F493673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1400 | 497 | 2800 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0192725|Ga0495676_0192725_203_1150 |
| Length | 303 |
| Sequence | MSFTGALSQLLEIVIAIALAPLLTGWVNQWRSWLQNKSAPSLWQPYWMLHKLFNKESMVADNASPLFRTAPYVKLGCMVLACAIIPTLSTDLPLAPAADAIALVGLFALARVFISLAAMDIGTAFGTMGARREMLVGFLAEPALLMVLFSASLISKSTSLTTIVGTLAHRELTIYPGLAENSRVPIDNPATHLELTMLHEALILEYSGRHLALLEWAASLKLFAYSCIGLALFFPWGVAEAQAPLAMLLALPALVLKLAVGGFMLALLETINAKMRIFRVPEFLATAFLLAVIGMLVHLLLAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 226 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 231 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 236 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 237 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 256 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 263 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 286 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 287 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 288 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 289 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 290 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 291 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 292 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 293 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 294 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 295 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 296 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 297 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 298 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 299 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 300 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 301 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 302 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 303 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 312 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 410 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 411 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 435 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 436 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 456 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 459 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 460 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 461 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 463 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 465 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 467 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 468 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 469 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 470 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 471 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 472 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 473 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 474 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 475 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 476 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 477 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 478 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 479 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 480 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 481 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 482 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 483 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 484 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 485 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 486 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 487 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 488 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 489 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 490 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 491 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 492 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 493 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 494 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 495 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 496 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 497 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 0 |
| Isolates | 2.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.86 |
| Nodule | 0.5 |
| Rhizoplane | 2.79 |
| Rhizosphere | 91.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495676_0192725 | 3300047321 | Bacteria | 1421 |
| 2 | SwRhRL2b_contig_365350 | 2162886007 | Bacteria | 8655 |
| 3 | rootH1_10121089 | 3300003323 | Bacteria | 2228 |
| 4 | Ga0055532_1000124 | 3300003758 | Bacteria | 78333 |
| 5 | Ga0055527_1000036 | 3300003760 | Bacteria | 133374 |
| 6 | Ga0055535_1000051 | 3300003761 | Bacteria | 133374 |
| 7 | Ga0055542_1001307 | 3300003762 | Bacteria | 13217 |
| 8 | Ga0065712_10068735 | 3300005290 | Bacteria | 9198 |
| 9 | Ga0065715_10105432 | 3300005293 | Bacteria | 2893 |
| 10 | Ga0065715_10132801 | 3300005293 | Bacteria | 1984 |
| 11 | Ga0065707_10000604 | 3300005295 | Bacteria | 25275 |
| 12 | Ga0065707_10031187 | 3300005295 | Bacteria | 1348 |
| 13 | Ga0070676_10003719 | 3300005328 | Bacteria | 7995 |
| 14 | Ga0070683_100002653 | 3300005329 | Bacteria | 14305 |
| 15 | Ga0070683_100022207 | 3300005329 | Bacteria | 5668 |
| 16 | Ga0070690_100000816 | 3300005330 | Bacteria | 15789 |
| 17 | Ga0070690_100021782 | 3300005330 | Bacteria | 3916 |
| 18 | Ga0070690_100061311 | 3300005330 | Bacteria | 2423 |
| 19 | Ga0070670_100000816 | 3300005331 | Bacteria | 24269 |
| 20 | Ga0070670_100014443 | 3300005331 | Bacteria | 6778 |
| 21 | Ga0070670_100197121 | 3300005331 | Bacteria | 1749 |
| 22 | Ga0070670_100459774 | 3300005331 | Bacteria | 1129 |
| 23 | Ga0068869_100002189 | 3300005334 | Bacteria | 11757 |
| 24 | Ga0068869_100003615 | 3300005334 | Bacteria | 9486 |
| 25 | Ga0068869_100033933 | 3300005334 | Bacteria | 3607 |
| 26 | Ga0068869_100038674 | 3300005334 | Bacteria | 3402 |
| 27 | Ga0068869_100099763 | 3300005334 | Bacteria | 2195 |
| 28 | Ga0070666_10009338 | 3300005335 | Bacteria | 6111 |
| 29 | Ga0070666_10016993 | 3300005335 | Bacteria | 4660 |
| 30 | Ga0070666_10084623 | 3300005335 | Bacteria | 2171 |
| 31 | Ga0070680_100017814 | 3300005336 | Bacteria | 5604 |
| 32 | Ga0070680_100055669 | 3300005336 | Bacteria | 3232 |
| 33 | Ga0070680_100100311 | 3300005336 | Bacteria | 2403 |
| 34 | Ga0070680_100109741 | 3300005336 | Bacteria | 2296 |
| 35 | Ga0068868_100039606 | 3300005338 | Bacteria | 3662 |
| 36 | Ga0068868_100060597 | 3300005338 | Bacteria | 2997 |
| 37 | Ga0068868_100074960 | 3300005338 | Bacteria | 2703 |
| 38 | Ga0068868_100152495 | 3300005338 | Bacteria | 1904 |
| 39 | Ga0068868_100407253 | 3300005338 | Bacteria | 1175 |
| 40 | Ga0070660_100001108 | 3300005339 | Bacteria | 18149 |
| 41 | Ga0070660_100001577 | 3300005339 | Bacteria | 15675 |
| 42 | Ga0070660_100060216 | 3300005339 | Bacteria | 2946 |
| 43 | Ga0070660_100100178 | 3300005339 | Bacteria | 2294 |
| 44 | Ga0070689_100000421 | 3300005340 | Bacteria | 24985 |
| 45 | Ga0070689_100036291 | 3300005340 | Bacteria | 3770 |
| 46 | Ga0070691_10003356 | 3300005341 | Bacteria | 7189 |
| 47 | Ga0070661_100003820 | 3300005344 | Bacteria | 10367 |
| 48 | Ga0070661_100020427 | 3300005344 | Bacteria | 4722 |
| 49 | Ga0070692_10004660 | 3300005345 | Bacteria | 5746 |
| 50 | Ga0070692_10082482 | 3300005345 | Bacteria | 1734 |
| 51 | Ga0070668_100029002 | 3300005347 | Bacteria | 4201 |
| 52 | Ga0070668_100047902 | 3300005347 | Bacteria | 3287 |
| 53 | Ga0070668_100211110 | 3300005347 | Bacteria | 1597 |
| 54 | Ga0070668_100222445 | 3300005347 | Bacteria | 1557 |
| 55 | Ga0070668_100236171 | 3300005347 | Bacteria | 1513 |
| 56 | Ga0070669_100012004 | 3300005353 | Bacteria | 6148 |
| 57 | Ga0070669_100024084 | 3300005353 | Bacteria | 4363 |
| 58 | Ga0070669_100174270 | 3300005353 | Bacteria | 1679 |
| 59 | Ga0070675_100005747 | 3300005354 | Bacteria | 9488 |
| 60 | Ga0070675_100006854 | 3300005354 | Bacteria | 8745 |
| 61 | Ga0070675_100008107 | 3300005354 | Bacteria | 8145 |
| 62 | Ga0070675_100010573 | 3300005354 | Bacteria | 7213 |
| 63 | Ga0070675_100016164 | 3300005354 | Bacteria | 5917 |
| 64 | Ga0070675_100018178 | 3300005354 | Bacteria | 5594 |
| 65 | Ga0070675_100052643 | 3300005354 | Bacteria | 3347 |
| 66 | Ga0070675_100058700 | 3300005354 | Bacteria | 3173 |
| 67 | Ga0070675_100064971 | 3300005354 | Bacteria | 3016 |
| 68 | Ga0070675_100344544 | 3300005354 | Bacteria | 1320 |
| 69 | Ga0070671_100005851 | 3300005355 | Bacteria | 9797 |
| 70 | Ga0070671_100011916 | 3300005355 | Bacteria | 6993 |
| 71 | Ga0070671_100017868 | 3300005355 | Bacteria | 5750 |
| 72 | Ga0070671_100086400 | 3300005355 | Bacteria | 2624 |
| 73 | Ga0070671_100098886 | 3300005355 | Bacteria | 2447 |
| 74 | Ga0070671_100243200 | 3300005355 | Bacteria | 1528 |
| 75 | Ga0070674_100021247 | 3300005356 | Bacteria | 4162 |
| 76 | Ga0070674_100034273 | 3300005356 | Bacteria | 3389 |
| 77 | Ga0070673_100024097 | 3300005364 | Bacteria | 4456 |
| 78 | Ga0070673_100041108 | 3300005364 | Bacteria | 3552 |
| 79 | Ga0070673_100126436 | 3300005364 | Bacteria | 2139 |
| 80 | Ga0070673_100131669 | 3300005364 | Bacteria | 2099 |
| 81 | Ga0070673_100463365 | 3300005364 | Bacteria | 1141 |
| 82 | Ga0070688_100044248 | 3300005365 | Bacteria | 2746 |
| 83 | Ga0070688_100047397 | 3300005365 | Bacteria | 2666 |
| 84 | Ga0070688_100175327 | 3300005365 | Bacteria | 1483 |
| 85 | Ga0070659_100000861 | 3300005366 | Bacteria | 22182 |
| 86 | Ga0070659_100010215 | 3300005366 | Bacteria | 6905 |
| 87 | Ga0070659_100295102 | 3300005366 | Bacteria | 1350 |
| 88 | Ga0070667_100023426 | 3300005367 | Bacteria | 5122 |
| 89 | Ga0070667_100045092 | 3300005367 | Bacteria | 3706 |
| 90 | Ga0070667_100056206 | 3300005367 | Bacteria | 3324 |
| 91 | Ga0070667_100076171 | 3300005367 | Bacteria | 2864 |
| 92 | Ga0070667_100087394 | 3300005367 | Bacteria | 2676 |
| 93 | Ga0070667_100096442 | 3300005367 | Bacteria | 2550 |
| 94 | Ga0070667_100197073 | 3300005367 | Bacteria | 1786 |
| 95 | Ga0070667_100264767 | 3300005367 | Bacteria | 1540 |
| 96 | Ga0070667_100295829 | 3300005367 | Bacteria | 1457 |
| 97 | Ga0070709_10017823 | 3300005434 | Bacteria | 4080 |
| 98 | Ga0070714_100001074 | 3300005435 | Bacteria | 19541 |
| 99 | Ga0070714_100315095 | 3300005435 | Bacteria | 1462 |
| 100 | Ga0070713_100005981 | 3300005436 | Bacteria | 8370 |
| 101 | Ga0070713_100036255 | 3300005436 | Bacteria | 3979 |
| 102 | Ga0070713_100051781 | 3300005436 | Bacteria | 3397 |
| 103 | Ga0070713_100094648 | 3300005436 | Bacteria | 2576 |
| 104 | Ga0070701_10002293 | 3300005438 | Bacteria | 7331 |
| 105 | Ga0070701_10013320 | 3300005438 | Bacteria | 3738 |
| 106 | Ga0070711_100092007 | 3300005439 | Bacteria | 2188 |
| 107 | Ga0070711_100161734 | 3300005439 | Bacteria | 1698 |
| 108 | Ga0070711_100189663 | 3300005439 | Bacteria | 1579 |
| 109 | Ga0070705_100004895 | 3300005440 | Bacteria | 6523 |
| 110 | Ga0070705_100311620 | 3300005440 | Bacteria | 1132 |
| 111 | Ga0070700_100012304 | 3300005441 | Bacteria | 4769 |
| 112 | Ga0070700_100107828 | 3300005441 | Bacteria | 1846 |
| 113 | Ga0070694_100016655 | 3300005444 | Bacteria | 4630 |
| 114 | Ga0070694_100050085 | 3300005444 | Bacteria | 2814 |
| 115 | Ga0070694_100060441 | 3300005444 | Bacteria | 2584 |
| 116 | Ga0070694_100275684 | 3300005444 | Bacteria | 1281 |
| 117 | Ga0070663_100008570 | 3300005455 | Bacteria | 6299 |
| 118 | Ga0070663_100058784 | 3300005455 | Bacteria | 2762 |
| 119 | Ga0070663_100160837 | 3300005455 | Bacteria | 1728 |
| 120 | Ga0070678_100023134 | 3300005456 | Bacteria | 4135 |
| 121 | Ga0070678_100044645 | 3300005456 | Bacteria | 3165 |
| 122 | Ga0070678_100055959 | 3300005456 | Bacteria | 2882 |
| 123 | Ga0070678_100060738 | 3300005456 | Bacteria | 2783 |
| 124 | Ga0070678_100064112 | 3300005456 | Bacteria | 2722 |
| 125 | Ga0070678_100190535 | 3300005456 | Bacteria | 1686 |
| 126 | Ga0070678_100227654 | 3300005456 | Bacteria | 1553 |
| 127 | Ga0070662_100021621 | 3300005457 | Bacteria | 4395 |
| 128 | Ga0070662_100044112 | 3300005457 | Bacteria | 3193 |
| 129 | Ga0070662_100078058 | 3300005457 | Bacteria | 2459 |
| 130 | Ga0070681_10002158 | 3300005458 | Bacteria | 17897 |
| 131 | Ga0070681_10011416 | 3300005458 | Bacteria | 8792 |
| 132 | Ga0070681_10011526 | 3300005458 | Bacteria | 8750 |
| 133 | Ga0070681_10033595 | 3300005458 | Bacteria | 5149 |
| 134 | Ga0070681_10034179 | 3300005458 | Bacteria | 5105 |
| 135 | Ga0070681_10099027 | 3300005458 | Bacteria | 2861 |
| 136 | Ga0070681_10296179 | 3300005458 | Bacteria | 1528 |
| 137 | Ga0068867_100000215 | 3300005459 | Bacteria | 38520 |
| 138 | Ga0068867_100022935 | 3300005459 | Bacteria | 4466 |
| 139 | Ga0068867_100079461 | 3300005459 | Bacteria | 2469 |
| 140 | Ga0068867_100086134 | 3300005459 | Bacteria | 2376 |
| 141 | Ga0068867_100087576 | 3300005459 | Bacteria | 2358 |
| 142 | Ga0068867_100112807 | 3300005459 | Bacteria | 2091 |
| 143 | Ga0068867_100221042 | 3300005459 | Bacteria | 1526 |
| 144 | Ga0070706_100038140 | 3300005467 | Bacteria | 4436 |
| 145 | Ga0070706_100314176 | 3300005467 | Bacteria | 1461 |
| 146 | Ga0070706_100565921 | 3300005467 | Bacteria | 1057 |
| 147 | Ga0070707_100049906 | 3300005468 | Bacteria | 4011 |
| 148 | Ga0070698_100237648 | 3300005471 | Bacteria | 1755 |
| 149 | Ga0070699_100050857 | 3300005518 | Bacteria | 3588 |
| 150 | Ga0070679_100002776 | 3300005530 | Bacteria | 15915 |
| 151 | Ga0070679_100007196 | 3300005530 | Bacteria | 10394 |
| 152 | Ga0070679_100015155 | 3300005530 | Bacteria | 7407 |
| 153 | Ga0070679_100139486 | 3300005530 | Bacteria | 2405 |
| 154 | Ga0070679_100149467 | 3300005530 | Bacteria | 2313 |
| 155 | Ga0070679_100220462 | 3300005530 | Bacteria | 1858 |
| 156 | Ga0070684_100005851 | 3300005535 | Bacteria | 9461 |
| 157 | Ga0070684_100008616 | 3300005535 | Bacteria | 7988 |
| 158 | Ga0070684_100211630 | 3300005535 | Bacteria | 1767 |
| 159 | Ga0070684_100215985 | 3300005535 | Bacteria | 1749 |
| 160 | Ga0070697_100005759 | 3300005536 | Bacteria | 9555 |
| 161 | Ga0068853_100053724 | 3300005539 | Bacteria | 3469 |
| 162 | Ga0068853_100055724 | 3300005539 | Bacteria | 3407 |
| 163 | Ga0068853_100381500 | 3300005539 | Bacteria | 1316 |
| 164 | Ga0070672_100001840 | 3300005543 | Bacteria | 13234 |
| 165 | Ga0070672_100009845 | 3300005543 | Bacteria | 6607 |
| 166 | Ga0070672_100293733 | 3300005543 | Bacteria | 1376 |
| 167 | Ga0070686_100001871 | 3300005544 | Bacteria | 11724 |
| 168 | Ga0070686_100016846 | 3300005544 | Bacteria | 4258 |
| 169 | Ga0070686_100024627 | 3300005544 | Bacteria | 3609 |
| 170 | Ga0070686_100032829 | 3300005544 | Bacteria | 3185 |
| 171 | Ga0070686_100035160 | 3300005544 | Bacteria | 3093 |
| 172 | Ga0070686_100076479 | 3300005544 | Bacteria | 2204 |
| 173 | Ga0070695_100039787 | 3300005545 | Bacteria | 2974 |
| 174 | Ga0070695_100045814 | 3300005545 | Bacteria | 2789 |
| 175 | Ga0070696_100005913 | 3300005546 | Bacteria | 8169 |
| 176 | Ga0070696_100065844 | 3300005546 | Bacteria | 2540 |
| 177 | Ga0070696_100153349 | 3300005546 | Bacteria | 1693 |
| 178 | Ga0070696_100289022 | 3300005546 | Bacteria | 1252 |
| 179 | Ga0070693_100005012 | 3300005547 | Bacteria | 6328 |
| 180 | Ga0070693_100023239 | 3300005547 | Bacteria | 3311 |
| 181 | Ga0070693_100137123 | 3300005547 | Bacteria | 1536 |
| 182 | Ga0070665_100001969 | 3300005548 | Bacteria | 23093 |
| 183 | Ga0070665_100080440 | 3300005548 | Bacteria | 3264 |
| 184 | Ga0070665_100105665 | 3300005548 | Bacteria | 2817 |
| 185 | Ga0070665_100312351 | 3300005548 | Bacteria | 1576 |
| 186 | Ga0070704_100001594 | 3300005549 | Bacteria | 12259 |
| 187 | Ga0070704_100012426 | 3300005549 | Bacteria | 5260 |
| 188 | Ga0070704_100091932 | 3300005549 | Bacteria | 2264 |
| 189 | Ga0068855_100001682 | 3300005563 | Bacteria | 27687 |
| 190 | Ga0068855_100002002 | 3300005563 | Bacteria | 25309 |
| 191 | Ga0068855_100002194 | 3300005563 | Bacteria | 24134 |
| 192 | Ga0068855_100005111 | 3300005563 | Bacteria | 15994 |
| 193 | Ga0068855_100011151 | 3300005563 | Bacteria | 10852 |
| 194 | Ga0068855_100017416 | 3300005563 | Bacteria | 8643 |
| 195 | Ga0068855_100029844 | 3300005563 | Bacteria | 6520 |
| 196 | Ga0068855_100031793 | 3300005563 | Bacteria | 6300 |
| 197 | Ga0068855_100042963 | 3300005563 | Bacteria | 5356 |
| 198 | Ga0068855_100130792 | 3300005563 | Bacteria | 2867 |
| 199 | Ga0070664_100000772 | 3300005564 | Bacteria | 24693 |
| 200 | Ga0070664_100009626 | 3300005564 | Bacteria | 7838 |
| 201 | Ga0070664_100440825 | 3300005564 | Bacteria | 1195 |
| 202 | Ga0068857_100012680 | 3300005577 | Bacteria | 7345 |
| 203 | Ga0068857_100048483 | 3300005577 | Bacteria | 3771 |
| 204 | Ga0068857_100160671 | 3300005577 | Bacteria | 2039 |
| 205 | Ga0068854_100029947 | 3300005578 | Bacteria | 3773 |
| 206 | Ga0068854_100091242 | 3300005578 | Bacteria | 2267 |
| 207 | Ga0068854_100153445 | 3300005578 | Bacteria | 1778 |
| 208 | Ga0068856_100035659 | 3300005614 | Bacteria | 4875 |
| 209 | Ga0068856_100049397 | 3300005614 | Bacteria | 4146 |
