689 | 3300009148 | Ga0105243_10186686 | Ga0105243_101866862 | 200 |
| 690 | 3300009148 | Ga0105243_10728830 | Ga0105243_107288301 | 200 |
| 691 | 3300009148 | Ga0105243_11214354 | Ga0105243_112143541 | 200 |
| 692 | 3300009174 | Ga0105241_10063746 | Ga0105241_100637463 | 200 |
| 693 | 3300009174 | Ga0105241_10299583 | Ga0105241_102995832 | 200 |
| 694 | 3300009176 | Ga0105242_10286386 | Ga0105242_102863862 | 200 |
| 695 | 3300009176 | Ga0105242_10647988 | Ga0105242_106479882 | 200 |
| 696 | 3300009177 | Ga0105248_10046598 | Ga0105248_100465982 | 200 |
| 697 | 3300009177 | Ga0105248_10208416 | Ga0105248_102084162 | 200 |
| 698 | 3300009177 | Ga0105248_10424995 | Ga0105248_104249952 | 200 |
| 699 | 3300009177 | Ga0105248_10447973 | Ga0105248_104479732 | 200 |
| 700 | 3300009545 | Ga0105237_10026719 | Ga0105237_100267198 | 200 |
| 701 | 3300009545 | Ga0105237_10074544 | Ga0105237_100745442 | 200 |
| 702 | 3300009545 | Ga0105237_10077150 | Ga0105237_100771506 | 200 |
| 703 | 3300009545 | Ga0105237_10245815 | Ga0105237_102458152 | 200 |
| 704 | 3300009545 | Ga0105237_10800157 | Ga0105237_108001571 | 200 |
| 705 | 3300009551 | Ga0105238_10033085 | Ga0105238_100330853 | 200 |
| 706 | 3300009551 | Ga0105238_10145140 | Ga0105238_101451402 | 200 |
| 707 | 3300009551 | Ga0105238_10267196 | Ga0105238_102671962 | 200 |
| 708 | 3300009553 | Ga0105249_10621320 | Ga0105249_106213201 | 200 |
| 709 | 3300010375 | Ga0105239_10082296 | Ga0105239_100822966 | 200 |
| 710 | 3300011119 | Ga0105246_10244219 | Ga0105246_102442192 | 200 |
| 711 | 3300013297 | Ga0157378_10038376 | Ga0157378_100383762 | 200 |
| 712 | 3300013297 | Ga0157378_10264371 | Ga0157378_102643712 | 200 |
| 713 | 3300013306 | Ga0163162_10387892 | Ga0163162_103878922 | 200 |
| 714 | 3300013308 | Ga0157375_10275010 | Ga0157375_102750102 | 200 |
| 715 | 3300013308 | Ga0157375_10496016 | Ga0157375_104960162 | 200 |
| 716 | 3300014325 | Ga0163163_10094827 | Ga0163163_100948272 | 200 |
| 717 | 3300014326 | Ga0157380_10469602 | Ga0157380_104696022 | 200 |
| 718 | 3300014969 | Ga0157376_10099522 | Ga0157376_100995223 | 200 |
| 719 | 3300017792 | Ga0163161_10059368 | Ga0163161_100593683 | 200 |
| 720 | 3300021377 | Ga0213874_10062481 | Ga0213874_100624811 | 200 |
| 721 | 3300021384 | Ga0213876_10005917 | Ga0213876_100059172 | 200 |
| 722 | 3300021384 | Ga0213876_10060874 | Ga0213876_100608742 | 200 |
| 723 | 3300025271 | Ga0207666_1006949 | Ga0207666_10069491 | 200 |
| 724 | 3300025295 | Ga0209564_1009367 | Ga0209564_10093673 | 200 |
| 725 | 3300025315 | Ga0207697_10077680 | Ga0207697_100776802 | 200 |
| 726 | 3300025893 | Ga0207682_10211738 | Ga0207682_102117381 | 200 |
| 727 | 3300025898 | Ga0207692_10001232 | Ga0207692_100012329 | 200 |
| 728 | 3300025899 | Ga0207642_10065958 | Ga0207642_100659582 | 200 |
| 729 | 3300025900 | Ga0207710_10094049 | Ga0207710_100940492 | 200 |
| 730 | 3300025903 | Ga0207680_10435633 | Ga0207680_104356331 | 200 |
| 731 | 3300025904 | Ga0207647_10095016 | Ga0207647_100950162 | 200 |
| 732 | 3300025904 | Ga0207647_10230334 | Ga0207647_102303342 | 200 |
| 733 | 3300025905 | Ga0207685_10132066 | Ga0207685_101320662 | 200 |
| 734 | 3300025906 | Ga0207699_10000345 | Ga0207699_100003456 | 200 |
| 735 | 3300025906 | Ga0207699_10021261 | Ga0207699_100212617 | 200 |
| 736 | 3300025906 | Ga0207699_10120490 | Ga0207699_101204902 | 200 |
| 737 | 3300025907 | Ga0207645_10209066 | Ga0207645_102090661 | 200 |
| 738 | 3300025910 | Ga0207684_10133125 | Ga0207684_101331252 | 200 |
| 739 | 3300025911 | Ga0207654_10021375 | Ga0207654_100213753 | 200 |
| 740 | 3300025912 | Ga0207707_10073543 | Ga0207707_100735432 | 200 |
| 741 | 3300025913 | Ga0207695_10356734 | Ga0207695_103567342 | 200 |
| 742 | 3300025914 | Ga0207671_10022642 | Ga0207671_100226421 | 200 |
| 743 | 3300025914 | Ga0207671_10043437 | Ga0207671_100434376 | 200 |
| 744 | 3300025914 | Ga0207671_10082020 | Ga0207671_100820202 | 200 |
| 745 | 3300025914 | Ga0207671_10159264 | Ga0207671_101592642 | 200 |
| 746 | 3300025915 | Ga0207693_10006294 | Ga0207693_100062946 | 200 |
| 747 | 3300025915 | Ga0207693_10008437 | Ga0207693_100084372 | 200 |
| 748 | 3300025915 | Ga0207693_10177731 | Ga0207693_101777312 | 200 |
| 749 | 3300025916 | Ga0207663_10017753 | Ga0207663_100177533 | 200 |
| 750 | 3300025916 | Ga0207663_10019112 | Ga0207663_100191125 | 200 |
| 751 | 3300025916 | Ga0207663_10351355 | Ga0207663_103513552 | 200 |
| 752 | 3300025918 | Ga0207662_10419964 | Ga0207662_104199642 | 200 |
| 753 | 3300025919 | Ga0207657_10737779 | Ga0207657_107377791 | 200 |
| 754 | 3300025921 | Ga0207652_10224532 | Ga0207652_102245322 | 200 |
| 755 | 3300025922 | Ga0207646_10102577 | Ga0207646_101025772 | 200 |
| 756 | 3300025922 | Ga0207646_10528257 | Ga0207646_105282571 | 200 |
| 757 | 3300025923 | Ga0207681_10295812 | Ga0207681_102958122 | 200 |
| 758 | 3300025924 | Ga0207694_10107579 | Ga0207694_101075792 | 200 |
| 759 | 3300025924 | Ga0207694_10253843 | Ga0207694_102538431 | 200 |
| 760 | 3300025924 | Ga0207694_10400785 | Ga0207694_104007852 | 200 |
| 761 | 3300025924 | Ga0207694_10637512 | Ga0207694_106375121 | 200 |
| 762 | 3300025925 | Ga0207650_10323459 | Ga0207650_103234592 | 200 |
| 763 | 3300025927 | Ga0207687_10049015 | Ga0207687_100490152 | 200 |
| 764 | 3300025927 | Ga0207687_10824948 | Ga0207687_108249481 | 200 |
| 765 | 3300025928 | Ga0207700_10262504 | Ga0207700_102625042 | 200 |
| 766 | 3300025929 | Ga0207664_10090021 | Ga0207664_100900212 | 200 |
| 767 | 3300025929 | Ga0207664_10501039 | Ga0207664_105010391 | 200 |
| 768 | 3300025929 | Ga0207664_10535075 | Ga0207664_105350751 | 200 |
| 769 | 3300025932 | Ga0207690_10588144 | Ga0207690_105881442 | 200 |
| 770 | 3300025933 | Ga0207706_10010842 | Ga0207706_100108427 | 200 |
| 771 | 3300025933 | Ga0207706_10386475 | Ga0207706_103864752 | 200 |
| 772 | 3300025934 | Ga0207686_10042534 | Ga0207686_100425341 | 200 |
| 773 | 3300025934 | Ga0207686_10293076 | Ga0207686_102930762 | 200 |
| 774 | 3300025935 | Ga0207709_10073436 | Ga0207709_100734362 | 200 |
| 775 | 3300025935 | Ga0207709_10151555 | Ga0207709_101515552 | 200 |
| 776 | 3300025936 | Ga0207670_10542773 | Ga0207670_105427731 | 200 |
| 777 | 3300025937 | Ga0207669_10204873 | Ga0207669_102048731 | 200 |
| 778 | 3300025938 | Ga0207704_10110919 | Ga0207704_101109192 | 200 |
| 779 | 3300025939 | Ga0207665_10043799 | Ga0207665_100437992 | 200 |
| 780 | 3300025939 | Ga0207665_10068941 | Ga0207665_100689412 | 200 |
| 781 | 3300025939 | Ga0207665_10216238 | Ga0207665_102162381 | 200 |
| 782 | 3300025939 | Ga0207665_10314709 | Ga0207665_103147092 | 200 |
| 783 | 3300025940 | Ga0207691_10836975 | Ga0207691_108369751 | 200 |
| 784 | 3300025941 | Ga0207711_10151349 | Ga0207711_101513491 | 200 |
| 785 | 3300025941 | Ga0207711_10465628 | Ga0207711_104656282 | 200 |
| 786 | 3300025941 | Ga0207711_10713241 | Ga0207711_107132412 | 200 |
| 787 | 3300025942 | Ga0207689_10088583 | Ga0207689_100885832 | 200 |
| 788 | 3300025944 | Ga0207661_10861235 | Ga0207661_108612351 | 200 |
| 789 | 3300025945 | Ga0207679_10384975 | Ga0207679_103849752 | 200 |
| 790 | 3300025949 | Ga0207667_10351657 | Ga0207667_103516572 | 200 |
| 791 | 3300025960 | Ga0207651_10063503 | Ga0207651_100635031 | 200 |
| 792 | 3300025961 | Ga0207712_10044951 | Ga0207712_100449513 | 200 |
| 793 | 3300025961 | Ga0207712_10171223 | Ga0207712_101712232 | 200 |
| 794 | 3300025972 | Ga0207668_10130886 | Ga0207668_101308862 | 200 |
| 795 | 3300025972 | Ga0207668_10154986 | Ga0207668_101549862 | 200 |
| 796 | 3300025986 | Ga0207658_10224895 | Ga0207658_102248952 | 200 |
| 797 | 3300026023 | Ga0207677_10018303 | Ga0207677_100183032 | 200 |
| 798 | 3300026023 | Ga0207677_10268183 | Ga0207677_102681832 | 200 |
| 799 | 3300026035 | Ga0207703_10052106 | Ga0207703_100521063 | 200 |
| 800 | 3300026035 | Ga0207703_10148388 | Ga0207703_101483882 | 200 |
| 801 | 3300026041 | Ga0207639_10298966 | Ga0207639_102989662 | 200 |
| 802 | 3300026041 | Ga0207639_10491344 | Ga0207639_104913441 | 200 |
| 803 | 3300026067 | Ga0207678_10001940 | Ga0207678_1000194016 | 200 |
| 804 | 3300026067 | Ga0207678_10012005 | Ga0207678_100120053 | 200 |
| 805 | 3300026067 | Ga0207678_10186384 | Ga0207678_101863842 | 200 |
| 806 | 3300026067 | Ga0207678_10198597 | Ga0207678_101985972 | 200 |
| 807 | 3300026088 | Ga0207641_10042216 | Ga0207641_100422163 | 200 |
| 808 | 3300026089 | Ga0207648_10110568 | Ga0207648_101105682 | 200 |
| 809 | 3300026089 | Ga0207648_10302732 | Ga0207648_103027322 | 200 |
| 810 | 3300026089 | Ga0207648_10570318 | Ga0207648_105703181 | 200 |
| 811 | 3300026095 | Ga0207676_10611995 | Ga0207676_106119951 | 200 |
| 812 | 3300026116 | Ga0207674_10153177 | Ga0207674_101531771 | 200 |
| 813 | 3300026116 | Ga0207674_10330138 | Ga0207674_103301382 | 200 |
| 814 | 3300026118 | Ga0207675_100048321 | Ga0207675_1000483212 | 200 |
| 815 | 3300026118 | Ga0207675_100356086 | Ga0207675_1003560862 | 200 |
| 816 | 3300026121 | Ga0207683_10130160 | Ga0207683_101301603 | 200 |
| 817 | 3300026142 | Ga0207698_10110712 | Ga0207698_101107122 | 200 |
| 818 | 3300026142 | Ga0207698_10154808 | Ga0207698_101548082 | 200 |
| 819 | 3300027907 | Ga0207428_10134050 | Ga0207428_101340501 | 200 |
| 820 | 3300028379 | Ga0268266_10016785 | Ga0268266_100167853 | 200 |
| 821 | 3300028379 | Ga0268266_10056859 | Ga0268266_100568593 | 200 |
| 822 | 3300028379 | Ga0268266_10382738 | Ga0268266_103827382 | 200 |
| 823 | 3300028379 | Ga0268266_10674560 | Ga0268266_106745601 | 200 |
| 824 | 3300028380 | Ga0268265_10586375 | Ga0268265_105863751 | 200 |
| 825 | 3300028381 | Ga0268264_10000157 | Ga0268264_1000015746 | 200 |
| 826 | 3300028381 | Ga0268264_10156300 | Ga0268264_101563002 | 200 |
| 827 | 3300028563 | Ga0265319_1017504 | Ga0265319_10175042 | 200 |
| 828 | 3300028653 | Ga0265323_10001788 | Ga0265323_100017887 | 200 |
| 829 | 3300028666 | Ga0265336_10000420 | Ga0265336_1000042012 | 200 |
| 830 | 3300028800 | Ga0265338_10001474 | Ga0265338_1000147419 | 200 |
| 831 | 3300030521 | Ga0307511_10030423 | Ga0307511_100304232 | 200 |
| 832 | 3300031249 | Ga0265339_10040989 | Ga0265339_100409891 | 200 |
| 833 | 3300031250 | Ga0265331_10101792 | Ga0265331_101017922 | 200 |
| 834 | 3300031507 | Ga0307509_10480241 | Ga0307509_104802411 | 200 |
| 835 | 3300031548 | Ga0307408_100058562 | Ga0307408_1000585622 | 200 |
| 836 | 3300031548 | Ga0307408_100658463 | Ga0307408_1006584632 | 200 |
| 837 | 3300031616 | Ga0307508_10000002 | Ga0307508_10000002135 | 200 |
| 838 | 3300031616 | Ga0307508_10072490 | Ga0307508_100724902 | 200 |
| 839 | 3300031711 | Ga0265314_10026224 | Ga0265314_100262241 | 200 |
| 840 | 3300031712 | Ga0265342_10020736 | Ga0265342_100207364 | 200 |
| 841 | 3300031730 | Ga0307516_10083745 | Ga0307516_100837454 | 200 |
| 842 | 3300031730 | Ga0307516_10203445 | Ga0307516_102034452 | 200 |
| 843 | 3300031824 | Ga0307413_10659436 | Ga0307413_106594362 | 200 |
| 844 | 3300031901 | Ga0307406_10794098 | Ga0307406_107940981 | 200 |
| 845 | 3300031911 | Ga0307412_10417898 | Ga0307412_104178981 | 200 |
| 846 | 3300033179 | Ga0307507_10075390 | Ga0307507_100753902 | 200 |
| 847 | 3300033180 | Ga0307510_10137772 | Ga0307510_101377722 | 200 |
| 848 | 3300033180 | Ga0307510_10150276 | Ga0307510_101502762 | 200 |
| 849 | 3300033544 | Ga0316215_1000607 | Ga0316215_10006072 | 200 |
| 850 | 3300035083 | Ga0373926_0015030 | Ga0373926_0015030_229_831 | 200 |
| 851 | 3300035089 | Ga0373944_0042552 | Ga0373944_0042552_51_653 | 200 |
| 852 | 3300035111 | Ga0373923_0022309 | Ga0373923_0022309_1782_2384 | 200 |
| 853 | 3300035112 | Ga0373932_0091145 | Ga0373932_0091145_276_878 | 200 |
| 854 | 3300035113 | Ga0373936_0018178 | Ga0373936_0018178_680_1282 | 200 |
| 855 | 3300035115 | Ga0373941_0072388 | Ga0373941_0072388_307_909 | 200 |
| 856 | 3300035116 | Ga0373945_0055772 | Ga0373945_0055772_744_1346 | 200 |
| 857 | 3300035116 | Ga0373945_0079242 | Ga0373945_0079242_524_1126 | 200 |
| 858 | 3300035117 | Ga0373953_0017961 | Ga0373953_0017961_835_1437 | 200 |
| 859 | 3300035118 | Ga0373954_0071546 | Ga0373954_0071546_847_1449 | 200 |
| 860 | 3300035170 | Ga0373943_0030353 | Ga0373943_0030353_272_874 | 200 |
| 861 | 3300035171 | Ga0373946_0007562 | Ga0373946_0007562_1361_1963 | 200 |
| 862 | 3300035171 | Ga0373946_0020932 | Ga0373946_0020932_1315_1917 | 200 |
| 863 | 3300035172 | Ga0373955_0033718 | Ga0373955_0033718_605_1207 | 200 |
| 864 | 3300035207 | Ga0373942_0021003 | Ga0373942_0021003_256_858 | 200 |
| 865 | 3300035241 | Ga0373961_0218800 | Ga0373961_0218800_65_667 | 200 |
| 866 | 3300035242 | Ga0373962_0010144 | Ga0373962_0010144_211_813 | 200 |
| 867 | 3300035242 | Ga0373962_0063278 | Ga0373962_0063278_468_1070 | 200 |
| 868 | 3300035410 | Ga0373924_0009123 | Ga0373924_0009123_1728_2330 | 200 |
| 869 | 3300035691 | Ga0373931_0025140 | Ga0373931_0025140_1259_1861 | 200 |
| 870 | 3300035692 | Ga0373935_0161943 | Ga0373935_0161943_42_722 | 200 |
| 871 | 3300035692 | Ga0373935_0182935 | Ga0373935_0182935_215_817 | 200 |
| 872 | 3300035695 | Ga0373927_0010933 | Ga0373927_0010933_2396_3076 | 200 |
| 873 | 3300035695 | Ga0373927_0036122 | Ga0373927_0036122_1767_2372 | 200 |
| 874 | 3300035695 | Ga0373927_0089978 | Ga0373927_0089978_263_865 | 200 |
| 875 | 3300035695 | Ga0373927_0105643 | Ga0373927_0105643_801_1403 | 200 |
| 876 | 3300035695 | Ga0373927_0163931 | Ga0373927_0163931_171_773 | 200 |
| 877 | 3300035724 | Ga0373933_0000118 | Ga0373933_0000118_21262_21864 | 200 |