| 210 | Ga0068856_100097139 | 3300005614 | Bacteria | 2935 |
| 211 | Ga0068856_100159467 | 3300005614 | Bacteria | 2266 |
| 212 | Ga0070702_100000854 | 3300005615 | Bacteria | 11764 |
| 213 | Ga0070702_100000889 | 3300005615 | Bacteria | 11627 |
| 214 | Ga0070702_100007766 | 3300005615 | Bacteria | 5155 |
| 215 | Ga0070702_100065768 | 3300005615 | Bacteria | 2124 |
| 216 | Ga0070702_100124671 | 3300005615 | Bacteria | 1618 |
| 217 | Ga0068852_100000419 | 3300005616 | Bacteria | 28349 |
| 218 | Ga0068852_100000944 | 3300005616 | Bacteria | 19185 |
| 219 | Ga0068852_100001924 | 3300005616 | Bacteria | 14147 |
| 220 | Ga0068852_100006532 | 3300005616 | Bacteria | 8434 |
| 221 | Ga0068852_100009876 | 3300005616 | Bacteria | 7102 |
| 222 | Ga0068852_100097479 | 3300005616 | Bacteria | 2645 |
| 223 | Ga0068852_100149609 | 3300005616 | Bacteria | 2170 |
| 224 | Ga0068852_100383701 | 3300005616 | Bacteria | 1379 |
| 225 | Ga0068859_100000253 | 3300005617 | Bacteria | 53069 |
| 226 | Ga0068859_100006199 | 3300005617 | Bacteria | 12150 |
| 227 | Ga0068859_100015782 | 3300005617 | Bacteria | 7589 |
| 228 | Ga0068859_100018481 | 3300005617 | Bacteria | 7006 |
| 229 | Ga0068859_100079124 | 3300005617 | Bacteria | 3327 |
| 230 | Ga0068859_100094533 | 3300005617 | Bacteria | 3041 |
| 231 | Ga0068859_100122677 | 3300005617 | Bacteria | 2665 |
| 232 | Ga0068859_100457923 | 3300005617 | Bacteria | 1371 |
| 233 | Ga0068864_100001205 | 3300005618 | Bacteria | 21463 |
| 234 | Ga0068864_100005181 | 3300005618 | Bacteria | 10674 |
| 235 | Ga0068864_100008410 | 3300005618 | Bacteria | 8514 |
| 236 | Ga0068864_100015984 | 3300005618 | Bacteria | 6245 |
| 237 | Ga0068864_100104699 | 3300005618 | Bacteria | 2514 |
| 238 | Ga0068864_100174533 | 3300005618 | Bacteria | 1961 |
| 239 | Ga0068864_100179216 | 3300005618 | Bacteria | 1936 |
| 240 | Ga0068864_100266579 | 3300005618 | Bacteria | 1595 |
| 241 | Ga0068866_10002860 | 3300005718 | Bacteria | 7119 |
| 242 | Ga0068866_10203602 | 3300005718 | Bacteria | 1184 |
| 243 | Ga0068861_100001372 | 3300005719 | Bacteria | 15283 |
| 244 | Ga0068861_100003053 | 3300005719 | Bacteria | 11055 |
| 245 | Ga0068861_100008134 | 3300005719 | Bacteria | 7216 |
| 246 | Ga0068861_100076244 | 3300005719 | Bacteria | 2612 |
| 247 | Ga0068861_100287251 | 3300005719 | Bacteria | 1419 |
| 248 | Ga0068851_10006725 | 3300005834 | Bacteria | 5260 |
| 249 | Ga0068851_10007729 | 3300005834 | Bacteria | 4945 |
| 250 | Ga0068851_10015524 | 3300005834 | Bacteria | 3629 |
| 251 | Ga0068851_10031134 | 3300005834 | Bacteria | 2648 |
| 252 | Ga0068851_10033402 | 3300005834 | Bacteria | 2564 |
| 253 | Ga0068851_10085565 | 3300005834 | Bacteria | 1653 |
| 254 | Ga0068870_10001202 | 3300005840 | Bacteria | 10390 |
| 255 | Ga0068863_100001784 | 3300005841 | Bacteria | 21344 |
| 256 | Ga0068863_100003276 | 3300005841 | Bacteria | 15984 |
| 257 | Ga0068863_100015332 | 3300005841 | Bacteria | 7365 |
| 258 | Ga0068863_100018873 | 3300005841 | Bacteria | 6599 |
| 259 | Ga0068863_100053000 | 3300005841 | Bacteria | 3844 |
| 260 | Ga0068863_100084247 | 3300005841 | Bacteria | 3013 |
| 261 | Ga0068863_100149508 | 3300005841 | Bacteria | 2234 |
| 262 | Ga0068863_100157041 | 3300005841 | Bacteria | 2178 |
| 263 | Ga0068863_100189995 | 3300005841 | Bacteria | 1973 |
| 264 | Ga0068863_100312905 | 3300005841 | Bacteria | 1524 |
| 265 | Ga0068863_100496504 | 3300005841 | Bacteria | 1201 |
| 266 | Ga0068858_100000503 | 3300005842 | Bacteria | 40960 |
| 267 | Ga0068858_100001910 | 3300005842 | Bacteria | 21265 |
| 268 | Ga0068858_100005731 | 3300005842 | Bacteria | 12140 |
| 269 | Ga0068858_100014286 | 3300005842 | Bacteria | 7487 |
| 270 | Ga0068858_100021279 | 3300005842 | Bacteria | 6058 |
| 271 | Ga0068858_100084265 | 3300005842 | Bacteria | 2957 |
| 272 | Ga0068858_100106996 | 3300005842 | Bacteria | 2610 |
| 273 | Ga0068858_100198229 | 3300005842 | Bacteria | 1898 |
| 274 | Ga0068858_100229330 | 3300005842 | Bacteria | 1760 |
| 275 | Ga0068860_100001280 | 3300005843 | Bacteria | 27317 |
| 276 | Ga0068860_100001625 | 3300005843 | Bacteria | 24111 |
| 277 | Ga0068860_100009569 | 3300005843 | Bacteria | 9628 |
| 278 | Ga0068860_100022290 | 3300005843 | Bacteria | 6129 |
| 279 | Ga0068860_100068118 | 3300005843 | Bacteria | 3382 |
| 280 | Ga0068860_100081692 | 3300005843 | Bacteria | 3073 |
| 281 | Ga0068860_100259740 | 3300005843 | Bacteria | 1693 |
| 282 | Ga0068860_100479549 | 3300005843 | Bacteria | 1240 |
| 283 | Ga0068862_100014488 | 3300005844 | Bacteria | 6543 |
| 284 | Ga0068862_100030640 | 3300005844 | Bacteria | 4535 |
| 285 | Ga0068862_100071572 | 3300005844 | Bacteria | 2994 |
| 286 | Ga0070717_10009990 | 3300006028 | Bacteria | 7141 |
| 287 | Ga0070717_10168299 | 3300006028 | Bacteria | 1905 |
| 288 | Ga0070717_10329322 | 3300006028 | Bacteria | 1362 |
| 289 | Ga0070716_100026160 | 3300006173 | Bacteria | 3122 |
| 290 | Ga0070716_100111887 | 3300006173 | Bacteria | 1694 |
| 291 | Ga0075366_10145367 | 3300006195 | Bacteria | 1435 |
| 292 | Ga0097621_100005458 | 3300006237 | Bacteria | 8951 |
| 293 | Ga0097621_100010078 | 3300006237 | Bacteria | 6892 |
| 294 | Ga0097621_100015961 | 3300006237 | Bacteria | 5664 |
| 295 | Ga0097621_100031728 | 3300006237 | Bacteria | 4193 |
| 296 | Ga0097621_100031848 | 3300006237 | Bacteria | 4186 |
| 297 | Ga0097621_100130031 | 3300006237 | Bacteria | 2142 |
| 298 | Ga0097621_100413816 | 3300006237 | Bacteria | 1209 |
| 299 | Ga0075370_10008340 | 3300006353 | Bacteria | 5328 |
| 300 | Ga0075370_10010453 | 3300006353 | Bacteria | 4854 |
| 301 | Ga0068871_100006085 | 3300006358 | Bacteria | 8491 |
| 302 | Ga0068871_100015806 | 3300006358 | Bacteria | 5664 |
| 303 | Ga0068871_100023694 | 3300006358 | Bacteria | 4752 |
| 304 | Ga0068871_100028456 | 3300006358 | Bacteria | 4381 |
| 305 | Ga0068871_100116227 | 3300006358 | Bacteria | 2255 |
| 306 | Ga0068871_100158493 | 3300006358 | Bacteria | 1934 |
| 307 | Ga0068871_100256170 | 3300006358 | Bacteria | 1525 |
| 308 | Ga0068871_100314858 | 3300006358 | Bacteria | 1376 |
| 309 | Ga0075428_100001989 | 3300006844 | Bacteria | 22029 |
| 310 | Ga0075428_100025341 | 3300006844 | Bacteria | 6564 |
| 311 | Ga0075428_100093431 | 3300006844 | Bacteria | 3279 |
| 312 | Ga0075430_100013481 | 3300006846 | Bacteria | 6968 |
| 313 | Ga0075430_100049533 | 3300006846 | Bacteria | 3545 |
| 314 | Ga0075430_100057765 | 3300006846 | Bacteria | 3263 |
| 315 | Ga0075430_100191234 | 3300006846 | Bacteria | 1701 |
| 316 | Ga0075431_100000077 | 3300006847 | Bacteria | 57475 |
| 317 | Ga0075431_100010025 | 3300006847 | Bacteria | 9518 |
| 318 | Ga0075431_100010660 | 3300006847 | Bacteria | 9237 |
| 319 | Ga0075431_100013529 | 3300006847 | Bacteria | 8245 |
| 320 | Ga0075431_100097175 | 3300006847 | Bacteria | 3041 |
| 321 | Ga0075431_100291621 | 3300006847 | Bacteria | 1650 |
| 322 | Ga0075433_10013143 | 3300006852 | Bacteria | 6719 |
| 323 | Ga0075434_100000204 | 3300006871 | Bacteria | 40084 |
| 324 | Ga0075429_100000019 | 3300006880 | Bacteria | 70971 |
| 325 | Ga0075429_100000208 | 3300006880 | Bacteria | 39267 |
| 326 | Ga0075429_100002310 | 3300006880 | Bacteria | 16000 |
| 327 | Ga0075429_100013327 | 3300006880 | Bacteria | 7128 |
| 328 | Ga0075429_100024433 | 3300006880 | Bacteria | 5243 |
| 329 | Ga0075429_100100487 | 3300006880 | Bacteria | 2525 |
| 330 | Ga0068865_100001062 | 3300006881 | Bacteria | 15802 |
| 331 | Ga0068865_100024371 | 3300006881 | Bacteria | 3969 |
| 332 | Ga0068865_100052323 | 3300006881 | Bacteria | 2830 |
| 333 | Ga0068865_100209211 | 3300006881 | Bacteria | 1519 |
| 334 | Ga0097620_100000253 | 3300006931 | Bacteria | 53069 |
| 335 | Ga0097620_100006199 | 3300006931 | Bacteria | 12150 |
| 336 | Ga0097620_100015395 | 3300006931 | Bacteria | 7685 |
| 337 | Ga0097620_100015782 | 3300006931 | Bacteria | 7589 |
| 338 | Ga0097620_100018481 | 3300006931 | Bacteria | 7006 |
| 339 | Ga0097620_100079120 | 3300006931 | Bacteria | 3327 |
| 340 | Ga0097620_100094531 | 3300006931 | Bacteria | 3041 |
| 341 | Ga0097620_100122665 | 3300006931 | Bacteria | 2665 |
| 342 | Ga0097620_100457944 | 3300006931 | Bacteria | 1371 |
| 343 | Ga0075435_100003374 | 3300007076 | Bacteria | 10831 |
| 344 | Ga0075435_100005884 | 3300007076 | Bacteria | 8630 |
| 345 | Ga0075435_100130109 | 3300007076 | Bacteria | 2106 |
| 346 | Ga0099794_10002384 | 3300007265 | Bacteria | 6920 |
| 347 | Ga0099794_10015352 | 3300007265 | Bacteria | 3379 |
| 348 | Ga0099794_10016356 | 3300007265 | Bacteria | 3287 |
| 349 | Ga0099795_10000234 | 3300007788 | Bacteria | 9765 |
| 350 | Ga0105251_10000043 | 3300009011 | Bacteria | 113848 |
| 351 | Ga0105240_10000760 | 3300009093 | Bacteria | 58925 |
| 352 | Ga0105240_10001599 | 3300009093 | Bacteria | 38474 |
| 353 | Ga0105240_10002211 | 3300009093 | Bacteria | 31723 |
| 354 | Ga0105240_10002714 | 3300009093 | Bacteria | 28107 |
| 355 | Ga0105240_10004577 | 3300009093 | Bacteria | 20971 |
| 356 | Ga0105240_10006209 | 3300009093 | Bacteria | 17574 |
| 357 | Ga0105240_10006435 | 3300009093 | Bacteria | 17267 |
| 358 | Ga0105240_10006620 | 3300009093 | Bacteria | 17008 |
| 359 | Ga0105240_10016618 | 3300009093 | Bacteria | 9953 |
| 360 | Ga0105240_10018889 | 3300009093 | Bacteria | 9230 |
| 361 | Ga0105240_10043447 | 3300009093 | Bacteria | 5718 |
| 362 | Ga0105240_10047021 | 3300009093 | Bacteria | 5463 |
| 363 | Ga0105240_10064068 | 3300009093 | Bacteria | 4569 |
| 364 | Ga0105240_10092430 | 3300009093 | Bacteria | 3694 |
| 365 | Ga0105240_10202073 | 3300009093 | Bacteria | 2328 |
| 366 | Ga0105240_10263648 | 3300009093 | Bacteria | 1986 |
| 367 | Ga0111539_10000277 | 3300009094 | Bacteria | 61362 |
| 368 | Ga0111539_10000660 | 3300009094 | Bacteria | 44559 |
| 369 | Ga0111539_10023238 | 3300009094 | Bacteria | 7616 |
| 370 | Ga0111539_10033962 | 3300009094 | Bacteria | 6189 |
| 371 | Ga0111539_10090554 | 3300009094 | Bacteria | 3595 |
| 372 | Ga0111539_10121571 | 3300009094 | Bacteria | 3059 |
| 373 | Ga0105245_10005588 | 3300009098 | Bacteria | 11044 |
| 374 | Ga0105245_10010063 | 3300009098 | Bacteria | 8240 |
| 375 | Ga0105245_10024118 | 3300009098 | Bacteria | 5341 |
| 376 | Ga0105245_10146415 | 3300009098 | Bacteria | 2229 |
| 377 | Ga0105247_10001306 | 3300009101 | Bacteria | 18293 |
| 378 | Ga0105247_10015443 | 3300009101 | Bacteria | 4574 |
| 379 | Ga0114129_10000140 | 3300009147 | Bacteria | 75593 |
| 380 | Ga0114129_10007801 | 3300009147 | Bacteria | 15231 |
| 381 | Ga0114129_10011889 | 3300009147 | Bacteria | 12382 |
| 382 | Ga0105243_10001776 | 3300009148 | Bacteria | 18517 |
| 383 | Ga0105243_10026919 | 3300009148 | Bacteria | 4404 |
| 384 | Ga0105243_10055619 | 3300009148 | Bacteria | 3144 |
| 385 | Ga0105243_10395106 | 3300009148 | Bacteria | 1283 |
| 386 | Ga0105241_10045630 | 3300009174 | Bacteria | 3326 |
| 387 | Ga0105241_10150552 | 3300009174 | Bacteria | 1903 |
| 388 | Ga0105242_10003224 | 3300009176 | Bacteria | 12720 |
| 389 | Ga0105242_10225280 | 3300009176 | Bacteria | 1678 |
| 390 | Ga0105248_10008298 | 3300009177 | Bacteria | 11411 |
| 391 | Ga0105248_10062484 | 3300009177 | Bacteria | 4181 |
| 392 | Ga0105248_10072048 | 3300009177 | Bacteria | 3883 |
| 393 | Ga0105248_10091826 | 3300009177 | Bacteria | 3419 |
| 394 | Ga0105248_10193964 | 3300009177 | Bacteria | 2289 |
| 395 | Ga0105248_10290856 | 3300009177 | Bacteria | 1840 |
| 396 | Ga0105248_10312241 | 3300009177 | Bacteria | 1771 |
| 397 | Ga0105237_10020287 | 3300009545 | Bacteria | 6855 |
| 398 | Ga0105237_10111692 | 3300009545 | Bacteria | 2725 |
| 399 | Ga0105237_10122798 | 3300009545 | Bacteria | 2591 |
| 400 | Ga0105237_10138435 | 3300009545 | Bacteria | 2429 |
| 401 | Ga0105237_10251341 | 3300009545 | Bacteria | 1770 |
| 402 | Ga0105237_10301147 | 3300009545 | Bacteria | 1606 |
| 403 | Ga0105237_10436254 | 3300009545 | Bacteria | 1315 |
| 404 | Ga0105237_10476510 | 3300009545 | Bacteria | 1254 |
| 405 | Ga0105238_10001924 | 3300009551 | Bacteria | 20848 |
| 406 | Ga0105238_10002536 | 3300009551 | Bacteria | 18246 |
| 407 | Ga0105238_10014052 | 3300009551 | Bacteria | 8096 |
| 408 | Ga0105238_10019205 | 3300009551 | Bacteria | 6961 |
| 409 | Ga0105238_10029625 | 3300009551 | Bacteria | 5575 |
| 410 | Ga0105238_10208949 | 3300009551 | Bacteria | 1928 |
| 411 | Ga0105238_10406647 | 3300009551 | Bacteria | 1355 |
| 412 | Ga0105249_10027048 | 3300009553 | Bacteria | 5174 |
| 413 | Ga0105249_10218934 | 3300009553 | Bacteria | 1872 |
| 414 | Ga0099796_10000467 | 3300010159 | Bacteria | 6806 |
| 415 | Ga0105239_10020458 | 3300010375 | Bacteria | 7299 |
| 416 | Ga0105239_10161706 | 3300010375 | Bacteria | 2502 |
| 417 | Ga0105239_10283679 | 3300010375 | Bacteria | 1865 |
| 418 | Ga0105239_10313309 | 3300010375 | Bacteria | 1769 |
| 419 | Ga0105246_10062603 | 3300011119 | Bacteria | 2593 |
| 420 | Ga0105246_10079015 | 3300011119 | Bacteria | 2338 |
| 421 | Ga0105246_10205733 | 3300011119 | Bacteria | 1533 |
| 422 | Ga0105246_10326172 | 3300011119 | Bacteria | 1250 |
| 423 | Ga0157373_10020648 | 3300013100 | Bacteria | 4784 |
| 424 | Ga0157370_10000890 | 3300013104 | Bacteria | 37928 |
| 425 | Ga0157370_10003740 | 3300013104 | Bacteria | 17787 |
| 426 | Ga0157370_10006678 | 3300013104 | Bacteria | 12667 |
| 427 | Ga0157370_10071356 | 3300013104 | Bacteria | 3276 |
| 428 | Ga0157370_10110858 | 3300013104 | Bacteria | 2565 |
| 429 | Ga0157369_10001971 | 3300013105 | Bacteria | 24762 |
| 430 | Ga0157369_10007730 | 3300013105 | Bacteria | 12365 |
| 431 | Ga0157369_10015794 | 3300013105 | Bacteria | 8506 |
| 432 | Ga0157369_10028361 | 3300013105 | Bacteria | 6196 |
| 433 | Ga0157369_10040421 | 3300013105 | Bacteria | 5091 |
| 434 | Ga0157369_10102907 | 3300013105 | Bacteria | 3042 |
| 435 | Ga0157369_10128738 | 3300013105 | Bacteria | 2683 |
| 436 | Ga0157369_10215306 | 3300013105 | Bacteria | 2012 |
| 437 | Ga0157374_10018746 | 3300013296 | Bacteria | 6114 |
| 438 | Ga0157374_10332316 | 3300013296 | Bacteria | 1508 |
| 439 | Ga0157374_10420632 | 3300013296 | Bacteria | 1335 |
| 440 | Ga0157378_10008705 | 3300013297 | Bacteria | 8832 |
| 441 | Ga0157378_10026047 | 3300013297 | Bacteria | 5155 |
| 442 | Ga0157378_10124138 | 3300013297 | Bacteria | 2383 |
| 443 | Ga0157378_10367157 | 3300013297 | Bacteria | 1410 |
| 444 | Ga0157378_10472672 | 3300013297 | Bacteria | 1248 |
| 445 | Ga0163162_10000655 | 3300013306 | Bacteria | 32037 |
| 446 | Ga0163162_10008965 | 3300013306 | Bacteria | 9727 |
| 447 | Ga0163162_10127222 | 3300013306 | Bacteria | 2655 |
| 448 | Ga0163162_10259799 | 3300013306 | Bacteria | 1868 |
| 449 | Ga0157372_10002980 | 3300013307 | Bacteria | 18240 |
| 450 | Ga0157372_10025602 | 3300013307 | Bacteria | 6418 |
| 451 | Ga0157372_10057816 | 3300013307 | Bacteria | 4335 |
| 452 | Ga0157372_10058620 | 3300013307 | Bacteria | 4305 |
| 453 | Ga0157372_10093826 | 3300013307 | Bacteria | 3416 |
| 454 | Ga0157372_10176679 | 3300013307 | Bacteria | 2471 |
| 455 | Ga0157372_10227793 | 3300013307 | Bacteria | 2160 |
| 456 | Ga0157375_10005328 | 3300013308 | Bacteria | 11175 |
| 457 | Ga0157375_10009938 | 3300013308 | Bacteria | 8369 |
| 458 | Ga0157375_10079484 | 3300013308 | Bacteria | 3315 |
| 459 | Ga0157375_10095255 | 3300013308 | Bacteria | 3047 |
| 460 | Ga0157375_10148680 | 3300013308 | Bacteria | 2476 |
| 461 | Ga0157375_10261261 | 3300013308 | Bacteria | 1893 |
| 462 | Ga0157375_10709780 | 3300013308 | Bacteria | 1159 |
| 463 | Ga0163163_10001355 | 3300014325 | Bacteria | 20667 |
| 464 | Ga0163163_10002424 | 3300014325 | Bacteria | 15774 |
| 465 | Ga0163163_10073516 | 3300014325 | Bacteria | 3410 |
| 466 | Ga0163163_10287139 | 3300014325 | Bacteria | 1697 |
| 467 | Ga0157380_10012492 | 3300014326 | Bacteria | 6162 |
| 468 | Ga0157380_10032710 | 3300014326 | Bacteria | 4003 |
| 469 | Ga0157380_10121508 | 3300014326 | Bacteria | 2213 |
| 470 | Ga0157380_10354750 | 3300014326 | Bacteria | 1374 |
| 471 | Ga0157379_10002507 | 3300014968 | Bacteria | 15367 |
| 472 | Ga0157379_10013568 | 3300014968 | Bacteria | 7140 |
| 473 | Ga0157379_10027320 | 3300014968 | Bacteria | 5081 |
| 474 | Ga0157379_10036848 | 3300014968 | Bacteria | 4361 |
| 475 | Ga0157379_10043368 | 3300014968 | Bacteria | 4016 |
| 476 | Ga0157379_10164225 | 3300014968 | Bacteria | 2004 |
| 477 | Ga0157379_10211862 | 3300014968 | Bacteria | 1754 |
| 478 | Ga0157379_10353418 | 3300014968 | Bacteria | 1346 |
| 479 | Ga0157376_10008831 | 3300014969 | Bacteria | 7293 |
| 480 | Ga0157376_10284486 | 3300014969 | Bacteria | 1559 |
| 481 | Ga0157376_10345329 | 3300014969 | Bacteria | 1422 |
| 482 | Ga0182006_1004726 | 3300015261 | Bacteria | 6657 |
| 483 | Ga0182006_1015446 | 3300015261 | Bacteria | 3273 |
| 484 | Ga0182007_10000245 | 3300015262 | Bacteria | 36521 |
| 485 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 486 | Ga0163161_10013868 | 3300017792 | Bacteria | 5615 |
| 487 | Ga0163161_10040313 | 3300017792 | Bacteria | 3354 |
| 488 | Ga0163161_10062884 | 3300017792 | Bacteria | 2704 |
| 489 | Ga0213872_10000419 | 3300021361 | Bacteria | 34805 |
| 490 | Ga0213872_10054286 | 3300021361 | Bacteria | 1817 |
| 491 | Ga0213872_10092211 | 3300021361 | Bacteria | 1355 |
| 492 | Ga0209672_100026 | 3300025228 | Bacteria | 348998 |
| 493 | Ga0209147_100033 | 3300025229 | Bacteria | 348998 |
| 494 | Ga0209258_100051 | 3300025242 | Bacteria | 348998 |
| 495 | Ga0209026_1000952 | 3300025250 | Bacteria | 14523 |
| 496 | Ga0209148_1000328 | 3300025254 | Bacteria | 65887 |
| 497 | Ga0209759_1000773 | 3300025256 | Bacteria | 26972 |
| 498 | Ga0207666_1004688 | 3300025271 | Bacteria | 1723 |
| 499 | Ga0209455_1000252 | 3300025272 | Bacteria | 63647 |
| 500 | Ga0209025_1000115 | 3300025294 | Bacteria | 218871 |
| 501 | Ga0209564_1005666 | 3300025295 | Bacteria | 7010 |
| 502 | Ga0209051_1046486 | 3300025303 | Bacteria | 1493 |
| 503 | Ga0207656_10006944 | 3300025321 | Bacteria | 4105 |
| 504 | Ga0207656_10011244 | 3300025321 | Bacteria | 3378 |
| 505 | Ga0207656_10035556 | 3300025321 | Bacteria | 2087 |
| 506 | Ga0207656_10152649 | 3300025321 | Bacteria | 1095 |
| 507 | Ga0207713_1000240 | 3300025735 | Bacteria | 73219 |
| 508 | Ga0207682_10023878 | 3300025893 | Bacteria | 2418 |
| 509 | Ga0207642_10009459 | 3300025899 | Bacteria | 3391 |
| 510 | Ga0207642_10067592 | 3300025899 | Bacteria | 1688 |
| 511 | Ga0207710_10000538 | 3300025900 | Bacteria | 23137 |
| 512 | Ga0207710_10011325 | 3300025900 | Bacteria | 3755 |
| 513 | Ga0207688_10019841 | 3300025901 | Bacteria | 3665 |
| 514 | Ga0207680_10006697 | 3300025903 | Bacteria | 5590 |
| 515 | Ga0207680_10276697 | 3300025903 | Bacteria | 1165 |
| 516 | Ga0207647_10001239 | 3300025904 | Bacteria | 19642 |
| 517 | Ga0207647_10061551 | 3300025904 | Bacteria | 2290 |
| 518 | Ga0207645_10099625 | 3300025907 | Bacteria | 1874 |
| 519 | Ga0207645_10139566 | 3300025907 | Bacteria | 1579 |
| 520 | Ga0207643_10004764 | 3300025908 | Bacteria | 7269 |
| 521 | Ga0207643_10005459 | 3300025908 | Bacteria | 6798 |
| 522 | Ga0207643_10040443 | 3300025908 | Bacteria | 2625 |
| 523 | Ga0207643_10127821 | 3300025908 | Bacteria | 1510 |
| 524 | Ga0207705_10150791 | 3300025909 | Bacteria | 1742 |
| 525 | Ga0207705_10261473 | 3300025909 | Bacteria | 1321 |
| 526 | Ga0207684_10042338 | 3300025910 | Bacteria | 3860 |
| 527 | Ga0207684_10289787 | 3300025910 | Bacteria | 1412 |
| 528 | Ga0207654_10027099 | 3300025911 | Bacteria | 3112 |
| 529 | Ga0207707_10000999 | 3300025912 | Bacteria | 27087 |
| 530 | Ga0207707_10003421 | 3300025912 | Bacteria | 14070 |
| 531 | Ga0207707_10007561 | 3300025912 | Bacteria | 9465 |
| 532 | Ga0207707_10009440 | 3300025912 | Bacteria | 8461 |
| 533 | Ga0207707_10067077 | 3300025912 | Bacteria | 3125 |
| 534 | Ga0207707_10081933 | 3300025912 | Bacteria | 2817 |
| 535 | Ga0207707_10283545 | 3300025912 | Bacteria | 1434 |
| 536 | Ga0207707_10289262 | 3300025912 | Bacteria | 1418 |
| 537 | Ga0207695_10000372 | 3300025913 | Bacteria | 101840 |
| 538 | Ga0207695_10002611 | 3300025913 | Bacteria | 26367 |
| 539 | Ga0207695_10004603 | 3300025913 | Bacteria | 18730 |
| 540 | Ga0207695_10011587 | 3300025913 | Bacteria | 10663 |
| 541 | Ga0207695_10023693 | 3300025913 | Bacteria | 6927 |
| 542 | Ga0207695_10032813 | 3300025913 | Bacteria | 5675 |
| 543 | Ga0207695_10034143 | 3300025913 | Bacteria | 5537 |
| 544 | Ga0207695_10035292 | 3300025913 | Bacteria | 5426 |
| 545 | Ga0207695_10040875 | 3300025913 | Bacteria | 4967 |
| 546 | Ga0207695_10305546 | 3300025913 | Bacteria | 1481 |
| 547 | Ga0207695_10412159 | 3300025913 | Bacteria | 1236 |
| 548 | Ga0207671_10030597 | 3300025914 | Bacteria | 4013 |
| 549 | Ga0207671_10098841 | 3300025914 | Bacteria | 2208 |
| 550 | Ga0207671_10101676 | 3300025914 | Bacteria | 2178 |
| 551 | Ga0207671_10275549 | 3300025914 | Bacteria | 1326 |
| 552 | Ga0207663_10155978 | 3300025916 | Bacteria | 1606 |
| 553 | Ga0207663_10314425 | 3300025916 | Bacteria | 1175 |
| 554 | Ga0207660_10004733 | 3300025917 | Bacteria | 8860 |
| 555 | Ga0207660_10012148 | 3300025917 | Bacteria | 5628 |
| 556 | Ga0207660_10038383 | 3300025917 | Bacteria | 3343 |
| 557 | Ga0207660_10077593 | 3300025917 | Bacteria | 2432 |
| 558 | Ga0207660_10110635 | 3300025917 | Bacteria | 2067 |
| 559 | Ga0207662_10003006 | 3300025918 | Bacteria | 8590 |
| 560 | Ga0207662_10013087 | 3300025918 | Bacteria | 4635 |
| 561 | Ga0207662_10078226 | 3300025918 | Bacteria | 2013 |
| 562 | Ga0207662_10122087 | 3300025918 | Bacteria | 1635 |
| 563 | Ga0207657_10001557 | 3300025919 | Bacteria | 24609 |
| 564 | Ga0207657_10002377 | 3300025919 | Bacteria | 20356 |
| 565 | Ga0207657_10018692 | 3300025919 | Bacteria | 6604 |
| 566 | Ga0207657_10023713 | 3300025919 | Bacteria | 5706 |
| 567 | Ga0207657_10055596 | 3300025919 | Bacteria | 3418 |
| 568 | Ga0207657_10089864 | 3300025919 | Bacteria | 2564 |
| 569 | Ga0207649_10009407 | 3300025920 | Bacteria | 5348 |
| 570 | Ga0207652_10007161 | 3300025921 | Bacteria | 8995 |
| 571 | Ga0207652_10074627 | 3300025921 | Bacteria | 2953 |
| 572 | Ga0207652_10192792 | 3300025921 | Bacteria | 1833 |
| 573 | Ga0207646_10114637 | 3300025922 | Bacteria | 2420 |
| 574 | Ga0207681_10003209 | 3300025923 | Bacteria | 10260 |
| 575 | Ga0207681_10004286 | 3300025923 | Bacteria | 8806 |
| 576 | Ga0207681_10043952 | 3300025923 | Bacteria | 2992 |
| 577 | Ga0207694_10011446 | 3300025924 | Bacteria | 6694 |
| 578 | Ga0207694_10062995 | 3300025924 | Bacteria | 2888 |
| 579 | Ga0207694_10066550 | 3300025924 | Bacteria | 2811 |
| 580 | Ga0207694_10076469 | 3300025924 | Bacteria | 2622 |
| 581 | Ga0207650_10018773 | 3300025925 | Bacteria | 4856 |
| 582 | Ga0207650_10105835 | 3300025925 | Bacteria | 2172 |
| 583 | Ga0207650_10227091 | 3300025925 | Bacteria | 1504 |
| 584 | Ga0207659_10000504 | 3300025926 | Bacteria | 23477 |
| 585 | Ga0207659_10007377 | 3300025926 | Bacteria | 6757 |
| 586 | Ga0207659_10026286 | 3300025926 | Bacteria | 3926 |
| 587 | Ga0207659_10092162 | 3300025926 | Bacteria | 2265 |
| 588 | Ga0207659_10164256 | 3300025926 | Bacteria | 1746 |
| 589 | Ga0207659_10210315 | 3300025926 | Bacteria | 1559 |
| 590 | Ga0207659_10248509 | 3300025926 | Bacteria | 1442 |
| 591 | Ga0207687_10002479 | 3300025927 | Bacteria | 12536 |
| 592 | Ga0207687_10056276 | 3300025927 | Bacteria | 2758 |
| 593 | Ga0207687_10325347 | 3300025927 | Bacteria | 1246 |
| 594 | Ga0207700_10018771 | 3300025928 | Bacteria | 4656 |
| 595 | Ga0207700_10282173 | 3300025928 | Bacteria | 1429 |
| 596 | Ga0207700_10367539 | 3300025928 | Bacteria | 1255 |
| 597 | Ga0207664_10002954 | 3300025929 | Bacteria | 11291 |
| 598 | Ga0207664_10004364 | 3300025929 | Bacteria | 9582 |
| 599 | Ga0207644_10014289 | 3300025931 | Bacteria | 5311 |
| 600 | Ga0207644_10035583 | 3300025931 | Bacteria | 3490 |
| 601 | Ga0207644_10100801 | 3300025931 | Bacteria | 2169 |
| 602 | Ga0207644_10108322 | 3300025931 | Bacteria | 2097 |
| 603 | Ga0207690_10014884 | 3300025932 | Bacteria | 4708 |
| 604 | Ga0207690_10038603 | 3300025932 | Bacteria | 3109 |
| 605 | Ga0207690_10100789 | 3300025932 | Bacteria | 2062 |
| 606 | Ga0207706_10017228 | 3300025933 | Bacteria | 6513 |
| 607 | Ga0207706_10064398 | 3300025933 | Bacteria | 3227 |
| 608 | Ga0207686_10006895 | 3300025934 | Bacteria | 6116 |
| 609 | Ga0207686_10070377 | 3300025934 | Bacteria | 2248 |
| 610 | Ga0207709_10003263 | 3300025935 | Bacteria | 9728 |
| 611 | Ga0207709_10007438 | 3300025935 | Bacteria | 6098 |
| 612 | Ga0207670_10013321 | 3300025936 | Bacteria | 4843 |
| 613 | Ga0207670_10013767 | 3300025936 | Bacteria | 4782 |
| 614 | Ga0207670_10016809 | 3300025936 | Bacteria | 4407 |
| 615 | Ga0207670_10024359 | 3300025936 | Bacteria | 3782 |
| 616 | Ga0207670_10079956 | 3300025936 | Bacteria | 2284 |
| 617 | Ga0207670_10130562 | 3300025936 | Bacteria | 1840 |
| 618 | Ga0207670_10161187 | 3300025936 | Bacteria | 1674 |
| 619 | Ga0207669_10002388 | 3300025937 | Bacteria | 7992 |
| 620 | Ga0207669_10041562 | 3300025937 | Bacteria | 2677 |
| 621 | Ga0207669_10102974 | 3300025937 | Bacteria | 1892 |
| 622 | Ga0207704_10016656 | 3300025938 | Bacteria | 3784 |
| 623 | Ga0207704_10114313 | 3300025938 | Bacteria | 1832 |
| 624 | Ga0207665_10023366 | 3300025939 | Bacteria | 4073 |
| 625 | Ga0207665_10033344 | 3300025939 | Bacteria | 3412 |
| 626 | Ga0207665_10224313 | 3300025939 | Bacteria | 1378 |
| 627 | Ga0207691_10006936 | 3300025940 | Bacteria | 10925 |
| 628 | Ga0207691_10073497 | 3300025940 | Bacteria | 3084 |
| 629 | Ga0207691_10094169 | 3300025940 | Bacteria | 2681 |
| 630 | Ga0207691_10145270 | 3300025940 | Bacteria | 2088 |
| 631 | Ga0207691_10201245 | 3300025940 | Bacteria | 1733 |
| 632 | Ga0207691_10213788 | 3300025940 | Bacteria | 1674 |
| 633 | Ga0207691_10214007 | 3300025940 | Bacteria | 1673 |
| 634 | Ga0207691_10296756 | 3300025940 | Bacteria | 1389 |
| 635 | Ga0207711_10037939 | 3300025941 | Bacteria | 4096 |
| 636 | Ga0207711_10092214 | 3300025941 | Bacteria | 2666 |
| 637 | Ga0207711_10118849 | 3300025941 | Bacteria | 2358 |
| 638 | Ga0207711_10261779 | 3300025941 | Bacteria | 1590 |
| 639 | Ga0207689_10001646 | 3300025942 | Bacteria | 21167 |
| 640 | Ga0207689_10002213 | 3300025942 | Bacteria | 18225 |
| 641 | Ga0207689_10003936 | 3300025942 | Bacteria | 13518 |
| 642 | Ga0207689_10005924 | 3300025942 | Bacteria | 10826 |
| 643 | Ga0207689_10011714 | 3300025942 | Bacteria | 7515 |
| 644 | Ga0207689_10030091 | 3300025942 | Bacteria | 4526 |
| 645 | Ga0207689_10052871 | 3300025942 | Bacteria | 3346 |
| 646 | Ga0207689_10112441 | 3300025942 | Bacteria | 2238 |
| 647 | Ga0207661_10079658 | 3300025944 | Bacteria | 2700 |
| 648 | Ga0207679_10004394 | 3300025945 | Bacteria | 8779 |
| 649 | Ga0207679_10026262 | 3300025945 | Bacteria | 4014 |
| 650 | Ga0207679_10056694 | 3300025945 | Bacteria | 2894 |
| 651 | Ga0207667_10001268 | 3300025949 | Bacteria | 31682 |
| 652 | Ga0207667_10003353 | 3300025949 | Bacteria | 19766 |
| 653 | Ga0207667_10009964 | 3300025949 | Bacteria | 11147 |
| 654 | Ga0207667_10036735 | 3300025949 | Bacteria | 5246 |
| 655 | Ga0207667_10067327 | 3300025949 | Bacteria | 3731 |
| 656 | Ga0207667_10086186 | 3300025949 | Bacteria | 3250 |
| 657 | Ga0207667_10304377 | 3300025949 | Bacteria | 1629 |
| 658 | Ga0207651_10014883 | 3300025960 | Bacteria | 4504 |
| 659 | Ga0207651_10026564 | 3300025960 | Bacteria | 3620 |
| 660 | Ga0207651_10059375 | 3300025960 | Bacteria | 2649 |
| 661 | Ga0207712_10064747 | 3300025961 | Bacteria | 2607 |
| 662 | Ga0207712_10122786 | 3300025961 | Bacteria | 1968 |
| 663 | Ga0207712_10124040 | 3300025961 | Bacteria | 1959 |
| 664 | Ga0207668_10060144 | 3300025972 | Bacteria | 2665 |
| 665 | Ga0207640_10019344 | 3300025981 | Bacteria | 4021 |
| 666 | Ga0207658_10002948 | 3300025986 | Bacteria | 12186 |
| 667 | Ga0207658_10027235 | 3300025986 | Bacteria | 4014 |
| 668 | Ga0207658_10095871 | 3300025986 | Bacteria | 2312 |
| 669 | Ga0207658_10188073 | 3300025986 | Bacteria | 1714 |
| 670 | Ga0207658_10397135 | 3300025986 | Bacteria | 1211 |
| 671 | Ga0207677_10004422 | 3300026023 | Bacteria | 7540 |
| 672 | Ga0207677_10006268 | 3300026023 | Bacteria | 6507 |
| 673 | Ga0207677_10029726 | 3300026023 | Bacteria | 3477 |
| 674 | Ga0207677_10036882 | 3300026023 | Bacteria | 3190 |
| 675 | Ga0207677_10236545 | 3300026023 | Bacteria | 1475 |
| 676 | Ga0207677_10302256 | 3300026023 | Bacteria | 1322 |
| 677 | Ga0207703_10000899 | 3300026035 | Bacteria | 29113 |
| 678 | Ga0207703_10001339 | 3300026035 | Bacteria | 22554 |
| 679 | Ga0207703_10003150 | 3300026035 | Bacteria | 13916 |
| 680 | Ga0207703_10015310 | 3300026035 | Bacteria | 5983 |
| 681 | Ga0207703_10032230 | 3300026035 | Bacteria | 4147 |
| 682 | Ga0207703_10042866 | 3300026035 | Bacteria | 3630 |
| 683 | Ga0207703_10053261 | 3300026035 | Bacteria | 3288 |
| 684 | Ga0207703_10092420 | 3300026035 | Bacteria | 2547 |
| 685 | Ga0207703_10098931 | 3300026035 | Bacteria | 2468 |
| 686 | Ga0207703_10120544 | 3300026035 | Bacteria | 2251 |
| 687 | Ga0207703_10181161 | 3300026035 | Bacteria | 1859 |
| 688 | Ga0207639_10096243 | 3300026041 | Bacteria | 2381 |
| 689 | Ga0207639_10118183 | 3300026041 | Bacteria | 2174 |
| 690 | Ga0207639_10118266 | 3300026041 | Bacteria | 2173 |
| 691 | Ga0207639_10483275 | 3300026041 | Bacteria | 1129 |
| 692 | Ga0207639_10624108 | 3300026041 | Bacteria | 995 |
| 693 | Ga0207678_10056179 | 3300026067 | Bacteria | 3389 |
| 694 | Ga0207678_10063172 | 3300026067 | Bacteria | 3182 |
| 695 | Ga0207678_10097707 | 3300026067 | Bacteria | 2509 |
| 696 | Ga0207678_10104879 | 3300026067 | Bacteria | 2412 |
| 697 | Ga0207678_10192775 | 3300026067 | Bacteria | 1742 |
| 698 | Ga0207708_10004385 | 3300026075 | Bacteria | 10398 |
| 699 | Ga0207708_10007997 | 3300026075 | Bacteria | 7834 |
| 700 | Ga0207708_10010897 | 3300026075 | Bacteria | 6763 |
| 701 | Ga0207708_10058902 | 3300026075 | Bacteria | 2931 |
| 702 | Ga0207708_10140355 | 3300026075 | Bacteria | 1895 |
| 703 | Ga0207708_10255812 | 3300026075 | Bacteria | 1412 |
| 704 | Ga0207702_10001106 | 3300026078 | Bacteria | 27575 |
| 705 | Ga0207702_10150724 | 3300026078 | Bacteria | 2115 |
| 706 | Ga0207641_10011464 | 3300026088 | Bacteria | 7276 |
| 707 | Ga0207641_10012901 | 3300026088 | Bacteria | 6855 |
| 708 | Ga0207641_10013953 | 3300026088 | Bacteria | 6588 |
| 709 | Ga0207641_10015567 | 3300026088 | Bacteria | 6232 |
| 710 | Ga0207641_10037955 | 3300026088 | Bacteria | 4025 |
| 711 | Ga0207641_10089998 | 3300026088 | Bacteria | 2683 |
| 712 | Ga0207641_10186874 | 3300026088 | Bacteria | 1902 |
| 713 | Ga0207641_10365072 | 3300026088 | Bacteria | 1379 |
| 714 | Ga0207648_10000484 | 3300026089 | Bacteria | 44276 |
| 715 | Ga0207648_10008361 | 3300026089 | Bacteria | 10031 |
| 716 | Ga0207648_10010090 | 3300026089 | Bacteria | 8980 |
| 717 | Ga0207648_10019355 | 3300026089 | Bacteria | 6145 |
| 718 | Ga0207648_10068205 | 3300026089 | Bacteria | 3099 |
| 719 | Ga0207648_10083569 | 3300026089 | Bacteria | 2784 |
| 720 | Ga0207648_10095391 | 3300026089 | Bacteria | 2602 |
| 721 | Ga0207648_10106585 | 3300026089 | Bacteria | 2460 |
| 722 | Ga0207648_10152587 | 3300026089 | Bacteria | 2039 |
| 723 | Ga0207648_10187114 | 3300026089 | Bacteria | 1834 |
| 724 | Ga0207648_10535491 | 3300026089 | Bacteria | 1074 |
| 725 | Ga0207676_10000216 | 3300026095 | Bacteria | 49875 |
| 726 | Ga0207676_10005169 | 3300026095 | Bacteria | 9234 |
| 727 | Ga0207676_10017461 | 3300026095 | Bacteria | 5200 |
| 728 | Ga0207676_10189986 | 3300026095 | Bacteria | 1806 |
| 729 | Ga0207676_10285372 | 3300026095 | Bacteria | 1500 |
| 730 | Ga0207674_10000292 | 3300026116 | Bacteria | 63309 |
| 731 | Ga0207674_10012012 | 3300026116 | Bacteria | 9701 |
| 732 | Ga0207674_10114395 | 3300026116 | Bacteria | 2670 |
| 733 | Ga0207675_100001426 | 3300026118 | Bacteria | 23961 |
| 734 | Ga0207675_100001767 | 3300026118 | Bacteria | 21608 |
| 735 | Ga0207675_100001972 | 3300026118 | Bacteria | 20452 |
| 736 | Ga0207675_100003149 | 3300026118 | Bacteria | 16180 |
| 737 | Ga0207675_100003455 | 3300026118 | Bacteria | 15442 |
| 738 | Ga0207675_100015452 | 3300026118 | Bacteria | 7120 |
| 739 | Ga0207675_100018059 | 3300026118 | Bacteria | 6578 |
| 740 | Ga0207675_100021232 | 3300026118 | Bacteria | 6048 |
| 741 | Ga0207675_100041328 | 3300026118 | Bacteria | 4306 |
| 742 | Ga0207675_100110877 | 3300026118 | Bacteria | 2589 |
| 743 | Ga0207675_100288407 | 3300026118 | Bacteria | 1596 |
| 744 | Ga0207683_10000920 | 3300026121 | Bacteria | 27089 |
| 745 | Ga0207683_10007342 | 3300026121 | Bacteria | 9447 |
| 746 | Ga0207683_10060407 | 3300026121 | Bacteria | 3332 |
| 747 | Ga0207683_10072230 | 3300026121 | Bacteria | 3051 |
| 748 | Ga0207683_10088043 | 3300026121 | Bacteria | 2762 |
| 749 | Ga0207683_10204105 | 3300026121 | Bacteria | 1797 |
| 750 | Ga0207698_10007793 | 3300026142 | Bacteria | 6729 |
| 751 | Ga0207698_10016751 | 3300026142 | Bacteria | 4952 |
| 752 | Ga0207698_10059132 | 3300026142 | Bacteria | 2974 |
| 753 | Ga0207698_10076854 | 3300026142 | Bacteria | 2674 |
| 754 | Ga0207698_10082638 | 3300026142 | Bacteria | 2597 |
| 755 | Ga0207698_10497083 | 3300026142 | Bacteria | 1186 |
| 756 | Ga0209969_1000861 | 3300027360 | Bacteria | 4093 |
| 757 | Ga0209967_1005493 | 3300027364 | Bacteria | 1702 |
| 758 | Ga0209981_1003420 | 3300027378 | Bacteria | 2062 |
| 759 | Ga0209996_1003492 | 3300027395 | Bacteria | 1980 |
| 760 | Ga0210000_1000129 | 3300027462 | Bacteria | 10819 |
| 761 | Ga0210000_1004629 | 3300027462 | Bacteria | 1984 |
| 762 | Ga0209999_1001944 | 3300027543 | Bacteria | 3598 |
| 763 | Ga0209982_1001715 | 3300027552 | Bacteria | 3016 |
| 764 | Ga0209983_1008824 | 3300027665 | Bacteria | 2058 |
| 765 | Ga0209588_1014660 | 3300027671 | Bacteria | 2402 |
| 766 | Ga0209588_1028137 | 3300027671 | Bacteria | 1789 |
| 767 | Ga0209971_1001444 | 3300027682 | Bacteria | 5910 |
| 768 | Ga0209966_1006585 | 3300027695 | Bacteria | 2019 |
| 769 | Ga0209974_10007837 | 3300027876 | Bacteria | 3667 |
| 770 | Ga0209974_10083958 | 3300027876 | Bacteria | 1099 |
| 771 | Ga0207428_10003044 | 3300027907 | Bacteria | 16504 |
| 772 | Ga0207428_10027877 | 3300027907 | Bacteria | 4698 |
| 773 | Ga0207428_10031162 | 3300027907 | Bacteria | 4404 |
| 774 | Ga0207428_10081767 | 3300027907 | Bacteria | 2522 |
| 775 | Ga0265357_1007234 | 3300028023 | Bacteria | 1068 |
| 776 | Ga0268266_10003005 | 3300028379 | Bacteria | 17351 |
| 777 | Ga0268266_10020512 | 3300028379 | Bacteria | 5633 |
| 778 | Ga0268266_10050834 | 3300028379 | Bacteria | 3557 |
| 779 | Ga0268266_10057234 | 3300028379 | Bacteria | 3355 |