| 878 | 3300035725 | Ga0373947_0056369 | Ga0373947_0056369_832_1434 | 200 |
| 879 | 3300035725 | Ga0373947_0075893 | Ga0373947_0075893_1269_1871 | 200 |
| 880 | 3300035725 | Ga0373947_0214690 | Ga0373947_0214690_77_757 | 200 |
| 881 | 3300037068 | Ga0373925_0043981 | Ga0373925_0043981_2615_3295 | 200 |
| 882 | 3300037068 | Ga0373925_0196788 | Ga0373925_0196788_77_679 | 200 |
| 883 | 3300037418 | Ga0395900_0756953 | Ga0395900_0756953_59_661 | 200 |
| 884 | 3300037466 | Ga0395898_0043238 | Ga0395898_0043238_2567_3169 | 200 |
| 885 | 3300037466 | Ga0395898_0053299 | Ga0395898_0053299_203_805 | 200 |
| 886 | 3300037466 | Ga0395898_0114600 | Ga0395898_0114600_1411_2013 | 200 |
| 887 | 3300037471 | Ga0395905_0149916 | Ga0395905_0149916_337_939 | 200 |
| 888 | 3300037471 | Ga0395905_0247944 | Ga0395905_0247944_334_936 | 200 |
| 889 | 3300037853 | Ga0436364_0209479 | Ga0436364_0209479_169_771 | 200 |
| 890 | 3300037853 | Ga0436364_0393542 | Ga0436364_0393542_658_1260 | 200 |
| 891 | 3300038443 | Ga0395901_0129331 | Ga0395901_0129331_886_1488 | 200 |
| 892 | 3300038443 | Ga0395901_0170499 | Ga0395901_0170499_144_746 | 200 |
| 893 | 3300039437 | Ga0436365_0029847 | Ga0436365_0029847_1344_1946 | 200 |
| 894 | 3300039437 | Ga0436365_1609765 | Ga0436365_1609765_6747_7349 | 200 |
| 895 | 3300039438 | Ga0436360_0760184 | Ga0436360_0760184_36_638 | 200 |
| 896 | 3300039450 | Ga0436363_0152156 | Ga0436363_0152156_79_681 | 200 |
| 897 | 3300039450 | Ga0436363_0766255 | Ga0436363_0766255_985_1587 | 200 |
| 898 | 3300041459 | Ga0451800_0066149 | Ga0451800_0066149_283_885 | 200 |
| 899 | 3300044656 | Ga0466969_0151527 | Ga0466969_0151527_290_892 | 200 |
| 900 | 3300044765 | Ga0466970_0088075 | Ga0466970_0088075_395_997 | 200 |
| 901 | 3300045049 | Ga0466959_0073082 | Ga0466959_0073082_1410_2012 | 200 |
| 902 | 3300045049 | Ga0466959_0082582 | Ga0466959_0082582_1626_2228 | 200 |
| 903 | 3300045976 | Ga0466967_0079574 | Ga0466967_0079574_59_664 | 200 |
| 904 | 3300046454 | Ga0495592_0046637 | Ga0495592_0046637_672_1274 | 200 |
| 905 | 3300046455 | Ga0495603_0337348 | Ga0495603_0337348_200_802 | 200 |
| 906 | 3300046457 | Ga0495590_0109499 | Ga0495590_0109499_259_864 | 200 |
| 907 | 3300046459 | Ga0495629_0041783 | Ga0495629_0041783_657_1262 | 200 |
| 908 | 3300046462 | Ga0495651_0203289 | Ga0495651_0203289_85_687 | 200 |
| 909 | 3300046472 | Ga0495580_0012056 | Ga0495580_0012056_1391_1993 | 200 |
| 910 | 3300046472 | Ga0495580_0631164 | Ga0495580_0631164_94_696 | 200 |
| 911 | 3300046474 | Ga0495605_0056857 | Ga0495605_0056857_1165_1770 | 200 |
| 912 | 3300046477 | Ga0495664_0014728 | Ga0495664_0014728_1383_1985 | 200 |
| 913 | 3300046477 | Ga0495664_0020681 | Ga0495664_0020681_541_1143 | 200 |
| 914 | 3300046491 | Ga0495584_0171909 | Ga0495584_0171909_414_1016 | 200 |
| 915 | 3300046500 | Ga0495596_0031573 | Ga0495596_0031573_830_1435 | 200 |
| 916 | 3300046501 | Ga0495607_0059800 | Ga0495607_0059800_510_1115 | 200 |
| 917 | 3300046507 | Ga0495606_0043701 | Ga0495606_0043701_1017_1622 | 200 |
| 918 | 3300046507 | Ga0495606_0087085 | Ga0495606_0087085_827_1429 | 200 |
| 919 | 3300046513 | Ga0495616_0037073 | Ga0495616_0037073_781_1386 | 200 |
| 920 | 3300046514 | Ga0495618_0222517 | Ga0495618_0222517_538_1140 | 200 |
| 921 | 3300046515 | Ga0495620_0007418 | Ga0495620_0007418_4585_5190 | 200 |
| 922 | 3300046515 | Ga0495620_0139601 | Ga0495620_0139601_147_749 | 200 |
| 923 | 3300046517 | Ga0495630_0058135 | Ga0495630_0058135_2143_2745 | 200 |
| 924 | 3300046517 | Ga0495630_0142692 | Ga0495630_0142692_662_1264 | 200 |
| 925 | 3300046519 | Ga0495632_0033914 | Ga0495632_0033914_904_1509 | 200 |
| 926 | 3300046520 | Ga0495637_0021828 | Ga0495637_0021828_674_1279 | 200 |
| 927 | 3300046524 | Ga0495648_0031929 | Ga0495648_0031929_1645_2250 | 200 |
| 928 | 3300046530 | Ga0495654_0011184 | Ga0495654_0011184_4127_4732 | 200 |
| 929 | 3300046531 | Ga0495665_0034243 | Ga0495665_0034243_464_1066 | 200 |
| 930 | 3300046533 | Ga0495640_0040675 | Ga0495640_0040675_1782_2384 | 200 |
| 931 | 3300046535 | Ga0495586_0296150 | Ga0495586_0296150_292_894 | 200 |
| 932 | 3300046538 | Ga0495609_0043451 | Ga0495609_0043451_549_1154 | 200 |
| 933 | 3300046542 | Ga0495597_0043566 | Ga0495597_0043566_463_1068 | 200 |
| 934 | 3300046543 | Ga0495645_0293170 | Ga0495645_0293170_237_839 | 200 |
| 935 | 3300046557 | Ga0495622_0004148 | Ga0495622_0004148_4083_4688 | 200 |
| 936 | 3300046557 | Ga0495622_0026065 | Ga0495622_0026065_730_1410 | 200 |
| 937 | 3300046559 | Ga0495667_0089365 | Ga0495667_0089365_331_933 | 200 |
| 938 | 3300046615 | Ga0495656_0089773 | Ga0495656_0089773_81_683 | 200 |
| 939 | 3300046642 | Ga0495634_0114548 | Ga0495634_0114548_928_1530 | 200 |
| 940 | 3300046660 | Ga0495625_0317425 | Ga0495625_0317425_122_724 | 200 |
| 941 | 3300046660 | Ga0495625_0365479 | Ga0495625_0365479_39_644 | 200 |
| 942 | 3300046663 | Ga0495635_0145510 | Ga0495635_0145510_812_1414 | 200 |
| 943 | 3300046674 | Ga0495588_0026572 | Ga0495588_0026572_1575_2180 | 200 |
| 944 | 3300046674 | Ga0495588_0127581 | Ga0495588_0127581_381_983 | 200 |
| 945 | 3300046678 | Ga0495599_0451552 | Ga0495599_0451552_83_685 | 200 |
| 946 | 3300046680 | Ga0495646_0035772 | Ga0495646_0035772_1217_1819 | 200 |
| 947 | 3300046681 | Ga0495647_0004481 | Ga0495647_0004481_3364_3966 | 200 |
| 948 | 3300046683 | Ga0495658_0093310 | Ga0495658_0093310_377_979 | 200 |
| 949 | 3300046684 | Ga0495669_0092929 | Ga0495669_0092929_539_1141 | 200 |
| 950 | 3300046690 | Ga0495624_0163877 | Ga0495624_0163877_114_716 | 200 |
| 951 | 3300046690 | Ga0495624_0257732 | Ga0495624_0257732_35_637 | 200 |
| 952 | 3300046691 | Ga0495670_0085016 | Ga0495670_0085016_156_761 | 200 |
| 953 | 3300046694 | Ga0495649_0179144 | Ga0495649_0179144_229_831 | 200 |
| 954 | 3300046794 | Ga0495589_0258350 | Ga0495589_0258350_39_641 | 200 |
| 955 | 3300046810 | Ga0495660_0021236 | Ga0495660_0021236_1563_2168 | 200 |
| 956 | 3300047315 | Ga0495581_0057962 | Ga0495581_0057962_1614_2216 | 200 |
| 957 | 3300047315 | Ga0495581_0097094 | Ga0495581_0097094_413_1015 | 200 |
| 958 | 3300047315 | Ga0495581_0105543 | Ga0495581_0105543_917_1519 | 200 |
| 959 | 3300047317 | Ga0495604_0076221 | Ga0495604_0076221_1483_2085 | 200 |
| 960 | 3300047317 | Ga0495604_0218672 | Ga0495604_0218672_337_939 | 200 |
| 961 | 3300047319 | Ga0495674_0017831 | Ga0495674_0017831_5266_5868 | 200 |
| 962 | 3300047319 | Ga0495674_0748515 | Ga0495674_0748515_140_742 | 200 |
| 963 | 3300047320 | Ga0495672_0161240 | Ga0495672_0161240_159_761 | 200 |
| 964 | 3300047321 | Ga0495676_0316600 | Ga0495676_0316600_301_903 | 200 |
| 965 | 3300047445 | Ga0495677_0010566 | Ga0495677_0010566_285_887 | 200 |
| 966 | 3300047472 | Ga0495686_0073863 | Ga0495686_0073863_689_1294 | 200 |