| 780 | Ga0268266_10189434 | 3300028379 | Bacteria | 1877 |
| 781 | Ga0268265_10016607 | 3300028380 | Bacteria | 5062 |
| 782 | Ga0268265_10018358 | 3300028380 | Bacteria | 4845 |
| 783 | Ga0268265_10099648 | 3300028380 | Bacteria | 2343 |
| 784 | Ga0268265_10135273 | 3300028380 | Bacteria | 2055 |
| 785 | Ga0268265_10263673 | 3300028380 | Bacteria | 1533 |
| 786 | Ga0268265_10421918 | 3300028380 | Bacteria | 1239 |
| 787 | Ga0268264_10000299 | 3300028381 | Bacteria | 80981 |
| 788 | Ga0268264_10013145 | 3300028381 | Bacteria | 6808 |
| 789 | Ga0268264_10024972 | 3300028381 | Bacteria | 4884 |
| 790 | Ga0268264_10072281 | 3300028381 | Bacteria | 2925 |
| 791 | Ga0268264_10327148 | 3300028381 | Bacteria | 1451 |
| 792 | Ga0265334_10018682 | 3300028573 | Bacteria | 2859 |
| 793 | Ga0265336_10007212 | 3300028666 | Bacteria | 3966 |
| 794 | Ga0307517_10000024 | 3300028786 | Bacteria | 185597 |
| 795 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 796 | Ga0265338_10000058 | 3300028800 | Bacteria | 198555 |
| 797 | Ga0265338_10006256 | 3300028800 | Bacteria | 15232 |
| 798 | Ga0265338_10008827 | 3300028800 | Bacteria | 12160 |
| 799 | Ga0265324_10007430 | 3300029957 | Bacteria | 4443 |
| 800 | Ga0307511_10011888 | 3300030521 | Bacteria | 8564 |
| 801 | Ga0265330_10000156 | 3300031235 | Bacteria | 55313 |
| 802 | Ga0265330_10000564 | 3300031235 | Bacteria | 24138 |
| 803 | Ga0265332_10000085 | 3300031238 | Bacteria | 82163 |
| 804 | Ga0265332_10000157 | 3300031238 | Bacteria | 55228 |
| 805 | Ga0265328_10001015 | 3300031239 | Bacteria | 12917 |
| 806 | Ga0265328_10002908 | 3300031239 | Bacteria | 7637 |
| 807 | Ga0265320_10014626 | 3300031240 | Bacteria | 4458 |
| 808 | Ga0265325_10000396 | 3300031241 | Bacteria | 30886 |
| 809 | Ga0265340_10003568 | 3300031247 | Bacteria | 8754 |
| 810 | Ga0265340_10041778 | 3300031247 | Bacteria | 2253 |
| 811 | Ga0265339_10007765 | 3300031249 | Bacteria | 6897 |
| 812 | Ga0265331_10001313 | 3300031250 | Bacteria | 18434 |
| 813 | Ga0265331_10022500 | 3300031250 | Bacteria | 3216 |
| 814 | Ga0265327_10000549 | 3300031251 | Bacteria | 64188 |
| 815 | Ga0265316_10004897 | 3300031344 | Bacteria | 13177 |
| 816 | Ga0265316_10033511 | 3300031344 | Bacteria | 4182 |
| 817 | Ga0307513_10027559 | 3300031456 | Bacteria | 6520 |
| 818 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 819 | Ga0307509_10000018 | 3300031507 | Bacteria | 258998 |
| 820 | Ga0307509_10000109 | 3300031507 | Bacteria | 117520 |
| 821 | Ga0307408_100060345 | 3300031548 | Bacteria | 2764 |
| 822 | Ga0307408_100067510 | 3300031548 | Bacteria | 2630 |
| 823 | Ga0307408_100264610 | 3300031548 | Bacteria | 1425 |
| 824 | Ga0265313_10000729 | 3300031595 | Bacteria | 33816 |
| 825 | Ga0307508_10007662 | 3300031616 | Bacteria | 10037 |
| 826 | Ga0307508_10041267 | 3300031616 | Bacteria | 4142 |
| 827 | Ga0307514_10048870 | 3300031649 | Bacteria | 3292 |
| 828 | Ga0316575_10006556 | 3300031665 | Bacteria | 4193 |
| 829 | Ga0265314_10000036 | 3300031711 | Bacteria | 234928 |
| 830 | Ga0265314_10000446 | 3300031711 | Bacteria | 55219 |
| 831 | Ga0265342_10000765 | 3300031712 | Bacteria | 32742 |
| 832 | Ga0316578_10019647 | 3300031728 | Bacteria | 3723 |
| 833 | Ga0307516_10054864 | 3300031730 | Bacteria | 3893 |
| 834 | Ga0307405_10010260 | 3300031731 | Bacteria | 4841 |
| 835 | Ga0307405_10115913 | 3300031731 | Bacteria | 1824 |
| 836 | Ga0307405_10157866 | 3300031731 | Bacteria | 1603 |
| 837 | Ga0307410_10006700 | 3300031852 | Bacteria | 6241 |
| 838 | Ga0307410_10136581 | 3300031852 | Bacteria | 1808 |
| 839 | Ga0307406_10261223 | 3300031901 | Bacteria | 1310 |
| 840 | Ga0307407_10028986 | 3300031903 | Bacteria | 2967 |
| 841 | Ga0307412_10047607 | 3300031911 | Bacteria | 2817 |
| 842 | Ga0307412_10070451 | 3300031911 | Bacteria | 2383 |
| 843 | Ga0307412_10211161 | 3300031911 | Bacteria | 1481 |
| 844 | Ga0307416_100067305 | 3300032002 | Bacteria | 2953 |
| 845 | Ga0307416_100083196 | 3300032002 | Bacteria | 2714 |
| 846 | Ga0307416_100090074 | 3300032002 | Bacteria | 2629 |
| 847 | Ga0307416_100099458 | 3300032002 | Bacteria | 2526 |
| 848 | Ga0307416_100175122 | 3300032002 | Bacteria | 2003 |
| 849 | Ga0307416_100175163 | 3300032002 | Bacteria | 2003 |
| 850 | Ga0307416_100263547 | 3300032002 | Bacteria | 1686 |
| 851 | Ga0307416_100357342 | 3300032002 | Bacteria | 1481 |
| 852 | Ga0307411_10000606 | 3300032005 | Bacteria | 12875 |
| 853 | Ga0307411_10136334 | 3300032005 | Bacteria | 1802 |
| 854 | Ga0307411_10486995 | 3300032005 | Bacteria | 1040 |
| 855 | Ga0307415_100013217 | 3300032126 | Bacteria | 4812 |
| 856 | Ga0307415_100239284 | 3300032126 | Bacteria | 1467 |
| 857 | Ga0307415_100318512 | 3300032126 | Bacteria | 1296 |
| 858 | Ga0316583_10006551 | 3300032133 | Bacteria | 4184 |
| 859 | Ga0316583_10007061 | 3300032133 | Bacteria | 4039 |
| 860 | Ga0373930_0000484 | 3300034816 | Bacteria | 5392 |
| 861 | Ga0373938_0004945 | 3300034957 | Bacteria | 2248 |
| 862 | Ga0373938_0022085 | 3300034957 | Bacteria | 1297 |
| 863 | Ga0373934_0009726 | 3300035086 | Bacteria | 3607 |
| 864 | Ga0373940_0001325 | 3300035088 | Bacteria | 4412 |
| 865 | Ga0373944_0044708 | 3300035089 | Bacteria | 1380 |
| 866 | Ga0373949_0004944 | 3300035090 | Bacteria | 3009 |
| 867 | Ga0373952_0002430 | 3300035092 | Bacteria | 3359 |
| 868 | Ga0373923_0013458 | 3300035111 | Bacteria | 3050 |
| 869 | Ga0373932_0001860 | 3300035112 | Bacteria | 5652 |
| 870 | Ga0373932_0002355 | 3300035112 | Bacteria | 4796 |
| 871 | Ga0373936_0003169 | 3300035113 | Bacteria | 6156 |
| 872 | Ga0373936_0006544 | 3300035113 | Bacteria | 4387 |
| 873 | Ga0373945_0018321 | 3300035116 | Bacteria | 2381 |
| 874 | Ga0373953_0001139 | 3300035117 | Bacteria | 7546 |
| 875 | Ga0373956_0026985 | 3300035119 | Bacteria | 2490 |
| 876 | Ga0373957_0031285 | 3300035120 | Bacteria | 1955 |
| 877 | Ga0373960_0010732 | 3300035121 | Bacteria | 2244 |
| 878 | Ga0373960_0016610 | 3300035121 | Bacteria | 1897 |
| 879 | Ga0373943_0014340 | 3300035170 | Bacteria | 3587 |
| 880 | Ga0373943_0103771 | 3300035170 | Bacteria | 1490 |
| 881 | Ga0373955_0020888 | 3300035172 | Bacteria | 3297 |
| 882 | Ga0373955_0064615 | 3300035172 | Bacteria | 2029 |
| 883 | Ga0373961_0006886 | 3300035241 | Bacteria | 2735 |
| 884 | Ga0373961_0007299 | 3300035241 | Bacteria | 2671 |
| 885 | Ga0373961_0023801 | 3300035241 | Bacteria | 1651 |
| 886 | Ga0373962_0004968 | 3300035242 | Bacteria | 3216 |
| 887 | Ga0316574_0195504 | 3300035398 | Bacteria | 1300 |
| 888 | Ga0373924_0002265 | 3300035410 | Bacteria | 6455 |
| 889 | Ga0373924_0008436 | 3300035410 | Bacteria | 3745 |
| 890 | Ga0373924_0013759 | 3300035410 | Bacteria | 3045 |
| 891 | Ga0373924_0120039 | 3300035410 | Bacteria | 1140 |
| 892 | Ga0373931_0001851 | 3300035691 | Bacteria | 9207 |
| 893 | Ga0373931_0002614 | 3300035691 | Bacteria | 8011 |
| 894 | Ga0373931_0009572 | 3300035691 | Bacteria | 4635 |
| 895 | Ga0373931_0049571 | 3300035691 | Bacteria | 2231 |
| 896 | Ga0373931_0224752 | 3300035691 | Bacteria | 1132 |
| 897 | Ga0373935_0051018 | 3300035692 | Bacteria | 2627 |
| 898 | Ga0373935_0057983 | 3300035692 | Bacteria | 2472 |
| 899 | Ga0373927_0034159 | 3300035695 | Bacteria | 3309 |
| 900 | Ga0373933_0005006 | 3300035724 | Bacteria | 7228 |
| 901 | Ga0373933_0350295 | 3300035724 | Bacteria | 959 |
| 902 | Ga0373937_0005534 | 3300036401 | Bacteria | 10832 |
| 903 | Ga0373937_0006172 | 3300036401 | Bacteria | 10319 |
| 904 | Ga0373937_0022263 | 3300036401 | Bacteria | 5696 |
| 905 | Ga0373937_0078668 | 3300036401 | Bacteria | 3047 |
| 906 | Ga0373937_0189572 | 3300036401 | Bacteria | 1932 |
| 907 | Ga0316582_0025856 | 3300036647 | Bacteria | 3529 |
| 908 | Ga0373925_0005195 | 3300037068 | Bacteria | 9740 |
| 909 | Ga0373925_0008462 | 3300037068 | Bacteria | 7497 |
| 910 | Ga0373925_0009800 | 3300037068 | Bacteria | 6956 |
| 911 | Ga0373925_0013565 | 3300037068 | Bacteria | 5899 |
| 912 | Ga0373925_0076340 | 3300037068 | Bacteria | 2540 |
| 913 | Ga0373925_0098336 | 3300037068 | Bacteria | 2246 |
| 914 | Ga0373925_0115562 | 3300037068 | Bacteria | 2078 |
| 915 | Ga0373925_0154818 | 3300037068 | Bacteria | 1802 |
| 916 | Ga0373925_0423294 | 3300037068 | Bacteria | 1088 |
| 917 | Ga0373925_0605854 | 3300037068 | Bacteria | 902 |
| 918 | Ga0395899_0119945 | 3300037312 | Bacteria | 1885 |
| 919 | Ga0395905_0002868 | 3300037471 | Bacteria | 18825 |
| 920 | Ga0395905_0010024 | 3300037471 | Bacteria | 9236 |
| 921 | Ga0395901_0056428 | 3300038443 | Bacteria | 4085 |
| 922 | Ga0436360_0867881 | 3300039438 | Bacteria | 4438 |
| 923 | Ga0436361_0106893 | 3300039447 | Bacteria | 33853 |
| 924 | Ga0436361_0115046 | 3300039447 | Bacteria | 2357 |
| 925 | Ga0436361_0149387 | 3300039447 | Bacteria | 5189 |
| 926 | Ga0436361_0298613 | 3300039447 | Bacteria | 2252 |
| 927 | Ga0436361_1015109 | 3300039447 | Bacteria | 3088 |
| 928 | Ga0436361_1035781 | 3300039447 | Bacteria | 3040 |
| 929 | Ga0436363_0441792 | 3300039450 | Bacteria | 8029 |
| 930 | Ga0439447_029963 | 3300041407 | Bacteria | 1374 |
| 931 | Ga0439466_0001370 | 3300041411 | Bacteria | 9476 |
| 932 | Ga0451853_3964788 | 3300041512 | Bacteria | 1373 |
| 933 | Ga0439431_0003640 | 3300041997 | Bacteria | 3401 |
| 934 | Ga0439448_0002019 | 3300042005 | Bacteria | 5426 |
| 935 | Ga0439432_011742 | 3300042006 | Bacteria | 3012 |
| 936 | Ga0439450_021130 | 3300042008 | Bacteria | 1395 |
| 937 | Ga0439455_0002250 | 3300042012 | Bacteria | 3465 |
| 938 | Ga0450888_006722 | 3300042126 | Bacteria | 1257 |
| 939 | Ga0439464_0010768 | 3300042439 | Bacteria | 2417 |
| 940 | Ga0439460_0004047 | 3300042461 | Bacteria | 3562 |
| 941 | Ga0451577_0002804 | 3300042876 | Bacteria | 20111 |
| 942 | Ga0451577_0003002 | 3300042876 | Bacteria | 19230 |
| 943 | Ga0451577_0029523 | 3300042876 | Bacteria | 4957 |
| 944 | Ga0451577_0051298 | 3300042876 | Bacteria | 3683 |
| 945 | Ga0451577_0056299 | 3300042876 | Bacteria | 3507 |
| 946 | Ga0451577_0116278 | 3300042876 | Unclassified | 2395 |
| 947 | Ga0451577_0125332 | 3300042876 | Bacteria | 2302 |
| 948 | Ga0466969_0001856 | 3300044656 | Bacteria | 11299 |
| 949 | Ga0466969_0002107 | 3300044656 | Bacteria | 10610 |
| 950 | Ga0453683_0017707 | 3300044673 | Bacteria | 4583 |
| 951 | Ga0453683_0024472 | 3300044673 | Bacteria | 3841 |
| 952 | Ga0453683_0026181 | 3300044673 | Bacteria | 3705 |
| 953 | Ga0453683_0067113 | 3300044673 | Bacteria | 2242 |
| 954 | Ga0466966_0003642 | 3300044684 | Bacteria | 10169 |
| 955 | Ga0466961_0001050 | 3300044693 | Bacteria | 17009 |
| 956 | Ga0466964_0001846 | 3300044706 | Bacteria | 7373 |
| 957 | Ga0453684_0000789 | 3300044712 | Bacteria | 108459 |
| 958 | Ga0453684_0001404 | 3300044712 | Bacteria | 69532 |
| 959 | Ga0453684_0005874 | 3300044712 | Bacteria | 23847 |
| 960 | Ga0453684_0021384 | 3300044712 | Bacteria | 9667 |
| 961 | Ga0453684_0056579 | 3300044712 | Bacteria | 5086 |
| 962 | Ga0453684_0111559 | 3300044712 | Bacteria | 3322 |
| 963 | Ga0453684_0584459 | 3300044712 | Bacteria | 1226 |
| 964 | Ga0453684_0665782 | 3300044712 | Bacteria | 1134 |
| 965 | Ga0453684_0735601 | 3300044712 | Bacteria | 1069 |
| 966 | Ga0466971_0000216 | 3300044719 | Bacteria | 22087 |
| 967 | Ga0466970_0005778 | 3300044765 | Bacteria | 6149 |
| 968 | Ga0466957_0055856 | 3300044842 | Bacteria | 2413 |
| 969 | Ga0451576_0000674 | 3300045051 | Bacteria | 69516 |
| 970 | Ga0451576_0015471 | 3300045051 | Bacteria | 8450 |
| 971 | Ga0451576_0025255 | 3300045051 | Bacteria | 6402 |
| 972 | Ga0451576_0043727 | 3300045051 | Bacteria | 4725 |
| 973 | Ga0451576_0054139 | 3300045051 | Bacteria | 4202 |
| 974 | Ga0451576_0061972 | 3300045051 | Bacteria | 3900 |
| 975 | Ga0451576_0069622 | 3300045051 | Bacteria | 3661 |
| 976 | Ga0451576_0075225 | 3300045051 | Bacteria | 3513 |
| 977 | Ga0451576_0366656 | 3300045051 | Bacteria | 1509 |
| 978 | Ga0466967_0023171 | 3300045976 | Bacteria | 5084 |
| 979 | Ga0495592_0031259 | 3300046454 | Bacteria | 4024 |
| 980 | Ga0495592_0054489 | 3300046454 | Bacteria | 2963 |
| 981 | Ga0495603_0001866 | 3300046455 | Bacteria | 12413 |
| 982 | Ga0495603_0006042 | 3300046455 | Bacteria | 7240 |
| 983 | Ga0495603_0031425 | 3300046455 | Bacteria | 3196 |
| 984 | Ga0495603_0059548 | 3300046455 | Bacteria | 2258 |
| 985 | Ga0495603_0078298 | 3300046455 | Bacteria | 1939 |
| 986 | Ga0495591_008842 | 3300046458 | Bacteria | 4070 |
| 987 | Ga0495629_0000224 | 3300046459 | Bacteria | 50510 |
| 988 | Ga0495629_0030251 | 3300046459 | Bacteria | 3840 |
| 989 | Ga0495629_0100995 | 3300046459 | Bacteria | 2013 |
| 990 | Ga0495629_0140797 | 3300046459 | Bacteria | 1678 |
| 991 | Ga0495629_0238256 | 3300046459 | Bacteria | 1253 |
| 992 | Ga0495638_0002026 | 3300046460 | Bacteria | 17240 |
| 993 | Ga0495638_0010227 | 3300046460 | Bacteria | 6530 |
| 994 | Ga0495638_0229638 | 3300046460 | Bacteria | 1033 |
| 995 | Ga0495641_0007096 | 3300046461 | Bacteria | 7093 |
| 996 | Ga0495651_0014853 | 3300046462 | Bacteria | 6020 |
| 997 | Ga0495653_0001151 | 3300046463 | Bacteria | 20356 |
| 998 | Ga0495653_0001599 | 3300046463 | Bacteria | 17790 |
| 999 | Ga0495653_0017344 | 3300046463 | Bacteria | 5856 |
| 1000 | Ga0495650_0002288 | 3300046471 | Bacteria | 15923 |
| 1001 | Ga0495580_0000700 | 3300046472 | Bacteria | 28661 |
| 1002 | Ga0495580_0001538 | 3300046472 | Bacteria | 20295 |
| 1003 | Ga0495580_0002263 | 3300046472 | Bacteria | 16815 |
| 1004 | Ga0495580_0003902 | 3300046472 | Bacteria | 12604 |
| 1005 | Ga0495580_0008595 | 3300046472 | Bacteria | 8101 |
| 1006 | Ga0495580_0009699 | 3300046472 | Bacteria | 7552 |
| 1007 | Ga0495580_0025496 | 3300046472 | Bacteria | 4321 |
| 1008 | Ga0495580_0033047 | 3300046472 | Bacteria | 3728 |
| 1009 | Ga0495580_0033173 | 3300046472 | Bacteria | 3721 |
| 1010 | Ga0495580_0082434 | 3300046472 | Bacteria | 2241 |
| 1011 | Ga0495582_0019073 | 3300046473 | Bacteria | 3753 |
| 1012 | Ga0495582_0052523 | 3300046473 | Bacteria | 2247 |
| 1013 | Ga0495605_0006406 | 3300046474 | Bacteria | 6773 |
| 1014 | Ga0495605_0007666 | 3300046474 | Bacteria | 6119 |
| 1015 | Ga0495639_0001641 | 3300046475 | Bacteria | 9963 |
| 1016 | Ga0495639_0046076 | 3300046475 | Bacteria | 1973 |
| 1017 | Ga0495662_0013582 | 3300046476 | Bacteria | 3964 |
| 1018 | Ga0495664_0000429 | 3300046477 | Bacteria | 20586 |
| 1019 | Ga0495664_0000685 | 3300046477 | Bacteria | 17239 |
| 1020 | Ga0495664_0018928 | 3300046477 | Bacteria | 3953 |
| 1021 | Ga0495664_0071398 | 3300046477 | Bacteria | 2074 |
| 1022 | Ga0495664_0078990 | 3300046477 | Bacteria | 1972 |
| 1023 | Ga0495664_0088622 | 3300046477 | Bacteria | 1860 |
| 1024 | Ga0495584_0045122 | 3300046491 | Bacteria | 2224 |
| 1025 | Ga0495594_0020522 | 3300046499 | Bacteria | 3519 |
| 1026 | Ga0495596_0007864 | 3300046500 | Bacteria | 4777 |
| 1027 | Ga0495607_0084173 | 3300046501 | Bacteria | 1741 |
| 1028 | Ga0495583_0006963 | 3300046506 | Bacteria | 7244 |
| 1029 | Ga0495583_0118856 | 3300046506 | Bacteria | 1114 |
| 1030 | Ga0495606_0116395 | 3300046507 | Bacteria | 1606 |
| 1031 | Ga0495608_0043714 | 3300046511 | Bacteria | 2992 |
| 1032 | Ga0495608_0046901 | 3300046511 | Bacteria | 2874 |
| 1033 | Ga0495616_0020071 | 3300046513 | Bacteria | 3640 |
| 1034 | Ga0495616_0064025 | 3300046513 | Bacteria | 1795 |
| 1035 | Ga0495618_0010454 | 3300046514 | Bacteria | 5613 |
| 1036 | Ga0495618_0056472 | 3300046514 | Bacteria | 2486 |
| 1037 | Ga0495618_0108921 | 3300046514 | Bacteria | 1774 |
| 1038 | Ga0495628_0000831 | 3300046516 | Bacteria | 28661 |
| 1039 | Ga0495628_0003725 | 3300046516 | Bacteria | 13566 |
| 1040 | Ga0495628_0055138 | 3300046516 | Bacteria | 3131 |
| 1041 | Ga0495628_0114914 | 3300046516 | Bacteria | 2067 |
| 1042 | Ga0495630_0002201 | 3300046517 | Bacteria | 13571 |
| 1043 | Ga0495630_0014399 | 3300046517 | Bacteria | 5762 |
| 1044 | Ga0495630_0077992 | 3300046517 | Bacteria | 2497 |
| 1045 | Ga0495632_0057179 | 3300046519 | Bacteria | 1905 |
| 1046 | Ga0495632_0104489 | 3300046519 | Bacteria | 1333 |
| 1047 | Ga0495648_0002762 | 3300046524 | Bacteria | 15851 |
| 1048 | Ga0495648_0015139 | 3300046524 | Bacteria | 5617 |
| 1049 | Ga0495648_0016753 | 3300046524 | Bacteria | 5271 |
| 1050 | Ga0495648_0058926 | 3300046524 | Bacteria | 2293 |
| 1051 | Ga0495648_0097364 | 3300046524 | Bacteria | 1632 |
| 1052 | Ga0495666_0000299 | 3300046526 | Bacteria | 21603 |
| 1053 | Ga0495666_0058413 | 3300046526 | Bacteria | 1845 |
| 1054 | Ga0495642_0022914 | 3300046528 | Bacteria | 2463 |
| 1055 | Ga0495652_0001797 | 3300046529 | Bacteria | 22856 |
| 1056 | Ga0495652_0014692 | 3300046529 | Bacteria | 7021 |
| 1057 | Ga0495652_0073952 | 3300046529 | Bacteria | 2835 |
| 1058 | Ga0495665_0000415 | 3300046531 | Bacteria | 21709 |
| 1059 | Ga0495665_0000879 | 3300046531 | Bacteria | 15726 |
| 1060 | Ga0495665_0014148 | 3300046531 | Bacteria | 4306 |
| 1061 | Ga0495665_0019069 | 3300046531 | Bacteria | 3687 |
| 1062 | Ga0495665_0049929 | 3300046531 | Bacteria | 2218 |
| 1063 | Ga0495665_0059945 | 3300046531 | Bacteria | 2009 |
| 1064 | Ga0495640_0014707 | 3300046533 | Bacteria | 5912 |
| 1065 | Ga0495640_0034387 | 3300046533 | Bacteria | 3594 |
| 1066 | Ga0495586_0063979 | 3300046535 | Bacteria | 2004 |
| 1067 | Ga0495586_0105781 | 3300046535 | Bacteria | 1564 |