| 967 | 3300047673 | Ga0495593_0075061 | Ga0495593_0075061_427_1029 | 200 |
| 968 | 3300048091 | Ga0495626_0023882 | Ga0495626_0023882_1627_2232 | 200 |
| 969 | 3300048903 | Ga0496100_0095050 | Ga0496100_0095050_246_848 | 200 |
| 970 | 3300048904 | Ga0496101_0074665 | Ga0496101_0074665_1633_2235 | 200 |
| 971 | 3300048904 | Ga0496101_0114415 | Ga0496101_0114415_413_1015 | 200 |
| 972 | 3300048904 | Ga0496101_0228653 | Ga0496101_0228653_766_1368 | 200 |
| 973 | 3300048904 | Ga0496101_0390429 | Ga0496101_0390429_322_924 | 200 |
| 974 | 3300048905 | Ga0496102_0023114 | Ga0496102_0023114_2620_3222 | 200 |
| 975 | 3300048905 | Ga0496102_0061798 | Ga0496102_0061798_1579_2181 | 200 |
| 976 | 3300048905 | Ga0496102_0136236 | Ga0496102_0136236_742_1344 | 200 |
| 977 | 3300048905 | Ga0496102_0178336 | Ga0496102_0178336_1010_1612 | 200 |
| 978 | 3300048905 | Ga0496102_0214900 | Ga0496102_0214900_53_655 | 200 |
| 979 | 3300048905 | Ga0496102_0407694 | Ga0496102_0407694_15_617 | 200 |
| 980 | 3300048905 | Ga0496102_0642440 | Ga0496102_0642440_85_690 | 200 |
| 981 | 3300048906 | Ga0496103_0322189 | Ga0496103_0322189_127_729 | 200 |
| 982 | 3300048907 | Ga0496104_0348134 | Ga0496104_0348134_200_802 | 200 |
| 983 | 3300048908 | Ga0496105_0005494 | Ga0496105_0005494_7540_8142 | 200 |
| 984 | 3300048909 | Ga0496106_0086129 | Ga0496106_0086129_236_838 | 200 |
| 985 | 3300048909 | Ga0496106_0263196 | Ga0496106_0263196_163_765 | 200 |
| 986 | 3300048909 | Ga0496106_0492590 | Ga0496106_0492590_52_654 | 200 |
| 987 | 3300048910 | Ga0496107_0013421 | Ga0496107_0013421_1452_2054 | 200 |
| 988 | 3300048910 | Ga0496107_0249969 | Ga0496107_0249969_697_1299 | 200 |
| 989 | 3300048911 | Ga0496108_0066705 | Ga0496108_0066705_1614_2216 | 200 |
| 990 | 3300048911 | Ga0496108_0319669 | Ga0496108_0319669_401_1003 | 200 |
| 991 | 3300048912 | Ga0496109_0056868 | Ga0496109_0056868_2341_2943 | 200 |
| 992 | 3300048912 | Ga0496109_0166750 | Ga0496109_0166750_846_1448 | 200 |
| 993 | 3300048912 | Ga0496109_0248378 | Ga0496109_0248378_477_1079 | 200 |
| 994 | 3300048913 | Ga0496110_0015748 | Ga0496110_0015748_2685_3287 | 200 |
| 995 | 3300048913 | Ga0496110_0620550 | Ga0496110_0620550_175_777 | 200 |
| 996 | 3300048914 | Ga0496111_0022680 | Ga0496111_0022680_1153_1755 | 200 |
| 997 | 3300048914 | Ga0496111_0401221 | Ga0496111_0401221_95_697 | 200 |
| 998 | 3300048915 | Ga0496112_0082929 | Ga0496112_0082929_2169_2771 | 200 |
| 999 | 3300048915 | Ga0496112_0251085 | Ga0496112_0251085_69_671 | 200 |
| 1000 | 3300048915 | Ga0496112_0440814 | Ga0496112_0440814_200_802 | 200 |
| 1001 | 3300048916 | Ga0496113_0034908 | Ga0496113_0034908_2732_3334 | 200 |
| 1002 | 3300048916 | Ga0496113_0330271 | Ga0496113_0330271_299_904 | 200 |
| 1003 | 3300048917 | Ga0496114_0070083 | Ga0496114_0070083_2003_2605 | 200 |
| 1004 | 3300048917 | Ga0496114_0111528 | Ga0496114_0111528_323_925 | 200 |
| 1005 | 3300048918 | Ga0496115_0011792 | Ga0496115_0011792_2564_3166 | 200 |
| 1006 | 3300048918 | Ga0496115_0210366 | Ga0496115_0210366_80_682 | 200 |
| 1007 | 3300048919 | Ga0496116_0003347 | Ga0496116_0003347_11551_12156 | 200 |
| 1008 | 3300048920 | Ga0496117_0090473 | Ga0496117_0090473_1289_1894 | 200 |
| 1009 | 3300048921 | Ga0496118_0050976 | Ga0496118_0050976_276_881 | 200 |
| 1010 | 3300048922 | Ga0496119_0038956 | Ga0496119_0038956_462_1067 | 200 |
| 1011 | 3300048924 | Ga0496121_0053237 | Ga0496121_0053237_2450_3052 | 200 |
| 1012 | 3300048924 | Ga0496121_0116392 | Ga0496121_0116392_360_965 | 200 |
| 1013 | 3300048924 | Ga0496121_0175568 | Ga0496121_0175568_339_941 | 200 |
| 1014 | 3300048924 | Ga0496121_0205107 | Ga0496121_0205107_461_1063 | 200 |
| 1015 | 3300048924 | Ga0496121_0214211 | Ga0496121_0214211_230_838 | 200 |
| 1016 | 3300048925 | Ga0496122_0039972 | Ga0496122_0039972_3003_3605 | 200 |
| 1017 | 3300048925 | Ga0496122_0184717 | Ga0496122_0184717_139_744 | 200 |
| 1018 | 3300048926 | Ga0496123_0219349 | Ga0496123_0219349_130_735 | 200 |
| 1019 | 3300048927 | Ga0496124_0077272 | Ga0496124_0077272_377_982 | 200 |
| 1020 | 3300048927 | Ga0496124_0407012 | Ga0496124_0407012_232_837 | 200 |
| 1021 | 3300048928 | Ga0496125_0003766 | Ga0496125_0003766_4007_4612 | 200 |
| 1022 | 3300048928 | Ga0496125_0052271 | Ga0496125_0052271_2672_3277 | 200 |
| 1023 | 3300048929 | Ga0496126_0016873 | Ga0496126_0016873_2855_3457 | 200 |
| 1024 | 3300048929 | Ga0496126_0065690 | Ga0496126_0065690_988_1590 | 200 |
| 1025 | 3300048929 | Ga0496126_0401718 | Ga0496126_0401718_118_720 | 200 |
| 1026 | 3300049583 | Ga0501067_0186178 | Ga0501067_0186178_400_1002 | 200 |
| 1027 | 3300049585 | Ga0501069_0070442 | Ga0501069_0070442_891_1493 | 200 |
| 1028 | 3300050489 | nmdc:mga03683_126265_c1 | nmdc:mga03683_126265_c1_466_1068 | 200 |
| 1029 | 3300050490 | nmdc:mga03n38_206422_c1 | nmdc:mga03n38_206422_c1_255_860 | 200 |
| 1030 | 3300050490 | nmdc:mga03n38_54485_c2 | nmdc:mga03n38_54485_c2_583_1185 | 200 |
| 1031 | 3300050491 | nmdc:mga00v17_106581_c1 | nmdc:mga00v17_106581_c1_52_654 | 200 |
| 1032 | 3300050491 | nmdc:mga00v17_1725_c1 | nmdc:mga00v17_1725_c1_10546_11151 | 200 |
| 1033 | 3300050492 | nmdc:mga0yw44_245180_c1 | nmdc:mga0yw44_245180_c1_213_818 | 200 |
| 1034 | 3300050493 | nmdc:mga0k408_149525_c1 | nmdc:mga0k408_149525_c1_613_1215 | 200 |
| 1035 | 3300050494 | nmdc:mga06z11_81027_c1 | nmdc:mga06z11_81027_c1_813_1415 | 200 |
| 1036 | 3300050494 | nmdc:mga06z11_93263_c1 | nmdc:mga06z11_93263_c1_648_1253 | 200 |
| 1037 | 3300050496 | nmdc:mga07m45_62754_c1 | nmdc:mga07m45_62754_c1_232_834 | 200 |
| 1038 | 3300050511 | nmdc:mga08y16_78647_c1 | nmdc:mga08y16_78647_c1_919_1521 | 200 |
| 1039 | 3300050512 | nmdc:mga0n895_263504_c1 | nmdc:mga0n895_263504_c1_994_1596 | 200 |
| 1040 | 3300050512 | nmdc:mga0n895_38171_c1 | nmdc:mga0n895_38171_c1_3356_4021 | 200 |
| 1041 | 3300050513 | nmdc:mga0rr50_355652_c1 | nmdc:mga0rr50_355652_c1_498_1100 | 200 |
| 1042 | 3300050514 | nmdc:mga08x19_70623_c1 | nmdc:mga08x19_70623_c1_592_1257 | 200 |
| 1043 | 3300050516 | nmdc:mga0sz30_41661_c1 | nmdc:mga0sz30_41661_c1_489_1094 | 200 |
| 1044 | 3300053077 | Ga0495601_0016608 | Ga0495601_0016608_3447_4049 | 200 |
| 1045 | 3300053078 | Ga0495612_0052700 | Ga0495612_0052700_873_1475 | 200 |
| 1046 | 3300053080 | Ga0500635_0011050 | Ga0500635_0011050_839_1519 | 200 |
| 1047 | 3300053084 | Ga0495595_0071265 | Ga0495595_0071265_233_835 | 200 |
| 1048 | 3300053085 | Ga0495619_0473933 | Ga0495619_0473933_94_696 | 200 |
| 1049 | 3300053086 | Ga0500578_0085342 | Ga0500578_0085342_264_869 | 200 |
| 1050 | 3300053087 | Ga0500643_022492 | Ga0500643_022492_472_1077 | 200 |
| 1051 | 3300053089 | Ga0500581_085417 | Ga0500581_085417_434_1039 | 200 |