| 1068 | Ga0495586_0129104 | 3300046535 | Bacteria | 1415 |
| 1069 | Ga0495586_0204706 | 3300046535 | Bacteria | 1119 |
| 1070 | Ga0495587_0000686 | 3300046536 | Bacteria | 22717 |
| 1071 | Ga0495587_0015593 | 3300046536 | Bacteria | 4740 |
| 1072 | Ga0495598_0048507 | 3300046537 | Bacteria | 1270 |
| 1073 | Ga0495621_0002198 | 3300046539 | Bacteria | 5198 |
| 1074 | Ga0495621_0059634 | 3300046539 | Bacteria | 1383 |
| 1075 | Ga0495645_0001756 | 3300046543 | Bacteria | 14734 |
| 1076 | Ga0495667_0014831 | 3300046559 | Bacteria | 5266 |
| 1077 | Ga0495667_0021574 | 3300046559 | Bacteria | 4346 |
| 1078 | Ga0495634_0002194 | 3300046642 | Bacteria | 16391 |
| 1079 | Ga0495634_0022609 | 3300046642 | Bacteria | 4429 |
| 1080 | Ga0495611_0051663 | 3300046648 | Bacteria | 1853 |
| 1081 | Ga0495625_0079604 | 3300046660 | Bacteria | 2284 |
| 1082 | Ga0495635_0031672 | 3300046663 | Bacteria | 3669 |
| 1083 | Ga0495635_0100569 | 3300046663 | Bacteria | 1976 |
| 1084 | Ga0495635_0115000 | 3300046663 | Bacteria | 1837 |
| 1085 | Ga0495635_0137592 | 3300046663 | Bacteria | 1664 |
| 1086 | Ga0495661_0001293 | 3300046665 | Bacteria | 21387 |
| 1087 | Ga0495661_0005687 | 3300046665 | Bacteria | 8827 |
| 1088 | Ga0495657_0035778 | 3300046675 | Bacteria | 3438 |
| 1089 | Ga0495657_0046331 | 3300046675 | Bacteria | 2945 |
| 1090 | Ga0495657_0073700 | 3300046675 | Bacteria | 2223 |
| 1091 | Ga0495657_0260342 | 3300046675 | Bacteria | 1042 |
| 1092 | Ga0495599_0002006 | 3300046678 | Bacteria | 11774 |
| 1093 | Ga0495599_0004056 | 3300046678 | Bacteria | 8626 |
| 1094 | Ga0495599_0006027 | 3300046678 | Bacteria | 7297 |
| 1095 | Ga0495599_0025854 | 3300046678 | Bacteria | 3677 |
| 1096 | Ga0495599_0052227 | 3300046678 | Bacteria | 2560 |
| 1097 | Ga0495623_0003332 | 3300046679 | Bacteria | 10617 |
| 1098 | Ga0495623_0011928 | 3300046679 | Bacteria | 5632 |
| 1099 | Ga0495623_0051308 | 3300046679 | Bacteria | 2610 |
| 1100 | Ga0495646_0012481 | 3300046680 | Bacteria | 5402 |
| 1101 | Ga0495646_0133343 | 3300046680 | Bacteria | 1396 |
| 1102 | Ga0495647_0007459 | 3300046681 | Bacteria | 3665 |
| 1103 | Ga0495647_0032350 | 3300046681 | Bacteria | 1949 |
| 1104 | Ga0495647_0050172 | 3300046681 | Bacteria | 1618 |
| 1105 | Ga0495658_0002904 | 3300046683 | Bacteria | 8605 |
| 1106 | Ga0495658_0005709 | 3300046683 | Bacteria | 6112 |
| 1107 | Ga0495658_0034592 | 3300046683 | Bacteria | 2773 |
| 1108 | Ga0495658_0167427 | 3300046683 | Bacteria | 1358 |
| 1109 | Ga0495669_0006310 | 3300046684 | Bacteria | 4951 |
| 1110 | Ga0495669_0188450 | 3300046684 | Bacteria | 984 |
| 1111 | Ga0495613_0064614 | 3300046689 | Bacteria | 2676 |
| 1112 | Ga0495613_0356406 | 3300046689 | Bacteria | 1004 |
| 1113 | Ga0495624_0000062 | 3300046690 | Bacteria | 67917 |
| 1114 | Ga0495624_0000540 | 3300046690 | Bacteria | 29548 |
| 1115 | Ga0495624_0000958 | 3300046690 | Bacteria | 22780 |
| 1116 | Ga0495624_0008355 | 3300046690 | Bacteria | 7227 |
| 1117 | Ga0495624_0065966 | 3300046690 | Bacteria | 2260 |
| 1118 | Ga0495670_0008307 | 3300046691 | Bacteria | 5104 |
| 1119 | Ga0495670_0212559 | 3300046691 | Bacteria | 1026 |
| 1120 | Ga0495671_0049495 | 3300046692 | Bacteria | 2095 |
| 1121 | Ga0495671_0179386 | 3300046692 | Bacteria | 1029 |
| 1122 | Ga0495649_0132632 | 3300046694 | Bacteria | 1314 |
| 1123 | Ga0495589_0003015 | 3300046794 | Bacteria | 9257 |
| 1124 | Ga0495589_0005218 | 3300046794 | Bacteria | 6874 |
| 1125 | Ga0495589_0022660 | 3300046794 | Bacteria | 3204 |
| 1126 | Ga0495589_0119397 | 3300046794 | Bacteria | 1270 |
| 1127 | Ga0495600_0165220 | 3300046809 | Bacteria | 1430 |
| 1128 | Ga0495581_0004550 | 3300047315 | Bacteria | 8010 |
| 1129 | Ga0495581_0140908 | 3300047315 | Bacteria | 1406 |
| 1130 | Ga0495604_0001008 | 3300047317 | Bacteria | 23441 |
| 1131 | Ga0495604_0002577 | 3300047317 | Bacteria | 14512 |
| 1132 | Ga0495604_0054559 | 3300047317 | Bacteria | 3083 |
| 1133 | Ga0495604_0059375 | 3300047317 | Bacteria | 2931 |
| 1134 | Ga0495604_0088452 | 3300047317 | Bacteria | 2304 |
| 1135 | Ga0495604_0187178 | 3300047317 | Bacteria | 1445 |
| 1136 | Ga0495604_0221862 | 3300047317 | Bacteria | 1301 |
| 1137 | Ga0495636_0001185 | 3300047318 | Bacteria | 9829 |
| 1138 | Ga0495674_0000741 | 3300047319 | Bacteria | 30840 |
| 1139 | Ga0495674_0005345 | 3300047319 | Bacteria | 12323 |
| 1140 | Ga0495674_0008223 | 3300047319 | Bacteria | 9954 |
| 1141 | Ga0495674_0008525 | 3300047319 | Bacteria | 9756 |
| 1142 | Ga0495674_0014935 | 3300047319 | Bacteria | 7267 |
| 1143 | Ga0495674_0016022 | 3300047319 | Bacteria | 6995 |
| 1144 | Ga0495674_0022797 | 3300047319 | Bacteria | 5770 |
| 1145 | Ga0495674_0094474 | 3300047319 | Bacteria | 2550 |
| 1146 | Ga0495674_0141256 | 3300047319 | Bacteria | 2024 |
| 1147 | Ga0495672_0005393 | 3300047320 | Bacteria | 10158 |
| 1148 | Ga0495672_0010282 | 3300047320 | Bacteria | 6685 |
| 1149 | Ga0495672_0025979 | 3300047320 | Bacteria | 3742 |
| 1150 | Ga0495676_0031125 | 3300047321 | Bacteria | 4517 |
| 1151 | Ga0495680_0001805 | 3300047322 | Bacteria | 22616 |
| 1152 | Ga0495680_0024289 | 3300047322 | Bacteria | 5029 |
| 1153 | Ga0495680_0062618 | 3300047322 | Bacteria | 2859 |
| 1154 | Ga0495680_0102662 | 3300047322 | Bacteria | 2129 |
| 1155 | Ga0495680_0168969 | 3300047322 | Bacteria | 1584 |
| 1156 | Ga0495683_0031837 | 3300047323 | Bacteria | 2687 |
| 1157 | Ga0495687_019854 | 3300047443 | Bacteria | 3288 |
| 1158 | Ga0495687_034998 | 3300047443 | Bacteria | 2263 |
| 1159 | Ga0495687_053767 | 3300047443 | Bacteria | 1694 |
| 1160 | Ga0495675_0002322 | 3300047444 | Bacteria | 11368 |
| 1161 | Ga0495675_0016280 | 3300047444 | Bacteria | 4703 |
| 1162 | Ga0495675_0048455 | 3300047444 | Bacteria | 2702 |
| 1163 | Ga0495675_0132809 | 3300047444 | Bacteria | 1546 |
| 1164 | Ga0495675_0175933 | 3300047444 | Bacteria | 1312 |
| 1165 | Ga0495679_000473 | 3300047446 | Bacteria | 29110 |
| 1166 | Ga0495679_000897 | 3300047446 | Bacteria | 18689 |
| 1167 | Ga0495679_074363 | 3300047446 | Bacteria | 973 |
| 1168 | Ga0495685_080701 | 3300047447 | Bacteria | 1083 |
| 1169 | Ga0495673_0014021 | 3300047469 | Bacteria | 4183 |
| 1170 | Ga0495673_0016141 | 3300047469 | Bacteria | 3826 |
| 1171 | Ga0495673_0016813 | 3300047469 | Bacteria | 3729 |
| 1172 | Ga0495684_0029557 | 3300047471 | Bacteria | 4207 |
| 1173 | Ga0495684_0055680 | 3300047471 | Bacteria | 3016 |
| 1174 | Ga0495593_0009257 | 3300047673 | Bacteria | 5714 |
| 1175 | Ga0495593_0076523 | 3300047673 | Bacteria | 1734 |
| 1176 | Ga0495593_0087487 | 3300047673 | Bacteria | 1606 |
| 1177 | Ga0495602_0001774 | 3300048088 | Bacteria | 21600 |
| 1178 | Ga0495602_0068433 | 3300048088 | Bacteria | 3048 |
| 1179 | Ga0495602_0085720 | 3300048088 | Bacteria | 2631 |
| 1180 | Ga0495602_0092490 | 3300048088 | Bacteria | 2505 |
| 1181 | Ga0495602_0168588 | 3300048088 | Bacteria | 1701 |
| 1182 | Ga0495614_0000191 | 3300048089 | Bacteria | 23174 |
| 1183 | Ga0495614_0023072 | 3300048089 | Bacteria | 2684 |
| 1184 | Ga0495626_0056015 | 3300048091 | Bacteria | 1806 |
| 1185 | Ga0496100_0004002 | 3300048903 | Bacteria | 7749 |
| 1186 | Ga0496100_0047886 | 3300048903 | Bacteria | 2757 |
| 1187 | Ga0496100_0126104 | 3300048903 | Bacteria | 1797 |
| 1188 | Ga0496100_0368867 | 3300048903 | Bacteria | 1088 |
| 1189 | Ga0496101_0003676 | 3300048904 | Bacteria | 9573 |
| 1190 | Ga0496102_0023692 | 3300048905 | Bacteria | 5455 |
| 1191 | Ga0496102_0069473 | 3300048905 | Bacteria | 3233 |
| 1192 | Ga0496102_0669216 | 3300048905 | Bacteria | 961 |
| 1193 | Ga0496104_0010082 | 3300048907 | Bacteria | 8436 |
| 1194 | Ga0496104_0012559 | 3300048907 | Bacteria | 7622 |
| 1195 | Ga0496104_0093923 | 3300048907 | Bacteria | 2869 |
| 1196 | Ga0496104_0351787 | 3300048907 | Bacteria | 1386 |
| 1197 | Ga0496105_0019505 | 3300048908 | Bacteria | 5470 |
| 1198 | Ga0496105_0033233 | 3300048908 | Bacteria | 4234 |
| 1199 | Ga0496105_0087117 | 3300048908 | Bacteria | 2580 |
| 1200 | Ga0496106_0151386 | 3300048909 | Bacteria | 1830 |
| 1201 | Ga0496106_0227393 | 3300048909 | Bacteria | 1489 |
| 1202 | Ga0496107_0021955 | 3300048910 | Bacteria | 4509 |
| 1203 | Ga0496107_0037468 | 3300048910 | Bacteria | 3480 |
| 1204 | Ga0496107_0196603 | 3300048910 | Bacteria | 1499 |
| 1205 | Ga0496108_0095747 | 3300048911 | Bacteria | 2528 |
| 1206 | Ga0496108_0172355 | 3300048911 | Bacteria | 1872 |
| 1207 | Ga0496109_0275245 | 3300048912 | Bacteria | 1586 |
| 1208 | Ga0496109_0319091 | 3300048912 | Bacteria | 1466 |
| 1209 | Ga0496109_0490838 | 3300048912 | Bacteria | 1159 |
| 1210 | Ga0496110_0094014 | 3300048913 | Bacteria | 2684 |
| 1211 | Ga0496110_0154892 | 3300048913 | Bacteria | 2076 |
| 1212 | Ga0496111_0013080 | 3300048914 | Bacteria | 5636 |
| 1213 | Ga0496112_0002424 | 3300048915 | Bacteria | 15013 |
| 1214 | Ga0496112_0036367 | 3300048915 | Bacteria | 4804 |
| 1215 | Ga0496112_0111487 | 3300048915 | Bacteria | 2705 |
| 1216 | Ga0496113_0002098 | 3300048916 | Bacteria | 11487 |
| 1217 | Ga0496113_0038684 | 3300048916 | Bacteria | 3508 |
| 1218 | Ga0496114_0031008 | 3300048917 | Bacteria | 4398 |
| 1219 | Ga0496114_0088369 | 3300048917 | Bacteria | 2629 |
| 1220 | Ga0496115_0010346 | 3300048918 | Bacteria | 6966 |
| 1221 | Ga0496116_0028474 | 3300048919 | Bacteria | 4047 |
| 1222 | Ga0496117_0046288 | 3300048920 | Bacteria | 3130 |
| 1223 | Ga0496118_0013636 | 3300048921 | Bacteria | 7672 |
| 1224 | Ga0496118_0046932 | 3300048921 | Bacteria | 3355 |
| 1225 | Ga0496119_0001412 | 3300048922 | Bacteria | 29074 |
| 1226 | Ga0496119_0111837 | 3300048922 | Bacteria | 1515 |
| 1227 | Ga0496120_0000061 | 3300048923 | Bacteria | 172817 |
| 1228 | Ga0496121_0003416 | 3300048924 | Bacteria | 22707 |
| 1229 | Ga0496121_0008989 | 3300048924 | Bacteria | 11585 |
| 1230 | Ga0496121_0010073 | 3300048924 | Bacteria | 10726 |
| 1231 | Ga0496125_0001329 | 3300048928 | Bacteria | 36515 |
| 1232 | Ga0496125_0009379 | 3300048928 | Bacteria | 10074 |
| 1233 | Ga0496126_0000102 | 3300048929 | Bacteria | 201540 |
| 1234 | Ga0496126_0111733 | 3300048929 | Bacteria | 2379 |
| 1235 | Ga0495682_0003413 | 3300049460 | Bacteria | 7065 |
| 1236 | Ga0501031_0094581 | 3300049568 | Bacteria | 1950 |
| 1237 | Ga0501031_0183505 | 3300049568 | Bacteria | 1367 |
| 1238 | Ga0501034_0432680 | 3300049571 | Bacteria | 1235 |
| 1239 | Ga0501036_0481422 | 3300049572 | Bacteria | 1033 |
| 1240 | Ga0501038_0144568 | 3300049574 | Bacteria | 1943 |
| 1241 | Ga0501039_0001318 | 3300049575 | Bacteria | 18144 |
| 1242 | Ga0501039_0152724 | 3300049575 | Bacteria | 1814 |
| 1243 | Ga0501040_0002506 | 3300049576 | Bacteria | 11828 |
| 1244 | Ga0501041_0002441 | 3300049577 | Bacteria | 10555 |
| 1245 | Ga0501041_0068175 | 3300049577 | Bacteria | 2181 |
| 1246 | Ga0501041_0127106 | 3300049577 | Bacteria | 1587 |
| 1247 | Ga0501041_0268240 | 3300049577 | Bacteria | 1074 |
| 1248 | Ga0501042_0005640 | 3300049578 | Bacteria | 8077 |
| 1249 | Ga0501042_0013689 | 3300049578 | Bacteria | 5525 |
| 1250 | Ga0501046_0113159 | 3300049580 | Bacteria | 2072 |
| 1251 | Ga0501047_0004510 | 3300049581 | Bacteria | 13101 |
| 1252 | Ga0501047_0008637 | 3300049581 | Bacteria | 9622 |
| 1253 | Ga0501048_0010224 | 3300049582 | Bacteria | 7018 |
| 1254 | Ga0501067_0176324 | 3300049583 | Bacteria | 1190 |
| 1255 | Ga0501068_0000336 | 3300049584 | Bacteria | 23645 |
| 1256 | Ga0501068_0220190 | 3300049584 | Bacteria | 1206 |
| 1257 | Ga0501069_0001252 | 3300049585 | Bacteria | 12431 |
| 1258 | Ga0501070_0000975 | 3300049586 | Bacteria | 25701 |
| 1259 | Ga0501070_0002573 | 3300049586 | Bacteria | 15879 |
| 1260 | Ga0501071_0001594 | 3300049587 | Bacteria | 13292 |
| 1261 | Ga0501071_0011264 | 3300049587 | Bacteria | 6017 |
| 1262 | Ga0501071_0012654 | 3300049587 | Bacteria | 5732 |
| 1263 | Ga0501071_0063039 | 3300049587 | Bacteria | 2687 |
| 1264 | Ga0501071_0094639 | 3300049587 | Bacteria | 2198 |
| 1265 | Ga0501071_0140456 | 3300049587 | Bacteria | 1798 |
| 1266 | Ga0501071_0164187 | 3300049587 | Bacteria | 1661 |
| 1267 | Ga0501072_0008439 | 3300049588 | Bacteria | 7820 |
| 1268 | Ga0501072_0010897 | 3300049588 | Bacteria | 6935 |
| 1269 | Ga0501072_0037994 | 3300049588 | Bacteria | 3778 |
| 1270 | Ga0501072_0080857 | 3300049588 | Bacteria | 2575 |
| 1271 | Ga0501073_0001472 | 3300049589 | Bacteria | 17438 |
| 1272 | Ga0501073_0003148 | 3300049589 | Bacteria | 12375 |
| 1273 | Ga0501073_0214512 | 3300049589 | Bacteria | 1330 |
| 1274 | Ga0501074_0012536 | 3300049590 | Bacteria | 6163 |
| 1275 | Ga0501074_0036304 | 3300049590 | Bacteria | 3570 |
| 1276 | Ga0501074_0142932 | 3300049590 | Bacteria | 1711 |
| 1277 | Ga0501075_0000301 | 3300049591 | Bacteria | 27561 |
| 1278 | Ga0501075_0340812 | 3300049591 | Bacteria | 1142 |
| 1279 | Ga0501076_0000098 | 3300049592 | Bacteria | 47158 |
| 1280 | Ga0501076_0009249 | 3300049592 | Bacteria | 7269 |
| 1281 | Ga0501076_0143264 | 3300049592 | Bacteria | 1942 |
| 1282 | Ga0501076_0201726 | 3300049592 | Bacteria | 1624 |
| 1283 | Ga0501077_0000288 | 3300049593 | Bacteria | 29818 |
| 1284 | Ga0501077_0004557 | 3300049593 | Bacteria | 8426 |
| 1285 | Ga0501198_000136 | 3300049649 | Bacteria | 10576 |
| 1286 | Ga0501222_000203 | 3300049662 | Bacteria | 10602 |
| 1287 | Ga0501079_0000932 | 3300049741 | Bacteria | 20112 |
| 1288 | Ga0501079_0003630 | 3300049741 | Bacteria | 11360 |
| 1289 | Ga0501079_0022877 | 3300049741 | Bacteria | 4798 |
| 1290 | Ga0501079_0038501 | 3300049741 | Bacteria | 3687 |
| 1291 | Ga0501079_0245411 | 3300049741 | Bacteria | 1399 |
| 1292 | Ga0501079_0293452 | 3300049741 | Bacteria | 1272 |
| 1293 | Ga0501080_0001504 | 3300049742 | Bacteria | 19672 |
| 1294 | Ga0501080_0002429 | 3300049742 | Bacteria | 16271 |
| 1295 | Ga0501080_0003832 | 3300049742 | Bacteria | 13282 |
| 1296 | Ga0501080_0006561 | 3300049742 | Bacteria | 10458 |
| 1297 | Ga0501080_0056729 | 3300049742 | Bacteria | 3646 |
| 1298 | Ga0501081_0007365 | 3300049743 | Bacteria | 7144 |
| 1299 | Ga0501081_0129722 | 3300049743 | Bacteria | 1801 |
| 1300 | Ga0501083_0002934 | 3300049744 | Bacteria | 11806 |
| 1301 | Ga0501083_0005053 | 3300049744 | Bacteria | 9346 |
| 1302 | Ga0501083_0195215 | 3300049744 | Bacteria | 1321 |
| 1303 | Ga0501035_0056514 | 3300049822 | Bacteria | 3501 |
| 1304 | Ga0501035_0069902 | 3300049822 | Bacteria | 3111 |
| 1305 | Ga0501035_0108421 | 3300049822 | Bacteria | 2435 |
| 1306 | Ga0501044_0011796 | 3300049823 | Bacteria | 9467 |
| 1307 | Ga0501044_0049492 | 3300049823 | Bacteria | 4338 |
| 1308 | Ga0501044_0083540 | 3300049823 | Bacteria | 3229 |
| 1309 | Ga0501044_0384198 | 3300049823 | Bacteria | 1319 |
| 1310 | Ga0501045_0005445 | 3300049824 | Bacteria | 8811 |
| 1311 | nmdc:mga06z11_10234_c1 | 3300050494 | Bacteria | 3984 |
| 1312 | nmdc:mga07m45_17021_c1 | 3300050496 | Bacteria | 3898 |
| 1313 | nmdc:mga07m45_1741_c1 | 3300050496 | Bacteria | 10017 |
| 1314 | nmdc:mga05p37_137_c1 | 3300050507 | Bacteria | 67873 |
| 1315 | nmdc:mga05p37_243420_c1 | 3300050507 | Bacteria | 2161 |
| 1316 | nmdc:mga05p37_67_c1 | 3300050507 | Bacteria | 91619 |
| 1317 | nmdc:mga05p37_8988_c1 | 3300050507 | Bacteria | 11817 |
| 1318 | nmdc:mga09592_1642_c1 | 3300050508 | Bacteria | 18009 |
| 1319 | nmdc:mga09592_255336_c1 | 3300050508 | Bacteria | 1519 |
| 1320 | nmdc:mga09592_258_c1 | 3300050508 | Bacteria | 38667 |
| 1321 | nmdc:mga09592_45_c1 | 3300050508 | Bacteria | 69144 |
| 1322 | nmdc:mga09592_5545_c1 | 3300050508 | Bacteria | 10272 |
| 1323 | nmdc:mga09592_69998_c1 | 3300050508 | Bacteria | 2976 |
| 1324 | nmdc:mga09592_986_c2 | 3300050508 | Bacteria | 22169 |
| 1325 | nmdc:mga0qj67_13357_c1 | 3300050509 | Bacteria | 6197 |
| 1326 | nmdc:mga0qj67_47189_c1 | 3300050509 | Bacteria | 3402 |
| 1327 | nmdc:mga0qj67_7447_c1 | 3300050509 | Bacteria | 8085 |
| 1328 | nmdc:mga06r32_115_c1 | 3300050510 | Bacteria | 57898 |
| 1329 | nmdc:mga06r32_19264_c1 | 3300050510 | Bacteria | 6262 |
| 1330 | nmdc:mga06r32_379684_c1 | 3300050510 | Bacteria | 1396 |
| 1331 | nmdc:mga06r32_9078_c1 | 3300050510 | Bacteria | 8962 |
| 1332 | nmdc:mga06r32_95468_c1 | 3300050510 | Bacteria | 2910 |
| 1333 | nmdc:mga06r32_9718_c1 | 3300050510 | Bacteria | 8689 |
| 1334 | nmdc:mga08y16_1100_c1 | 3300050511 | Bacteria | 26629 |
| 1335 | nmdc:mga08y16_125548_c1 | 3300050511 | Bacteria | 2670 |
| 1336 | nmdc:mga08y16_266_c1 | 3300050511 | Bacteria | 47344 |
| 1337 | nmdc:mga08y16_335512_c1 | 3300050511 | Bacteria | 1555 |
| 1338 | nmdc:mga08y16_34996_c1 | 3300050511 | Bacteria | 5277 |
| 1339 | nmdc:mga08y16_3923_c1 | 3300050511 | Bacteria | 15488 |
| 1340 | nmdc:mga08y16_84619_c1 | 3300050511 | Bacteria | 3306 |
| 1341 | nmdc:mga08y16_99374_c1 | 3300050511 | Bacteria | 3030 |
| 1342 | nmdc:mga0n895_456072_c1 | 3300050512 | Bacteria | 1290 |
| 1343 | nmdc:mga0rr50_12678_c1 | 3300050513 | Bacteria | 5459 |
| 1344 | nmdc:mga0rr50_480_c1 | 3300050513 | Bacteria | 21155 |
| 1345 | nmdc:mga0rr50_69392_c1 | 3300050513 | Bacteria | 2682 |
| 1346 | nmdc:mga0a205_402_c1 | 3300050515 | Bacteria | 33084 |
| 1347 | Ga0495601_0040475 | 3300053077 | Bacteria | 2918 |
| 1348 | Ga0495612_0013915 | 3300053078 | Bacteria | 3242 |
| 1349 | Ga0500610_0000061 | 3300053079 | Bacteria | 34215 |
| 1350 | Ga0495595_0007920 | 3300053084 | Bacteria | 4350 |