| 1052 | 3300053090 | Ga0500646_0008172 | Ga0500646_0008172_1297_1902 | 200 |
| 1053 | 3300053091 | Ga0500647_0285023 | Ga0500647_0285023_22_624 | 200 |
| 1054 | 3300053093 | Ga0500651_0015639 | Ga0500651_0015639_3420_4025 | 200 |
| 1055 | 3300053093 | Ga0500651_0049749 | Ga0500651_0049749_1773_2378 | 200 |
| 1056 | 3300053094 | Ga0500566_0000243 | Ga0500566_0000243_9438_10040 | 200 |
| 1057 | 3300053094 | Ga0500566_0006814 | Ga0500566_0006814_2699_3304 | 200 |
| 1058 | 3300053095 | Ga0500640_011728 | Ga0500640_011728_414_1016 | 200 |
| 1059 | 3300053096 | Ga0500641_0003009 | Ga0500641_0003009_654_1259 | 200 |
| 1060 | 3300053103 | Ga0500555_027690 | Ga0500555_027690_513_1118 | 200 |
| 1061 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_430231_430836 | 200 |
| 1062 | 3300053109 | Ga0500569_038305 | Ga0500569_038305_687_1292 | 200 |
| 1063 | 3300053111 | Ga0500572_002477 | Ga0500572_002477_2996_3598 | 200 |
| 1064 | 3300053111 | Ga0500572_003577 | Ga0500572_003577_1662_2264 | 200 |
| 1065 | 3300053116 | Ga0500592_000518 | Ga0500592_000518_4823_5428 | 200 |
| 1066 | 3300053117 | Ga0500593_063406 | Ga0500593_063406_418_1023 | 200 |
| 1067 | 3300053119 | Ga0500595_015071 | Ga0500595_015071_918_1598 | 200 |
| 1068 | 3300053122 | Ga0500608_019283 | Ga0500608_019283_978_1583 | 200 |
| 1069 | 3300053122 | Ga0500608_024237 | Ga0500608_024237_915_1517 | 200 |
| 1070 | 3300053125 | Ga0500618_010251 | Ga0500618_010251_1171_1776 | 200 |
| 1071 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_23152_23757 | 200 |
| 1072 | 3300053131 | Ga0500652_008629 | Ga0500652_008629_18_623 | 200 |
| 1073 | 3300053134 | Ga0500658_0051650 | Ga0500658_0051650_708_1313 | 200 |
| 1074 | 3300053136 | Ga0500559_0000276 | Ga0500559_0000276_28241_28846 | 200 |
| 1075 | 3300053136 | Ga0500559_0000660 | Ga0500559_0000660_20858_21460 | 200 |
| 1076 | 3300053136 | Ga0500559_0049006 | Ga0500559_0049006_1085_1687 | 200 |
| 1077 | 3300053139 | Ga0500568_0003467 | Ga0500568_0003467_711_1316 | 200 |
| 1078 | 3300053145 | Ga0500586_001407 | Ga0500586_001407_4068_4673 | 200 |
| 1079 | 3300053147 | Ga0500589_155532 | Ga0500589_155532_170_775 | 200 |
| 1080 | 3300053150 | Ga0500603_002895 | Ga0500603_002895_974_1576 | 200 |
| 1081 | 3300053150 | Ga0500603_007630 | Ga0500603_007630_764_1444 | 200 |
| 1082 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_436675_437280 | 200 |
| 1083 | 3300053156 | Ga0500622_0002509 | Ga0500622_0002509_2387_2992 | 200 |
| 1084 | 3300053159 | Ga0500630_042577 | Ga0500630_042577_882_1484 | 200 |
| 1085 | 3300053160 | Ga0500633_0007947 | Ga0500633_0007947_287_892 | 200 |
| 1086 | 3300053163 | Ga0500639_011635 | Ga0500639_011635_1578_2180 | 200 |
| 1087 | 3300053163 | Ga0500639_016672 | Ga0500639_016672_1690_2292 | 200 |
| 1088 | 3300053177 | Ga0500636_0000766 | Ga0500636_0000766_2809_3414 | 200 |
| 1089 | 3300053177 | Ga0500636_0180298 | Ga0500636_0180298_12_614 | 200 |
| 1090 | 3300053177 | Ga0500636_0374509 | Ga0500636_0374509_54_656 | 200 |
| 1091 | 3300053178 | Ga0500637_0016388 | Ga0500637_0016388_2614_3219 | 200 |
| 1092 | 3300053178 | Ga0500637_0203738 | Ga0500637_0203738_414_1016 | 200 |
| 1093 | 3300053178 | Ga0500637_0446954 | Ga0500637_0446954_34_636 | 200 |
| 1094 | 3300053724 | Ga0500570_021281 | Ga0500570_021281_2259_2864 | 200 |
| 1095 | 3300053730 | Ga0500645_023467 | Ga0500645_023467_1130_1735 | 200 |
| 1096 | 3300053735 | Ga0500596_001464 | Ga0500596_001464_333_935 | 200 |
| 1097 | 3300053735 | Ga0500596_003829 | Ga0500596_003829_1689_2291 | 200 |
| 1098 | 3300053737 | Ga0500601_001777 | Ga0500601_001777_994_1596 | 200 |
| 1099 | 3300003203 | JGI25406J46586_10000544 | JGI25406J46586_1000054410 | 201 |
| 1100 | 3300005327 | Ga0070658_10027906 | Ga0070658_100279062 | 201 |
| 1101 | 3300005336 | Ga0070680_100504353 | Ga0070680_1005043532 | 201 |
| 1102 | 3300005339 | Ga0070660_100001887 | Ga0070660_1000018874 | 201 |
| 1103 | 3300005341 | Ga0070691_10017022 | Ga0070691_100170222 | 201 |
| 1104 | 3300005344 | Ga0070661_100085682 | Ga0070661_1000856822 | 201 |
| 1105 | 3300005455 | Ga0070663_100546548 | Ga0070663_1005465481 | 201 |
| 1106 | 3300005458 | Ga0070681_10598941 | Ga0070681_105989411 | 201 |
| 1107 | 3300005530 | Ga0070679_100170516 | Ga0070679_1001705162 | 201 |
| 1108 | 3300005535 | Ga0070684_100029211 | Ga0070684_1000292116 | 201 |
| 1109 | 3300005539 | Ga0068853_100001962 | Ga0068853_10000196211 | 201 |
| 1110 | 3300005539 | Ga0068853_100571017 | Ga0068853_1005710171 | 201 |
| 1111 | 3300005563 | Ga0068855_100061111 | Ga0068855_1000611112 | 201 |
| 1112 | 3300005577 | Ga0068857_100243626 | Ga0068857_1002436262 | 201 |
| 1113 | 3300005985 | Ga0081539_10000064 | Ga0081539_10000064143 | 201 |
| 1114 | 3300006163 | Ga0070715_10386874 | Ga0070715_103868741 | 201 |
| 1115 | 3300009098 | Ga0105245_10428517 | Ga0105245_104285171 | 201 |
| 1116 | 3300009545 | Ga0105237_10006051 | Ga0105237_1000605111 | 201 |
| 1117 | 3300009551 | Ga0105238_10014911 | Ga0105238_1001491110 | 201 |
| 1118 | 3300013105 | Ga0157369_10213203 | Ga0157369_102132032 | 201 |
| 1119 | 3300025321 | Ga0207656_10035153 | Ga0207656_100351533 | 201 |
| 1120 | 3300025912 | Ga0207707_10005686 | Ga0207707_100056862 | 201 |
| 1121 | 3300025913 | Ga0207695_10149702 | Ga0207695_101497023 | 201 |
| 1122 | 3300025914 | Ga0207671_10049571 | Ga0207671_100495715 | 201 |
| 1123 | 3300025917 | Ga0207660_10002576 | Ga0207660_100025762 | 201 |
| 1124 | 3300025919 | Ga0207657_10008426 | Ga0207657_100084268 | 201 |
| 1125 | 3300025920 | Ga0207649_10275874 | Ga0207649_102758742 | 201 |
| 1126 | 3300025921 | Ga0207652_10077264 | Ga0207652_100772643 | 201 |
| 1127 | 3300025924 | Ga0207694_10044974 | Ga0207694_100449741 | 201 |
| 1128 | 3300025949 | Ga0207667_10010444 | Ga0207667_100104442 | 201 |
| 1129 | 3300026041 | Ga0207639_10003564 | Ga0207639_100035642 | 201 |
| 1130 | 3300026067 | Ga0207678_10500536 | Ga0207678_105005361 | 201 |
| 1131 | 3300026142 | Ga0207698_10273543 | Ga0207698_102735432 | 201 |
| 1132 | 3300031235 | Ga0265330_10004307 | Ga0265330_100043074 | 201 |
| 1133 | 3300031235 | Ga0265330_10026213 | Ga0265330_100262132 | 201 |
| 1134 | 3300031241 | Ga0265325_10008214 | Ga0265325_100082141 | 201 |
| 1135 | 3300031247 | Ga0265340_10002797 | Ga0265340_100027975 | 201 |
| 1136 | 3300031249 | Ga0265339_10032327 | Ga0265339_100323272 | 201 |
| 1137 | 3300031250 | Ga0265331_10019262 | Ga0265331_100192622 | 201 |
| 1138 | 3300031250 | Ga0265331_10170726 | Ga0265331_101707261 | 201 |
| 1139 | 3300031712 | Ga0265342_10025879 | Ga0265342_100258792 | 201 |
| 1140 | 3300041462 | Ga0451806_863455 | Ga0451806_863455_240_845 | 201 |
| 1141 | 3300046507 | Ga0495606_0005275 | Ga0495606_0005275_2399_3007 | 201 |