| 1351 | Ga0495619_0077481 | 3300053085 | Bacteria | 2233 |
| 1352 | Ga0495619_0158501 | 3300053085 | Bacteria | 1562 |
| 1353 | Ga0500643_003261 | 3300053087 | Bacteria | 7902 |
| 1354 | Ga0500583_0029107 | 3300053092 | Bacteria | 2404 |
| 1355 | Ga0500583_0133237 | 3300053092 | Bacteria | 1233 |
| 1356 | Ga0500583_0154631 | 3300053092 | Bacteria | 1142 |
| 1357 | Ga0500608_000226 | 3300053122 | Bacteria | 22247 |
| 1358 | Ga0500561_0009144 | 3300053137 | Bacteria | 2001 |
| 1359 | Ga0500574_035921 | 3300053141 | Bacteria | 1359 |
| 1360 | Ga0501084_0023456 | 3300054114 | Bacteria | 5148 |
| 1361 | Ga0590071_001242 | 3300059421 | Bacteria | 6886 |
| 1362 | Ga0501082_0001136 | 3300060353 | Bacteria | 23513 |
| 1363 | Ga0501082_0008333 | 3300060353 | Bacteria | 8942 |
| 1364 | Ga0501082_0033418 | 3300060353 | Bacteria | 4438 |
| 1365 | Ga0501082_0117225 | 3300060353 | Bacteria | 2307 |
| 1366 | Ga0530510_0013711 | 3300061734 | Bacteria | 5705 |
| 1367 | Ga0530510_0154518 | 3300061734 | Bacteria | 1695 |
| 1368 | 2501071946 | 2501025501 | Bacteria | 7768574 |
| 1369 | 2501411818 | 2501025504 | Bacteria | 8008976 |
| 1370 | 2511100818 | 2510917014 | Bacteria | 8296963 |
| 1371 | 2511107472 | 2510917015 | Bacteria | 7950052 |
| 1372 | 2512350029 | 2512047030 | Bacteria | 9031815 |
| 1373 | 2513552531 | 2513237082 | Bacteria | 8640282 |
| 1374 | 2513560733 | 2513237083 | Bacteria | 8410967 |
| 1375 | 2514047656 | 2513237166 | Bacteria | 10373764 |
| 1376 | 2515682017 | 2515154122 | Bacteria | 8609520 |
| 1377 | 2516017169 | 2515154189 | Bacteria | 9629850 |
| 1378 | 2563056892 | 2562617112 | Bacteria | 10918404 |
| 1379 | 2563064566 | 2562617112 | Bacteria | 10918404 |
| 1380 | 2599744999 | 2599185240 | Bacteria | 7968121 |
| 1381 | 2600206820 | 2599185355 | Bacteria | 7968906 |
| 1382 | 2600811090 | 2600255067 | Bacteria | 6795583 |
| 1383 | 2676743273 | 2675903129 | Bacteria | 7964495 |
| 1384 | 2713472871 | 2711768613 | Bacteria | 11048459 |
| 1385 | 2713481087 | 2711768613 | Bacteria | 11048459 |
| 1386 | 2723878249 | 2721755763 | Bacteria | 4464185 |
| 1387 | 2792837089 | 2791355137 | Bacteria | 9654227 |
| 1388 | 2819620063 | 2818991450 | Bacteria | 6962147 |
| 1389 | 2870076548 | 2870068957 | Bacteria | 8925310 |
| 1390 | 2885279927 | 2885270888 | Bacteria | 9831543 |
| 1391 | 2891636331 | 2891633521 | Bacteria | 4602265 |
| 1392 | 2902685429 | 2902682994 | Bacteria | 8951596 |
| 1393 | 2904620163 | 2904615490 | Bacteria | 10047340 |
| 1394 | 2928110379 | 2928108538 | Bacteria | 7360024 |
| 1395 | 2928138487 | 2928135762 | Bacteria | 7259641 |
| 1396 | 2928505451 | 2928503688 | Bacteria | 7268108 |
| 1397 | 2990710481 | 2990703756 | Bacteria | 7715990 |
| 1398 | 642597772 | 642555112 | Bacteria | 8676562 |
| 1399 | 8003958309 | 8003955200 | Bacteria | 8601927 |
| 1400 | 8020948220 | 8020945358 | Bacteria | 8467355 |
| 1401 | Ga0495676_0192725 | |||
| 1402 | SwRhRL2b_contig_365350 | |||
| 1403 | rootH1_10121089 | |||
| 1404 | Ga0055532_1000124 | |||
| 1405 | Ga0055527_1000036 | |||
| 1406 | Ga0055535_1000051 | |||
| 1407 | Ga0055542_1001307 | |||
| 1408 | Ga0065712_10068735 | |||
| 1409 | Ga0065715_10105432 | |||
| 1410 | Ga0065715_10132801 | |||
| 1411 | Ga0065707_10000604 | |||
| 1412 | Ga0065707_10031187 | |||
| 1413 | Ga0070676_10003719 | |||
| 1414 | Ga0070683_100002653 | |||
| 1415 | Ga0070683_100022207 | |||
| 1416 | Ga0070690_100000816 | |||
| 1417 | Ga0070690_100021782 | |||
| 1418 | Ga0070690_100061311 | |||
| 1419 | Ga0070670_100000816 | |||
| 1420 | Ga0070670_100014443 | |||
| 1421 | Ga0070670_100197121 | |||
| 1422 | Ga0070670_100459774 | |||
| 1423 | Ga0068869_100002189 | |||
| 1424 | Ga0068869_100003615 | |||
| 1425 | Ga0068869_100033933 | |||
| 1426 | Ga0068869_100038674 | |||
| 1427 | Ga0068869_100099763 | |||
| 1428 | Ga0070666_10009338 | |||
| 1429 | Ga0070666_10016993 | |||
| 1430 | Ga0070666_10084623 | |||
| 1431 | Ga0070680_100017814 | |||
| 1432 | Ga0070680_100055669 | |||
| 1433 | Ga0070680_100100311 | |||
| 1434 | Ga0070680_100109741 | |||
| 1435 | Ga0068868_100039606 | |||
| 1436 | Ga0068868_100060597 | |||
| 1437 | Ga0068868_100074960 | |||
| 1438 | Ga0068868_100152495 | |||
| 1439 | Ga0068868_100407253 | |||
| 1440 | Ga0070660_100001108 | |||
| 1441 | Ga0070660_100001577 | |||
| 1442 | Ga0070660_100060216 | |||
| 1443 | Ga0070660_100100178 | |||
| 1444 | Ga0070689_100000421 | |||
| 1445 | Ga0070689_100036291 | |||
| 1446 | Ga0070691_10003356 | |||
| 1447 | Ga0070661_100003820 | |||
| 1448 | Ga0070661_100020427 | |||
| 1449 | Ga0070692_10004660 | |||
| 1450 | Ga0070692_10082482 | |||
| 1451 | Ga0070668_100029002 | |||
| 1452 | Ga0070668_100047902 | |||
| 1453 | Ga0070668_100211110 | |||
| 1454 | Ga0070668_100222445 | |||
| 1455 | Ga0070668_100236171 | |||
| 1456 | Ga0070669_100012004 | |||
| 1457 | Ga0070669_100024084 | |||
| 1458 | Ga0070669_100174270 | |||
| 1459 | Ga0070675_100005747 | |||
| 1460 | Ga0070675_100006854 | |||
| 1461 | Ga0070675_100008107 | |||
| 1462 | Ga0070675_100010573 | |||
| 1463 | Ga0070675_100016164 | |||
| 1464 | Ga0070675_100018178 | |||
| 1465 | Ga0070675_100052643 | |||
| 1466 | Ga0070675_100058700 | |||
| 1467 | Ga0070675_100064971 | |||
| 1468 | Ga0070675_100344544 | |||
| 1469 | Ga0070671_100005851 | |||
| 1470 | Ga0070671_100011916 | |||
| 1471 | Ga0070671_100017868 | |||
| 1472 | Ga0070671_100086400 | |||
| 1473 | Ga0070671_100098886 | |||
| 1474 | Ga0070671_100243200 | |||
| 1475 | Ga0070674_100021247 | |||
| 1476 | Ga0070674_100034273 | |||
| 1477 | Ga0070673_100024097 | |||
| 1478 | Ga0070673_100041108 | |||
| 1479 | Ga0070673_100126436 | |||
| 1480 | Ga0070673_100131669 | |||
| 1481 | Ga0070673_100463365 | |||
| 1482 | Ga0070688_100044248 | |||
| 1483 | Ga0070688_100047397 | |||
| 1484 | Ga0070688_100175327 | |||
| 1485 | Ga0070659_100000861 | |||
| 1486 | Ga0070659_100010215 | |||
| 1487 | Ga0070659_100295102 | |||
| 1488 | Ga0070667_100023426 | |||
| 1489 | Ga0070667_100045092 | |||
| 1490 | Ga0070667_100056206 | |||
| 1491 | Ga0070667_100076171 | |||
| 1492 | Ga0070667_100087394 | |||
| 1493 | Ga0070667_100096442 | |||
| 1494 | Ga0070667_100197073 | |||
| 1495 | Ga0070667_100264767 | |||
| 1496 | Ga0070667_100295829 | |||
| 1497 | Ga0070709_10017823 | |||
| 1498 | Ga0070714_100001074 | |||
| 1499 | Ga0070714_100315095 | |||
| 1500 | Ga0070713_100005981 | |||
| 1501 | Ga0070713_100036255 | |||
| 1502 | Ga0070713_100051781 | |||
| 1503 | Ga0070713_100094648 | |||
| 1504 | Ga0070701_10002293 | |||
| 1505 | Ga0070701_10013320 | |||
| 1506 | Ga0070711_100092007 | |||
| 1507 | Ga0070711_100161734 | |||
| 1508 | Ga0070711_100189663 | |||
| 1509 | Ga0070705_100004895 | |||
| 1510 | Ga0070705_100311620 | |||
| 1511 | Ga0070700_100012304 | |||
| 1512 | Ga0070700_100107828 | |||
| 1513 | Ga0070694_100016655 | |||
| 1514 | Ga0070694_100050085 | |||
| 1515 | Ga0070694_100060441 | |||
| 1516 | Ga0070694_100275684 | |||
| 1517 | Ga0070663_100008570 | |||
| 1518 | Ga0070663_100058784 | |||
| 1519 | Ga0070663_100160837 | |||
| 1520 | Ga0070678_100023134 | |||
| 1521 | Ga0070678_100044645 | |||
| 1522 | Ga0070678_100055959 | |||
| 1523 | Ga0070678_100060738 | |||
| 1524 | Ga0070678_100064112 | |||
| 1525 | Ga0070678_100190535 | |||
| 1526 | Ga0070678_100227654 | |||
| 1527 | Ga0070662_100021621 | |||
| 1528 | Ga0070662_100044112 | |||
| 1529 | Ga0070662_100078058 | |||
| 1530 | Ga0070681_10002158 | |||
| 1531 | Ga0070681_10011416 | |||
| 1532 | Ga0070681_10011526 | |||
| 1533 | Ga0070681_10033595 | |||
| 1534 | Ga0070681_10034179 | |||
| 1535 | Ga0070681_10099027 | |||
| 1536 | Ga0070681_10296179 | |||
| 1537 | Ga0068867_100000215 | |||
| 1538 | Ga0068867_100022935 | |||
| 1539 | Ga0068867_100079461 | |||
| 1540 | Ga0068867_100086134 | |||
| 1541 | Ga0068867_100087576 | |||
| 1542 | Ga0068867_100112807 | |||
| 1543 | Ga0068867_100221042 | |||
| 1544 | Ga0070706_100038140 | |||
| 1545 | Ga0070706_100314176 | |||
| 1546 | Ga0070706_100565921 | |||
| 1547 | Ga0070707_100049906 | |||
| 1548 | Ga0070698_100237648 | |||
| 1549 | Ga0070699_100050857 | |||
| 1550 | Ga0070679_100002776 | |||
| 1551 | Ga0070679_100007196 | |||
| 1552 | Ga0070679_100015155 | |||
| 1553 | Ga0070679_100139486 | |||
| 1554 | Ga0070679_100149467 | |||
| 1555 | Ga0070679_100220462 | |||
| 1556 | Ga0070684_100005851 | |||
| 1557 | Ga0070684_100008616 | |||
| 1558 | Ga0070684_100211630 | |||
| 1559 | Ga0070684_100215985 | |||
| 1560 | Ga0070697_100005759 | |||
| 1561 | Ga0068853_100053724 | |||
| 1562 | Ga0068853_100055724 | |||
| 1563 | Ga0068853_100381500 | |||
| 1564 | Ga0070672_100001840 | |||
| 1565 | Ga0070672_100009845 | |||
| 1566 | Ga0070672_100293733 | |||
| 1567 | Ga0070686_100001871 | |||
| 1568 | Ga0070686_100016846 | |||
| 1569 | Ga0070686_100024627 | |||
| 1570 | Ga0070686_100032829 | |||
| 1571 | Ga0070686_100035160 | |||
| 1572 | Ga0070686_100076479 | |||
| 1573 | Ga0070695_100039787 | |||
| 1574 | Ga0070695_100045814 | |||
| 1575 | Ga0070696_100005913 | |||
| 1576 | Ga0070696_100065844 | |||
| 1577 | Ga0070696_100153349 | |||
| 1578 | Ga0070696_100289022 | |||
| 1579 | Ga0070693_100005012 | |||
| 1580 | Ga0070693_100023239 | |||
| 1581 | Ga0070693_100137123 | |||
| 1582 | Ga0070665_100001969 | |||
| 1583 | Ga0070665_100080440 | |||
| 1584 | Ga0070665_100105665 | |||
| 1585 | Ga0070665_100312351 | |||
| 1586 | Ga0070704_100001594 | |||
| 1587 | Ga0070704_100012426 | |||
| 1588 | Ga0070704_100091932 | |||
| 1589 | Ga0068855_100001682 | |||
| 1590 | Ga0068855_100002002 | |||
| 1591 | Ga0068855_100002194 | |||
| 1592 | Ga0068855_100005111 | |||
| 1593 | Ga0068855_100011151 | |||
| 1594 | Ga0068855_100017416 | |||
| 1595 | Ga0068855_100029844 | |||
| 1596 | Ga0068855_100031793 | |||
| 1597 | Ga0068855_100042963 | |||
| 1598 | Ga0068855_100130792 | |||
| 1599 | Ga0070664_100000772 | |||
| 1600 | Ga0070664_100009626 | |||
| 1601 | Ga0070664_100440825 | |||
| 1602 | Ga0068857_100012680 | |||
| 1603 | Ga0068857_100048483 | |||
| 1604 | Ga0068857_100160671 | |||
| 1605 | Ga0068854_100029947 | |||
| 1606 | Ga0068854_100091242 | |||
| 1607 | Ga0068854_100153445 | |||
| 1608 | Ga0068856_100035659 | |||
| 1609 | Ga0068856_100049397 | |||
| 1610 | Ga0068856_100097139 | |||
| 1611 | Ga0068856_100159467 | |||
| 1612 | Ga0070702_100000854 | |||
| 1613 | Ga0070702_100000889 | |||
| 1614 | Ga0070702_100007766 | |||
| 1615 | Ga0070702_100065768 | |||
| 1616 | Ga0070702_100124671 | |||
| 1617 | Ga0068852_100000419 | |||
| 1618 | Ga0068852_100000944 | |||
| 1619 | Ga0068852_100001924 | |||
| 1620 | Ga0068852_100006532 | |||
| 1621 | Ga0068852_100009876 | |||
| 1622 | Ga0068852_100097479 | |||
| 1623 | Ga0068852_100149609 | |||
| 1624 | Ga0068852_100383701 | |||
| 1625 | Ga0068859_100000253 | |||
| 1626 | Ga0068859_100006199 | |||
| 1627 | Ga0068859_100015782 | |||
| 1628 | Ga0068859_100018481 | |||
| 1629 | Ga0068859_100079124 | |||
| 1630 | Ga0068859_100094533 | |||
| 1631 | Ga0068859_100122677 | |||
| 1632 | Ga0068859_100457923 | |||
| 1633 | Ga0068864_100001205 | |||
| 1634 | Ga0068864_100005181 | |||
| 1635 | Ga0068864_100008410 | |||
| 1636 | Ga0068864_100015984 | |||
| 1637 | Ga0068864_100104699 | |||
| 1638 | Ga0068864_100174533 | |||
| 1639 | Ga0068864_100179216 | |||
| 1640 | Ga0068864_100266579 | |||
| 1641 | Ga0068866_10002860 | |||
| 1642 | Ga0068866_10203602 | |||
| 1643 | Ga0068861_100001372 | |||
| 1644 | Ga0068861_100003053 | |||
| 1645 | Ga0068861_100008134 | |||
| 1646 | Ga0068861_100076244 | |||
| 1647 | Ga0068861_100287251 | |||
| 1648 | Ga0068851_10006725 | |||
| 1649 | Ga0068851_10007729 | |||
| 1650 | Ga0068851_10015524 | |||
| 1651 | Ga0068851_10031134 | |||
| 1652 | Ga0068851_10033402 | |||
| 1653 | Ga0068851_10085565 | |||
| 1654 | Ga0068870_10001202 | |||
| 1655 | Ga0068863_100001784 | |||
| 1656 | Ga0068863_100003276 | |||
| 1657 | Ga0068863_100015332 | |||
| 1658 | Ga0068863_100018873 | |||
| 1659 | Ga0068863_100053000 | |||
| 1660 | Ga0068863_100084247 | |||
| 1661 | Ga0068863_100149508 | |||
| 1662 | Ga0068863_100157041 | |||
| 1663 | Ga0068863_100189995 | |||
| 1664 | Ga0068863_100312905 | |||
| 1665 | Ga0068863_100496504 | |||
| 1666 | Ga0068858_100000503 | |||
| 1667 | Ga0068858_100001910 | |||
| 1668 | Ga0068858_100005731 | |||
| 1669 | Ga0068858_100014286 | |||
| 1670 | Ga0068858_100021279 | |||
| 1671 | Ga0068858_100084265 | |||
| 1672 | Ga0068858_100106996 | |||
| 1673 | Ga0068858_100198229 | |||
| 1674 | Ga0068858_100229330 | |||
| 1675 | Ga0068860_100001280 | |||
| 1676 | Ga0068860_100001625 | |||
| 1677 | Ga0068860_100009569 | |||
| 1678 | Ga0068860_100022290 | |||
| 1679 | Ga0068860_100068118 | |||
| 1680 | Ga0068860_100081692 | |||
| 1681 | Ga0068860_100259740 | |||
| 1682 | Ga0068860_100479549 | |||
| 1683 | Ga0068862_100014488 | |||
| 1684 | Ga0068862_100030640 | |||
| 1685 | Ga0068862_100071572 | |||
| 1686 | Ga0070717_10009990 | |||
| 1687 | Ga0070717_10168299 | |||
| 1688 | Ga0070717_10329322 | |||
| 1689 | Ga0070716_100026160 | |||
| 1690 | Ga0070716_100111887 | |||
| 1691 | Ga0075366_10145367 | |||
| 1692 | Ga0097621_100005458 | |||
| 1693 | Ga0097621_100010078 | |||
| 1694 | Ga0097621_100015961 | |||
| 1695 | Ga0097621_100031728 | |||
| 1696 | Ga0097621_100031848 | |||
| 1697 | Ga0097621_100130031 | |||
| 1698 | Ga0097621_100413816 | |||
| 1699 | Ga0075370_10008340 | |||
| 1700 | Ga0075370_10010453 | |||
| 1701 | Ga0068871_100006085 | |||
| 1702 | Ga0068871_100015806 | |||
| 1703 | Ga0068871_100023694 | |||
| 1704 | Ga0068871_100028456 | |||
| 1705 | Ga0068871_100116227 | |||
| 1706 | Ga0068871_100158493 | |||
| 1707 | Ga0068871_100256170 | |||
| 1708 | Ga0068871_100314858 | |||
| 1709 | Ga0075428_100001989 | |||
| 1710 | Ga0075428_100025341 | |||
| 1711 | Ga0075428_100093431 | |||
| 1712 | Ga0075430_100013481 | |||
| 1713 | Ga0075430_100049533 | |||
| 1714 | Ga0075430_100057765 | |||
| 1715 | Ga0075430_100191234 | |||
| 1716 | Ga0075431_100000077 | |||
| 1717 | Ga0075431_100010025 | |||
| 1718 | Ga0075431_100010660 | |||
| 1719 | Ga0075431_100013529 | |||
| 1720 | Ga0075431_100097175 | |||
| 1721 | Ga0075431_100291621 | |||
| 1722 | Ga0075433_10013143 | |||
| 1723 | Ga0075434_100000204 | |||
| 1724 | Ga0075429_100000019 | |||
| 1725 | Ga0075429_100000208 | |||
| 1726 | Ga0075429_100002310 | |||
| 1727 | Ga0075429_100013327 | |||
| 1728 | Ga0075429_100024433 | |||
| 1729 | Ga0075429_100100487 | |||
| 1730 | Ga0068865_100001062 | |||
| 1731 | Ga0068865_100024371 | |||
| 1732 | Ga0068865_100052323 | |||
| 1733 | Ga0068865_100209211 | |||
| 1734 | Ga0097620_100000253 | |||
| 1735 | Ga0097620_100006199 | |||
| 1736 | Ga0097620_100015395 | |||
| 1737 | Ga0097620_100015782 | |||
| 1738 | Ga0097620_100018481 | |||
| 1739 | Ga0097620_100079120 | |||
| 1740 | Ga0097620_100094531 | |||
| 1741 | Ga0097620_100122665 | |||
| 1742 | Ga0097620_100457944 | |||
| 1743 | Ga0075435_100003374 | |||
| 1744 | Ga0075435_100005884 | |||
| 1745 | Ga0075435_100130109 | |||
| 1746 | Ga0099794_10002384 | |||
| 1747 | Ga0099794_10015352 | |||
| 1748 | Ga0099794_10016356 | |||
| 1749 | Ga0099795_10000234 | |||
| 1750 | Ga0105251_10000043 | |||
| 1751 | Ga0105240_10000760 | |||
| 1752 | Ga0105240_10001599 | |||
| 1753 | Ga0105240_10002211 | |||
| 1754 | Ga0105240_10002714 | |||
| 1755 | Ga0105240_10004577 | |||
| 1756 | Ga0105240_10006209 | |||
| 1757 | Ga0105240_10006435 | |||
| 1758 | Ga0105240_10006620 | |||
| 1759 | Ga0105240_10016618 | |||
| 1760 | Ga0105240_10018889 | |||
| 1761 | Ga0105240_10043447 | |||
| 1762 | Ga0105240_10047021 | |||
| 1763 | Ga0105240_10064068 | |||
| 1764 | Ga0105240_10092430 | |||
| 1765 | Ga0105240_10202073 | |||
| 1766 | Ga0105240_10263648 | |||
| 1767 | Ga0111539_10000277 | |||
| 1768 | Ga0111539_10000660 | |||
| 1769 | Ga0111539_10023238 | |||
| 1770 | Ga0111539_10033962 | |||
| 1771 | Ga0111539_10090554 | |||
| 1772 | Ga0111539_10121571 | |||
| 1773 | Ga0105245_10005588 | |||
| 1774 | Ga0105245_10010063 | |||
| 1775 | Ga0105245_10024118 | |||
| 1776 | Ga0105245_10146415 | |||
| 1777 | Ga0105247_10001306 | |||
| 1778 | Ga0105247_10015443 | |||
| 1779 | Ga0114129_10000140 | |||
| 1780 | Ga0114129_10007801 | |||
| 1781 | Ga0114129_10011889 | |||
| 1782 | Ga0105243_10001776 | |||
| 1783 | Ga0105243_10026919 | |||
| 1784 | Ga0105243_10055619 | |||
| 1785 | Ga0105243_10395106 | |||
| 1786 | Ga0105241_10045630 | |||
| 1787 | Ga0105241_10150552 | |||
| 1788 | Ga0105242_10003224 | |||
| 1789 | Ga0105242_10225280 | |||
| 1790 | Ga0105248_10008298 | |||
| 1791 | Ga0105248_10062484 | |||
| 1792 | Ga0105248_10072048 | |||
| 1793 | Ga0105248_10091826 | |||
| 1794 | Ga0105248_10193964 | |||
| 1795 | Ga0105248_10290856 | |||
| 1796 | Ga0105248_10312241 | |||
| 1797 | Ga0105237_10020287 | |||
| 1798 | Ga0105237_10111692 | |||
| 1799 | Ga0105237_10122798 | |||
| 1800 | Ga0105237_10138435 | |||
| 1801 | Ga0105237_10251341 | |||
| 1802 | Ga0105237_10301147 | |||
| 1803 | Ga0105237_10436254 | |||
| 1804 | Ga0105237_10476510 | |||
| 1805 | Ga0105238_10001924 | |||
| 1806 | Ga0105238_10002536 | |||
| 1807 | Ga0105238_10014052 | |||
| 1808 | Ga0105238_10019205 | |||
| 1809 | Ga0105238_10029625 | |||
| 1810 | Ga0105238_10208949 | |||
| 1811 | Ga0105238_10406647 | |||
| 1812 | Ga0105249_10027048 | |||
| 1813 | Ga0105249_10218934 | |||