| 1142 | 3300046524 | Ga0495648_0027801 | Ga0495648_0027801_2337_2945 | 201 |
| 1143 | 3300048915 | Ga0496112_0000020 | Ga0496112_0000020_153896_154504 | 201 |
| 1144 | 3300048924 | Ga0496121_0000270 | Ga0496121_0000270_95581_96186 | 201 |
| 1145 | 3300048929 | Ga0496126_0044316 | Ga0496126_0044316_3442_4047 | 201 |
| 1146 | 3300050514 | nmdc:mga08x19_455809_c1 | nmdc:mga08x19_455809_c1_163_768 | 201 |
| 1147 | 3300053119 | Ga0500595_007669 | Ga0500595_007669_3126_3731 | 201 |
| 1148 | 3300053139 | Ga0500568_0041456 | Ga0500568_0041456_709_1314 | 201 |
| 1149 | 3300053153 | Ga0500616_0000127 | Ga0500616_0000127_2650_3264 | 201 |
| 1150 | 3300005327 | Ga0070658_10070700 | Ga0070658_100707002 | 202 |
| 1151 | 3300005439 | Ga0070711_100125060 | Ga0070711_1001250602 | 202 |
| 1152 | 3300005455 | Ga0070663_100107587 | Ga0070663_1001075872 | 202 |
| 1153 | 3300005471 | Ga0070698_101119659 | Ga0070698_1011196591 | 202 |
| 1154 | 3300005536 | Ga0070697_100385969 | Ga0070697_1003859692 | 202 |
| 1155 | 3300005563 | Ga0068855_100217393 | Ga0068855_1002173932 | 202 |
| 1156 | 3300005614 | Ga0068856_100628127 | Ga0068856_1006281271 | 202 |
| 1157 | 3300006175 | Ga0070712_100186524 | Ga0070712_1001865242 | 202 |
| 1158 | 3300007788 | Ga0099795_10017026 | Ga0099795_100170263 | 202 |
| 1159 | 3300009093 | Ga0105240_10148867 | Ga0105240_101488672 | 202 |
| 1160 | 3300009551 | Ga0105238_10442227 | Ga0105238_104422271 | 202 |
| 1161 | 3300022467 | Ga0224712_10027584 | Ga0224712_100275842 | 202 |
| 1162 | 3300025909 | Ga0207705_10660806 | Ga0207705_106608061 | 202 |
| 1163 | 3300025913 | Ga0207695_10270242 | Ga0207695_102702422 | 202 |
| 1164 | 3300025915 | Ga0207693_10177757 | Ga0207693_101777572 | 202 |
| 1165 | 3300025916 | Ga0207663_10298196 | Ga0207663_102981962 | 202 |
| 1166 | 3300025922 | Ga0207646_10042560 | Ga0207646_100425601 | 202 |
| 1167 | 3300025949 | Ga0207667_10237612 | Ga0207667_102376122 | 202 |
| 1168 | 3300025981 | Ga0207640_10103485 | Ga0207640_101034851 | 202 |
| 1169 | 3300026023 | Ga0207677_10358701 | Ga0207677_103587012 | 202 |
| 1170 | 3300026067 | Ga0207678_10021243 | Ga0207678_100212433 | 202 |
| 1171 | 3300026067 | Ga0207678_10147102 | Ga0207678_101471022 | 202 |
| 1172 | 3300028573 | Ga0265334_10048114 | Ga0265334_100481143 | 202 |
| 1173 | 3300032126 | Ga0307415_100266761 | Ga0307415_1002667612 | 202 |
| 1174 | 3300035083 | Ga0373926_0061857 | Ga0373926_0061857_399_1007 | 202 |
| 1175 | 3300035086 | Ga0373934_0025321 | Ga0373934_0025321_913_1521 | 202 |
| 1176 | 3300035086 | Ga0373934_0045393 | Ga0373934_0045393_183_791 | 202 |
| 1177 | 3300035086 | Ga0373934_0076714 | Ga0373934_0076714_14_622 | 202 |
| 1178 | 3300035111 | Ga0373923_0004941 | Ga0373923_0004941_3538_4146 | 202 |
| 1179 | 3300035111 | Ga0373923_0007011 | Ga0373923_0007011_1033_1641 | 202 |
| 1180 | 3300035111 | Ga0373923_0086521 | Ga0373923_0086521_711_1319 | 202 |
| 1181 | 3300035113 | Ga0373936_0027566 | Ga0373936_0027566_1602_2210 | 202 |
| 1182 | 3300035117 | Ga0373953_0000285 | Ga0373953_0000285_6186_6794 | 202 |
| 1183 | 3300035117 | Ga0373953_0007996 | Ga0373953_0007996_767_1375 | 202 |
| 1184 | 3300035117 | Ga0373953_0262520 | Ga0373953_0262520_123_731 | 202 |
| 1185 | 3300035118 | Ga0373954_0001351 | Ga0373954_0001351_6099_6707 | 202 |
| 1186 | 3300035118 | Ga0373954_0159753 | Ga0373954_0159753_49_657 | 202 |
| 1187 | 3300035119 | Ga0373956_0010175 | Ga0373956_0010175_2668_3276 | 202 |
| 1188 | 3300035119 | Ga0373956_0034088 | Ga0373956_0034088_436_1044 | 202 |
| 1189 | 3300035170 | Ga0373943_0004586 | Ga0373943_0004586_4272_4880 | 202 |
| 1190 | 3300035171 | Ga0373946_0003778 | Ga0373946_0003778_267_875 | 202 |
| 1191 | 3300035171 | Ga0373946_0038771 | Ga0373946_0038771_458_1066 | 202 |
| 1192 | 3300035172 | Ga0373955_0000636 | Ga0373955_0000636_8389_8997 | 202 |
| 1193 | 3300035172 | Ga0373955_0040531 | Ga0373955_0040531_452_1060 | 202 |
| 1194 | 3300035172 | Ga0373955_0044277 | Ga0373955_0044277_208_816 | 202 |
| 1195 | 3300035172 | Ga0373955_0248815 | Ga0373955_0248815_409_1017 | 202 |
| 1196 | 3300035172 | Ga0373955_0325075 | Ga0373955_0325075_190_798 | 202 |
| 1197 | 3300035410 | Ga0373924_0007304 | Ga0373924_0007304_181_789 | 202 |
| 1198 | 3300035410 | Ga0373924_0011229 | Ga0373924_0011229_1075_1683 | 202 |
| 1199 | 3300035692 | Ga0373935_0024695 | Ga0373935_0024695_1156_1764 | 202 |
| 1200 | 3300035692 | Ga0373935_0255286 | Ga0373935_0255286_475_1083 | 202 |
| 1201 | 3300035692 | Ga0373935_0633926 | Ga0373935_0633926_76_684 | 202 |
| 1202 | 3300035695 | Ga0373927_0003270 | Ga0373927_0003270_4086_4694 | 202 |
| 1203 | 3300035695 | Ga0373927_0017399 | Ga0373927_0017399_61_669 | 202 |
| 1204 | 3300035695 | Ga0373927_0023206 | Ga0373927_0023206_756_1364 | 202 |
| 1205 | 3300035724 | Ga0373933_0001611 | Ga0373933_0001611_10950_11558 | 202 |
| 1206 | 3300035724 | Ga0373933_0139004 | Ga0373933_0139004_668_1276 | 202 |
| 1207 | 3300035724 | Ga0373933_0140542 | Ga0373933_0140542_236_844 | 202 |
| 1208 | 3300035725 | Ga0373947_0000402 | Ga0373947_0000402_11915_12523 | 202 |
| 1209 | 3300035725 | Ga0373947_0056172 | Ga0373947_0056172_211_819 | 202 |
| 1210 | 3300035725 | Ga0373947_0187311 | Ga0373947_0187311_166_774 | 202 |
| 1211 | 3300036401 | Ga0373937_0011438 | Ga0373937_0011438_6548_7156 | 202 |
| 1212 | 3300036401 | Ga0373937_0030077 | Ga0373937_0030077_4225_4833 | 202 |
| 1213 | 3300036401 | Ga0373937_0032584 | Ga0373937_0032584_1776_2384 | 202 |
| 1214 | 3300036401 | Ga0373937_0096145 | Ga0373937_0096145_1727_2335 | 202 |
| 1215 | 3300036401 | Ga0373937_0141108 | Ga0373937_0141108_985_1593 | 202 |
| 1216 | 3300037068 | Ga0373925_0005137 | Ga0373925_0005137_553_1161 | 202 |
| 1217 | 3300037068 | Ga0373925_0089135 | Ga0373925_0089135_885_1493 | 202 |
| 1218 | 3300037068 | Ga0373925_0538312 | Ga0373925_0538312_336_944 | 202 |
| 1219 | 3300041509 | Ga0451843_1567046 | Ga0451843_1567046_85_696 | 202 |
| 1220 | 3300044842 | Ga0466957_0020746 | Ga0466957_0020746_260_868 | 202 |
| 1221 | 3300045976 | Ga0466967_0194934 | Ga0466967_0194934_739_1350 | 202 |
| 1222 | 3300046454 | Ga0495592_0001817 | Ga0495592_0001817_4567_5175 | 202 |
| 1223 | 3300046454 | Ga0495592_0084299 | Ga0495592_0084299_1231_1839 | 202 |
| 1224 | 3300046455 | Ga0495603_0000826 | Ga0495603_0000826_16869_17477 | 202 |
| 1225 | 3300046455 | Ga0495603_0007445 | Ga0495603_0007445_5108_5716 | 202 |
| 1226 | 3300046459 | Ga0495629_0000337 | Ga0495629_0000337_33434_34042 | 202 |
| 1227 | 3300046459 | Ga0495629_0000587 | Ga0495629_0000587_16820_17428 | 202 |
| 1228 | 3300046459 | Ga0495629_0111406 | Ga0495629_0111406_799_1407 | 202 |
| 1229 | 3300046462 | Ga0495651_0006522 | Ga0495651_0006522_6660_7268 | 202 |
| 1230 | 3300046462 | Ga0495651_0047122 | Ga0495651_0047122_40_648 | 202 |