| 1814 | Ga0099796_10000467 | |||
| 1815 | Ga0105239_10020458 | |||
| 1816 | Ga0105239_10161706 | |||
| 1817 | Ga0105239_10283679 | |||
| 1818 | Ga0105239_10313309 | |||
| 1819 | Ga0105246_10062603 | |||
| 1820 | Ga0105246_10079015 | |||
| 1821 | Ga0105246_10205733 | |||
| 1822 | Ga0105246_10326172 | |||
| 1823 | Ga0157373_10020648 | |||
| 1824 | Ga0157370_10000890 | |||
| 1825 | Ga0157370_10003740 | |||
| 1826 | Ga0157370_10006678 | |||
| 1827 | Ga0157370_10071356 | |||
| 1828 | Ga0157370_10110858 | |||
| 1829 | Ga0157369_10001971 | |||
| 1830 | Ga0157369_10007730 | |||
| 1831 | Ga0157369_10015794 | |||
| 1832 | Ga0157369_10028361 | |||
| 1833 | Ga0157369_10040421 | |||
| 1834 | Ga0157369_10102907 | |||
| 1835 | Ga0157369_10128738 | |||
| 1836 | Ga0157369_10215306 | |||
| 1837 | Ga0157374_10018746 | |||
| 1838 | Ga0157374_10332316 | |||
| 1839 | Ga0157374_10420632 | |||
| 1840 | Ga0157378_10008705 | |||
| 1841 | Ga0157378_10026047 | |||
| 1842 | Ga0157378_10124138 | |||
| 1843 | Ga0157378_10367157 | |||
| 1844 | Ga0157378_10472672 | |||
| 1845 | Ga0163162_10000655 | |||
| 1846 | Ga0163162_10008965 | |||
| 1847 | Ga0163162_10127222 | |||
| 1848 | Ga0163162_10259799 | |||
| 1849 | Ga0157372_10002980 | |||
| 1850 | Ga0157372_10025602 | |||
| 1851 | Ga0157372_10057816 | |||
| 1852 | Ga0157372_10058620 | |||
| 1853 | Ga0157372_10093826 | |||
| 1854 | Ga0157372_10176679 | |||
| 1855 | Ga0157372_10227793 | |||
| 1856 | Ga0157375_10005328 | |||
| 1857 | Ga0157375_10009938 | |||
| 1858 | Ga0157375_10079484 | |||
| 1859 | Ga0157375_10095255 | |||
| 1860 | Ga0157375_10148680 | |||
| 1861 | Ga0157375_10261261 | |||
| 1862 | Ga0157375_10709780 | |||
| 1863 | Ga0163163_10001355 | |||
| 1864 | Ga0163163_10002424 | |||
| 1865 | Ga0163163_10073516 | |||
| 1866 | Ga0163163_10287139 | |||
| 1867 | Ga0157380_10012492 | |||
| 1868 | Ga0157380_10032710 | |||
| 1869 | Ga0157380_10121508 | |||
| 1870 | Ga0157380_10354750 | |||
| 1871 | Ga0157379_10002507 | |||
| 1872 | Ga0157379_10013568 | |||
| 1873 | Ga0157379_10027320 | |||
| 1874 | Ga0157379_10036848 | |||
| 1875 | Ga0157379_10043368 | |||
| 1876 | Ga0157379_10164225 | |||
| 1877 | Ga0157379_10211862 | |||
| 1878 | Ga0157379_10353418 | |||
| 1879 | Ga0157376_10008831 | |||
| 1880 | Ga0157376_10284486 | |||
| 1881 | Ga0157376_10345329 | |||
| 1882 | Ga0182006_1004726 | |||
| 1883 | Ga0182006_1015446 | |||
| 1884 | Ga0182007_10000245 | |||
| 1885 | Ga0183362_10003 | |||
| 1886 | Ga0163161_10013868 | |||
| 1887 | Ga0163161_10040313 | |||
| 1888 | Ga0163161_10062884 | |||
| 1889 | Ga0213872_10000419 | |||
| 1890 | Ga0213872_10054286 | |||
| 1891 | Ga0213872_10092211 | |||
| 1892 | Ga0209672_100026 | |||
| 1893 | Ga0209147_100033 | |||
| 1894 | Ga0209258_100051 | |||
| 1895 | Ga0209026_1000952 | |||
| 1896 | Ga0209148_1000328 | |||
| 1897 | Ga0209759_1000773 | |||
| 1898 | Ga0207666_1004688 | |||
| 1899 | Ga0209455_1000252 | |||
| 1900 | Ga0209025_1000115 | |||
| 1901 | Ga0209564_1005666 | |||
| 1902 | Ga0209051_1046486 | |||
| 1903 | Ga0207656_10006944 | |||
| 1904 | Ga0207656_10011244 | |||
| 1905 | Ga0207656_10035556 | |||
| 1906 | Ga0207656_10152649 | |||
| 1907 | Ga0207713_1000240 | |||
| 1908 | Ga0207682_10023878 | |||
| 1909 | Ga0207642_10009459 | |||
| 1910 | Ga0207642_10067592 | |||
| 1911 | Ga0207710_10000538 | |||
| 1912 | Ga0207710_10011325 | |||
| 1913 | Ga0207688_10019841 | |||
| 1914 | Ga0207680_10006697 | |||
| 1915 | Ga0207680_10276697 | |||
| 1916 | Ga0207647_10001239 | |||
| 1917 | Ga0207647_10061551 | |||
| 1918 | Ga0207645_10099625 | |||
| 1919 | Ga0207645_10139566 | |||
| 1920 | Ga0207643_10004764 | |||
| 1921 | Ga0207643_10005459 | |||
| 1922 | Ga0207643_10040443 | |||
| 1923 | Ga0207643_10127821 | |||
| 1924 | Ga0207705_10150791 | |||
| 1925 | Ga0207705_10261473 | |||
| 1926 | Ga0207684_10042338 | |||
| 1927 | Ga0207684_10289787 | |||
| 1928 | Ga0207654_10027099 | |||
| 1929 | Ga0207707_10000999 | |||
| 1930 | Ga0207707_10003421 | |||
| 1931 | Ga0207707_10007561 | |||
| 1932 | Ga0207707_10009440 | |||
| 1933 | Ga0207707_10067077 | |||
| 1934 | Ga0207707_10081933 | |||
| 1935 | Ga0207707_10283545 | |||
| 1936 | Ga0207707_10289262 | |||
| 1937 | Ga0207695_10000372 | |||
| 1938 | Ga0207695_10002611 | |||
| 1939 | Ga0207695_10004603 | |||
| 1940 | Ga0207695_10011587 | |||
| 1941 | Ga0207695_10023693 | |||
| 1942 | Ga0207695_10032813 | |||
| 1943 | Ga0207695_10034143 | |||
| 1944 | Ga0207695_10035292 | |||
| 1945 | Ga0207695_10040875 | |||
| 1946 | Ga0207695_10305546 | |||
| 1947 | Ga0207695_10412159 | |||
| 1948 | Ga0207671_10030597 | |||
| 1949 | Ga0207671_10098841 | |||
| 1950 | Ga0207671_10101676 | |||
| 1951 | Ga0207671_10275549 | |||
| 1952 | Ga0207663_10155978 | |||
| 1953 | Ga0207663_10314425 | |||
| 1954 | Ga0207660_10004733 | |||
| 1955 | Ga0207660_10012148 | |||
| 1956 | Ga0207660_10038383 | |||
| 1957 | Ga0207660_10077593 | |||
| 1958 | Ga0207660_10110635 | |||
| 1959 | Ga0207662_10003006 | |||
| 1960 | Ga0207662_10013087 | |||
| 1961 | Ga0207662_10078226 | |||
| 1962 | Ga0207662_10122087 | |||
| 1963 | Ga0207657_10001557 | |||
| 1964 | Ga0207657_10002377 | |||
| 1965 | Ga0207657_10018692 | |||
| 1966 | Ga0207657_10023713 | |||
| 1967 | Ga0207657_10055596 | |||
| 1968 | Ga0207657_10089864 | |||
| 1969 | Ga0207649_10009407 | |||
| 1970 | Ga0207652_10007161 | |||
| 1971 | Ga0207652_10074627 | |||
| 1972 | Ga0207652_10192792 | |||
| 1973 | Ga0207646_10114637 | |||
| 1974 | Ga0207681_10003209 | |||
| 1975 | Ga0207681_10004286 | |||
| 1976 | Ga0207681_10043952 | |||
| 1977 | Ga0207694_10011446 | |||
| 1978 | Ga0207694_10062995 | |||
| 1979 | Ga0207694_10066550 | |||
| 1980 | Ga0207694_10076469 | |||
| 1981 | Ga0207650_10018773 | |||
| 1982 | Ga0207650_10105835 | |||
| 1983 | Ga0207650_10227091 | |||
| 1984 | Ga0207659_10000504 | |||
| 1985 | Ga0207659_10007377 | |||
| 1986 | Ga0207659_10026286 | |||
| 1987 | Ga0207659_10092162 | |||
| 1988 | Ga0207659_10164256 | |||
| 1989 | Ga0207659_10210315 | |||
| 1990 | Ga0207659_10248509 | |||
| 1991 | Ga0207687_10002479 | |||
| 1992 | Ga0207687_10056276 | |||
| 1993 | Ga0207687_10325347 | |||
| 1994 | Ga0207700_10018771 | |||
| 1995 | Ga0207700_10282173 | |||
| 1996 | Ga0207700_10367539 | |||
| 1997 | Ga0207664_10002954 | |||
| 1998 | Ga0207664_10004364 | |||
| 1999 | Ga0207644_10014289 | |||
| 2000 | Ga0207644_10035583 | |||
| 2001 | Ga0207644_10100801 | |||
| 2002 | Ga0207644_10108322 | |||
| 2003 | Ga0207690_10014884 | |||
| 2004 | Ga0207690_10038603 | |||
| 2005 | Ga0207690_10100789 | |||
| 2006 | Ga0207706_10017228 | |||
| 2007 | Ga0207706_10064398 | |||
| 2008 | Ga0207686_10006895 | |||
| 2009 | Ga0207686_10070377 | |||
| 2010 | Ga0207709_10003263 | |||
| 2011 | Ga0207709_10007438 | |||
| 2012 | Ga0207670_10013321 | |||
| 2013 | Ga0207670_10013767 | |||
| 2014 | Ga0207670_10016809 | |||
| 2015 | Ga0207670_10024359 | |||
| 2016 | Ga0207670_10079956 | |||
| 2017 | Ga0207670_10130562 | |||
| 2018 | Ga0207670_10161187 | |||
| 2019 | Ga0207669_10002388 | |||
| 2020 | Ga0207669_10041562 | |||
| 2021 | Ga0207669_10102974 | |||
| 2022 | Ga0207704_10016656 | |||
| 2023 | Ga0207704_10114313 | |||
| 2024 | Ga0207665_10023366 | |||
| 2025 | Ga0207665_10033344 | |||
| 2026 | Ga0207665_10224313 | |||
| 2027 | Ga0207691_10006936 | |||
| 2028 | Ga0207691_10073497 | |||
| 2029 | Ga0207691_10094169 | |||
| 2030 | Ga0207691_10145270 | |||
| 2031 | Ga0207691_10201245 | |||
| 2032 | Ga0207691_10213788 | |||
| 2033 | Ga0207691_10214007 | |||
| 2034 | Ga0207691_10296756 | |||
| 2035 | Ga0207711_10037939 | |||
| 2036 | Ga0207711_10092214 | |||
| 2037 | Ga0207711_10118849 | |||
| 2038 | Ga0207711_10261779 | |||
| 2039 | Ga0207689_10001646 | |||
| 2040 | Ga0207689_10002213 | |||
| 2041 | Ga0207689_10003936 | |||
| 2042 | Ga0207689_10005924 | |||
| 2043 | Ga0207689_10011714 | |||
| 2044 | Ga0207689_10030091 | |||
| 2045 | Ga0207689_10052871 | |||
| 2046 | Ga0207689_10112441 | |||
| 2047 | Ga0207661_10079658 | |||
| 2048 | Ga0207679_10004394 | |||
| 2049 | Ga0207679_10026262 | |||
| 2050 | Ga0207679_10056694 | |||
| 2051 | Ga0207667_10001268 | |||
| 2052 | Ga0207667_10003353 | |||
| 2053 | Ga0207667_10009964 | |||
| 2054 | Ga0207667_10036735 | |||
| 2055 | Ga0207667_10067327 | |||
| 2056 | Ga0207667_10086186 | |||
| 2057 | Ga0207667_10304377 | |||
| 2058 | Ga0207651_10014883 | |||
| 2059 | Ga0207651_10026564 | |||
| 2060 | Ga0207651_10059375 | |||
| 2061 | Ga0207712_10064747 | |||
| 2062 | Ga0207712_10122786 | |||
| 2063 | Ga0207712_10124040 | |||
| 2064 | Ga0207668_10060144 | |||
| 2065 | Ga0207640_10019344 | |||
| 2066 | Ga0207658_10002948 | |||
| 2067 | Ga0207658_10027235 | |||
| 2068 | Ga0207658_10095871 | |||
| 2069 | Ga0207658_10188073 | |||
| 2070 | Ga0207658_10397135 | |||
| 2071 | Ga0207677_10004422 | |||
| 2072 | Ga0207677_10006268 | |||
| 2073 | Ga0207677_10029726 | |||
| 2074 | Ga0207677_10036882 | |||
| 2075 | Ga0207677_10236545 | |||
| 2076 | Ga0207677_10302256 | |||
| 2077 | Ga0207703_10000899 | |||
| 2078 | Ga0207703_10001339 | |||
| 2079 | Ga0207703_10003150 | |||
| 2080 | Ga0207703_10015310 | |||
| 2081 | Ga0207703_10032230 | |||
| 2082 | Ga0207703_10042866 | |||
| 2083 | Ga0207703_10053261 | |||
| 2084 | Ga0207703_10092420 | |||
| 2085 | Ga0207703_10098931 | |||
| 2086 | Ga0207703_10120544 | |||
| 2087 | Ga0207703_10181161 | |||
| 2088 | Ga0207639_10096243 | |||
| 2089 | Ga0207639_10118183 | |||
| 2090 | Ga0207639_10118266 | |||
| 2091 | Ga0207639_10483275 | |||
| 2092 | Ga0207639_10624108 | |||
| 2093 | Ga0207678_10056179 | |||
| 2094 | Ga0207678_10063172 | |||
| 2095 | Ga0207678_10097707 | |||
| 2096 | Ga0207678_10104879 | |||
| 2097 | Ga0207678_10192775 | |||
| 2098 | Ga0207708_10004385 | |||
| 2099 | Ga0207708_10007997 | |||
| 2100 | Ga0207708_10010897 | |||
| 2101 | Ga0207708_10058902 | |||
| 2102 | Ga0207708_10140355 | |||
| 2103 | Ga0207708_10255812 | |||
| 2104 | Ga0207702_10001106 | |||
| 2105 | Ga0207702_10150724 | |||
| 2106 | Ga0207641_10011464 | |||
| 2107 | Ga0207641_10012901 | |||
| 2108 | Ga0207641_10013953 | |||
| 2109 | Ga0207641_10015567 | |||
| 2110 | Ga0207641_10037955 | |||
| 2111 | Ga0207641_10089998 | |||
| 2112 | Ga0207641_10186874 | |||
| 2113 | Ga0207641_10365072 | |||
| 2114 | Ga0207648_10000484 | |||
| 2115 | Ga0207648_10008361 | |||
| 2116 | Ga0207648_10010090 | |||
| 2117 | Ga0207648_10019355 | |||
| 2118 | Ga0207648_10068205 | |||
| 2119 | Ga0207648_10083569 | |||
| 2120 | Ga0207648_10095391 | |||
| 2121 | Ga0207648_10106585 | |||
| 2122 | Ga0207648_10152587 | |||
| 2123 | Ga0207648_10187114 | |||
| 2124 | Ga0207648_10535491 | |||
| 2125 | Ga0207676_10000216 | |||
| 2126 | Ga0207676_10005169 | |||
| 2127 | Ga0207676_10017461 | |||
| 2128 | Ga0207676_10189986 | |||
| 2129 | Ga0207676_10285372 | |||
| 2130 | Ga0207674_10000292 | |||
| 2131 | Ga0207674_10012012 | |||
| 2132 | Ga0207674_10114395 | |||
| 2133 | Ga0207675_100001426 | |||
| 2134 | Ga0207675_100001767 | |||
| 2135 | Ga0207675_100001972 | |||
| 2136 | Ga0207675_100003149 | |||
| 2137 | Ga0207675_100003455 | |||
| 2138 | Ga0207675_100015452 | |||
| 2139 | Ga0207675_100018059 | |||
| 2140 | Ga0207675_100021232 | |||
| 2141 | Ga0207675_100041328 | |||
| 2142 | Ga0207675_100110877 | |||
| 2143 | Ga0207675_100288407 | |||
| 2144 | Ga0207683_10000920 | |||
| 2145 | Ga0207683_10007342 | |||
| 2146 | Ga0207683_10060407 | |||
| 2147 | Ga0207683_10072230 | |||
| 2148 | Ga0207683_10088043 | |||
| 2149 | Ga0207683_10204105 | |||
| 2150 | Ga0207698_10007793 | |||
| 2151 | Ga0207698_10016751 | |||
| 2152 | Ga0207698_10059132 | |||
| 2153 | Ga0207698_10076854 | |||
| 2154 | Ga0207698_10082638 | |||
| 2155 | Ga0207698_10497083 | |||
| 2156 | Ga0209969_1000861 | |||
| 2157 | Ga0209967_1005493 | |||
| 2158 | Ga0209981_1003420 | |||
| 2159 | Ga0209996_1003492 | |||
| 2160 | Ga0210000_1000129 | |||
| 2161 | Ga0210000_1004629 | |||
| 2162 | Ga0209999_1001944 | |||
| 2163 | Ga0209982_1001715 | |||
| 2164 | Ga0209983_1008824 | |||
| 2165 | Ga0209588_1014660 | |||
| 2166 | Ga0209588_1028137 | |||
| 2167 | Ga0209971_1001444 | |||
| 2168 | Ga0209966_1006585 | |||
| 2169 | Ga0209974_10007837 | |||
| 2170 | Ga0209974_10083958 | |||
| 2171 | Ga0207428_10003044 | |||
| 2172 | Ga0207428_10027877 | |||
| 2173 | Ga0207428_10031162 | |||
| 2174 | Ga0207428_10081767 | |||
| 2175 | Ga0265357_1007234 | |||
| 2176 | Ga0268266_10003005 | |||
| 2177 | Ga0268266_10020512 | |||
| 2178 | Ga0268266_10050834 | |||
| 2179 | Ga0268266_10057234 | |||
| 2180 | Ga0268266_10189434 | |||
| 2181 | Ga0268265_10016607 | |||
| 2182 | Ga0268265_10018358 | |||
| 2183 | Ga0268265_10099648 | |||
| 2184 | Ga0268265_10135273 | |||
| 2185 | Ga0268265_10263673 | |||
| 2186 | Ga0268265_10421918 | |||
| 2187 | Ga0268264_10000299 | |||
| 2188 | Ga0268264_10013145 | |||
| 2189 | Ga0268264_10024972 | |||
| 2190 | Ga0268264_10072281 | |||
| 2191 | Ga0268264_10327148 | |||
| 2192 | Ga0265334_10018682 | |||
| 2193 | Ga0265336_10007212 | |||
| 2194 | Ga0307517_10000024 | |||
| 2195 | Ga0307515_10000043 | |||
| 2196 | Ga0265338_10000058 | |||
| 2197 | Ga0265338_10006256 | |||
| 2198 | Ga0265338_10008827 | |||
| 2199 | Ga0265324_10007430 | |||
| 2200 | Ga0307511_10011888 | |||
| 2201 | Ga0265330_10000156 | |||
| 2202 | Ga0265330_10000564 | |||
| 2203 | Ga0265332_10000085 | |||
| 2204 | Ga0265332_10000157 | |||
| 2205 | Ga0265328_10001015 | |||
| 2206 | Ga0265328_10002908 | |||
| 2207 | Ga0265320_10014626 | |||
| 2208 | Ga0265325_10000396 | |||
| 2209 | Ga0265340_10003568 | |||
| 2210 | Ga0265340_10041778 | |||
| 2211 | Ga0265339_10007765 | |||
| 2212 | Ga0265331_10001313 | |||
| 2213 | Ga0265331_10022500 | |||
| 2214 | Ga0265327_10000549 | |||
| 2215 | Ga0265316_10004897 | |||
| 2216 | Ga0265316_10033511 | |||
| 2217 | Ga0307513_10027559 | |||
| 2218 | Ga0307509_10000001 | |||
| 2219 | Ga0307509_10000018 | |||
| 2220 | Ga0307509_10000109 | |||
| 2221 | Ga0307408_100060345 | |||
| 2222 | Ga0307408_100067510 | |||
| 2223 | Ga0307408_100264610 | |||
| 2224 | Ga0265313_10000729 | |||
| 2225 | Ga0307508_10007662 | |||
| 2226 | Ga0307508_10041267 | |||
| 2227 | Ga0307514_10048870 | |||
| 2228 | Ga0316575_10006556 | |||
| 2229 | Ga0265314_10000036 | |||
| 2230 | Ga0265314_10000446 | |||
| 2231 | Ga0265342_10000765 | |||
| 2232 | Ga0316578_10019647 | |||
| 2233 | Ga0307516_10054864 | |||
| 2234 | Ga0307405_10010260 | |||
| 2235 | Ga0307405_10115913 | |||
| 2236 | Ga0307405_10157866 | |||
| 2237 | Ga0307410_10006700 | |||
| 2238 | Ga0307410_10136581 | |||
| 2239 | Ga0307406_10261223 | |||
| 2240 | Ga0307407_10028986 | |||
| 2241 | Ga0307412_10047607 | |||
| 2242 | Ga0307412_10070451 | |||
| 2243 | Ga0307412_10211161 | |||
| 2244 | Ga0307416_100067305 | |||
| 2245 | Ga0307416_100083196 | |||
| 2246 | Ga0307416_100090074 | |||
| 2247 | Ga0307416_100099458 | |||
| 2248 | Ga0307416_100175122 | |||
| 2249 | Ga0307416_100175163 | |||
| 2250 | Ga0307416_100263547 | |||
| 2251 | Ga0307416_100357342 | |||
| 2252 | Ga0307411_10000606 | |||
| 2253 | Ga0307411_10136334 | |||
| 2254 | Ga0307411_10486995 | |||
| 2255 | Ga0307415_100013217 | |||
| 2256 | Ga0307415_100239284 | |||
| 2257 | Ga0307415_100318512 | |||
| 2258 | Ga0316583_10006551 | |||
| 2259 | Ga0316583_10007061 | |||
| 2260 | Ga0373930_0000484 | |||
| 2261 | Ga0373938_0004945 | |||
| 2262 | Ga0373938_0022085 | |||
| 2263 | Ga0373934_0009726 | |||
| 2264 | Ga0373940_0001325 | |||
| 2265 | Ga0373944_0044708 | |||
| 2266 | Ga0373949_0004944 | |||
| 2267 | Ga0373952_0002430 | |||
| 2268 | Ga0373923_0013458 | |||
| 2269 | Ga0373932_0001860 | |||
| 2270 | Ga0373932_0002355 | |||
| 2271 | Ga0373936_0003169 | |||
| 2272 | Ga0373936_0006544 | |||
| 2273 | Ga0373945_0018321 | |||
| 2274 | Ga0373953_0001139 | |||
| 2275 | Ga0373956_0026985 | |||
| 2276 | Ga0373957_0031285 | |||
| 2277 | Ga0373960_0010732 | |||
| 2278 | Ga0373960_0016610 | |||
| 2279 | Ga0373943_0014340 | |||
| 2280 | Ga0373943_0103771 | |||
| 2281 | Ga0373955_0020888 | |||
| 2282 | Ga0373955_0064615 | |||
| 2283 | Ga0373961_0006886 | |||
| 2284 | Ga0373961_0007299 | |||
| 2285 | Ga0373961_0023801 | |||
| 2286 | Ga0373962_0004968 | |||
| 2287 | Ga0316574_0195504 | |||
| 2288 | Ga0373924_0002265 | |||
| 2289 | Ga0373924_0008436 | |||
| 2290 | Ga0373924_0013759 | |||
| 2291 | Ga0373924_0120039 | |||
| 2292 | Ga0373931_0001851 | |||
| 2293 | Ga0373931_0002614 | |||
| 2294 | Ga0373931_0009572 | |||
| 2295 | Ga0373931_0049571 | |||
| 2296 | Ga0373931_0224752 | |||
| 2297 | Ga0373935_0051018 | |||
| 2298 | Ga0373935_0057983 | |||
| 2299 | Ga0373927_0034159 | |||
| 2300 | Ga0373933_0005006 | |||
| 2301 | Ga0373933_0350295 | |||
| 2302 | Ga0373937_0005534 | |||
| 2303 | Ga0373937_0006172 | |||
| 2304 | Ga0373937_0022263 | |||
| 2305 | Ga0373937_0078668 | |||
| 2306 | Ga0373937_0189572 | |||
| 2307 | Ga0316582_0025856 | |||
| 2308 | Ga0373925_0005195 | |||
| 2309 | Ga0373925_0008462 | |||
| 2310 | Ga0373925_0009800 | |||
| 2311 | Ga0373925_0013565 | |||
| 2312 | Ga0373925_0076340 | |||
| 2313 | Ga0373925_0098336 | |||
| 2314 | Ga0373925_0115562 | |||
| 2315 | Ga0373925_0154818 | |||
| 2316 | Ga0373925_0423294 | |||
| 2317 | Ga0373925_0605854 | |||
| 2318 | Ga0395899_0119945 | |||
| 2319 | Ga0395905_0002868 | |||
| 2320 | Ga0395905_0010024 | |||
| 2321 | Ga0395901_0056428 | |||
| 2322 | Ga0436360_0867881 | |||
| 2323 | Ga0436361_0106893 | |||
| 2324 | Ga0436361_0115046 | |||
| 2325 | Ga0436361_0149387 | |||
| 2326 | Ga0436361_0298613 | |||
| 2327 | Ga0436361_1015109 | |||
| 2328 | Ga0436361_1035781 | |||
| 2329 | Ga0436363_0441792 | |||
| 2330 | Ga0439447_029963 | |||
| 2331 | Ga0439466_0001370 | |||
| 2332 | Ga0451853_3964788 | |||
| 2333 | Ga0439431_0003640 | |||
| 2334 | Ga0439448_0002019 | |||
| 2335 | Ga0439432_011742 | |||
| 2336 | Ga0439450_021130 | |||
| 2337 | Ga0439455_0002250 | |||
| 2338 | Ga0450888_006722 | |||
| 2339 | Ga0439464_0010768 | |||
| 2340 | Ga0439460_0004047 | |||
| 2341 | Ga0451577_0002804 | |||
| 2342 | Ga0451577_0003002 | |||
| 2343 | Ga0451577_0029523 | |||
| 2344 | Ga0451577_0051298 | |||
| 2345 | Ga0451577_0056299 | |||
| 2346 | Ga0451577_0116278 | |||
| 2347 | Ga0451577_0125332 | |||
| 2348 | Ga0466969_0001856 | |||
| 2349 | Ga0466969_0002107 | |||
| 2350 | Ga0453683_0017707 | |||
| 2351 | Ga0453683_0024472 | |||
| 2352 | Ga0453683_0026181 | |||
| 2353 | Ga0453683_0067113 | |||
| 2354 | Ga0466966_0003642 | |||
| 2355 | Ga0466961_0001050 | |||
| 2356 | Ga0466964_0001846 | |||
| 2357 | Ga0453684_0000789 | |||
| 2358 | Ga0453684_0001404 | |||
| 2359 | Ga0453684_0005874 | |||
| 2360 | Ga0453684_0021384 | |||
| 2361 | Ga0453684_0056579 | |||
| 2362 | Ga0453684_0111559 | |||
| 2363 | Ga0453684_0584459 | |||
| 2364 | Ga0453684_0665782 | |||
| 2365 | Ga0453684_0735601 | |||
| 2366 | Ga0466971_0000216 | |||
| 2367 | Ga0466970_0005778 | |||
| 2368 | Ga0466957_0055856 | |||
| 2369 | Ga0451576_0000674 | |||
| 2370 | Ga0451576_0015471 | |||
| 2371 | Ga0451576_0025255 | |||
| 2372 | Ga0451576_0043727 | |||
| 2373 | Ga0451576_0054139 | |||
| 2374 | Ga0451576_0061972 | |||
| 2375 | Ga0451576_0069622 | |||
| 2376 | Ga0451576_0075225 | |||
| 2377 | Ga0451576_0366656 | |||
| 2378 | Ga0466967_0023171 | |||
| 2379 | Ga0495592_0031259 | |||
| 2380 | Ga0495592_0054489 | |||
| 2381 | Ga0495603_0001866 | |||
| 2382 | Ga0495603_0006042 | |||
| 2383 | Ga0495603_0031425 | |||
| 2384 | Ga0495603_0059548 | |||
| 2385 | Ga0495603_0078298 | |||
| 2386 | Ga0495591_008842 | |||
| 2387 | Ga0495629_0000224 | |||
| 2388 | Ga0495629_0030251 | |||
| 2389 | Ga0495629_0100995 | |||
| 2390 | Ga0495629_0140797 | |||
| 2391 | Ga0495629_0238256 | |||
| 2392 | Ga0495638_0002026 | |||
| 2393 | Ga0495638_0010227 | |||
| 2394 | Ga0495638_0229638 | |||
| 2395 | Ga0495641_0007096 | |||
| 2396 | Ga0495651_0014853 | |||
| 2397 | Ga0495653_0001151 | |||
| 2398 | Ga0495653_0001599 | |||
| 2399 | Ga0495653_0017344 | |||
| 2400 | Ga0495650_0002288 | |||
| 2401 | Ga0495580_0000700 | |||
| 2402 | Ga0495580_0001538 | |||
| 2403 | Ga0495580_0002263 | |||
| 2404 | Ga0495580_0003902 | |||
| 2405 | Ga0495580_0008595 | |||
| 2406 | Ga0495580_0009699 | |||
| 2407 | Ga0495580_0025496 | |||
| 2408 | Ga0495580_0033047 | |||
| 2409 | Ga0495580_0033173 | |||
| 2410 | Ga0495580_0082434 | |||
| 2411 | Ga0495582_0019073 | |||
| 2412 | Ga0495582_0052523 | |||
| 2413 | Ga0495605_0006406 | |||
| 2414 | Ga0495605_0007666 | |||
| 2415 | Ga0495639_0001641 | |||
| 2416 | Ga0495639_0046076 | |||
| 2417 | Ga0495662_0013582 | |||
| 2418 | Ga0495664_0000429 | |||
| 2419 | Ga0495664_0000685 | |||
| 2420 | Ga0495664_0018928 | |||
| 2421 | Ga0495664_0071398 | |||
| 2422 | Ga0495664_0078990 | |||
| 2423 | Ga0495664_0088622 | |||
| 2424 | Ga0495584_0045122 | |||
| 2425 | Ga0495594_0020522 | |||
| 2426 | Ga0495596_0007864 | |||
| 2427 | Ga0495607_0084173 | |||
| 2428 | Ga0495583_0006963 | |||
| 2429 | Ga0495583_0118856 | |||
| 2430 | Ga0495606_0116395 | |||
| 2431 | Ga0495608_0043714 | |||
| 2432 | Ga0495608_0046901 | |||
| 2433 | Ga0495616_0020071 | |||
| 2434 | Ga0495616_0064025 | |||
| 2435 | Ga0495618_0010454 | |||
| 2436 | Ga0495618_0056472 | |||
| 2437 | Ga0495618_0108921 | |||
| 2438 | Ga0495628_0000831 | |||
| 2439 | Ga0495628_0003725 | |||
| 2440 | Ga0495628_0055138 | |||
| 2441 | Ga0495628_0114914 | |||
| 2442 | Ga0495630_0002201 | |||
| 2443 | Ga0495630_0014399 | |||
| 2444 | Ga0495630_0077992 | |||
| 2445 | Ga0495632_0057179 | |||
| 2446 | Ga0495632_0104489 | |||
| 2447 | Ga0495648_0002762 | |||
| 2448 | Ga0495648_0015139 | |||
| 2449 | Ga0495648_0016753 | |||
| 2450 | Ga0495648_0058926 | |||
| 2451 | Ga0495648_0097364 | |||
| 2452 | Ga0495666_0000299 | |||
| 2453 | Ga0495666_0058413 | |||
| 2454 | Ga0495642_0022914 | |||
| 2455 | Ga0495652_0001797 | |||
| 2456 | Ga0495652_0014692 | |||
| 2457 | Ga0495652_0073952 | |||
| 2458 | Ga0495665_0000415 | |||
| 2459 | Ga0495665_0000879 | |||
| 2460 | Ga0495665_0014148 | |||
| 2461 | Ga0495665_0019069 | |||
| 2462 | Ga0495665_0049929 | |||
| 2463 | Ga0495665_0059945 | |||
| 2464 | Ga0495640_0014707 | |||
| 2465 | Ga0495640_0034387 | |||
| 2466 | Ga0495586_0063979 | |||
| 2467 | Ga0495586_0105781 | |||
| 2468 | Ga0495586_0129104 | |||
| 2469 | Ga0495586_0204706 | |||
| 2470 | Ga0495587_0000686 | |||
| 2471 | Ga0495587_0015593 | |||
| 2472 | Ga0495598_0048507 | |||
| 2473 | Ga0495621_0002198 | |||
| 2474 | Ga0495621_0059634 | |||
| 2475 | Ga0495645_0001756 | |||
| 2476 | Ga0495667_0014831 | |||
| 2477 | Ga0495667_0021574 | |||
| 2478 | Ga0495634_0002194 | |||
| 2479 | Ga0495634_0022609 | |||
| 2480 | Ga0495611_0051663 | |||
| 2481 | Ga0495625_0079604 | |||
| 2482 | Ga0495635_0031672 | |||
| 2483 | Ga0495635_0100569 | |||
| 2484 | Ga0495635_0115000 | |||
| 2485 | Ga0495635_0137592 | |||
| 2486 | Ga0495661_0001293 | |||
| 2487 | Ga0495661_0005687 | |||
| 2488 | Ga0495657_0035778 | |||
| 2489 | Ga0495657_0046331 | |||
| 2490 | Ga0495657_0073700 | |||
| 2491 | Ga0495657_0260342 | |||
| 2492 | Ga0495599_0002006 | |||
| 2493 | Ga0495599_0004056 | |||
| 2494 | Ga0495599_0006027 | |||
| 2495 | Ga0495599_0025854 | |||
| 2496 | Ga0495599_0052227 | |||
| 2497 | Ga0495623_0003332 | |||
| 2498 | Ga0495623_0011928 | |||
| 2499 | Ga0495623_0051308 | |||
| 2500 | Ga0495646_0012481 | |||
| 2501 | Ga0495646_0133343 | |||
| 2502 | Ga0495647_0007459 | |||
| 2503 | Ga0495647_0032350 | |||
| 2504 | Ga0495647_0050172 | |||
| 2505 | Ga0495658_0002904 | |||
| 2506 | Ga0495658_0005709 | |||
| 2507 | Ga0495658_0034592 | |||
| 2508 | Ga0495658_0167427 | |||
| 2509 | Ga0495669_0006310 | |||
| 2510 | Ga0495669_0188450 | |||
| 2511 | Ga0495613_0064614 | |||
| 2512 | Ga0495613_0356406 | |||
| 2513 | Ga0495624_0000062 | |||
| 2514 | Ga0495624_0000540 | |||
| 2515 | Ga0495624_0000958 | |||
| 2516 | Ga0495624_0008355 | |||
| 2517 | Ga0495624_0065966 | |||
| 2518 | Ga0495670_0008307 | |||
| 2519 | Ga0495670_0212559 | |||
| 2520 | Ga0495671_0049495 | |||
| 2521 | Ga0495671_0179386 | |||
| 2522 | Ga0495649_0132632 | |||
| 2523 | Ga0495589_0003015 | |||
| 2524 | Ga0495589_0005218 | |||
| 2525 | Ga0495589_0022660 | |||
| 2526 | Ga0495589_0119397 | |||
| 2527 | Ga0495600_0165220 | |||
| 2528 | Ga0495581_0004550 | |||
| 2529 | Ga0495581_0140908 | |||
| 2530 | Ga0495604_0001008 | |||
| 2531 | Ga0495604_0002577 | |||
| 2532 | Ga0495604_0054559 | |||
| 2533 | Ga0495604_0059375 | |||
| 2534 | Ga0495604_0088452 | |||
| 2535 | Ga0495604_0187178 | |||
| 2536 | Ga0495604_0221862 | |||
| 2537 | Ga0495636_0001185 | |||
| 2538 | Ga0495674_0000741 | |||
| 2539 | Ga0495674_0005345 | |||
| 2540 | Ga0495674_0008223 | |||
| 2541 | Ga0495674_0008525 | |||
| 2542 | Ga0495674_0014935 | |||
| 2543 | Ga0495674_0016022 | |||
| 2544 | Ga0495674_0022797 | |||
| 2545 | Ga0495674_0094474 | |||
| 2546 | Ga0495674_0141256 | |||
| 2547 | Ga0495672_0005393 | |||
| 2548 | Ga0495672_0010282 | |||
| 2549 | Ga0495672_0025979 | |||
| 2550 | Ga0495676_0031125 | |||
| 2551 | Ga0495680_0001805 | |||
| 2552 | Ga0495680_0024289 | |||
| 2553 | Ga0495680_0062618 | |||
| 2554 | Ga0495680_0102662 | |||
| 2555 | Ga0495680_0168969 | |||
| 2556 | Ga0495683_0031837 | |||
| 2557 | Ga0495687_019854 | |||
| 2558 | Ga0495687_034998 | |||
| 2559 | Ga0495687_053767 | |||
| 2560 | Ga0495675_0002322 | |||
| 2561 | Ga0495675_0016280 | |||
| 2562 | Ga0495675_0048455 | |||
| 2563 | Ga0495675_0132809 | |||
| 2564 | Ga0495675_0175933 | |||
| 2565 | Ga0495679_000473 | |||
| 2566 | Ga0495679_000897 | |||
| 2567 | Ga0495679_074363 | |||
| 2568 | Ga0495685_080701 | |||
| 2569 | Ga0495673_0014021 | |||
| 2570 | Ga0495673_0016141 | |||
| 2571 | Ga0495673_0016813 | |||
| 2572 | Ga0495684_0029557 | |||
| 2573 | Ga0495684_0055680 | |||
| 2574 | Ga0495593_0009257 | |||
| 2575 | Ga0495593_0076523 | |||
| 2576 | Ga0495593_0087487 | |||
| 2577 | Ga0495602_0001774 | |||
| 2578 | Ga0495602_0068433 | |||
| 2579 | Ga0495602_0085720 | |||
| 2580 | Ga0495602_0092490 | |||
| 2581 | Ga0495602_0168588 | |||
| 2582 | Ga0495614_0000191 | |||
| 2583 | Ga0495614_0023072 | |||
| 2584 | Ga0495626_0056015 | |||
| 2585 | Ga0496100_0004002 | |||
| 2586 | Ga0496100_0047886 | |||
| 2587 | Ga0496100_0126104 | |||
| 2588 | Ga0496100_0368867 | |||
| 2589 | Ga0496101_0003676 | |||
| 2590 | Ga0496102_0023692 | |||
| 2591 | Ga0496102_0069473 | |||
| 2592 | Ga0496102_0669216 | |||
| 2593 | Ga0496104_0010082 | |||
| 2594 | Ga0496104_0012559 | |||
| 2595 | Ga0496104_0093923 | |||
| 2596 | Ga0496104_0351787 | |||
| 2597 | Ga0496105_0019505 | |||
| 2598 | Ga0496105_0033233 | |||
| 2599 | Ga0496105_0087117 | |||
| 2600 | Ga0496106_0151386 | |||
| 2601 | Ga0496106_0227393 | |||
| 2602 | Ga0496107_0021955 | |||
| 2603 | Ga0496107_0037468 | |||
| 2604 | Ga0496107_0196603 | |||
| 2605 | Ga0496108_0095747 | |||
| 2606 | Ga0496108_0172355 | |||
| 2607 | Ga0496109_0275245 | |||
| 2608 | Ga0496109_0319091 | |||
| 2609 | Ga0496109_0490838 | |||
| 2610 | Ga0496110_0094014 | |||
| 2611 | Ga0496110_0154892 | |||
| 2612 | Ga0496111_0013080 | |||
| 2613 | Ga0496112_0002424 | |||
| 2614 | Ga0496112_0036367 | |||
| 2615 | Ga0496112_0111487 | |||
| 2616 | Ga0496113_0002098 | |||
| 2617 | Ga0496113_0038684 | |||
| 2618 | Ga0496114_0031008 | |||
| 2619 | Ga0496114_0088369 | |||
| 2620 | Ga0496115_0010346 | |||
| 2621 | Ga0496116_0028474 | |||
| 2622 | Ga0496117_0046288 | |||
| 2623 | Ga0496118_0013636 | |||
| 2624 | Ga0496118_0046932 | |||
| 2625 | Ga0496119_0001412 | |||
| 2626 | Ga0496119_0111837 | |||
| 2627 | Ga0496120_0000061 | |||
| 2628 | Ga0496121_0003416 | |||
| 2629 | Ga0496121_0008989 | |||
| 2630 | Ga0496121_0010073 | |||
| 2631 | Ga0496125_0001329 | |||
| 2632 | Ga0496125_0009379 | |||
| 2633 | Ga0496126_0000102 | |||
| 2634 | Ga0496126_0111733 | |||
| 2635 | Ga0495682_0003413 | |||
| 2636 | Ga0501031_0094581 | |||
| 2637 | Ga0501031_0183505 | |||
| 2638 | Ga0501034_0432680 | |||
| 2639 | Ga0501036_0481422 | |||
| 2640 | Ga0501038_0144568 | |||
| 2641 | Ga0501039_0001318 | |||
| 2642 | Ga0501039_0152724 | |||
| 2643 | Ga0501040_0002506 | |||
| 2644 | Ga0501041_0002441 | |||
| 2645 | Ga0501041_0068175 | |||
| 2646 | Ga0501041_0127106 | |||
| 2647 | Ga0501041_0268240 | |||
| 2648 | Ga0501042_0005640 | |||
| 2649 | Ga0501042_0013689 | |||
| 2650 | Ga0501046_0113159 | |||
| 2651 | Ga0501047_0004510 | |||
| 2652 | Ga0501047_0008637 | |||
| 2653 | Ga0501048_0010224 | |||
| 2654 | Ga0501067_0176324 | |||
| 2655 | Ga0501068_0000336 | |||
| 2656 | Ga0501068_0220190 | |||
| 2657 | Ga0501069_0001252 | |||
| 2658 | Ga0501070_0000975 | |||
| 2659 | Ga0501070_0002573 | |||
| 2660 | Ga0501071_0001594 | |||
| 2661 | Ga0501071_0011264 | |||
| 2662 | Ga0501071_0012654 | |||
| 2663 | Ga0501071_0063039 | |||
| 2664 | Ga0501071_0094639 | |||
| 2665 | Ga0501071_0140456 | |||
| 2666 | Ga0501071_0164187 | |||
| 2667 | Ga0501072_0008439 | |||
| 2668 | Ga0501072_0010897 | |||
| 2669 | Ga0501072_0037994 | |||
| 2670 | Ga0501072_0080857 | |||
| 2671 | Ga0501073_0001472 | |||
| 2672 | Ga0501073_0003148 | |||
| 2673 | Ga0501073_0214512 | |||
| 2674 | Ga0501074_0012536 | |||
| 2675 | Ga0501074_0036304 | |||
| 2676 | Ga0501074_0142932 | |||
| 2677 | Ga0501075_0000301 | |||
| 2678 | Ga0501075_0340812 | |||
| 2679 | Ga0501076_0000098 | |||
| 2680 | Ga0501076_0009249 | |||
| 2681 | Ga0501076_0143264 | |||
| 2682 | Ga0501076_0201726 | |||
| 2683 | Ga0501077_0000288 | |||
| 2684 | Ga0501077_0004557 | |||
| 2685 | Ga0501198_000136 | |||
| 2686 | Ga0501222_000203 | |||
| 2687 | Ga0501079_0000932 | |||
| 2688 | Ga0501079_0003630 | |||
| 2689 | Ga0501079_0022877 | |||
| 2690 | Ga0501079_0038501 | |||
| 2691 | Ga0501079_0245411 | |||
| 2692 | Ga0501079_0293452 | |||
| 2693 | Ga0501080_0001504 | |||
| 2694 | Ga0501080_0002429 | |||
| 2695 | Ga0501080_0003832 | |||
| 2696 | Ga0501080_0006561 | |||
| 2697 | Ga0501080_0056729 | |||
| 2698 | Ga0501081_0007365 | |||
| 2699 | Ga0501081_0129722 | |||
| 2700 | Ga0501083_0002934 | |||
| 2701 | Ga0501083_0005053 | |||
| 2702 | Ga0501083_0195215 | |||
| 2703 | Ga0501035_0056514 | |||
| 2704 | Ga0501035_0069902 | |||
| 2705 | Ga0501035_0108421 | |||
| 2706 | Ga0501044_0011796 | |||
| 2707 | Ga0501044_0049492 | |||
| 2708 | Ga0501044_0083540 | |||
| 2709 | Ga0501044_0384198 | |||
| 2710 | Ga0501045_0005445 | |||
| 2711 | nmdc:mga06z11_10234_c1 | |||
| 2712 | nmdc:mga07m45_17021_c1 | |||
| 2713 | nmdc:mga07m45_1741_c1 | |||
| 2714 | nmdc:mga05p37_137_c1 | |||
| 2715 | nmdc:mga05p37_243420_c1 | |||
| 2716 | nmdc:mga05p37_67_c1 | |||
| 2717 | nmdc:mga05p37_8988_c1 | |||
| 2718 | nmdc:mga09592_1642_c1 | |||
| 2719 | nmdc:mga09592_255336_c1 | |||
| 2720 | nmdc:mga09592_258_c1 | |||
| 2721 | nmdc:mga09592_45_c1 | |||
| 2722 | nmdc:mga09592_5545_c1 | |||
| 2723 | nmdc:mga09592_69998_c1 | |||
| 2724 | nmdc:mga09592_986_c2 | |||
| 2725 | nmdc:mga0qj67_13357_c1 | |||
| 2726 | nmdc:mga0qj67_47189_c1 | |||
| 2727 | nmdc:mga0qj67_7447_c1 | |||
| 2728 | nmdc:mga06r32_115_c1 | |||
| 2729 | nmdc:mga06r32_19264_c1 | |||
| 2730 | nmdc:mga06r32_379684_c1 | |||
| 2731 | nmdc:mga06r32_9078_c1 | |||
| 2732 | nmdc:mga06r32_95468_c1 | |||
| 2733 | nmdc:mga06r32_9718_c1 | |||
| 2734 | nmdc:mga08y16_1100_c1 | |||
| 2735 | nmdc:mga08y16_125548_c1 | |||
| 2736 | nmdc:mga08y16_266_c1 | |||
| 2737 | nmdc:mga08y16_335512_c1 | |||
| 2738 | nmdc:mga08y16_34996_c1 | |||
| 2739 | nmdc:mga08y16_3923_c1 | |||
| 2740 | nmdc:mga08y16_84619_c1 | |||
| 2741 | nmdc:mga08y16_99374_c1 | |||
| 2742 | nmdc:mga0n895_456072_c1 | |||
| 2743 | nmdc:mga0rr50_12678_c1 | |||
| 2744 | nmdc:mga0rr50_480_c1 | |||
| 2745 | nmdc:mga0rr50_69392_c1 | |||
| 2746 | nmdc:mga0a205_402_c1 | |||
| 2747 | Ga0495601_0040475 | |||
| 2748 | Ga0495612_0013915 | |||
| 2749 | Ga0500610_0000061 | |||
| 2750 | Ga0495595_0007920 | |||
| 2751 | Ga0495619_0077481 | |||
| 2752 | Ga0495619_0158501 | |||
| 2753 | Ga0500643_003261 | |||
| 2754 | Ga0500583_0029107 | |||
| 2755 | Ga0500583_0133237 | |||
| 2756 | Ga0500583_0154631 | |||
| 2757 | Ga0500608_000226 | |||
| 2758 | Ga0500561_0009144 | |||
| 2759 | Ga0500574_035921 | |||
| 2760 | Ga0501084_0023456 | |||
| 2761 | Ga0590071_001242 | |||
| 2762 | Ga0501082_0001136 | |||
| 2763 | Ga0501082_0008333 | |||
| 2764 | Ga0501082_0033418 | |||
| 2765 | Ga0501082_0117225 | |||
| 2766 | Ga0530510_0013711 | |||
| 2767 | Ga0530510_0154518 | |||
| 2768 | 2501071946 | |||
| 2769 | 2501411818 | |||
| 2770 | 2511100818 | |||
| 2771 | 2511107472 | |||
| 2772 | 2512350029 | |||
| 2773 | 2513552531 | |||
| 2774 | 2513560733 | |||
| 2775 | 2514047656 | |||
| 2776 | 2515682017 | |||
| 2777 | 2516017169 | |||
| 2778 | 2563056892 | |||
| 2779 | 2563064566 | |||
| 2780 | 2599744999 | |||
| 2781 | 2600206820 | |||
| 2782 | 2600811090 | |||
| 2783 | 2676743273 | |||
| 2784 | 2713472871 | |||
| 2785 | 2713481087 | |||
| 2786 | 2723878249 | |||
| 2787 | 2792837089 | |||
| 2788 | 2819620063 | |||
| 2789 | 2870076548 | |||
| 2790 | 2885279927 | |||
| 2791 | 2891636331 | |||
| 2792 | 2902685429 | |||
| 2793 | 2904620163 | |||
| 2794 | 2928110379 | |||
| 2795 | 2928138487 | |||
| 2796 | 2928505451 | |||
| 2797 | 2990710481 | |||
| 2798 | 642597772 | |||
| 2799 | 8003958309 | |||
| 2800 | 8020948220 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.8912 | 2 | 316 |
| 7z0t-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) | 0.8883 | 2 | 316 |
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.8802 | 9 | 316 |
| 7z0s-assembly1.cif.gz_D | structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) | 0.8667 | 9 | 316 |
| 6u8y-assembly1.cif.gz_m | structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex | 0.7932 | 5 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58046_10_211_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.3415 | 66 | 246 | 1.20.58.220 |
| af_P37340_17_177_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.317 | 138 | 314 | 1.10.1760.20 |
| af_A0A1D8PCB5_370_524_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3157 | 104 | 313 | 1.20.1250.20 |
| af_Q58046_10_211_1.20.58.220 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 | 0.3135 | 66 | 246 | 1.20.58.220 |
| af_P37340_17_177_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3111 | 138 | 314 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522AP15-F1-model_v4 | Formate hydrogenlyase | 0.9565 | 1 | 199 |
GO:0005886
GO:0016829 |
| AF-A0A522M4U8-F1-model_v4 | Formate hydrogenlyase | 0.9562 | 2 | 149 |
GO:0005886
GO:0016829 |
| AF-A0A534DSG4-F1-model_v4 | deleted | 0.9561 | 1 | 149 |
|
| AF-A0A522AP15-F1-model_v4 | Formate hydrogenlyase | 0.9518 | 1 | 199 |
GO:0005886
GO:0016829 |
| AF-A0A3D3AY45-F1-model_v4 | Formate hydrogenlyase | 0.9508 | 68 | 195 |
GO:0005886
GO:0016829 |