| 1231 | 3300046462 | Ga0495651_0088850 | Ga0495651_0088850_132_740 | 202 |
| 1232 | 3300046462 | Ga0495651_0345161 | Ga0495651_0345161_110_718 | 202 |
| 1233 | 3300046463 | Ga0495653_0001248 | Ga0495653_0001248_5723_6331 | 202 |
| 1234 | 3300046463 | Ga0495653_0223262 | Ga0495653_0223262_225_833 | 202 |
| 1235 | 3300046472 | Ga0495580_0002634 | Ga0495580_0002634_3911_4519 | 202 |
| 1236 | 3300046472 | Ga0495580_0514119 | Ga0495580_0514119_140_748 | 202 |
| 1237 | 3300046473 | Ga0495582_0000018 | Ga0495582_0000018_71115_71723 | 202 |
| 1238 | 3300046475 | Ga0495639_0000272 | Ga0495639_0000272_3156_3764 | 202 |
| 1239 | 3300046476 | Ga0495662_0000023 | Ga0495662_0000023_49911_50519 | 202 |
| 1240 | 3300046477 | Ga0495664_0205258 | Ga0495664_0205258_247_855 | 202 |
| 1241 | 3300046477 | Ga0495664_0236849 | Ga0495664_0236849_342_950 | 202 |
| 1242 | 3300046499 | Ga0495594_0000155 | Ga0495594_0000155_15212_15820 | 202 |
| 1243 | 3300046499 | Ga0495594_0141619 | Ga0495594_0141619_556_1164 | 202 |
| 1244 | 3300046511 | Ga0495608_0007746 | Ga0495608_0007746_6773_7381 | 202 |
| 1245 | 3300046511 | Ga0495608_0153164 | Ga0495608_0153164_76_684 | 202 |
| 1246 | 3300046514 | Ga0495618_0071100 | Ga0495618_0071100_1444_2052 | 202 |
| 1247 | 3300046514 | Ga0495618_0094263 | Ga0495618_0094263_698_1306 | 202 |
| 1248 | 3300046514 | Ga0495618_0116963 | Ga0495618_0116963_1065_1673 | 202 |
| 1249 | 3300046516 | Ga0495628_0022393 | Ga0495628_0022393_1807_2415 | 202 |
| 1250 | 3300046516 | Ga0495628_0024841 | Ga0495628_0024841_4080_4688 | 202 |
| 1251 | 3300046517 | Ga0495630_0031482 | Ga0495630_0031482_2329_2937 | 202 |
| 1252 | 3300046524 | Ga0495648_0025624 | Ga0495648_0025624_2696_3304 | 202 |
| 1253 | 3300046529 | Ga0495652_0010774 | Ga0495652_0010774_7088_7696 | 202 |
| 1254 | 3300046529 | Ga0495652_0085591 | Ga0495652_0085591_948_1556 | 202 |
| 1255 | 3300046529 | Ga0495652_0108398 | Ga0495652_0108398_428_1036 | 202 |
| 1256 | 3300046531 | Ga0495665_0006339 | Ga0495665_0006339_2067_2675 | 202 |
| 1257 | 3300046531 | Ga0495665_0169006 | Ga0495665_0169006_122_730 | 202 |
| 1258 | 3300046533 | Ga0495640_0007630 | Ga0495640_0007630_5839_6447 | 202 |
| 1259 | 3300046533 | Ga0495640_0012003 | Ga0495640_0012003_3028_3636 | 202 |
| 1260 | 3300046533 | Ga0495640_0083233 | Ga0495640_0083233_284_892 | 202 |
| 1261 | 3300046536 | Ga0495587_0006289 | Ga0495587_0006289_7088_7696 | 202 |
| 1262 | 3300046536 | Ga0495587_0241048 | Ga0495587_0241048_126_734 | 202 |
| 1263 | 3300046543 | Ga0495645_0013917 | Ga0495645_0013917_3900_4508 | 202 |
| 1264 | 3300046543 | Ga0495645_0019992 | Ga0495645_0019992_3210_3818 | 202 |
| 1265 | 3300046557 | Ga0495622_0001524 | Ga0495622_0001524_3864_4472 | 202 |
| 1266 | 3300046559 | Ga0495667_0000270 | Ga0495667_0000270_21087_21695 | 202 |
| 1267 | 3300046559 | Ga0495667_0009948 | Ga0495667_0009948_3460_4068 | 202 |
| 1268 | 3300046559 | Ga0495667_0032576 | Ga0495667_0032576_2565_3173 | 202 |
| 1269 | 3300046559 | Ga0495667_0246339 | Ga0495667_0246339_212_820 | 202 |
| 1270 | 3300046642 | Ga0495634_0001584 | Ga0495634_0001584_2195_2803 | 202 |
| 1271 | 3300046642 | Ga0495634_0003421 | Ga0495634_0003421_3702_4310 | 202 |
| 1272 | 3300046642 | Ga0495634_0100430 | Ga0495634_0100430_286_894 | 202 |
| 1273 | 3300046663 | Ga0495635_0001043 | Ga0495635_0001043_6078_6686 | 202 |
| 1274 | 3300046663 | Ga0495635_0001867 | Ga0495635_0001867_1942_2550 | 202 |
| 1275 | 3300046663 | Ga0495635_0014465 | Ga0495635_0014465_2490_3098 | 202 |
| 1276 | 3300046674 | Ga0495588_0002125 | Ga0495588_0002125_1674_2282 | 202 |
| 1277 | 3300046675 | Ga0495657_0004611 | Ga0495657_0004611_4654_5262 | 202 |
| 1278 | 3300046675 | Ga0495657_0039530 | Ga0495657_0039530_720_1328 | 202 |
| 1279 | 3300046675 | Ga0495657_0150137 | Ga0495657_0150137_663_1271 | 202 |
| 1280 | 3300046678 | Ga0495599_0001005 | Ga0495599_0001005_7755_8363 | 202 |
| 1281 | 3300046678 | Ga0495599_0008343 | Ga0495599_0008343_2967_3575 | 202 |
| 1282 | 3300046678 | Ga0495599_0067491 | Ga0495599_0067491_1333_1941 | 202 |
| 1283 | 3300046679 | Ga0495623_0006560 | Ga0495623_0006560_6788_7396 | 202 |
| 1284 | 3300046679 | Ga0495623_0046270 | Ga0495623_0046270_561_1169 | 202 |
| 1285 | 3300046679 | Ga0495623_0222681 | Ga0495623_0222681_240_848 | 202 |
| 1286 | 3300046679 | Ga0495623_0303826 | Ga0495623_0303826_51_659 | 202 |
| 1287 | 3300046680 | Ga0495646_0003477 | Ga0495646_0003477_983_1591 | 202 |
| 1288 | 3300046680 | Ga0495646_0076876 | Ga0495646_0076876_70_678 | 202 |
| 1289 | 3300046680 | Ga0495646_0120665 | Ga0495646_0120665_487_1095 | 202 |
| 1290 | 3300046681 | Ga0495647_0001870 | Ga0495647_0001870_1842_2450 | 202 |
| 1291 | 3300046683 | Ga0495658_0002067 | Ga0495658_0002067_4213_4821 | 202 |
| 1292 | 3300046683 | Ga0495658_0148356 | Ga0495658_0148356_175_783 | 202 |
| 1293 | 3300046683 | Ga0495658_0293974 | Ga0495658_0293974_74_682 | 202 |
| 1294 | 3300046689 | Ga0495613_0036823 | Ga0495613_0036823_2044_2652 | 202 |
| 1295 | 3300046689 | Ga0495613_0049088 | Ga0495613_0049088_1176_1784 | 202 |
| 1296 | 3300046690 | Ga0495624_0001316 | Ga0495624_0001316_2043_2651 | 202 |
| 1297 | 3300046809 | Ga0495600_0000400 | Ga0495600_0000400_16304_16912 | 202 |
| 1298 | 3300047315 | Ga0495581_0002742 | Ga0495581_0002742_2196_2804 | 202 |
| 1299 | 3300047315 | Ga0495581_0035143 | Ga0495581_0035143_139_747 | 202 |
| 1300 | 3300047317 | Ga0495604_0015960 | Ga0495604_0015960_4900_5508 | 202 |
| 1301 | 3300047319 | Ga0495674_0003018 | Ga0495674_0003018_13416_14024 | 202 |
| 1302 | 3300047319 | Ga0495674_0080034 | Ga0495674_0080034_1456_2064 | 202 |
| 1303 | 3300047319 | Ga0495674_0203816 | Ga0495674_0203816_935_1543 | 202 |
| 1304 | 3300047321 | Ga0495676_0039072 | Ga0495676_0039072_740_1348 | 202 |
| 1305 | 3300047321 | Ga0495676_0066367 | Ga0495676_0066367_1711_2319 | 202 |
| 1306 | 3300047322 | Ga0495680_0002432 | Ga0495680_0002432_6662_7270 | 202 |
| 1307 | 3300047322 | Ga0495680_0037304 | Ga0495680_0037304_1968_2576 | 202 |
| 1308 | 3300047322 | Ga0495680_0505477 | Ga0495680_0505477_101_709 | 202 |
| 1309 | 3300047444 | Ga0495675_0074297 | Ga0495675_0074297_589_1197 | 202 |
| 1310 | 3300047444 | Ga0495675_0180255 | Ga0495675_0180255_632_1240 | 202 |
| 1311 | 3300047469 | Ga0495673_0018685 | Ga0495673_0018685_366_974 | 202 |
| 1312 | 3300047471 | Ga0495684_0000766 | Ga0495684_0000766_5976_6584 | 202 |
| 1313 | 3300047471 | Ga0495684_0058049 | Ga0495684_0058049_1876_2484 | 202 |
| 1314 | 3300047471 | Ga0495684_0315700 | Ga0495684_0315700_270_878 | 202 |
| 1315 | 3300047673 | Ga0495593_0000419 | Ga0495593_0000419_16869_17477 | 202 |
| 1316 | 3300047673 | Ga0495593_0006119 | Ga0495593_0006119_4902_5510 | 202 |
| 1317 | 3300048088 | Ga0495602_0053610 | Ga0495602_0053610_504_1112 | 202 |
| 1318 | 3300048088 | Ga0495602_0066580 | Ga0495602_0066580_2446_3054 | 202 |
| 1319 | 3300048913 | Ga0496110_0195641 | Ga0496110_0195641_798_1406 | 202 |
| 1320 | 3300048914 | Ga0496111_0460995 | Ga0496111_0460995_74_682 | 202 |
| 1321 | 3300048915 | Ga0496112_0230112 | Ga0496112_0230112_740_1348 | 202 |
| 1322 | 3300048918 | Ga0496115_0085598 | Ga0496115_0085598_242_850 | 202 |
| 1323 | 3300048929 | Ga0496126_0141839 | Ga0496126_0141839_833_1444 | 202 |
| 1324 | 3300049581 | Ga0501047_0060047 | Ga0501047_0060047_552_1163 | 202 |
| 1325 | 3300050492 | nmdc:mga0yw44_41065_c1 | nmdc:mga0yw44_41065_c1_1115_1726 | 202 |
| 1326 | 3300053077 | Ga0495601_0020415 | Ga0495601_0020415_3258_3866 | 202 |
| 1327 | 3300053077 | Ga0495601_0617826 | Ga0495601_0617826_19_627 | 202 |
| 1328 | 3300053078 | Ga0495612_0072416 | Ga0495612_0072416_796_1404 | 202 |
| 1329 | 3300053078 | Ga0495612_0119094 | Ga0495612_0119094_280_888 | 202 |
| 1330 | 3300053078 | Ga0495612_0363651 | Ga0495612_0363651_22_630 | 202 |
| 1331 | 3300053084 | Ga0495595_0001138 | Ga0495595_0001138_9142_9750 | 202 |
| 1332 | 3300053084 | Ga0495595_0008097 | Ga0495595_0008097_1206_1814 | 202 |
| 1333 | 3300053085 | Ga0495619_0016127 | Ga0495619_0016127_491_1099 | 202 |
| 1334 | 3300053086 | Ga0500578_0100444 | Ga0500578_0100444_365_982 | 203 |
| 1335 | 3300053092 | Ga0500583_0085309 | Ga0500583_0085309_488_1105 | 203 |
| 1336 | 3300053093 | Ga0500651_0002638 | Ga0500651_0002638_6168_6785 | 203 |
| 1337 | 3300053118 | Ga0500594_0003603 | Ga0500594_0003603_206_823 | 203 |
| 1338 | 3300053119 | Ga0500595_001299 | Ga0500595_001299_503_1120 | 203 |
| 1339 | 3300053130 | Ga0500642_0002295 | Ga0500642_0002295_4263_4880 | 203 |
| 1340 | 3300005366 | Ga0070659_100058955 | Ga0070659_1000589553 | 204 |
| 1341 | 3300005563 | Ga0068855_100319149 | Ga0068855_1003191492 | 204 |
| 1342 | 3300013105 | Ga0157369_10186347 | Ga0157369_101863472 | 204 |
| 1343 | 3300025917 | Ga0207660_10084430 | Ga0207660_100844302 | 204 |
| 1344 | 3300025932 | Ga0207690_10545348 | Ga0207690_105453482 | 204 |
| 1345 | 3300026142 | Ga0207698_10154328 | Ga0207698_101543282 | 204 |
| 1346 | 3300047472 | Ga0495686_0186604 | Ga0495686_0186604_527_1144 | 204 |
| 1347 | 3300048915 | Ga0496112_0345605 | Ga0496112_0345605_642_1256 | 204 |
| 1348 | 3300001989 | JGI24739J22299_10008334 | JGI24739J22299_100083347 | 205 |
| 1349 | 3300005455 | Ga0070663_100010152 | Ga0070663_1000101525 | 205 |
| 1350 | 3300005539 | Ga0068853_100032203 | Ga0068853_1000322034 | 205 |
| 1351 | 3300005563 | Ga0068855_100021775 | Ga0068855_1000217759 | 205 |
| 1352 | 3300005577 | Ga0068857_100022705 | Ga0068857_1000227055 | 205 |
| 1353 | 3300005578 | Ga0068854_100157430 | Ga0068854_1001574302 | 205 |
| 1354 | 3300005614 | Ga0068856_100023377 | Ga0068856_1000233775 | 205 |
| 1355 | 3300005616 | Ga0068852_100235724 | Ga0068852_1002357242 | 205 |
| 1356 | 3300009545 | Ga0105237_10089262 | Ga0105237_100892622 | 205 |
| 1357 | 3300009551 | Ga0105238_10078708 | Ga0105238_100787082 | 205 |
| 1358 | 3300010375 | Ga0105239_10049838 | Ga0105239_100498382 | 205 |
| 1359 | 3300025904 | Ga0207647_10006459 | Ga0207647_100064598 | 205 |
| 1360 | 3300025914 | Ga0207671_10089189 | Ga0207671_100891892 | 205 |
| 1361 | 3300025920 | Ga0207649_10233364 | Ga0207649_102333642 | 205 |
| 1362 | 3300025924 | Ga0207694_10031304 | Ga0207694_100313043 | 205 |
| 1363 | 3300025949 | Ga0207667_10043047 | Ga0207667_100430472 | 205 |
| 1364 | 3300025981 | Ga0207640_10533811 | Ga0207640_105338112 | 205 |
| 1365 | 3300026041 | Ga0207639_10342291 | Ga0207639_103422911 | 205 |
| 1366 | 3300026067 | Ga0207678_10018042 | Ga0207678_100180423 | 205 |
| 1367 | 3300026078 | Ga0207702_10005413 | Ga0207702_100054135 | 205 |
| 1368 | 3300026116 | Ga0207674_10042939 | Ga0207674_100429394 | 205 |
| 1369 | 3300026142 | Ga0207698_10199312 | Ga0207698_101993122 | 205 |
| 1370 | 3300005434 | Ga0070709_10449380 | Ga0070709_104493801 | 206 |
| 1371 | 3300005436 | Ga0070713_100007850 | Ga0070713_1000078505 | 206 |
| 1372 | 3300005840 | Ga0068870_10076285 | Ga0068870_100762851 | 206 |
| 1373 | 3300025928 | Ga0207700_10005791 | Ga0207700_100057916 | 206 |
| 1374 | 3300005434 | Ga0070709_10007655 | Ga0070709_100076558 | 207 |
| 1375 | 3300005435 | Ga0070714_100024582 | Ga0070714_1000245826 | 207 |
| 1376 | 3300005436 | Ga0070713_100013276 | Ga0070713_1000132763 | 207 |
| 1377 | 3300005437 | Ga0070710_10003955 | Ga0070710_100039556 | 207 |
| 1378 | 3300005439 | Ga0070711_100009559 | Ga0070711_1000095592 | 207 |
| 1379 | 3300006028 | Ga0070717_10009355 | Ga0070717_100093558 | 207 |
| 1380 | 3300006163 | Ga0070715_10008734 | Ga0070715_100087342 | 207 |
| 1381 | 3300006173 | Ga0070716_100015200 | Ga0070716_1000152003 | 207 |
| 1382 | 3300025898 | Ga0207692_10005010 | Ga0207692_100050105 | 207 |
| 1383 | 3300025905 | Ga0207685_10019369 | Ga0207685_100193692 | 207 |
| 1384 | 3300025915 | Ga0207693_10006492 | Ga0207693_100064926 | 207 |
| 1385 | 3300025916 | Ga0207663_10000630 | Ga0207663_100006306 | 207 |
| 1386 | 3300025928 | Ga0207700_10042068 | Ga0207700_100420682 | 207 |
| 1387 | 3300025929 | Ga0207664_10012691 | Ga0207664_100126911 | 207 |
| 1388 | 3300025939 | Ga0207665_10000235 | Ga0207665_1000023532 | 207 |
| 1389 | 3300036401 | Ga0373937_0351257 | Ga0373937_0351257_347_973 | 207 |
| 1390 | 3300001979 | JGI24740J21852_10003409 | JGI24740J21852_100034099 | 209 |
| 1391 | 3300005539 | Ga0068853_100008973 | Ga0068853_1000089739 | 209 |
| 1392 | 3300005578 | Ga0068854_100003097 | Ga0068854_1000030978 | 209 |
| 1393 | 3300005616 | Ga0068852_101165377 | Ga0068852_1011653771 | 209 |
| 1394 | 3300005834 | Ga0068851_10004663 | Ga0068851_100046636 | 209 |
| 1395 | 3300009093 | Ga0105240_10060689 | Ga0105240_100606892 | 209 |
| 1396 | 3300009174 | Ga0105241_10002619 | Ga0105241_100026195 | 209 |
| 1397 | 3300009545 | Ga0105237_10135303 | Ga0105237_101353032 | 209 |
| 1398 | 3300009551 | Ga0105238_10015293 | Ga0105238_100152934 | 209 |
| 1399 | 3300025906 | Ga0207699_10001416 | Ga0207699_100014169 | 209 |
| 1400 | 3300025911 | Ga0207654_10000175 | Ga0207654_100001757 | 209 |
| 1401 | 3300025913 | Ga0207695_10009236 | Ga0207695_1000923610 | 209 |
| 1402 | 3300025924 | Ga0207694_10000226 | Ga0207694_1000022621 | 209 |
| 1403 | 3300025949 | Ga0207667_10026837 | Ga0207667_100268377 | 209 |
| 1404 | 3300025981 | Ga0207640_10332145 | Ga0207640_103321452 | 209 |
| 1405 | 3300026041 | Ga0207639_10027664 | Ga0207639_100276641 | 209 |
| 1406 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004322 | 209 |
| 1407 | 3300026116 | Ga0207674_10043994 | Ga0207674_100439944 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar