F493673

General Info

Members Datasets Scaffolds Average Seq Length
1400 497 2800 315

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0192725|Ga0495676_0192725_203_1150
Length 303
Sequence MSFTGALSQLLEIVIAIALAPLLTGWVNQWRSWLQNKSAPSLWQPYWMLHKLFNKESMVADNASPLFRTAPYVKLGCMVLACAIIPTLSTDLPLAPAADAIALVGLFALARVFISLAAMDIGTAFGTMGARREMLVGFLAEPALLMVLFSASLISKSTSLTTIVGTLAHRELTIYPGLAENSRVPIDNPATHLELTMLHEALILEYSGRHLALLEWAASLKLFAYSCIGLALFFPWGVAEAQAPLAMLLALPALVLKLAVGGFMLALLETINAKMRIFRVPEFLATAFLLAVIGMLVHLLLAR

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
226 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
227 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
228 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
229 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
237 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
255 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
256 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
257 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
258 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
263 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
271 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
272 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
273 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
274 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
275 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
276 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
277 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
288 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
289 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
290 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
291 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
292 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
293 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
294 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
295 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
298 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
299 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
300 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
301 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
302 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
303 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
304 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
305 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
308 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
336 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
340 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
343 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
349 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
350 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
363 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
364 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
365 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
366 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
367 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
368 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
369 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
376 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
377 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
378 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
379 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
380 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
381 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
382 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
383 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
384 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
385 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
386 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
387 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
388 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
389 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
390 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
410 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
411 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
426 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
427 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
428 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
429 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
430 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
431 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
432 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
433 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
434 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
435 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
436 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
437 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
438 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
439 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
440 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
443 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
446 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
447 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
448 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
449 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
450 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
451 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
452 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
453 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
454 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
455 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
456 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
457 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
458 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
459 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
460 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
461 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
462 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
463 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
464 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
465 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
466 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
467 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
468 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
469 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
470 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
471 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
472 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
473 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
474 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
475 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
476 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
477 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
478 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
479 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
480 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
481 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
482 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
483 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
484 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
485 2818991450 Burkholderia sp. 604 Isolate Unclassified
486 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
487 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
488 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
489 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
490 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
491 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
492 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
493 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
494 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
495 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
496 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
497 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0.5
Rhizoplane 2.79
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0192725 3300047321 Bacteria 1421
2 SwRhRL2b_contig_365350 2162886007 Bacteria 8655
3 rootH1_10121089 3300003323 Bacteria 2228
4 Ga0055532_1000124 3300003758 Bacteria 78333
5 Ga0055527_1000036 3300003760 Bacteria 133374
6 Ga0055535_1000051 3300003761 Bacteria 133374
7 Ga0055542_1001307 3300003762 Bacteria 13217
8 Ga0065712_10068735 3300005290 Bacteria 9198
9 Ga0065715_10105432 3300005293 Bacteria 2893
10 Ga0065715_10132801 3300005293 Bacteria 1984
11 Ga0065707_10000604 3300005295 Bacteria 25275
12 Ga0065707_10031187 3300005295 Bacteria 1348
13 Ga0070676_10003719 3300005328 Bacteria 7995
14 Ga0070683_100002653 3300005329 Bacteria 14305
15 Ga0070683_100022207 3300005329 Bacteria 5668
16 Ga0070690_100000816 3300005330 Bacteria 15789
17 Ga0070690_100021782 3300005330 Bacteria 3916
18 Ga0070690_100061311 3300005330 Bacteria 2423
19 Ga0070670_100000816 3300005331 Bacteria 24269
20 Ga0070670_100014443 3300005331 Bacteria 6778
21 Ga0070670_100197121 3300005331 Bacteria 1749
22 Ga0070670_100459774 3300005331 Bacteria 1129
23 Ga0068869_100002189 3300005334 Bacteria 11757
24 Ga0068869_100003615 3300005334 Bacteria 9486
25 Ga0068869_100033933 3300005334 Bacteria 3607
26 Ga0068869_100038674 3300005334 Bacteria 3402
27 Ga0068869_100099763 3300005334 Bacteria 2195
28 Ga0070666_10009338 3300005335 Bacteria 6111
29 Ga0070666_10016993 3300005335 Bacteria 4660
30 Ga0070666_10084623 3300005335 Bacteria 2171
31 Ga0070680_100017814 3300005336 Bacteria 5604
32 Ga0070680_100055669 3300005336 Bacteria 3232
33 Ga0070680_100100311 3300005336 Bacteria 2403
34 Ga0070680_100109741 3300005336 Bacteria 2296
35 Ga0068868_100039606 3300005338 Bacteria 3662
36 Ga0068868_100060597 3300005338 Bacteria 2997
37 Ga0068868_100074960 3300005338 Bacteria 2703
38 Ga0068868_100152495 3300005338 Bacteria 1904
39 Ga0068868_100407253 3300005338 Bacteria 1175
40 Ga0070660_100001108 3300005339 Bacteria 18149
41 Ga0070660_100001577 3300005339 Bacteria 15675
42 Ga0070660_100060216 3300005339 Bacteria 2946
43 Ga0070660_100100178 3300005339 Bacteria 2294
44 Ga0070689_100000421 3300005340 Bacteria 24985
45 Ga0070689_100036291 3300005340 Bacteria 3770
46 Ga0070691_10003356 3300005341 Bacteria 7189
47 Ga0070661_100003820 3300005344 Bacteria 10367
48 Ga0070661_100020427 3300005344 Bacteria 4722
49 Ga0070692_10004660 3300005345 Bacteria 5746
50 Ga0070692_10082482 3300005345 Bacteria 1734
51 Ga0070668_100029002 3300005347 Bacteria 4201
52 Ga0070668_100047902 3300005347 Bacteria 3287
53 Ga0070668_100211110 3300005347 Bacteria 1597
54 Ga0070668_100222445 3300005347 Bacteria 1557
55 Ga0070668_100236171 3300005347 Bacteria 1513
56 Ga0070669_100012004 3300005353 Bacteria 6148
57 Ga0070669_100024084 3300005353 Bacteria 4363
58 Ga0070669_100174270 3300005353 Bacteria 1679
59 Ga0070675_100005747 3300005354 Bacteria 9488
60 Ga0070675_100006854 3300005354 Bacteria 8745
61 Ga0070675_100008107 3300005354 Bacteria 8145
62 Ga0070675_100010573 3300005354 Bacteria 7213
63 Ga0070675_100016164 3300005354 Bacteria 5917
64 Ga0070675_100018178 3300005354 Bacteria 5594
65 Ga0070675_100052643 3300005354 Bacteria 3347
66 Ga0070675_100058700 3300005354 Bacteria 3173
67 Ga0070675_100064971 3300005354 Bacteria 3016
68 Ga0070675_100344544 3300005354 Bacteria 1320
69 Ga0070671_100005851 3300005355 Bacteria 9797
70 Ga0070671_100011916 3300005355 Bacteria 6993
71 Ga0070671_100017868 3300005355 Bacteria 5750
72 Ga0070671_100086400 3300005355 Bacteria 2624
73 Ga0070671_100098886 3300005355 Bacteria 2447
74 Ga0070671_100243200 3300005355 Bacteria 1528
75 Ga0070674_100021247 3300005356 Bacteria 4162
76 Ga0070674_100034273 3300005356 Bacteria 3389
77 Ga0070673_100024097 3300005364 Bacteria 4456
78 Ga0070673_100041108 3300005364 Bacteria 3552
79 Ga0070673_100126436 3300005364 Bacteria 2139
80 Ga0070673_100131669 3300005364 Bacteria 2099
81 Ga0070673_100463365 3300005364 Bacteria 1141
82 Ga0070688_100044248 3300005365 Bacteria 2746
83 Ga0070688_100047397 3300005365 Bacteria 2666
84 Ga0070688_100175327 3300005365 Bacteria 1483
85 Ga0070659_100000861 3300005366 Bacteria 22182
86 Ga0070659_100010215 3300005366 Bacteria 6905
87 Ga0070659_100295102 3300005366 Bacteria 1350
88 Ga0070667_100023426 3300005367 Bacteria 5122
89 Ga0070667_100045092 3300005367 Bacteria 3706
90 Ga0070667_100056206 3300005367 Bacteria 3324
91 Ga0070667_100076171 3300005367 Bacteria 2864
92 Ga0070667_100087394 3300005367 Bacteria 2676
93 Ga0070667_100096442 3300005367 Bacteria 2550
94 Ga0070667_100197073 3300005367 Bacteria 1786
95 Ga0070667_100264767 3300005367 Bacteria 1540
96 Ga0070667_100295829 3300005367 Bacteria 1457
97 Ga0070709_10017823 3300005434 Bacteria 4080
98 Ga0070714_100001074 3300005435 Bacteria 19541
99 Ga0070714_100315095 3300005435 Bacteria 1462
100 Ga0070713_100005981 3300005436 Bacteria 8370
101 Ga0070713_100036255 3300005436 Bacteria 3979
102 Ga0070713_100051781 3300005436 Bacteria 3397
103 Ga0070713_100094648 3300005436 Bacteria 2576
104 Ga0070701_10002293 3300005438 Bacteria 7331
105 Ga0070701_10013320 3300005438 Bacteria 3738
106 Ga0070711_100092007 3300005439 Bacteria 2188
107 Ga0070711_100161734 3300005439 Bacteria 1698
108 Ga0070711_100189663 3300005439 Bacteria 1579
109 Ga0070705_100004895 3300005440 Bacteria 6523
110 Ga0070705_100311620 3300005440 Bacteria 1132
111 Ga0070700_100012304 3300005441 Bacteria 4769
112 Ga0070700_100107828 3300005441 Bacteria 1846
113 Ga0070694_100016655 3300005444 Bacteria 4630
114 Ga0070694_100050085 3300005444 Bacteria 2814
115 Ga0070694_100060441 3300005444 Bacteria 2584
116 Ga0070694_100275684 3300005444 Bacteria 1281
117 Ga0070663_100008570 3300005455 Bacteria 6299
118 Ga0070663_100058784 3300005455 Bacteria 2762
119 Ga0070663_100160837 3300005455 Bacteria 1728
120 Ga0070678_100023134 3300005456 Bacteria 4135
121 Ga0070678_100044645 3300005456 Bacteria 3165
122 Ga0070678_100055959 3300005456 Bacteria 2882
123 Ga0070678_100060738 3300005456 Bacteria 2783
124 Ga0070678_100064112 3300005456 Bacteria 2722
125 Ga0070678_100190535 3300005456 Bacteria 1686
126 Ga0070678_100227654 3300005456 Bacteria 1553
127 Ga0070662_100021621 3300005457 Bacteria 4395
128 Ga0070662_100044112 3300005457 Bacteria 3193
129 Ga0070662_100078058 3300005457 Bacteria 2459
130 Ga0070681_10002158 3300005458 Bacteria 17897
131 Ga0070681_10011416 3300005458 Bacteria 8792
132 Ga0070681_10011526 3300005458 Bacteria 8750
133 Ga0070681_10033595 3300005458 Bacteria 5149
134 Ga0070681_10034179 3300005458 Bacteria 5105
135 Ga0070681_10099027 3300005458 Bacteria 2861
136 Ga0070681_10296179 3300005458 Bacteria 1528
137 Ga0068867_100000215 3300005459 Bacteria 38520
138 Ga0068867_100022935 3300005459 Bacteria 4466
139 Ga0068867_100079461 3300005459 Bacteria 2469
140 Ga0068867_100086134 3300005459 Bacteria 2376
141 Ga0068867_100087576 3300005459 Bacteria 2358
142 Ga0068867_100112807 3300005459 Bacteria 2091
143 Ga0068867_100221042 3300005459 Bacteria 1526
144 Ga0070706_100038140 3300005467 Bacteria 4436
145 Ga0070706_100314176 3300005467 Bacteria 1461
146 Ga0070706_100565921 3300005467 Bacteria 1057
147 Ga0070707_100049906 3300005468 Bacteria 4011
148 Ga0070698_100237648 3300005471 Bacteria 1755
149 Ga0070699_100050857 3300005518 Bacteria 3588
150 Ga0070679_100002776 3300005530 Bacteria 15915
151 Ga0070679_100007196 3300005530 Bacteria 10394
152 Ga0070679_100015155 3300005530 Bacteria 7407
153 Ga0070679_100139486 3300005530 Bacteria 2405
154 Ga0070679_100149467 3300005530 Bacteria 2313
155 Ga0070679_100220462 3300005530 Bacteria 1858
156 Ga0070684_100005851 3300005535 Bacteria 9461
157 Ga0070684_100008616 3300005535 Bacteria 7988
158 Ga0070684_100211630 3300005535 Bacteria 1767
159 Ga0070684_100215985 3300005535 Bacteria 1749
160 Ga0070697_100005759 3300005536 Bacteria 9555
161 Ga0068853_100053724 3300005539 Bacteria 3469
162 Ga0068853_100055724 3300005539 Bacteria 3407
163 Ga0068853_100381500 3300005539 Bacteria 1316
164 Ga0070672_100001840 3300005543 Bacteria 13234
165 Ga0070672_100009845 3300005543 Bacteria 6607
166 Ga0070672_100293733 3300005543 Bacteria 1376
167 Ga0070686_100001871 3300005544 Bacteria 11724
168 Ga0070686_100016846 3300005544 Bacteria 4258
169 Ga0070686_100024627 3300005544 Bacteria 3609
170 Ga0070686_100032829 3300005544 Bacteria 3185
171 Ga0070686_100035160 3300005544 Bacteria 3093
172 Ga0070686_100076479 3300005544 Bacteria 2204
173 Ga0070695_100039787 3300005545 Bacteria 2974
174 Ga0070695_100045814 3300005545 Bacteria 2789
175 Ga0070696_100005913 3300005546 Bacteria 8169
176 Ga0070696_100065844 3300005546 Bacteria 2540
177 Ga0070696_100153349 3300005546 Bacteria 1693
178 Ga0070696_100289022 3300005546 Bacteria 1252
179 Ga0070693_100005012 3300005547 Bacteria 6328
180 Ga0070693_100023239 3300005547 Bacteria 3311
181 Ga0070693_100137123 3300005547 Bacteria 1536
182 Ga0070665_100001969 3300005548 Bacteria 23093
183 Ga0070665_100080440 3300005548 Bacteria 3264
184 Ga0070665_100105665 3300005548 Bacteria 2817
185 Ga0070665_100312351 3300005548 Bacteria 1576
186 Ga0070704_100001594 3300005549 Bacteria 12259
187 Ga0070704_100012426 3300005549 Bacteria 5260
188 Ga0070704_100091932 3300005549 Bacteria 2264
189 Ga0068855_100001682 3300005563 Bacteria 27687
190 Ga0068855_100002002 3300005563 Bacteria 25309
191 Ga0068855_100002194 3300005563 Bacteria 24134
192 Ga0068855_100005111 3300005563 Bacteria 15994
193 Ga0068855_100011151 3300005563 Bacteria 10852
194 Ga0068855_100017416 3300005563 Bacteria 8643
195 Ga0068855_100029844 3300005563 Bacteria 6520
196 Ga0068855_100031793 3300005563 Bacteria 6300
197 Ga0068855_100042963 3300005563 Bacteria 5356
198 Ga0068855_100130792 3300005563 Bacteria 2867
199 Ga0070664_100000772 3300005564 Bacteria 24693
200 Ga0070664_100009626 3300005564 Bacteria 7838
201 Ga0070664_100440825 3300005564 Bacteria 1195
202 Ga0068857_100012680 3300005577 Bacteria 7345
203 Ga0068857_100048483 3300005577 Bacteria 3771
204 Ga0068857_100160671 3300005577 Bacteria 2039
205 Ga0068854_100029947 3300005578 Bacteria 3773
206 Ga0068854_100091242 3300005578 Bacteria 2267
207 Ga0068854_100153445 3300005578 Bacteria 1778
208 Ga0068856_100035659 3300005614 Bacteria 4875
209 Ga0068856_100049397 3300005614 Bacteria 4146
210 Ga0068856_100097139 3300005614 Bacteria 2935
211 Ga0068856_100159467 3300005614 Bacteria 2266
212 Ga0070702_100000854 3300005615 Bacteria 11764
213 Ga0070702_100000889 3300005615 Bacteria 11627
214 Ga0070702_100007766 3300005615 Bacteria 5155
215 Ga0070702_100065768 3300005615 Bacteria 2124
216 Ga0070702_100124671 3300005615 Bacteria 1618
217 Ga0068852_100000419 3300005616 Bacteria 28349
218 Ga0068852_100000944 3300005616 Bacteria 19185
219 Ga0068852_100001924 3300005616 Bacteria 14147
220 Ga0068852_100006532 3300005616 Bacteria 8434
221 Ga0068852_100009876 3300005616 Bacteria 7102
222 Ga0068852_100097479 3300005616 Bacteria 2645
223 Ga0068852_100149609 3300005616 Bacteria 2170
224 Ga0068852_100383701 3300005616 Bacteria 1379
225 Ga0068859_100000253 3300005617 Bacteria 53069
226 Ga0068859_100006199 3300005617 Bacteria 12150
227 Ga0068859_100015782 3300005617 Bacteria 7589
228 Ga0068859_100018481 3300005617 Bacteria 7006
229 Ga0068859_100079124 3300005617 Bacteria 3327
230 Ga0068859_100094533 3300005617 Bacteria 3041
231 Ga0068859_100122677 3300005617 Bacteria 2665
232 Ga0068859_100457923 3300005617 Bacteria 1371
233 Ga0068864_100001205 3300005618 Bacteria 21463
234 Ga0068864_100005181 3300005618 Bacteria 10674
235 Ga0068864_100008410 3300005618 Bacteria 8514
236 Ga0068864_100015984 3300005618 Bacteria 6245
237 Ga0068864_100104699 3300005618 Bacteria 2514
238 Ga0068864_100174533 3300005618 Bacteria 1961
239 Ga0068864_100179216 3300005618 Bacteria 1936
240 Ga0068864_100266579 3300005618 Bacteria 1595
241 Ga0068866_10002860 3300005718 Bacteria 7119
242 Ga0068866_10203602 3300005718 Bacteria 1184
243 Ga0068861_100001372 3300005719 Bacteria 15283
244 Ga0068861_100003053 3300005719 Bacteria 11055
245 Ga0068861_100008134 3300005719 Bacteria 7216
246 Ga0068861_100076244 3300005719 Bacteria 2612
247 Ga0068861_100287251 3300005719 Bacteria 1419
248 Ga0068851_10006725 3300005834 Bacteria 5260
249 Ga0068851_10007729 3300005834 Bacteria 4945
250 Ga0068851_10015524 3300005834 Bacteria 3629
251 Ga0068851_10031134 3300005834 Bacteria 2648
252 Ga0068851_10033402 3300005834 Bacteria 2564
253 Ga0068851_10085565 3300005834 Bacteria 1653
254 Ga0068870_10001202 3300005840 Bacteria 10390
255 Ga0068863_100001784 3300005841 Bacteria 21344
256 Ga0068863_100003276 3300005841 Bacteria 15984
257 Ga0068863_100015332 3300005841 Bacteria 7365
258 Ga0068863_100018873 3300005841 Bacteria 6599
259 Ga0068863_100053000 3300005841 Bacteria 3844
260 Ga0068863_100084247 3300005841 Bacteria 3013
261 Ga0068863_100149508 3300005841 Bacteria 2234
262 Ga0068863_100157041 3300005841 Bacteria 2178
263 Ga0068863_100189995 3300005841 Bacteria 1973
264 Ga0068863_100312905 3300005841 Bacteria 1524
265 Ga0068863_100496504 3300005841 Bacteria 1201
266 Ga0068858_100000503 3300005842 Bacteria 40960
267 Ga0068858_100001910 3300005842 Bacteria 21265
268 Ga0068858_100005731 3300005842 Bacteria 12140
269 Ga0068858_100014286 3300005842 Bacteria 7487
270 Ga0068858_100021279 3300005842 Bacteria 6058
271 Ga0068858_100084265 3300005842 Bacteria 2957
272 Ga0068858_100106996 3300005842 Bacteria 2610
273 Ga0068858_100198229 3300005842 Bacteria 1898
274 Ga0068858_100229330 3300005842 Bacteria 1760
275 Ga0068860_100001280 3300005843 Bacteria 27317
276 Ga0068860_100001625 3300005843 Bacteria 24111
277 Ga0068860_100009569 3300005843 Bacteria 9628
278 Ga0068860_100022290 3300005843 Bacteria 6129
279 Ga0068860_100068118 3300005843 Bacteria 3382
280 Ga0068860_100081692 3300005843 Bacteria 3073
281 Ga0068860_100259740 3300005843 Bacteria 1693
282 Ga0068860_100479549 3300005843 Bacteria 1240
283 Ga0068862_100014488 3300005844 Bacteria 6543
284 Ga0068862_100030640 3300005844 Bacteria 4535
285 Ga0068862_100071572 3300005844 Bacteria 2994
286 Ga0070717_10009990 3300006028 Bacteria 7141
287 Ga0070717_10168299 3300006028 Bacteria 1905
288 Ga0070717_10329322 3300006028 Bacteria 1362
289 Ga0070716_100026160 3300006173 Bacteria 3122
290 Ga0070716_100111887 3300006173 Bacteria 1694
291 Ga0075366_10145367 3300006195 Bacteria 1435
292 Ga0097621_100005458 3300006237 Bacteria 8951
293 Ga0097621_100010078 3300006237 Bacteria 6892
294 Ga0097621_100015961 3300006237 Bacteria 5664
295 Ga0097621_100031728 3300006237 Bacteria 4193
296 Ga0097621_100031848 3300006237 Bacteria 4186
297 Ga0097621_100130031 3300006237 Bacteria 2142
298 Ga0097621_100413816 3300006237 Bacteria 1209
299 Ga0075370_10008340 3300006353 Bacteria 5328
300 Ga0075370_10010453 3300006353 Bacteria 4854
301 Ga0068871_100006085 3300006358 Bacteria 8491
302 Ga0068871_100015806 3300006358 Bacteria 5664
303 Ga0068871_100023694 3300006358 Bacteria 4752
304 Ga0068871_100028456 3300006358 Bacteria 4381
305 Ga0068871_100116227 3300006358 Bacteria 2255
306 Ga0068871_100158493 3300006358 Bacteria 1934
307 Ga0068871_100256170 3300006358 Bacteria 1525
308 Ga0068871_100314858 3300006358 Bacteria 1376
309 Ga0075428_100001989 3300006844 Bacteria 22029
310 Ga0075428_100025341 3300006844 Bacteria 6564
311 Ga0075428_100093431 3300006844 Bacteria 3279
312 Ga0075430_100013481 3300006846 Bacteria 6968
313 Ga0075430_100049533 3300006846 Bacteria 3545
314 Ga0075430_100057765 3300006846 Bacteria 3263
315 Ga0075430_100191234 3300006846 Bacteria 1701
316 Ga0075431_100000077 3300006847 Bacteria 57475
317 Ga0075431_100010025 3300006847 Bacteria 9518
318 Ga0075431_100010660 3300006847 Bacteria 9237
319 Ga0075431_100013529 3300006847 Bacteria 8245
320 Ga0075431_100097175 3300006847 Bacteria 3041
321 Ga0075431_100291621 3300006847 Bacteria 1650
322 Ga0075433_10013143 3300006852 Bacteria 6719
323 Ga0075434_100000204 3300006871 Bacteria 40084
324 Ga0075429_100000019 3300006880 Bacteria 70971
325 Ga0075429_100000208 3300006880 Bacteria 39267
326 Ga0075429_100002310 3300006880 Bacteria 16000
327 Ga0075429_100013327 3300006880 Bacteria 7128
328 Ga0075429_100024433 3300006880 Bacteria 5243
329 Ga0075429_100100487 3300006880 Bacteria 2525
330 Ga0068865_100001062 3300006881 Bacteria 15802
331 Ga0068865_100024371 3300006881 Bacteria 3969
332 Ga0068865_100052323 3300006881 Bacteria 2830
333 Ga0068865_100209211 3300006881 Bacteria 1519
334 Ga0097620_100000253 3300006931 Bacteria 53069
335 Ga0097620_100006199 3300006931 Bacteria 12150
336 Ga0097620_100015395 3300006931 Bacteria 7685
337 Ga0097620_100015782 3300006931 Bacteria 7589
338 Ga0097620_100018481 3300006931 Bacteria 7006
339 Ga0097620_100079120 3300006931 Bacteria 3327
340 Ga0097620_100094531 3300006931 Bacteria 3041
341 Ga0097620_100122665 3300006931 Bacteria 2665
342 Ga0097620_100457944 3300006931 Bacteria 1371
343 Ga0075435_100003374 3300007076 Bacteria 10831
344 Ga0075435_100005884 3300007076 Bacteria 8630
345 Ga0075435_100130109 3300007076 Bacteria 2106
346 Ga0099794_10002384 3300007265 Bacteria 6920
347 Ga0099794_10015352 3300007265 Bacteria 3379
348 Ga0099794_10016356 3300007265 Bacteria 3287
349 Ga0099795_10000234 3300007788 Bacteria 9765
350 Ga0105251_10000043 3300009011 Bacteria 113848
351 Ga0105240_10000760 3300009093 Bacteria 58925
352 Ga0105240_10001599 3300009093 Bacteria 38474
353 Ga0105240_10002211 3300009093 Bacteria 31723
354 Ga0105240_10002714 3300009093 Bacteria 28107
355 Ga0105240_10004577 3300009093 Bacteria 20971
356 Ga0105240_10006209 3300009093 Bacteria 17574
357 Ga0105240_10006435 3300009093 Bacteria 17267
358 Ga0105240_10006620 3300009093 Bacteria 17008
359 Ga0105240_10016618 3300009093 Bacteria 9953
360 Ga0105240_10018889 3300009093 Bacteria 9230
361 Ga0105240_10043447 3300009093 Bacteria 5718
362 Ga0105240_10047021 3300009093 Bacteria 5463
363 Ga0105240_10064068 3300009093 Bacteria 4569
364 Ga0105240_10092430 3300009093 Bacteria 3694
365 Ga0105240_10202073 3300009093 Bacteria 2328
366 Ga0105240_10263648 3300009093 Bacteria 1986
367 Ga0111539_10000277 3300009094 Bacteria 61362
368 Ga0111539_10000660 3300009094 Bacteria 44559
369 Ga0111539_10023238 3300009094 Bacteria 7616
370 Ga0111539_10033962 3300009094 Bacteria 6189
371 Ga0111539_10090554 3300009094 Bacteria 3595
372 Ga0111539_10121571 3300009094 Bacteria 3059
373 Ga0105245_10005588 3300009098 Bacteria 11044
374 Ga0105245_10010063 3300009098 Bacteria 8240
375 Ga0105245_10024118 3300009098 Bacteria 5341
376 Ga0105245_10146415 3300009098 Bacteria 2229
377 Ga0105247_10001306 3300009101 Bacteria 18293
378 Ga0105247_10015443 3300009101 Bacteria 4574
379 Ga0114129_10000140 3300009147 Bacteria 75593
380 Ga0114129_10007801 3300009147 Bacteria 15231
381 Ga0114129_10011889 3300009147 Bacteria 12382
382 Ga0105243_10001776 3300009148 Bacteria 18517
383 Ga0105243_10026919 3300009148 Bacteria 4404
384 Ga0105243_10055619 3300009148 Bacteria 3144
385 Ga0105243_10395106 3300009148 Bacteria 1283
386 Ga0105241_10045630 3300009174 Bacteria 3326
387 Ga0105241_10150552 3300009174 Bacteria 1903
388 Ga0105242_10003224 3300009176 Bacteria 12720
389 Ga0105242_10225280 3300009176 Bacteria 1678
390 Ga0105248_10008298 3300009177 Bacteria 11411
391 Ga0105248_10062484 3300009177 Bacteria 4181
392 Ga0105248_10072048 3300009177 Bacteria 3883
393 Ga0105248_10091826 3300009177 Bacteria 3419
394 Ga0105248_10193964 3300009177 Bacteria 2289
395 Ga0105248_10290856 3300009177 Bacteria 1840
396 Ga0105248_10312241 3300009177 Bacteria 1771
397 Ga0105237_10020287 3300009545 Bacteria 6855
398 Ga0105237_10111692 3300009545 Bacteria 2725
399 Ga0105237_10122798 3300009545 Bacteria 2591
400 Ga0105237_10138435 3300009545 Bacteria 2429
401 Ga0105237_10251341 3300009545 Bacteria 1770
402 Ga0105237_10301147 3300009545 Bacteria 1606
403 Ga0105237_10436254 3300009545 Bacteria 1315
404 Ga0105237_10476510 3300009545 Bacteria 1254
405 Ga0105238_10001924 3300009551 Bacteria 20848
406 Ga0105238_10002536 3300009551 Bacteria 18246
407 Ga0105238_10014052 3300009551 Bacteria 8096
408 Ga0105238_10019205 3300009551 Bacteria 6961
409 Ga0105238_10029625 3300009551 Bacteria 5575
410 Ga0105238_10208949 3300009551 Bacteria 1928
411 Ga0105238_10406647 3300009551 Bacteria 1355
412 Ga0105249_10027048 3300009553 Bacteria 5174
413 Ga0105249_10218934 3300009553 Bacteria 1872
414 Ga0099796_10000467 3300010159 Bacteria 6806
415 Ga0105239_10020458 3300010375 Bacteria 7299
416 Ga0105239_10161706 3300010375 Bacteria 2502
417 Ga0105239_10283679 3300010375 Bacteria 1865
418 Ga0105239_10313309 3300010375 Bacteria 1769
419 Ga0105246_10062603 3300011119 Bacteria 2593
420 Ga0105246_10079015 3300011119 Bacteria 2338
421 Ga0105246_10205733 3300011119 Bacteria 1533
422 Ga0105246_10326172 3300011119 Bacteria 1250
423 Ga0157373_10020648 3300013100 Bacteria 4784
424 Ga0157370_10000890 3300013104 Bacteria 37928
425 Ga0157370_10003740 3300013104 Bacteria 17787
426 Ga0157370_10006678 3300013104 Bacteria 12667
427 Ga0157370_10071356 3300013104 Bacteria 3276
428 Ga0157370_10110858 3300013104 Bacteria 2565
429 Ga0157369_10001971 3300013105 Bacteria 24762
430 Ga0157369_10007730 3300013105 Bacteria 12365
431 Ga0157369_10015794 3300013105 Bacteria 8506
432 Ga0157369_10028361 3300013105 Bacteria 6196
433 Ga0157369_10040421 3300013105 Bacteria 5091
434 Ga0157369_10102907 3300013105 Bacteria 3042
435 Ga0157369_10128738 3300013105 Bacteria 2683
436 Ga0157369_10215306 3300013105 Bacteria 2012
437 Ga0157374_10018746 3300013296 Bacteria 6114
438 Ga0157374_10332316 3300013296 Bacteria 1508
439 Ga0157374_10420632 3300013296 Bacteria 1335
440 Ga0157378_10008705 3300013297 Bacteria 8832
441 Ga0157378_10026047 3300013297 Bacteria 5155
442 Ga0157378_10124138 3300013297 Bacteria 2383
443 Ga0157378_10367157 3300013297 Bacteria 1410
444 Ga0157378_10472672 3300013297 Bacteria 1248
445 Ga0163162_10000655 3300013306 Bacteria 32037
446 Ga0163162_10008965 3300013306 Bacteria 9727
447 Ga0163162_10127222 3300013306 Bacteria 2655
448 Ga0163162_10259799 3300013306 Bacteria 1868
449 Ga0157372_10002980 3300013307 Bacteria 18240
450 Ga0157372_10025602 3300013307 Bacteria 6418
451 Ga0157372_10057816 3300013307 Bacteria 4335
452 Ga0157372_10058620 3300013307 Bacteria 4305
453 Ga0157372_10093826 3300013307 Bacteria 3416
454 Ga0157372_10176679 3300013307 Bacteria 2471
455 Ga0157372_10227793 3300013307 Bacteria 2160
456 Ga0157375_10005328 3300013308 Bacteria 11175
457 Ga0157375_10009938 3300013308 Bacteria 8369
458 Ga0157375_10079484 3300013308 Bacteria 3315
459 Ga0157375_10095255 3300013308 Bacteria 3047
460 Ga0157375_10148680 3300013308 Bacteria 2476
461 Ga0157375_10261261 3300013308 Bacteria 1893
462 Ga0157375_10709780 3300013308 Bacteria 1159
463 Ga0163163_10001355 3300014325 Bacteria 20667
464 Ga0163163_10002424 3300014325 Bacteria 15774
465 Ga0163163_10073516 3300014325 Bacteria 3410
466 Ga0163163_10287139 3300014325 Bacteria 1697
467 Ga0157380_10012492 3300014326 Bacteria 6162
468 Ga0157380_10032710 3300014326 Bacteria 4003
469 Ga0157380_10121508 3300014326 Bacteria 2213
470 Ga0157380_10354750 3300014326 Bacteria 1374
471 Ga0157379_10002507 3300014968 Bacteria 15367
472 Ga0157379_10013568 3300014968 Bacteria 7140
473 Ga0157379_10027320 3300014968 Bacteria 5081
474 Ga0157379_10036848 3300014968 Bacteria 4361
475 Ga0157379_10043368 3300014968 Bacteria 4016
476 Ga0157379_10164225 3300014968 Bacteria 2004
477 Ga0157379_10211862 3300014968 Bacteria 1754
478 Ga0157379_10353418 3300014968 Bacteria 1346
479 Ga0157376_10008831 3300014969 Bacteria 7293
480 Ga0157376_10284486 3300014969 Bacteria 1559
481 Ga0157376_10345329 3300014969 Bacteria 1422
482 Ga0182006_1004726 3300015261 Bacteria 6657
483 Ga0182006_1015446 3300015261 Bacteria 3273
484 Ga0182007_10000245 3300015262 Bacteria 36521
485 Ga0183362_10003 3300015683 Bacteria 977584
486 Ga0163161_10013868 3300017792 Bacteria 5615
487 Ga0163161_10040313 3300017792 Bacteria 3354
488 Ga0163161_10062884 3300017792 Bacteria 2704
489 Ga0213872_10000419 3300021361 Bacteria 34805
490 Ga0213872_10054286 3300021361 Bacteria 1817
491 Ga0213872_10092211 3300021361 Bacteria 1355
492 Ga0209672_100026 3300025228 Bacteria 348998
493 Ga0209147_100033 3300025229 Bacteria 348998
494 Ga0209258_100051 3300025242 Bacteria 348998
495 Ga0209026_1000952 3300025250 Bacteria 14523
496 Ga0209148_1000328 3300025254 Bacteria 65887
497 Ga0209759_1000773 3300025256 Bacteria 26972
498 Ga0207666_1004688 3300025271 Bacteria 1723
499 Ga0209455_1000252 3300025272 Bacteria 63647
500 Ga0209025_1000115 3300025294 Bacteria 218871
501 Ga0209564_1005666 3300025295 Bacteria 7010
502 Ga0209051_1046486 3300025303 Bacteria 1493
503 Ga0207656_10006944 3300025321 Bacteria 4105
504 Ga0207656_10011244 3300025321 Bacteria 3378
505 Ga0207656_10035556 3300025321 Bacteria 2087
506 Ga0207656_10152649 3300025321 Bacteria 1095
507 Ga0207713_1000240 3300025735 Bacteria 73219
508 Ga0207682_10023878 3300025893 Bacteria 2418
509 Ga0207642_10009459 3300025899 Bacteria 3391
510 Ga0207642_10067592 3300025899 Bacteria 1688
511 Ga0207710_10000538 3300025900 Bacteria 23137
512 Ga0207710_10011325 3300025900 Bacteria 3755
513 Ga0207688_10019841 3300025901 Bacteria 3665
514 Ga0207680_10006697 3300025903 Bacteria 5590
515 Ga0207680_10276697 3300025903 Bacteria 1165
516 Ga0207647_10001239 3300025904 Bacteria 19642
517 Ga0207647_10061551 3300025904 Bacteria 2290
518 Ga0207645_10099625 3300025907 Bacteria 1874
519 Ga0207645_10139566 3300025907 Bacteria 1579
520 Ga0207643_10004764 3300025908 Bacteria 7269
521 Ga0207643_10005459 3300025908 Bacteria 6798
522 Ga0207643_10040443 3300025908 Bacteria 2625
523 Ga0207643_10127821 3300025908 Bacteria 1510
524 Ga0207705_10150791 3300025909 Bacteria 1742
525 Ga0207705_10261473 3300025909 Bacteria 1321
526 Ga0207684_10042338 3300025910 Bacteria 3860
527 Ga0207684_10289787 3300025910 Bacteria 1412
528 Ga0207654_10027099 3300025911 Bacteria 3112
529 Ga0207707_10000999 3300025912 Bacteria 27087
530 Ga0207707_10003421 3300025912 Bacteria 14070
531 Ga0207707_10007561 3300025912 Bacteria 9465
532 Ga0207707_10009440 3300025912 Bacteria 8461
533 Ga0207707_10067077 3300025912 Bacteria 3125
534 Ga0207707_10081933 3300025912 Bacteria 2817
535 Ga0207707_10283545 3300025912 Bacteria 1434
536 Ga0207707_10289262 3300025912 Bacteria 1418
537 Ga0207695_10000372 3300025913 Bacteria 101840
538 Ga0207695_10002611 3300025913 Bacteria 26367
539 Ga0207695_10004603 3300025913 Bacteria 18730
540 Ga0207695_10011587 3300025913 Bacteria 10663
541 Ga0207695_10023693 3300025913 Bacteria 6927
542 Ga0207695_10032813 3300025913 Bacteria 5675
543 Ga0207695_10034143 3300025913 Bacteria 5537
544 Ga0207695_10035292 3300025913 Bacteria 5426
545 Ga0207695_10040875 3300025913 Bacteria 4967
546 Ga0207695_10305546 3300025913 Bacteria 1481
547 Ga0207695_10412159 3300025913 Bacteria 1236
548 Ga0207671_10030597 3300025914 Bacteria 4013
549 Ga0207671_10098841 3300025914 Bacteria 2208
550 Ga0207671_10101676 3300025914 Bacteria 2178
551 Ga0207671_10275549 3300025914 Bacteria 1326
552 Ga0207663_10155978 3300025916 Bacteria 1606
553 Ga0207663_10314425 3300025916 Bacteria 1175
554 Ga0207660_10004733 3300025917 Bacteria 8860
555 Ga0207660_10012148 3300025917 Bacteria 5628
556 Ga0207660_10038383 3300025917 Bacteria 3343
557 Ga0207660_10077593 3300025917 Bacteria 2432
558 Ga0207660_10110635 3300025917 Bacteria 2067
559 Ga0207662_10003006 3300025918 Bacteria 8590
560 Ga0207662_10013087 3300025918 Bacteria 4635
561 Ga0207662_10078226 3300025918 Bacteria 2013
562 Ga0207662_10122087 3300025918 Bacteria 1635
563 Ga0207657_10001557 3300025919 Bacteria 24609
564 Ga0207657_10002377 3300025919 Bacteria 20356
565 Ga0207657_10018692 3300025919 Bacteria 6604
566 Ga0207657_10023713 3300025919 Bacteria 5706
567 Ga0207657_10055596 3300025919 Bacteria 3418
568 Ga0207657_10089864 3300025919 Bacteria 2564
569 Ga0207649_10009407 3300025920 Bacteria 5348
570 Ga0207652_10007161 3300025921 Bacteria 8995
571 Ga0207652_10074627 3300025921 Bacteria 2953
572 Ga0207652_10192792 3300025921 Bacteria 1833
573 Ga0207646_10114637 3300025922 Bacteria 2420
574 Ga0207681_10003209 3300025923 Bacteria 10260
575 Ga0207681_10004286 3300025923 Bacteria 8806
576 Ga0207681_10043952 3300025923 Bacteria 2992
577 Ga0207694_10011446 3300025924 Bacteria 6694
578 Ga0207694_10062995 3300025924 Bacteria 2888
579 Ga0207694_10066550 3300025924 Bacteria 2811
580 Ga0207694_10076469 3300025924 Bacteria 2622
581 Ga0207650_10018773 3300025925 Bacteria 4856
582 Ga0207650_10105835 3300025925 Bacteria 2172
583 Ga0207650_10227091 3300025925 Bacteria 1504
584 Ga0207659_10000504 3300025926 Bacteria 23477
585 Ga0207659_10007377 3300025926 Bacteria 6757
586 Ga0207659_10026286 3300025926 Bacteria 3926
587 Ga0207659_10092162 3300025926 Bacteria 2265
588 Ga0207659_10164256 3300025926 Bacteria 1746
589 Ga0207659_10210315 3300025926 Bacteria 1559
590 Ga0207659_10248509 3300025926 Bacteria 1442
591 Ga0207687_10002479 3300025927 Bacteria 12536
592 Ga0207687_10056276 3300025927 Bacteria 2758
593 Ga0207687_10325347 3300025927 Bacteria 1246
594 Ga0207700_10018771 3300025928 Bacteria 4656
595 Ga0207700_10282173 3300025928 Bacteria 1429
596 Ga0207700_10367539 3300025928 Bacteria 1255
597 Ga0207664_10002954 3300025929 Bacteria 11291
598 Ga0207664_10004364 3300025929 Bacteria 9582
599 Ga0207644_10014289 3300025931 Bacteria 5311
600 Ga0207644_10035583 3300025931 Bacteria 3490
601 Ga0207644_10100801 3300025931 Bacteria 2169
602 Ga0207644_10108322 3300025931 Bacteria 2097
603 Ga0207690_10014884 3300025932 Bacteria 4708
604 Ga0207690_10038603 3300025932 Bacteria 3109
605 Ga0207690_10100789 3300025932 Bacteria 2062
606 Ga0207706_10017228 3300025933 Bacteria 6513
607 Ga0207706_10064398 3300025933 Bacteria 3227
608 Ga0207686_10006895 3300025934 Bacteria 6116
609 Ga0207686_10070377 3300025934 Bacteria 2248
610 Ga0207709_10003263 3300025935 Bacteria 9728
611 Ga0207709_10007438 3300025935 Bacteria 6098
612 Ga0207670_10013321 3300025936 Bacteria 4843
613 Ga0207670_10013767 3300025936 Bacteria 4782
614 Ga0207670_10016809 3300025936 Bacteria 4407
615 Ga0207670_10024359 3300025936 Bacteria 3782
616 Ga0207670_10079956 3300025936 Bacteria 2284
617 Ga0207670_10130562 3300025936 Bacteria 1840
618 Ga0207670_10161187 3300025936 Bacteria 1674
619 Ga0207669_10002388 3300025937 Bacteria 7992
620 Ga0207669_10041562 3300025937 Bacteria 2677
621 Ga0207669_10102974 3300025937 Bacteria 1892
622 Ga0207704_10016656 3300025938 Bacteria 3784
623 Ga0207704_10114313 3300025938 Bacteria 1832
624 Ga0207665_10023366 3300025939 Bacteria 4073
625 Ga0207665_10033344 3300025939 Bacteria 3412
626 Ga0207665_10224313 3300025939 Bacteria 1378
627 Ga0207691_10006936 3300025940 Bacteria 10925
628 Ga0207691_10073497 3300025940 Bacteria 3084
629 Ga0207691_10094169 3300025940 Bacteria 2681
630 Ga0207691_10145270 3300025940 Bacteria 2088
631 Ga0207691_10201245 3300025940 Bacteria 1733
632 Ga0207691_10213788 3300025940 Bacteria 1674
633 Ga0207691_10214007 3300025940 Bacteria 1673
634 Ga0207691_10296756 3300025940 Bacteria 1389
635 Ga0207711_10037939 3300025941 Bacteria 4096
636 Ga0207711_10092214 3300025941 Bacteria 2666
637 Ga0207711_10118849 3300025941 Bacteria 2358
638 Ga0207711_10261779 3300025941 Bacteria 1590
639 Ga0207689_10001646 3300025942 Bacteria 21167
640 Ga0207689_10002213 3300025942 Bacteria 18225
641 Ga0207689_10003936 3300025942 Bacteria 13518
642 Ga0207689_10005924 3300025942 Bacteria 10826
643 Ga0207689_10011714 3300025942 Bacteria 7515
644 Ga0207689_10030091 3300025942 Bacteria 4526
645 Ga0207689_10052871 3300025942 Bacteria 3346
646 Ga0207689_10112441 3300025942 Bacteria 2238
647 Ga0207661_10079658 3300025944 Bacteria 2700
648 Ga0207679_10004394 3300025945 Bacteria 8779
649 Ga0207679_10026262 3300025945 Bacteria 4014
650 Ga0207679_10056694 3300025945 Bacteria 2894
651 Ga0207667_10001268 3300025949 Bacteria 31682
652 Ga0207667_10003353 3300025949 Bacteria 19766
653 Ga0207667_10009964 3300025949 Bacteria 11147
654 Ga0207667_10036735 3300025949 Bacteria 5246
655 Ga0207667_10067327 3300025949 Bacteria 3731
656 Ga0207667_10086186 3300025949 Bacteria 3250
657 Ga0207667_10304377 3300025949 Bacteria 1629
658 Ga0207651_10014883 3300025960 Bacteria 4504
659 Ga0207651_10026564 3300025960 Bacteria 3620
660 Ga0207651_10059375 3300025960 Bacteria 2649
661 Ga0207712_10064747 3300025961 Bacteria 2607
662 Ga0207712_10122786 3300025961 Bacteria 1968
663 Ga0207712_10124040 3300025961 Bacteria 1959
664 Ga0207668_10060144 3300025972 Bacteria 2665
665 Ga0207640_10019344 3300025981 Bacteria 4021
666 Ga0207658_10002948 3300025986 Bacteria 12186
667 Ga0207658_10027235 3300025986 Bacteria 4014
668 Ga0207658_10095871 3300025986 Bacteria 2312
669 Ga0207658_10188073 3300025986 Bacteria 1714
670 Ga0207658_10397135 3300025986 Bacteria 1211
671 Ga0207677_10004422 3300026023 Bacteria 7540
672 Ga0207677_10006268 3300026023 Bacteria 6507
673 Ga0207677_10029726 3300026023 Bacteria 3477
674 Ga0207677_10036882 3300026023 Bacteria 3190
675 Ga0207677_10236545 3300026023 Bacteria 1475
676 Ga0207677_10302256 3300026023 Bacteria 1322
677 Ga0207703_10000899 3300026035 Bacteria 29113
678 Ga0207703_10001339 3300026035 Bacteria 22554
679 Ga0207703_10003150 3300026035 Bacteria 13916
680 Ga0207703_10015310 3300026035 Bacteria 5983
681 Ga0207703_10032230 3300026035 Bacteria 4147
682 Ga0207703_10042866 3300026035 Bacteria 3630
683 Ga0207703_10053261 3300026035 Bacteria 3288
684 Ga0207703_10092420 3300026035 Bacteria 2547
685 Ga0207703_10098931 3300026035 Bacteria 2468
686 Ga0207703_10120544 3300026035 Bacteria 2251
687 Ga0207703_10181161 3300026035 Bacteria 1859
688 Ga0207639_10096243 3300026041 Bacteria 2381
689 Ga0207639_10118183 3300026041 Bacteria 2174
690 Ga0207639_10118266 3300026041 Bacteria 2173
691 Ga0207639_10483275 3300026041 Bacteria 1129
692 Ga0207639_10624108 3300026041 Bacteria 995
693 Ga0207678_10056179 3300026067 Bacteria 3389
694 Ga0207678_10063172 3300026067 Bacteria 3182
695 Ga0207678_10097707 3300026067 Bacteria 2509
696 Ga0207678_10104879 3300026067 Bacteria 2412
697 Ga0207678_10192775 3300026067 Bacteria 1742
698 Ga0207708_10004385 3300026075 Bacteria 10398
699 Ga0207708_10007997 3300026075 Bacteria 7834
700 Ga0207708_10010897 3300026075 Bacteria 6763
701 Ga0207708_10058902 3300026075 Bacteria 2931
702 Ga0207708_10140355 3300026075 Bacteria 1895
703 Ga0207708_10255812 3300026075 Bacteria 1412
704 Ga0207702_10001106 3300026078 Bacteria 27575
705 Ga0207702_10150724 3300026078 Bacteria 2115
706 Ga0207641_10011464 3300026088 Bacteria 7276
707 Ga0207641_10012901 3300026088 Bacteria 6855
708 Ga0207641_10013953 3300026088 Bacteria 6588
709 Ga0207641_10015567 3300026088 Bacteria 6232
710 Ga0207641_10037955 3300026088 Bacteria 4025
711 Ga0207641_10089998 3300026088 Bacteria 2683
712 Ga0207641_10186874 3300026088 Bacteria 1902
713 Ga0207641_10365072 3300026088 Bacteria 1379
714 Ga0207648_10000484 3300026089 Bacteria 44276
715 Ga0207648_10008361 3300026089 Bacteria 10031
716 Ga0207648_10010090 3300026089 Bacteria 8980
717 Ga0207648_10019355 3300026089 Bacteria 6145
718 Ga0207648_10068205 3300026089 Bacteria 3099
719 Ga0207648_10083569 3300026089 Bacteria 2784
720 Ga0207648_10095391 3300026089 Bacteria 2602
721 Ga0207648_10106585 3300026089 Bacteria 2460
722 Ga0207648_10152587 3300026089 Bacteria 2039
723 Ga0207648_10187114 3300026089 Bacteria 1834
724 Ga0207648_10535491 3300026089 Bacteria 1074
725 Ga0207676_10000216 3300026095 Bacteria 49875
726 Ga0207676_10005169 3300026095 Bacteria 9234
727 Ga0207676_10017461 3300026095 Bacteria 5200
728 Ga0207676_10189986 3300026095 Bacteria 1806
729 Ga0207676_10285372 3300026095 Bacteria 1500
730 Ga0207674_10000292 3300026116 Bacteria 63309
731 Ga0207674_10012012 3300026116 Bacteria 9701
732 Ga0207674_10114395 3300026116 Bacteria 2670
733 Ga0207675_100001426 3300026118 Bacteria 23961
734 Ga0207675_100001767 3300026118 Bacteria 21608
735 Ga0207675_100001972 3300026118 Bacteria 20452
736 Ga0207675_100003149 3300026118 Bacteria 16180
737 Ga0207675_100003455 3300026118 Bacteria 15442
738 Ga0207675_100015452 3300026118 Bacteria 7120
739 Ga0207675_100018059 3300026118 Bacteria 6578
740 Ga0207675_100021232 3300026118 Bacteria 6048
741 Ga0207675_100041328 3300026118 Bacteria 4306
742 Ga0207675_100110877 3300026118 Bacteria 2589
743 Ga0207675_100288407 3300026118 Bacteria 1596
744 Ga0207683_10000920 3300026121 Bacteria 27089
745 Ga0207683_10007342 3300026121 Bacteria 9447
746 Ga0207683_10060407 3300026121 Bacteria 3332
747 Ga0207683_10072230 3300026121 Bacteria 3051
748 Ga0207683_10088043 3300026121 Bacteria 2762
749 Ga0207683_10204105 3300026121 Bacteria 1797
750 Ga0207698_10007793 3300026142 Bacteria 6729
751 Ga0207698_10016751 3300026142 Bacteria 4952
752 Ga0207698_10059132 3300026142 Bacteria 2974
753 Ga0207698_10076854 3300026142 Bacteria 2674
754 Ga0207698_10082638 3300026142 Bacteria 2597
755 Ga0207698_10497083 3300026142 Bacteria 1186
756 Ga0209969_1000861 3300027360 Bacteria 4093
757 Ga0209967_1005493 3300027364 Bacteria 1702
758 Ga0209981_1003420 3300027378 Bacteria 2062
759 Ga0209996_1003492 3300027395 Bacteria 1980
760 Ga0210000_1000129 3300027462 Bacteria 10819
761 Ga0210000_1004629 3300027462 Bacteria 1984
762 Ga0209999_1001944 3300027543 Bacteria 3598
763 Ga0209982_1001715 3300027552 Bacteria 3016
764 Ga0209983_1008824 3300027665 Bacteria 2058
765 Ga0209588_1014660 3300027671 Bacteria 2402
766 Ga0209588_1028137 3300027671 Bacteria 1789
767 Ga0209971_1001444 3300027682 Bacteria 5910
768 Ga0209966_1006585 3300027695 Bacteria 2019
769 Ga0209974_10007837 3300027876 Bacteria 3667
770 Ga0209974_10083958 3300027876 Bacteria 1099
771 Ga0207428_10003044 3300027907 Bacteria 16504
772 Ga0207428_10027877 3300027907 Bacteria 4698
773 Ga0207428_10031162 3300027907 Bacteria 4404
774 Ga0207428_10081767 3300027907 Bacteria 2522
775 Ga0265357_1007234 3300028023 Bacteria 1068
776 Ga0268266_10003005 3300028379 Bacteria 17351
777 Ga0268266_10020512 3300028379 Bacteria 5633
778 Ga0268266_10050834 3300028379 Bacteria 3557
779 Ga0268266_10057234 3300028379 Bacteria 3355
780 Ga0268266_10189434 3300028379 Bacteria 1877
781 Ga0268265_10016607 3300028380 Bacteria 5062
782 Ga0268265_10018358 3300028380 Bacteria 4845
783 Ga0268265_10099648 3300028380 Bacteria 2343
784 Ga0268265_10135273 3300028380 Bacteria 2055
785 Ga0268265_10263673 3300028380 Bacteria 1533
786 Ga0268265_10421918 3300028380 Bacteria 1239
787 Ga0268264_10000299 3300028381 Bacteria 80981
788 Ga0268264_10013145 3300028381 Bacteria 6808
789 Ga0268264_10024972 3300028381 Bacteria 4884
790 Ga0268264_10072281 3300028381 Bacteria 2925
791 Ga0268264_10327148 3300028381 Bacteria 1451
792 Ga0265334_10018682 3300028573 Bacteria 2859
793 Ga0265336_10007212 3300028666 Bacteria 3966
794 Ga0307517_10000024 3300028786 Bacteria 185597
795 Ga0307515_10000043 3300028794 Bacteria 304612
796 Ga0265338_10000058 3300028800 Bacteria 198555
797 Ga0265338_10006256 3300028800 Bacteria 15232
798 Ga0265338_10008827 3300028800 Bacteria 12160
799 Ga0265324_10007430 3300029957 Bacteria 4443
800 Ga0307511_10011888 3300030521 Bacteria 8564
801 Ga0265330_10000156 3300031235 Bacteria 55313
802 Ga0265330_10000564 3300031235 Bacteria 24138
803 Ga0265332_10000085 3300031238 Bacteria 82163
804 Ga0265332_10000157 3300031238 Bacteria 55228
805 Ga0265328_10001015 3300031239 Bacteria 12917
806 Ga0265328_10002908 3300031239 Bacteria 7637
807 Ga0265320_10014626 3300031240 Bacteria 4458
808 Ga0265325_10000396 3300031241 Bacteria 30886
809 Ga0265340_10003568 3300031247 Bacteria 8754
810 Ga0265340_10041778 3300031247 Bacteria 2253
811 Ga0265339_10007765 3300031249 Bacteria 6897
812 Ga0265331_10001313 3300031250 Bacteria 18434
813 Ga0265331_10022500 3300031250 Bacteria 3216
814 Ga0265327_10000549 3300031251 Bacteria 64188
815 Ga0265316_10004897 3300031344 Bacteria 13177
816 Ga0265316_10033511 3300031344 Bacteria 4182
817 Ga0307513_10027559 3300031456 Bacteria 6520
818 Ga0307509_10000001 3300031507 Bacteria 629324
819 Ga0307509_10000018 3300031507 Bacteria 258998
820 Ga0307509_10000109 3300031507 Bacteria 117520
821 Ga0307408_100060345 3300031548 Bacteria 2764
822 Ga0307408_100067510 3300031548 Bacteria 2630
823 Ga0307408_100264610 3300031548 Bacteria 1425
824 Ga0265313_10000729 3300031595 Bacteria 33816
825 Ga0307508_10007662 3300031616 Bacteria 10037
826 Ga0307508_10041267 3300031616 Bacteria 4142
827 Ga0307514_10048870 3300031649 Bacteria 3292
828 Ga0316575_10006556 3300031665 Bacteria 4193
829 Ga0265314_10000036 3300031711 Bacteria 234928
830 Ga0265314_10000446 3300031711 Bacteria 55219
831 Ga0265342_10000765 3300031712 Bacteria 32742
832 Ga0316578_10019647 3300031728 Bacteria 3723
833 Ga0307516_10054864 3300031730 Bacteria 3893
834 Ga0307405_10010260 3300031731 Bacteria 4841
835 Ga0307405_10115913 3300031731 Bacteria 1824
836 Ga0307405_10157866 3300031731 Bacteria 1603
837 Ga0307410_10006700 3300031852 Bacteria 6241
838 Ga0307410_10136581 3300031852 Bacteria 1808
839 Ga0307406_10261223 3300031901 Bacteria 1310
840 Ga0307407_10028986 3300031903 Bacteria 2967
841 Ga0307412_10047607 3300031911 Bacteria 2817
842 Ga0307412_10070451 3300031911 Bacteria 2383
843 Ga0307412_10211161 3300031911 Bacteria 1481
844 Ga0307416_100067305 3300032002 Bacteria 2953
845 Ga0307416_100083196 3300032002 Bacteria 2714
846 Ga0307416_100090074 3300032002 Bacteria 2629
847 Ga0307416_100099458 3300032002 Bacteria 2526
848 Ga0307416_100175122 3300032002 Bacteria 2003
849 Ga0307416_100175163 3300032002 Bacteria 2003
850 Ga0307416_100263547 3300032002 Bacteria 1686
851 Ga0307416_100357342 3300032002 Bacteria 1481
852 Ga0307411_10000606 3300032005 Bacteria 12875
853 Ga0307411_10136334 3300032005 Bacteria 1802
854 Ga0307411_10486995 3300032005 Bacteria 1040
855 Ga0307415_100013217 3300032126 Bacteria 4812
856 Ga0307415_100239284 3300032126 Bacteria 1467
857 Ga0307415_100318512 3300032126 Bacteria 1296
858 Ga0316583_10006551 3300032133 Bacteria 4184
859 Ga0316583_10007061 3300032133 Bacteria 4039
860 Ga0373930_0000484 3300034816 Bacteria 5392
861 Ga0373938_0004945 3300034957 Bacteria 2248
862 Ga0373938_0022085 3300034957 Bacteria 1297
863 Ga0373934_0009726 3300035086 Bacteria 3607
864 Ga0373940_0001325 3300035088 Bacteria 4412
865 Ga0373944_0044708 3300035089 Bacteria 1380
866 Ga0373949_0004944 3300035090 Bacteria 3009
867 Ga0373952_0002430 3300035092 Bacteria 3359
868 Ga0373923_0013458 3300035111 Bacteria 3050
869 Ga0373932_0001860 3300035112 Bacteria 5652
870 Ga0373932_0002355 3300035112 Bacteria 4796
871 Ga0373936_0003169 3300035113 Bacteria 6156
872 Ga0373936_0006544 3300035113 Bacteria 4387
873 Ga0373945_0018321 3300035116 Bacteria 2381
874 Ga0373953_0001139 3300035117 Bacteria 7546
875 Ga0373956_0026985 3300035119 Bacteria 2490
876 Ga0373957_0031285 3300035120 Bacteria 1955
877 Ga0373960_0010732 3300035121 Bacteria 2244
878 Ga0373960_0016610 3300035121 Bacteria 1897
879 Ga0373943_0014340 3300035170 Bacteria 3587
880 Ga0373943_0103771 3300035170 Bacteria 1490
881 Ga0373955_0020888 3300035172 Bacteria 3297
882 Ga0373955_0064615 3300035172 Bacteria 2029
883 Ga0373961_0006886 3300035241 Bacteria 2735
884 Ga0373961_0007299 3300035241 Bacteria 2671
885 Ga0373961_0023801 3300035241 Bacteria 1651
886 Ga0373962_0004968 3300035242 Bacteria 3216
887 Ga0316574_0195504 3300035398 Bacteria 1300
888 Ga0373924_0002265 3300035410 Bacteria 6455
889 Ga0373924_0008436 3300035410 Bacteria 3745
890 Ga0373924_0013759 3300035410 Bacteria 3045
891 Ga0373924_0120039 3300035410 Bacteria 1140
892 Ga0373931_0001851 3300035691 Bacteria 9207
893 Ga0373931_0002614 3300035691 Bacteria 8011
894 Ga0373931_0009572 3300035691 Bacteria 4635
895 Ga0373931_0049571 3300035691 Bacteria 2231
896 Ga0373931_0224752 3300035691 Bacteria 1132
897 Ga0373935_0051018 3300035692 Bacteria 2627
898 Ga0373935_0057983 3300035692 Bacteria 2472
899 Ga0373927_0034159 3300035695 Bacteria 3309
900 Ga0373933_0005006 3300035724 Bacteria 7228
901 Ga0373933_0350295 3300035724 Bacteria 959
902 Ga0373937_0005534 3300036401 Bacteria 10832
903 Ga0373937_0006172 3300036401 Bacteria 10319
904 Ga0373937_0022263 3300036401 Bacteria 5696
905 Ga0373937_0078668 3300036401 Bacteria 3047
906 Ga0373937_0189572 3300036401 Bacteria 1932
907 Ga0316582_0025856 3300036647 Bacteria 3529
908 Ga0373925_0005195 3300037068 Bacteria 9740
909 Ga0373925_0008462 3300037068 Bacteria 7497
910 Ga0373925_0009800 3300037068 Bacteria 6956
911 Ga0373925_0013565 3300037068 Bacteria 5899
912 Ga0373925_0076340 3300037068 Bacteria 2540
913 Ga0373925_0098336 3300037068 Bacteria 2246
914 Ga0373925_0115562 3300037068 Bacteria 2078
915 Ga0373925_0154818 3300037068 Bacteria 1802
916 Ga0373925_0423294 3300037068 Bacteria 1088
917 Ga0373925_0605854 3300037068 Bacteria 902
918 Ga0395899_0119945 3300037312 Bacteria 1885
919 Ga0395905_0002868 3300037471 Bacteria 18825
920 Ga0395905_0010024 3300037471 Bacteria 9236
921 Ga0395901_0056428 3300038443 Bacteria 4085
922 Ga0436360_0867881 3300039438 Bacteria 4438
923 Ga0436361_0106893 3300039447 Bacteria 33853
924 Ga0436361_0115046 3300039447 Bacteria 2357
925 Ga0436361_0149387 3300039447 Bacteria 5189
926 Ga0436361_0298613 3300039447 Bacteria 2252
927 Ga0436361_1015109 3300039447 Bacteria 3088
928 Ga0436361_1035781 3300039447 Bacteria 3040
929 Ga0436363_0441792 3300039450 Bacteria 8029
930 Ga0439447_029963 3300041407 Bacteria 1374
931 Ga0439466_0001370 3300041411 Bacteria 9476
932 Ga0451853_3964788 3300041512 Bacteria 1373
933 Ga0439431_0003640 3300041997 Bacteria 3401
934 Ga0439448_0002019 3300042005 Bacteria 5426
935 Ga0439432_011742 3300042006 Bacteria 3012
936 Ga0439450_021130 3300042008 Bacteria 1395
937 Ga0439455_0002250 3300042012 Bacteria 3465
938 Ga0450888_006722 3300042126 Bacteria 1257
939 Ga0439464_0010768 3300042439 Bacteria 2417
940 Ga0439460_0004047 3300042461 Bacteria 3562
941 Ga0451577_0002804 3300042876 Bacteria 20111
942 Ga0451577_0003002 3300042876 Bacteria 19230
943 Ga0451577_0029523 3300042876 Bacteria 4957
944 Ga0451577_0051298 3300042876 Bacteria 3683
945 Ga0451577_0056299 3300042876 Bacteria 3507
946 Ga0451577_0116278 3300042876 Unclassified 2395
947 Ga0451577_0125332 3300042876 Bacteria 2302
948 Ga0466969_0001856 3300044656 Bacteria 11299
949 Ga0466969_0002107 3300044656 Bacteria 10610
950 Ga0453683_0017707 3300044673 Bacteria 4583
951 Ga0453683_0024472 3300044673 Bacteria 3841
952 Ga0453683_0026181 3300044673 Bacteria 3705
953 Ga0453683_0067113 3300044673 Bacteria 2242
954 Ga0466966_0003642 3300044684 Bacteria 10169
955 Ga0466961_0001050 3300044693 Bacteria 17009
956 Ga0466964_0001846 3300044706 Bacteria 7373
957 Ga0453684_0000789 3300044712 Bacteria 108459
958 Ga0453684_0001404 3300044712 Bacteria 69532
959 Ga0453684_0005874 3300044712 Bacteria 23847
960 Ga0453684_0021384 3300044712 Bacteria 9667
961 Ga0453684_0056579 3300044712 Bacteria 5086
962 Ga0453684_0111559 3300044712 Bacteria 3322
963 Ga0453684_0584459 3300044712 Bacteria 1226
964 Ga0453684_0665782 3300044712 Bacteria 1134
965 Ga0453684_0735601 3300044712 Bacteria 1069
966 Ga0466971_0000216 3300044719 Bacteria 22087
967 Ga0466970_0005778 3300044765 Bacteria 6149
968 Ga0466957_0055856 3300044842 Bacteria 2413
969 Ga0451576_0000674 3300045051 Bacteria 69516
970 Ga0451576_0015471 3300045051 Bacteria 8450
971 Ga0451576_0025255 3300045051 Bacteria 6402
972 Ga0451576_0043727 3300045051 Bacteria 4725
973 Ga0451576_0054139 3300045051 Bacteria 4202
974 Ga0451576_0061972 3300045051 Bacteria 3900
975 Ga0451576_0069622 3300045051 Bacteria 3661
976 Ga0451576_0075225 3300045051 Bacteria 3513
977 Ga0451576_0366656 3300045051 Bacteria 1509
978 Ga0466967_0023171 3300045976 Bacteria 5084
979 Ga0495592_0031259 3300046454 Bacteria 4024
980 Ga0495592_0054489 3300046454 Bacteria 2963
981 Ga0495603_0001866 3300046455 Bacteria 12413
982 Ga0495603_0006042 3300046455 Bacteria 7240
983 Ga0495603_0031425 3300046455 Bacteria 3196
984 Ga0495603_0059548 3300046455 Bacteria 2258
985 Ga0495603_0078298 3300046455 Bacteria 1939
986 Ga0495591_008842 3300046458 Bacteria 4070
987 Ga0495629_0000224 3300046459 Bacteria 50510
988 Ga0495629_0030251 3300046459 Bacteria 3840
989 Ga0495629_0100995 3300046459 Bacteria 2013
990 Ga0495629_0140797 3300046459 Bacteria 1678
991 Ga0495629_0238256 3300046459 Bacteria 1253
992 Ga0495638_0002026 3300046460 Bacteria 17240
993 Ga0495638_0010227 3300046460 Bacteria 6530
994 Ga0495638_0229638 3300046460 Bacteria 1033
995 Ga0495641_0007096 3300046461 Bacteria 7093
996 Ga0495651_0014853 3300046462 Bacteria 6020
997 Ga0495653_0001151 3300046463 Bacteria 20356
998 Ga0495653_0001599 3300046463 Bacteria 17790
999 Ga0495653_0017344 3300046463 Bacteria 5856
1000 Ga0495650_0002288 3300046471 Bacteria 15923
1001 Ga0495580_0000700 3300046472 Bacteria 28661
1002 Ga0495580_0001538 3300046472 Bacteria 20295
1003 Ga0495580_0002263 3300046472 Bacteria 16815
1004 Ga0495580_0003902 3300046472 Bacteria 12604
1005 Ga0495580_0008595 3300046472 Bacteria 8101
1006 Ga0495580_0009699 3300046472 Bacteria 7552
1007 Ga0495580_0025496 3300046472 Bacteria 4321
1008 Ga0495580_0033047 3300046472 Bacteria 3728
1009 Ga0495580_0033173 3300046472 Bacteria 3721
1010 Ga0495580_0082434 3300046472 Bacteria 2241
1011 Ga0495582_0019073 3300046473 Bacteria 3753
1012 Ga0495582_0052523 3300046473 Bacteria 2247
1013 Ga0495605_0006406 3300046474 Bacteria 6773
1014 Ga0495605_0007666 3300046474 Bacteria 6119
1015 Ga0495639_0001641 3300046475 Bacteria 9963
1016 Ga0495639_0046076 3300046475 Bacteria 1973
1017 Ga0495662_0013582 3300046476 Bacteria 3964
1018 Ga0495664_0000429 3300046477 Bacteria 20586
1019 Ga0495664_0000685 3300046477 Bacteria 17239
1020 Ga0495664_0018928 3300046477 Bacteria 3953
1021 Ga0495664_0071398 3300046477 Bacteria 2074
1022 Ga0495664_0078990 3300046477 Bacteria 1972
1023 Ga0495664_0088622 3300046477 Bacteria 1860
1024 Ga0495584_0045122 3300046491 Bacteria 2224
1025 Ga0495594_0020522 3300046499 Bacteria 3519
1026 Ga0495596_0007864 3300046500 Bacteria 4777
1027 Ga0495607_0084173 3300046501 Bacteria 1741
1028 Ga0495583_0006963 3300046506 Bacteria 7244
1029 Ga0495583_0118856 3300046506 Bacteria 1114
1030 Ga0495606_0116395 3300046507 Bacteria 1606
1031 Ga0495608_0043714 3300046511 Bacteria 2992
1032 Ga0495608_0046901 3300046511 Bacteria 2874
1033 Ga0495616_0020071 3300046513 Bacteria 3640
1034 Ga0495616_0064025 3300046513 Bacteria 1795
1035 Ga0495618_0010454 3300046514 Bacteria 5613
1036 Ga0495618_0056472 3300046514 Bacteria 2486
1037 Ga0495618_0108921 3300046514 Bacteria 1774
1038 Ga0495628_0000831 3300046516 Bacteria 28661
1039 Ga0495628_0003725 3300046516 Bacteria 13566
1040 Ga0495628_0055138 3300046516 Bacteria 3131
1041 Ga0495628_0114914 3300046516 Bacteria 2067
1042 Ga0495630_0002201 3300046517 Bacteria 13571
1043 Ga0495630_0014399 3300046517 Bacteria 5762
1044 Ga0495630_0077992 3300046517 Bacteria 2497
1045 Ga0495632_0057179 3300046519 Bacteria 1905
1046 Ga0495632_0104489 3300046519 Bacteria 1333
1047 Ga0495648_0002762 3300046524 Bacteria 15851
1048 Ga0495648_0015139 3300046524 Bacteria 5617
1049 Ga0495648_0016753 3300046524 Bacteria 5271
1050 Ga0495648_0058926 3300046524 Bacteria 2293
1051 Ga0495648_0097364 3300046524 Bacteria 1632
1052 Ga0495666_0000299 3300046526 Bacteria 21603
1053 Ga0495666_0058413 3300046526 Bacteria 1845
1054 Ga0495642_0022914 3300046528 Bacteria 2463
1055 Ga0495652_0001797 3300046529 Bacteria 22856
1056 Ga0495652_0014692 3300046529 Bacteria 7021
1057 Ga0495652_0073952 3300046529 Bacteria 2835
1058 Ga0495665_0000415 3300046531 Bacteria 21709
1059 Ga0495665_0000879 3300046531 Bacteria 15726
1060 Ga0495665_0014148 3300046531 Bacteria 4306
1061 Ga0495665_0019069 3300046531 Bacteria 3687
1062 Ga0495665_0049929 3300046531 Bacteria 2218
1063 Ga0495665_0059945 3300046531 Bacteria 2009
1064 Ga0495640_0014707 3300046533 Bacteria 5912
1065 Ga0495640_0034387 3300046533 Bacteria 3594
1066 Ga0495586_0063979 3300046535 Bacteria 2004
1067 Ga0495586_0105781 3300046535 Bacteria 1564
1068 Ga0495586_0129104 3300046535 Bacteria 1415
1069 Ga0495586_0204706 3300046535 Bacteria 1119
1070 Ga0495587_0000686 3300046536 Bacteria 22717
1071 Ga0495587_0015593 3300046536 Bacteria 4740
1072 Ga0495598_0048507 3300046537 Bacteria 1270
1073 Ga0495621_0002198 3300046539 Bacteria 5198
1074 Ga0495621_0059634 3300046539 Bacteria 1383
1075 Ga0495645_0001756 3300046543 Bacteria 14734
1076 Ga0495667_0014831 3300046559 Bacteria 5266
1077 Ga0495667_0021574 3300046559 Bacteria 4346
1078 Ga0495634_0002194 3300046642 Bacteria 16391
1079 Ga0495634_0022609 3300046642 Bacteria 4429
1080 Ga0495611_0051663 3300046648 Bacteria 1853
1081 Ga0495625_0079604 3300046660 Bacteria 2284
1082 Ga0495635_0031672 3300046663 Bacteria 3669
1083 Ga0495635_0100569 3300046663 Bacteria 1976
1084 Ga0495635_0115000 3300046663 Bacteria 1837
1085 Ga0495635_0137592 3300046663 Bacteria 1664
1086 Ga0495661_0001293 3300046665 Bacteria 21387
1087 Ga0495661_0005687 3300046665 Bacteria 8827
1088 Ga0495657_0035778 3300046675 Bacteria 3438
1089 Ga0495657_0046331 3300046675 Bacteria 2945
1090 Ga0495657_0073700 3300046675 Bacteria 2223
1091 Ga0495657_0260342 3300046675 Bacteria 1042
1092 Ga0495599_0002006 3300046678 Bacteria 11774
1093 Ga0495599_0004056 3300046678 Bacteria 8626
1094 Ga0495599_0006027 3300046678 Bacteria 7297
1095 Ga0495599_0025854 3300046678 Bacteria 3677
1096 Ga0495599_0052227 3300046678 Bacteria 2560
1097 Ga0495623_0003332 3300046679 Bacteria 10617
1098 Ga0495623_0011928 3300046679 Bacteria 5632
1099 Ga0495623_0051308 3300046679 Bacteria 2610
1100 Ga0495646_0012481 3300046680 Bacteria 5402
1101 Ga0495646_0133343 3300046680 Bacteria 1396
1102 Ga0495647_0007459 3300046681 Bacteria 3665
1103 Ga0495647_0032350 3300046681 Bacteria 1949
1104 Ga0495647_0050172 3300046681 Bacteria 1618
1105 Ga0495658_0002904 3300046683 Bacteria 8605
1106 Ga0495658_0005709 3300046683 Bacteria 6112
1107 Ga0495658_0034592 3300046683 Bacteria 2773
1108 Ga0495658_0167427 3300046683 Bacteria 1358
1109 Ga0495669_0006310 3300046684 Bacteria 4951
1110 Ga0495669_0188450 3300046684 Bacteria 984
1111 Ga0495613_0064614 3300046689 Bacteria 2676
1112 Ga0495613_0356406 3300046689 Bacteria 1004
1113 Ga0495624_0000062 3300046690 Bacteria 67917
1114 Ga0495624_0000540 3300046690 Bacteria 29548
1115 Ga0495624_0000958 3300046690 Bacteria 22780
1116 Ga0495624_0008355 3300046690 Bacteria 7227
1117 Ga0495624_0065966 3300046690 Bacteria 2260
1118 Ga0495670_0008307 3300046691 Bacteria 5104
1119 Ga0495670_0212559 3300046691 Bacteria 1026
1120 Ga0495671_0049495 3300046692 Bacteria 2095
1121 Ga0495671_0179386 3300046692 Bacteria 1029
1122 Ga0495649_0132632 3300046694 Bacteria 1314
1123 Ga0495589_0003015 3300046794 Bacteria 9257
1124 Ga0495589_0005218 3300046794 Bacteria 6874
1125 Ga0495589_0022660 3300046794 Bacteria 3204
1126 Ga0495589_0119397 3300046794 Bacteria 1270
1127 Ga0495600_0165220 3300046809 Bacteria 1430
1128 Ga0495581_0004550 3300047315 Bacteria 8010
1129 Ga0495581_0140908 3300047315 Bacteria 1406
1130 Ga0495604_0001008 3300047317 Bacteria 23441
1131 Ga0495604_0002577 3300047317 Bacteria 14512
1132 Ga0495604_0054559 3300047317 Bacteria 3083
1133 Ga0495604_0059375 3300047317 Bacteria 2931
1134 Ga0495604_0088452 3300047317 Bacteria 2304
1135 Ga0495604_0187178 3300047317 Bacteria 1445
1136 Ga0495604_0221862 3300047317 Bacteria 1301
1137 Ga0495636_0001185 3300047318 Bacteria 9829
1138 Ga0495674_0000741 3300047319 Bacteria 30840
1139 Ga0495674_0005345 3300047319 Bacteria 12323
1140 Ga0495674_0008223 3300047319 Bacteria 9954
1141 Ga0495674_0008525 3300047319 Bacteria 9756
1142 Ga0495674_0014935 3300047319 Bacteria 7267
1143 Ga0495674_0016022 3300047319 Bacteria 6995
1144 Ga0495674_0022797 3300047319 Bacteria 5770
1145 Ga0495674_0094474 3300047319 Bacteria 2550
1146 Ga0495674_0141256 3300047319 Bacteria 2024
1147 Ga0495672_0005393 3300047320 Bacteria 10158
1148 Ga0495672_0010282 3300047320 Bacteria 6685
1149 Ga0495672_0025979 3300047320 Bacteria 3742
1150 Ga0495676_0031125 3300047321 Bacteria 4517
1151 Ga0495680_0001805 3300047322 Bacteria 22616
1152 Ga0495680_0024289 3300047322 Bacteria 5029
1153 Ga0495680_0062618 3300047322 Bacteria 2859
1154 Ga0495680_0102662 3300047322 Bacteria 2129
1155 Ga0495680_0168969 3300047322 Bacteria 1584
1156 Ga0495683_0031837 3300047323 Bacteria 2687
1157 Ga0495687_019854 3300047443 Bacteria 3288
1158 Ga0495687_034998 3300047443 Bacteria 2263
1159 Ga0495687_053767 3300047443 Bacteria 1694
1160 Ga0495675_0002322 3300047444 Bacteria 11368
1161 Ga0495675_0016280 3300047444 Bacteria 4703
1162 Ga0495675_0048455 3300047444 Bacteria 2702
1163 Ga0495675_0132809 3300047444 Bacteria 1546
1164 Ga0495675_0175933 3300047444 Bacteria 1312
1165 Ga0495679_000473 3300047446 Bacteria 29110
1166 Ga0495679_000897 3300047446 Bacteria 18689
1167 Ga0495679_074363 3300047446 Bacteria 973
1168 Ga0495685_080701 3300047447 Bacteria 1083
1169 Ga0495673_0014021 3300047469 Bacteria 4183
1170 Ga0495673_0016141 3300047469 Bacteria 3826
1171 Ga0495673_0016813 3300047469 Bacteria 3729
1172 Ga0495684_0029557 3300047471 Bacteria 4207
1173 Ga0495684_0055680 3300047471 Bacteria 3016
1174 Ga0495593_0009257 3300047673 Bacteria 5714
1175 Ga0495593_0076523 3300047673 Bacteria 1734
1176 Ga0495593_0087487 3300047673 Bacteria 1606
1177 Ga0495602_0001774 3300048088 Bacteria 21600
1178 Ga0495602_0068433 3300048088 Bacteria 3048
1179 Ga0495602_0085720 3300048088 Bacteria 2631
1180 Ga0495602_0092490 3300048088 Bacteria 2505
1181 Ga0495602_0168588 3300048088 Bacteria 1701
1182 Ga0495614_0000191 3300048089 Bacteria 23174
1183 Ga0495614_0023072 3300048089 Bacteria 2684
1184 Ga0495626_0056015 3300048091 Bacteria 1806
1185 Ga0496100_0004002 3300048903 Bacteria 7749
1186 Ga0496100_0047886 3300048903 Bacteria 2757
1187 Ga0496100_0126104 3300048903 Bacteria 1797
1188 Ga0496100_0368867 3300048903 Bacteria 1088
1189 Ga0496101_0003676 3300048904 Bacteria 9573
1190 Ga0496102_0023692 3300048905 Bacteria 5455
1191 Ga0496102_0069473 3300048905 Bacteria 3233
1192 Ga0496102_0669216 3300048905 Bacteria 961
1193 Ga0496104_0010082 3300048907 Bacteria 8436
1194 Ga0496104_0012559 3300048907 Bacteria 7622
1195 Ga0496104_0093923 3300048907 Bacteria 2869
1196 Ga0496104_0351787 3300048907 Bacteria 1386
1197 Ga0496105_0019505 3300048908 Bacteria 5470
1198 Ga0496105_0033233 3300048908 Bacteria 4234
1199 Ga0496105_0087117 3300048908 Bacteria 2580
1200 Ga0496106_0151386 3300048909 Bacteria 1830
1201 Ga0496106_0227393 3300048909 Bacteria 1489
1202 Ga0496107_0021955 3300048910 Bacteria 4509
1203 Ga0496107_0037468 3300048910 Bacteria 3480
1204 Ga0496107_0196603 3300048910 Bacteria 1499
1205 Ga0496108_0095747 3300048911 Bacteria 2528
1206 Ga0496108_0172355 3300048911 Bacteria 1872
1207 Ga0496109_0275245 3300048912 Bacteria 1586
1208 Ga0496109_0319091 3300048912 Bacteria 1466
1209 Ga0496109_0490838 3300048912 Bacteria 1159
1210 Ga0496110_0094014 3300048913 Bacteria 2684
1211 Ga0496110_0154892 3300048913 Bacteria 2076
1212 Ga0496111_0013080 3300048914 Bacteria 5636
1213 Ga0496112_0002424 3300048915 Bacteria 15013
1214 Ga0496112_0036367 3300048915 Bacteria 4804
1215 Ga0496112_0111487 3300048915 Bacteria 2705
1216 Ga0496113_0002098 3300048916 Bacteria 11487
1217 Ga0496113_0038684 3300048916 Bacteria 3508
1218 Ga0496114_0031008 3300048917 Bacteria 4398
1219 Ga0496114_0088369 3300048917 Bacteria 2629
1220 Ga0496115_0010346 3300048918 Bacteria 6966
1221 Ga0496116_0028474 3300048919 Bacteria 4047
1222 Ga0496117_0046288 3300048920 Bacteria 3130
1223 Ga0496118_0013636 3300048921 Bacteria 7672
1224 Ga0496118_0046932 3300048921 Bacteria 3355
1225 Ga0496119_0001412 3300048922 Bacteria 29074
1226 Ga0496119_0111837 3300048922 Bacteria 1515
1227 Ga0496120_0000061 3300048923 Bacteria 172817
1228 Ga0496121_0003416 3300048924 Bacteria 22707
1229 Ga0496121_0008989 3300048924 Bacteria 11585
1230 Ga0496121_0010073 3300048924 Bacteria 10726
1231 Ga0496125_0001329 3300048928 Bacteria 36515
1232 Ga0496125_0009379 3300048928 Bacteria 10074
1233 Ga0496126_0000102 3300048929 Bacteria 201540
1234 Ga0496126_0111733 3300048929 Bacteria 2379
1235 Ga0495682_0003413 3300049460 Bacteria 7065
1236 Ga0501031_0094581 3300049568 Bacteria 1950
1237 Ga0501031_0183505 3300049568 Bacteria 1367
1238 Ga0501034_0432680 3300049571 Bacteria 1235
1239 Ga0501036_0481422 3300049572 Bacteria 1033
1240 Ga0501038_0144568 3300049574 Bacteria 1943
1241 Ga0501039_0001318 3300049575 Bacteria 18144
1242 Ga0501039_0152724 3300049575 Bacteria 1814
1243 Ga0501040_0002506 3300049576 Bacteria 11828
1244 Ga0501041_0002441 3300049577 Bacteria 10555
1245 Ga0501041_0068175 3300049577 Bacteria 2181
1246 Ga0501041_0127106 3300049577 Bacteria 1587
1247 Ga0501041_0268240 3300049577 Bacteria 1074
1248 Ga0501042_0005640 3300049578 Bacteria 8077
1249 Ga0501042_0013689 3300049578 Bacteria 5525
1250 Ga0501046_0113159 3300049580 Bacteria 2072
1251 Ga0501047_0004510 3300049581 Bacteria 13101
1252 Ga0501047_0008637 3300049581 Bacteria 9622
1253 Ga0501048_0010224 3300049582 Bacteria 7018
1254 Ga0501067_0176324 3300049583 Bacteria 1190
1255 Ga0501068_0000336 3300049584 Bacteria 23645
1256 Ga0501068_0220190 3300049584 Bacteria 1206
1257 Ga0501069_0001252 3300049585 Bacteria 12431
1258 Ga0501070_0000975 3300049586 Bacteria 25701
1259 Ga0501070_0002573 3300049586 Bacteria 15879
1260 Ga0501071_0001594 3300049587 Bacteria 13292
1261 Ga0501071_0011264 3300049587 Bacteria 6017
1262 Ga0501071_0012654 3300049587 Bacteria 5732
1263 Ga0501071_0063039 3300049587 Bacteria 2687
1264 Ga0501071_0094639 3300049587 Bacteria 2198
1265 Ga0501071_0140456 3300049587 Bacteria 1798
1266 Ga0501071_0164187 3300049587 Bacteria 1661
1267 Ga0501072_0008439 3300049588 Bacteria 7820
1268 Ga0501072_0010897 3300049588 Bacteria 6935
1269 Ga0501072_0037994 3300049588 Bacteria 3778
1270 Ga0501072_0080857 3300049588 Bacteria 2575
1271 Ga0501073_0001472 3300049589 Bacteria 17438
1272 Ga0501073_0003148 3300049589 Bacteria 12375
1273 Ga0501073_0214512 3300049589 Bacteria 1330
1274 Ga0501074_0012536 3300049590 Bacteria 6163
1275 Ga0501074_0036304 3300049590 Bacteria 3570
1276 Ga0501074_0142932 3300049590 Bacteria 1711
1277 Ga0501075_0000301 3300049591 Bacteria 27561
1278 Ga0501075_0340812 3300049591 Bacteria 1142
1279 Ga0501076_0000098 3300049592 Bacteria 47158
1280 Ga0501076_0009249 3300049592 Bacteria 7269
1281 Ga0501076_0143264 3300049592 Bacteria 1942
1282 Ga0501076_0201726 3300049592 Bacteria 1624
1283 Ga0501077_0000288 3300049593 Bacteria 29818
1284 Ga0501077_0004557 3300049593 Bacteria 8426
1285 Ga0501198_000136 3300049649 Bacteria 10576
1286 Ga0501222_000203 3300049662 Bacteria 10602
1287 Ga0501079_0000932 3300049741 Bacteria 20112
1288 Ga0501079_0003630 3300049741 Bacteria 11360
1289 Ga0501079_0022877 3300049741 Bacteria 4798
1290 Ga0501079_0038501 3300049741 Bacteria 3687
1291 Ga0501079_0245411 3300049741 Bacteria 1399
1292 Ga0501079_0293452 3300049741 Bacteria 1272
1293 Ga0501080_0001504 3300049742 Bacteria 19672
1294 Ga0501080_0002429 3300049742 Bacteria 16271
1295 Ga0501080_0003832 3300049742 Bacteria 13282
1296 Ga0501080_0006561 3300049742 Bacteria 10458
1297 Ga0501080_0056729 3300049742 Bacteria 3646
1298 Ga0501081_0007365 3300049743 Bacteria 7144
1299 Ga0501081_0129722 3300049743 Bacteria 1801
1300 Ga0501083_0002934 3300049744 Bacteria 11806
1301 Ga0501083_0005053 3300049744 Bacteria 9346
1302 Ga0501083_0195215 3300049744 Bacteria 1321
1303 Ga0501035_0056514 3300049822 Bacteria 3501
1304 Ga0501035_0069902 3300049822 Bacteria 3111
1305 Ga0501035_0108421 3300049822 Bacteria 2435
1306 Ga0501044_0011796 3300049823 Bacteria 9467
1307 Ga0501044_0049492 3300049823 Bacteria 4338
1308 Ga0501044_0083540 3300049823 Bacteria 3229
1309 Ga0501044_0384198 3300049823 Bacteria 1319
1310 Ga0501045_0005445 3300049824 Bacteria 8811
1311 nmdc:mga06z11_10234_c1 3300050494 Bacteria 3984
1312 nmdc:mga07m45_17021_c1 3300050496 Bacteria 3898
1313 nmdc:mga07m45_1741_c1 3300050496 Bacteria 10017
1314 nmdc:mga05p37_137_c1 3300050507 Bacteria 67873
1315 nmdc:mga05p37_243420_c1 3300050507 Bacteria 2161
1316 nmdc:mga05p37_67_c1 3300050507 Bacteria 91619
1317 nmdc:mga05p37_8988_c1 3300050507 Bacteria 11817
1318 nmdc:mga09592_1642_c1 3300050508 Bacteria 18009
1319 nmdc:mga09592_255336_c1 3300050508 Bacteria 1519
1320 nmdc:mga09592_258_c1 3300050508 Bacteria 38667
1321 nmdc:mga09592_45_c1 3300050508 Bacteria 69144
1322 nmdc:mga09592_5545_c1 3300050508 Bacteria 10272
1323 nmdc:mga09592_69998_c1 3300050508 Bacteria 2976
1324 nmdc:mga09592_986_c2 3300050508 Bacteria 22169
1325 nmdc:mga0qj67_13357_c1 3300050509 Bacteria 6197
1326 nmdc:mga0qj67_47189_c1 3300050509 Bacteria 3402
1327 nmdc:mga0qj67_7447_c1 3300050509 Bacteria 8085
1328 nmdc:mga06r32_115_c1 3300050510 Bacteria 57898
1329 nmdc:mga06r32_19264_c1 3300050510 Bacteria 6262
1330 nmdc:mga06r32_379684_c1 3300050510 Bacteria 1396
1331 nmdc:mga06r32_9078_c1 3300050510 Bacteria 8962
1332 nmdc:mga06r32_95468_c1 3300050510 Bacteria 2910
1333 nmdc:mga06r32_9718_c1 3300050510 Bacteria 8689
1334 nmdc:mga08y16_1100_c1 3300050511 Bacteria 26629
1335 nmdc:mga08y16_125548_c1 3300050511 Bacteria 2670
1336 nmdc:mga08y16_266_c1 3300050511 Bacteria 47344
1337 nmdc:mga08y16_335512_c1 3300050511 Bacteria 1555
1338 nmdc:mga08y16_34996_c1 3300050511 Bacteria 5277
1339 nmdc:mga08y16_3923_c1 3300050511 Bacteria 15488
1340 nmdc:mga08y16_84619_c1 3300050511 Bacteria 3306
1341 nmdc:mga08y16_99374_c1 3300050511 Bacteria 3030
1342 nmdc:mga0n895_456072_c1 3300050512 Bacteria 1290
1343 nmdc:mga0rr50_12678_c1 3300050513 Bacteria 5459
1344 nmdc:mga0rr50_480_c1 3300050513 Bacteria 21155
1345 nmdc:mga0rr50_69392_c1 3300050513 Bacteria 2682
1346 nmdc:mga0a205_402_c1 3300050515 Bacteria 33084
1347 Ga0495601_0040475 3300053077 Bacteria 2918
1348 Ga0495612_0013915 3300053078 Bacteria 3242
1349 Ga0500610_0000061 3300053079 Bacteria 34215
1350 Ga0495595_0007920 3300053084 Bacteria 4350
1351 Ga0495619_0077481 3300053085 Bacteria 2233
1352 Ga0495619_0158501 3300053085 Bacteria 1562
1353 Ga0500643_003261 3300053087 Bacteria 7902
1354 Ga0500583_0029107 3300053092 Bacteria 2404
1355 Ga0500583_0133237 3300053092 Bacteria 1233
1356 Ga0500583_0154631 3300053092 Bacteria 1142
1357 Ga0500608_000226 3300053122 Bacteria 22247
1358 Ga0500561_0009144 3300053137 Bacteria 2001
1359 Ga0500574_035921 3300053141 Bacteria 1359
1360 Ga0501084_0023456 3300054114 Bacteria 5148
1361 Ga0590071_001242 3300059421 Bacteria 6886
1362 Ga0501082_0001136 3300060353 Bacteria 23513
1363 Ga0501082_0008333 3300060353 Bacteria 8942
1364 Ga0501082_0033418 3300060353 Bacteria 4438
1365 Ga0501082_0117225 3300060353 Bacteria 2307
1366 Ga0530510_0013711 3300061734 Bacteria 5705
1367 Ga0530510_0154518 3300061734 Bacteria 1695
1368 2501071946 2501025501 Bacteria 7768574
1369 2501411818 2501025504 Bacteria 8008976
1370 2511100818 2510917014 Bacteria 8296963
1371 2511107472 2510917015 Bacteria 7950052
1372 2512350029 2512047030 Bacteria 9031815
1373 2513552531 2513237082 Bacteria 8640282
1374 2513560733 2513237083 Bacteria 8410967
1375 2514047656 2513237166 Bacteria 10373764
1376 2515682017 2515154122 Bacteria 8609520
1377 2516017169 2515154189 Bacteria 9629850
1378 2563056892 2562617112 Bacteria 10918404
1379 2563064566 2562617112 Bacteria 10918404
1380 2599744999 2599185240 Bacteria 7968121
1381 2600206820 2599185355 Bacteria 7968906
1382 2600811090 2600255067 Bacteria 6795583
1383 2676743273 2675903129 Bacteria 7964495
1384 2713472871 2711768613 Bacteria 11048459
1385 2713481087 2711768613 Bacteria 11048459
1386 2723878249 2721755763 Bacteria 4464185
1387 2792837089 2791355137 Bacteria 9654227
1388 2819620063 2818991450 Bacteria 6962147
1389 2870076548 2870068957 Bacteria 8925310
1390 2885279927 2885270888 Bacteria 9831543
1391 2891636331 2891633521 Bacteria 4602265
1392 2902685429 2902682994 Bacteria 8951596
1393 2904620163 2904615490 Bacteria 10047340
1394 2928110379 2928108538 Bacteria 7360024
1395 2928138487 2928135762 Bacteria 7259641
1396 2928505451 2928503688 Bacteria 7268108
1397 2990710481 2990703756 Bacteria 7715990
1398 642597772 642555112 Bacteria 8676562
1399 8003958309 8003955200 Bacteria 8601927
1400 8020948220 8020945358 Bacteria 8467355
1401 Ga0495676_0192725
1402 SwRhRL2b_contig_365350
1403 rootH1_10121089
1404 Ga0055532_1000124
1405 Ga0055527_1000036
1406 Ga0055535_1000051
1407 Ga0055542_1001307
1408 Ga0065712_10068735
1409 Ga0065715_10105432
1410 Ga0065715_10132801
1411 Ga0065707_10000604
1412 Ga0065707_10031187
1413 Ga0070676_10003719
1414 Ga0070683_100002653
1415 Ga0070683_100022207
1416 Ga0070690_100000816
1417 Ga0070690_100021782
1418 Ga0070690_100061311
1419 Ga0070670_100000816
1420 Ga0070670_100014443
1421 Ga0070670_100197121
1422 Ga0070670_100459774
1423 Ga0068869_100002189
1424 Ga0068869_100003615
1425 Ga0068869_100033933
1426 Ga0068869_100038674
1427 Ga0068869_100099763
1428 Ga0070666_10009338
1429 Ga0070666_10016993
1430 Ga0070666_10084623
1431 Ga0070680_100017814
1432 Ga0070680_100055669
1433 Ga0070680_100100311
1434 Ga0070680_100109741
1435 Ga0068868_100039606
1436 Ga0068868_100060597
1437 Ga0068868_100074960
1438 Ga0068868_100152495
1439 Ga0068868_100407253
1440 Ga0070660_100001108
1441 Ga0070660_100001577
1442 Ga0070660_100060216
1443 Ga0070660_100100178
1444 Ga0070689_100000421
1445 Ga0070689_100036291
1446 Ga0070691_10003356
1447 Ga0070661_100003820
1448 Ga0070661_100020427
1449 Ga0070692_10004660
1450 Ga0070692_10082482
1451 Ga0070668_100029002
1452 Ga0070668_100047902
1453 Ga0070668_100211110
1454 Ga0070668_100222445
1455 Ga0070668_100236171
1456 Ga0070669_100012004
1457 Ga0070669_100024084
1458 Ga0070669_100174270
1459 Ga0070675_100005747
1460 Ga0070675_100006854
1461 Ga0070675_100008107
1462 Ga0070675_100010573
1463 Ga0070675_100016164
1464 Ga0070675_100018178
1465 Ga0070675_100052643
1466 Ga0070675_100058700
1467 Ga0070675_100064971
1468 Ga0070675_100344544
1469 Ga0070671_100005851
1470 Ga0070671_100011916
1471 Ga0070671_100017868
1472 Ga0070671_100086400
1473 Ga0070671_100098886
1474 Ga0070671_100243200
1475 Ga0070674_100021247
1476 Ga0070674_100034273
1477 Ga0070673_100024097
1478 Ga0070673_100041108
1479 Ga0070673_100126436
1480 Ga0070673_100131669
1481 Ga0070673_100463365
1482 Ga0070688_100044248
1483 Ga0070688_100047397
1484 Ga0070688_100175327
1485 Ga0070659_100000861
1486 Ga0070659_100010215
1487 Ga0070659_100295102
1488 Ga0070667_100023426
1489 Ga0070667_100045092
1490 Ga0070667_100056206
1491 Ga0070667_100076171
1492 Ga0070667_100087394
1493 Ga0070667_100096442
1494 Ga0070667_100197073
1495 Ga0070667_100264767
1496 Ga0070667_100295829
1497 Ga0070709_10017823
1498 Ga0070714_100001074
1499 Ga0070714_100315095
1500 Ga0070713_100005981
1501 Ga0070713_100036255
1502 Ga0070713_100051781
1503 Ga0070713_100094648
1504 Ga0070701_10002293
1505 Ga0070701_10013320
1506 Ga0070711_100092007
1507 Ga0070711_100161734
1508 Ga0070711_100189663
1509 Ga0070705_100004895
1510 Ga0070705_100311620
1511 Ga0070700_100012304
1512 Ga0070700_100107828
1513 Ga0070694_100016655
1514 Ga0070694_100050085
1515 Ga0070694_100060441
1516 Ga0070694_100275684
1517 Ga0070663_100008570
1518 Ga0070663_100058784
1519 Ga0070663_100160837
1520 Ga0070678_100023134
1521 Ga0070678_100044645
1522 Ga0070678_100055959
1523 Ga0070678_100060738
1524 Ga0070678_100064112
1525 Ga0070678_100190535
1526 Ga0070678_100227654
1527 Ga0070662_100021621
1528 Ga0070662_100044112
1529 Ga0070662_100078058
1530 Ga0070681_10002158
1531 Ga0070681_10011416
1532 Ga0070681_10011526
1533 Ga0070681_10033595
1534 Ga0070681_10034179
1535 Ga0070681_10099027
1536 Ga0070681_10296179
1537 Ga0068867_100000215
1538 Ga0068867_100022935
1539 Ga0068867_100079461
1540 Ga0068867_100086134
1541 Ga0068867_100087576
1542 Ga0068867_100112807
1543 Ga0068867_100221042
1544 Ga0070706_100038140
1545 Ga0070706_100314176
1546 Ga0070706_100565921
1547 Ga0070707_100049906
1548 Ga0070698_100237648
1549 Ga0070699_100050857
1550 Ga0070679_100002776
1551 Ga0070679_100007196
1552 Ga0070679_100015155
1553 Ga0070679_100139486
1554 Ga0070679_100149467
1555 Ga0070679_100220462
1556 Ga0070684_100005851
1557 Ga0070684_100008616
1558 Ga0070684_100211630
1559 Ga0070684_100215985
1560 Ga0070697_100005759
1561 Ga0068853_100053724
1562 Ga0068853_100055724
1563 Ga0068853_100381500
1564 Ga0070672_100001840
1565 Ga0070672_100009845
1566 Ga0070672_100293733
1567 Ga0070686_100001871
1568 Ga0070686_100016846
1569 Ga0070686_100024627
1570 Ga0070686_100032829
1571 Ga0070686_100035160
1572 Ga0070686_100076479
1573 Ga0070695_100039787
1574 Ga0070695_100045814
1575 Ga0070696_100005913
1576 Ga0070696_100065844
1577 Ga0070696_100153349
1578 Ga0070696_100289022
1579 Ga0070693_100005012
1580 Ga0070693_100023239
1581 Ga0070693_100137123
1582 Ga0070665_100001969
1583 Ga0070665_100080440
1584 Ga0070665_100105665
1585 Ga0070665_100312351
1586 Ga0070704_100001594
1587 Ga0070704_100012426
1588 Ga0070704_100091932
1589 Ga0068855_100001682
1590 Ga0068855_100002002
1591 Ga0068855_100002194
1592 Ga0068855_100005111
1593 Ga0068855_100011151
1594 Ga0068855_100017416
1595 Ga0068855_100029844
1596 Ga0068855_100031793
1597 Ga0068855_100042963
1598 Ga0068855_100130792
1599 Ga0070664_100000772
1600 Ga0070664_100009626
1601 Ga0070664_100440825
1602 Ga0068857_100012680
1603 Ga0068857_100048483
1604 Ga0068857_100160671
1605 Ga0068854_100029947
1606 Ga0068854_100091242
1607 Ga0068854_100153445
1608 Ga0068856_100035659
1609 Ga0068856_100049397
1610 Ga0068856_100097139
1611 Ga0068856_100159467
1612 Ga0070702_100000854
1613 Ga0070702_100000889
1614 Ga0070702_100007766
1615 Ga0070702_100065768
1616 Ga0070702_100124671
1617 Ga0068852_100000419
1618 Ga0068852_100000944
1619 Ga0068852_100001924
1620 Ga0068852_100006532
1621 Ga0068852_100009876
1622 Ga0068852_100097479
1623 Ga0068852_100149609
1624 Ga0068852_100383701
1625 Ga0068859_100000253
1626 Ga0068859_100006199
1627 Ga0068859_100015782
1628 Ga0068859_100018481
1629 Ga0068859_100079124
1630 Ga0068859_100094533
1631 Ga0068859_100122677
1632 Ga0068859_100457923
1633 Ga0068864_100001205
1634 Ga0068864_100005181
1635 Ga0068864_100008410
1636 Ga0068864_100015984
1637 Ga0068864_100104699
1638 Ga0068864_100174533
1639 Ga0068864_100179216
1640 Ga0068864_100266579
1641 Ga0068866_10002860
1642 Ga0068866_10203602
1643 Ga0068861_100001372
1644 Ga0068861_100003053
1645 Ga0068861_100008134
1646 Ga0068861_100076244
1647 Ga0068861_100287251
1648 Ga0068851_10006725
1649 Ga0068851_10007729
1650 Ga0068851_10015524
1651 Ga0068851_10031134
1652 Ga0068851_10033402
1653 Ga0068851_10085565
1654 Ga0068870_10001202
1655 Ga0068863_100001784
1656 Ga0068863_100003276
1657 Ga0068863_100015332
1658 Ga0068863_100018873
1659 Ga0068863_100053000
1660 Ga0068863_100084247
1661 Ga0068863_100149508
1662 Ga0068863_100157041
1663 Ga0068863_100189995
1664 Ga0068863_100312905
1665 Ga0068863_100496504
1666 Ga0068858_100000503
1667 Ga0068858_100001910
1668 Ga0068858_100005731
1669 Ga0068858_100014286
1670 Ga0068858_100021279
1671 Ga0068858_100084265
1672 Ga0068858_100106996
1673 Ga0068858_100198229
1674 Ga0068858_100229330
1675 Ga0068860_100001280
1676 Ga0068860_100001625
1677 Ga0068860_100009569
1678 Ga0068860_100022290
1679 Ga0068860_100068118
1680 Ga0068860_100081692
1681 Ga0068860_100259740
1682 Ga0068860_100479549
1683 Ga0068862_100014488
1684 Ga0068862_100030640
1685 Ga0068862_100071572
1686 Ga0070717_10009990
1687 Ga0070717_10168299
1688 Ga0070717_10329322
1689 Ga0070716_100026160
1690 Ga0070716_100111887
1691 Ga0075366_10145367
1692 Ga0097621_100005458
1693 Ga0097621_100010078
1694 Ga0097621_100015961
1695 Ga0097621_100031728
1696 Ga0097621_100031848
1697 Ga0097621_100130031
1698 Ga0097621_100413816
1699 Ga0075370_10008340
1700 Ga0075370_10010453
1701 Ga0068871_100006085
1702 Ga0068871_100015806
1703 Ga0068871_100023694
1704 Ga0068871_100028456
1705 Ga0068871_100116227
1706 Ga0068871_100158493
1707 Ga0068871_100256170
1708 Ga0068871_100314858
1709 Ga0075428_100001989
1710 Ga0075428_100025341
1711 Ga0075428_100093431
1712 Ga0075430_100013481
1713 Ga0075430_100049533
1714 Ga0075430_100057765
1715 Ga0075430_100191234
1716 Ga0075431_100000077
1717 Ga0075431_100010025
1718 Ga0075431_100010660
1719 Ga0075431_100013529
1720 Ga0075431_100097175
1721 Ga0075431_100291621
1722 Ga0075433_10013143
1723 Ga0075434_100000204
1724 Ga0075429_100000019
1725 Ga0075429_100000208
1726 Ga0075429_100002310
1727 Ga0075429_100013327
1728 Ga0075429_100024433
1729 Ga0075429_100100487
1730 Ga0068865_100001062
1731 Ga0068865_100024371
1732 Ga0068865_100052323
1733 Ga0068865_100209211
1734 Ga0097620_100000253
1735 Ga0097620_100006199
1736 Ga0097620_100015395
1737 Ga0097620_100015782
1738 Ga0097620_100018481
1739 Ga0097620_100079120
1740 Ga0097620_100094531
1741 Ga0097620_100122665
1742 Ga0097620_100457944
1743 Ga0075435_100003374
1744 Ga0075435_100005884
1745 Ga0075435_100130109
1746 Ga0099794_10002384
1747 Ga0099794_10015352
1748 Ga0099794_10016356
1749 Ga0099795_10000234
1750 Ga0105251_10000043
1751 Ga0105240_10000760
1752 Ga0105240_10001599
1753 Ga0105240_10002211
1754 Ga0105240_10002714
1755 Ga0105240_10004577
1756 Ga0105240_10006209
1757 Ga0105240_10006435
1758 Ga0105240_10006620
1759 Ga0105240_10016618
1760 Ga0105240_10018889
1761 Ga0105240_10043447
1762 Ga0105240_10047021
1763 Ga0105240_10064068
1764 Ga0105240_10092430
1765 Ga0105240_10202073
1766 Ga0105240_10263648
1767 Ga0111539_10000277
1768 Ga0111539_10000660
1769 Ga0111539_10023238
1770 Ga0111539_10033962
1771 Ga0111539_10090554
1772 Ga0111539_10121571
1773 Ga0105245_10005588
1774 Ga0105245_10010063
1775 Ga0105245_10024118
1776 Ga0105245_10146415
1777 Ga0105247_10001306
1778 Ga0105247_10015443
1779 Ga0114129_10000140
1780 Ga0114129_10007801
1781 Ga0114129_10011889
1782 Ga0105243_10001776
1783 Ga0105243_10026919
1784 Ga0105243_10055619
1785 Ga0105243_10395106
1786 Ga0105241_10045630
1787 Ga0105241_10150552
1788 Ga0105242_10003224
1789 Ga0105242_10225280
1790 Ga0105248_10008298
1791 Ga0105248_10062484
1792 Ga0105248_10072048
1793 Ga0105248_10091826
1794 Ga0105248_10193964
1795 Ga0105248_10290856
1796 Ga0105248_10312241
1797 Ga0105237_10020287
1798 Ga0105237_10111692
1799 Ga0105237_10122798
1800 Ga0105237_10138435
1801 Ga0105237_10251341
1802 Ga0105237_10301147
1803 Ga0105237_10436254
1804 Ga0105237_10476510
1805 Ga0105238_10001924
1806 Ga0105238_10002536
1807 Ga0105238_10014052
1808 Ga0105238_10019205
1809 Ga0105238_10029625
1810 Ga0105238_10208949
1811 Ga0105238_10406647
1812 Ga0105249_10027048
1813 Ga0105249_10218934
1814 Ga0099796_10000467
1815 Ga0105239_10020458
1816 Ga0105239_10161706
1817 Ga0105239_10283679
1818 Ga0105239_10313309
1819 Ga0105246_10062603
1820 Ga0105246_10079015
1821 Ga0105246_10205733
1822 Ga0105246_10326172
1823 Ga0157373_10020648
1824 Ga0157370_10000890
1825 Ga0157370_10003740
1826 Ga0157370_10006678
1827 Ga0157370_10071356
1828 Ga0157370_10110858
1829 Ga0157369_10001971
1830 Ga0157369_10007730
1831 Ga0157369_10015794
1832 Ga0157369_10028361
1833 Ga0157369_10040421
1834 Ga0157369_10102907
1835 Ga0157369_10128738
1836 Ga0157369_10215306
1837 Ga0157374_10018746
1838 Ga0157374_10332316
1839 Ga0157374_10420632
1840 Ga0157378_10008705
1841 Ga0157378_10026047
1842 Ga0157378_10124138
1843 Ga0157378_10367157
1844 Ga0157378_10472672
1845 Ga0163162_10000655
1846 Ga0163162_10008965
1847 Ga0163162_10127222
1848 Ga0163162_10259799
1849 Ga0157372_10002980
1850 Ga0157372_10025602
1851 Ga0157372_10057816
1852 Ga0157372_10058620
1853 Ga0157372_10093826
1854 Ga0157372_10176679
1855 Ga0157372_10227793
1856 Ga0157375_10005328
1857 Ga0157375_10009938
1858 Ga0157375_10079484
1859 Ga0157375_10095255
1860 Ga0157375_10148680
1861 Ga0157375_10261261
1862 Ga0157375_10709780
1863 Ga0163163_10001355
1864 Ga0163163_10002424
1865 Ga0163163_10073516
1866 Ga0163163_10287139
1867 Ga0157380_10012492
1868 Ga0157380_10032710
1869 Ga0157380_10121508
1870 Ga0157380_10354750
1871 Ga0157379_10002507
1872 Ga0157379_10013568
1873 Ga0157379_10027320
1874 Ga0157379_10036848
1875 Ga0157379_10043368
1876 Ga0157379_10164225
1877 Ga0157379_10211862
1878 Ga0157379_10353418
1879 Ga0157376_10008831
1880 Ga0157376_10284486
1881 Ga0157376_10345329
1882 Ga0182006_1004726
1883 Ga0182006_1015446
1884 Ga0182007_10000245
1885 Ga0183362_10003
1886 Ga0163161_10013868
1887 Ga0163161_10040313
1888 Ga0163161_10062884
1889 Ga0213872_10000419
1890 Ga0213872_10054286
1891 Ga0213872_10092211
1892 Ga0209672_100026
1893 Ga0209147_100033
1894 Ga0209258_100051
1895 Ga0209026_1000952
1896 Ga0209148_1000328
1897 Ga0209759_1000773
1898 Ga0207666_1004688
1899 Ga0209455_1000252
1900 Ga0209025_1000115
1901 Ga0209564_1005666
1902 Ga0209051_1046486
1903 Ga0207656_10006944
1904 Ga0207656_10011244
1905 Ga0207656_10035556
1906 Ga0207656_10152649
1907 Ga0207713_1000240
1908 Ga0207682_10023878
1909 Ga0207642_10009459
1910 Ga0207642_10067592
1911 Ga0207710_10000538
1912 Ga0207710_10011325
1913 Ga0207688_10019841
1914 Ga0207680_10006697
1915 Ga0207680_10276697
1916 Ga0207647_10001239
1917 Ga0207647_10061551
1918 Ga0207645_10099625
1919 Ga0207645_10139566
1920 Ga0207643_10004764
1921 Ga0207643_10005459
1922 Ga0207643_10040443
1923 Ga0207643_10127821
1924 Ga0207705_10150791
1925 Ga0207705_10261473
1926 Ga0207684_10042338
1927 Ga0207684_10289787
1928 Ga0207654_10027099
1929 Ga0207707_10000999
1930 Ga0207707_10003421
1931 Ga0207707_10007561
1932 Ga0207707_10009440
1933 Ga0207707_10067077
1934 Ga0207707_10081933
1935 Ga0207707_10283545
1936 Ga0207707_10289262
1937 Ga0207695_10000372
1938 Ga0207695_10002611
1939 Ga0207695_10004603
1940 Ga0207695_10011587
1941 Ga0207695_10023693
1942 Ga0207695_10032813
1943 Ga0207695_10034143
1944 Ga0207695_10035292
1945 Ga0207695_10040875
1946 Ga0207695_10305546
1947 Ga0207695_10412159
1948 Ga0207671_10030597
1949 Ga0207671_10098841
1950 Ga0207671_10101676
1951 Ga0207671_10275549
1952 Ga0207663_10155978
1953 Ga0207663_10314425
1954 Ga0207660_10004733
1955 Ga0207660_10012148
1956 Ga0207660_10038383
1957 Ga0207660_10077593
1958 Ga0207660_10110635
1959 Ga0207662_10003006
1960 Ga0207662_10013087
1961 Ga0207662_10078226
1962 Ga0207662_10122087
1963 Ga0207657_10001557
1964 Ga0207657_10002377
1965 Ga0207657_10018692
1966 Ga0207657_10023713
1967 Ga0207657_10055596
1968 Ga0207657_10089864
1969 Ga0207649_10009407
1970 Ga0207652_10007161
1971 Ga0207652_10074627
1972 Ga0207652_10192792
1973 Ga0207646_10114637
1974 Ga0207681_10003209
1975 Ga0207681_10004286
1976 Ga0207681_10043952
1977 Ga0207694_10011446
1978 Ga0207694_10062995
1979 Ga0207694_10066550
1980 Ga0207694_10076469
1981 Ga0207650_10018773
1982 Ga0207650_10105835
1983 Ga0207650_10227091
1984 Ga0207659_10000504
1985 Ga0207659_10007377
1986 Ga0207659_10026286
1987 Ga0207659_10092162
1988 Ga0207659_10164256
1989 Ga0207659_10210315
1990 Ga0207659_10248509
1991 Ga0207687_10002479
1992 Ga0207687_10056276
1993 Ga0207687_10325347
1994 Ga0207700_10018771
1995 Ga0207700_10282173
1996 Ga0207700_10367539
1997 Ga0207664_10002954
1998 Ga0207664_10004364
1999 Ga0207644_10014289
2000 Ga0207644_10035583
2001 Ga0207644_10100801
2002 Ga0207644_10108322
2003 Ga0207690_10014884
2004 Ga0207690_10038603
2005 Ga0207690_10100789
2006 Ga0207706_10017228
2007 Ga0207706_10064398
2008 Ga0207686_10006895
2009 Ga0207686_10070377
2010 Ga0207709_10003263
2011 Ga0207709_10007438
2012 Ga0207670_10013321
2013 Ga0207670_10013767
2014 Ga0207670_10016809
2015 Ga0207670_10024359
2016 Ga0207670_10079956
2017 Ga0207670_10130562
2018 Ga0207670_10161187
2019 Ga0207669_10002388
2020 Ga0207669_10041562
2021 Ga0207669_10102974
2022 Ga0207704_10016656
2023 Ga0207704_10114313
2024 Ga0207665_10023366
2025 Ga0207665_10033344
2026 Ga0207665_10224313
2027 Ga0207691_10006936
2028 Ga0207691_10073497
2029 Ga0207691_10094169
2030 Ga0207691_10145270
2031 Ga0207691_10201245
2032 Ga0207691_10213788
2033 Ga0207691_10214007
2034 Ga0207691_10296756
2035 Ga0207711_10037939
2036 Ga0207711_10092214
2037 Ga0207711_10118849
2038 Ga0207711_10261779
2039 Ga0207689_10001646
2040 Ga0207689_10002213
2041 Ga0207689_10003936
2042 Ga0207689_10005924
2043 Ga0207689_10011714
2044 Ga0207689_10030091
2045 Ga0207689_10052871
2046 Ga0207689_10112441
2047 Ga0207661_10079658
2048 Ga0207679_10004394
2049 Ga0207679_10026262
2050 Ga0207679_10056694
2051 Ga0207667_10001268
2052 Ga0207667_10003353
2053 Ga0207667_10009964
2054 Ga0207667_10036735
2055 Ga0207667_10067327
2056 Ga0207667_10086186
2057 Ga0207667_10304377
2058 Ga0207651_10014883
2059 Ga0207651_10026564
2060 Ga0207651_10059375
2061 Ga0207712_10064747
2062 Ga0207712_10122786
2063 Ga0207712_10124040
2064 Ga0207668_10060144
2065 Ga0207640_10019344
2066 Ga0207658_10002948
2067 Ga0207658_10027235
2068 Ga0207658_10095871
2069 Ga0207658_10188073
2070 Ga0207658_10397135
2071 Ga0207677_10004422
2072 Ga0207677_10006268
2073 Ga0207677_10029726
2074 Ga0207677_10036882
2075 Ga0207677_10236545
2076 Ga0207677_10302256
2077 Ga0207703_10000899
2078 Ga0207703_10001339
2079 Ga0207703_10003150
2080 Ga0207703_10015310
2081 Ga0207703_10032230
2082 Ga0207703_10042866
2083 Ga0207703_10053261
2084 Ga0207703_10092420
2085 Ga0207703_10098931
2086 Ga0207703_10120544
2087 Ga0207703_10181161
2088 Ga0207639_10096243
2089 Ga0207639_10118183
2090 Ga0207639_10118266
2091 Ga0207639_10483275
2092 Ga0207639_10624108
2093 Ga0207678_10056179
2094 Ga0207678_10063172
2095 Ga0207678_10097707
2096 Ga0207678_10104879
2097 Ga0207678_10192775
2098 Ga0207708_10004385
2099 Ga0207708_10007997
2100 Ga0207708_10010897
2101 Ga0207708_10058902
2102 Ga0207708_10140355
2103 Ga0207708_10255812
2104 Ga0207702_10001106
2105 Ga0207702_10150724
2106 Ga0207641_10011464
2107 Ga0207641_10012901
2108 Ga0207641_10013953
2109 Ga0207641_10015567
2110 Ga0207641_10037955
2111 Ga0207641_10089998
2112 Ga0207641_10186874
2113 Ga0207641_10365072
2114 Ga0207648_10000484
2115 Ga0207648_10008361
2116 Ga0207648_10010090
2117 Ga0207648_10019355
2118 Ga0207648_10068205
2119 Ga0207648_10083569
2120 Ga0207648_10095391
2121 Ga0207648_10106585
2122 Ga0207648_10152587
2123 Ga0207648_10187114
2124 Ga0207648_10535491
2125 Ga0207676_10000216
2126 Ga0207676_10005169
2127 Ga0207676_10017461
2128 Ga0207676_10189986
2129 Ga0207676_10285372
2130 Ga0207674_10000292
2131 Ga0207674_10012012
2132 Ga0207674_10114395
2133 Ga0207675_100001426
2134 Ga0207675_100001767
2135 Ga0207675_100001972
2136 Ga0207675_100003149
2137 Ga0207675_100003455
2138 Ga0207675_100015452
2139 Ga0207675_100018059
2140 Ga0207675_100021232
2141 Ga0207675_100041328
2142 Ga0207675_100110877
2143 Ga0207675_100288407
2144 Ga0207683_10000920
2145 Ga0207683_10007342
2146 Ga0207683_10060407
2147 Ga0207683_10072230
2148 Ga0207683_10088043
2149 Ga0207683_10204105
2150 Ga0207698_10007793
2151 Ga0207698_10016751
2152 Ga0207698_10059132
2153 Ga0207698_10076854
2154 Ga0207698_10082638
2155 Ga0207698_10497083
2156 Ga0209969_1000861
2157 Ga0209967_1005493
2158 Ga0209981_1003420
2159 Ga0209996_1003492
2160 Ga0210000_1000129
2161 Ga0210000_1004629
2162 Ga0209999_1001944
2163 Ga0209982_1001715
2164 Ga0209983_1008824
2165 Ga0209588_1014660
2166 Ga0209588_1028137
2167 Ga0209971_1001444
2168 Ga0209966_1006585
2169 Ga0209974_10007837
2170 Ga0209974_10083958
2171 Ga0207428_10003044
2172 Ga0207428_10027877
2173 Ga0207428_10031162
2174 Ga0207428_10081767
2175 Ga0265357_1007234
2176 Ga0268266_10003005
2177 Ga0268266_10020512
2178 Ga0268266_10050834
2179 Ga0268266_10057234
2180 Ga0268266_10189434
2181 Ga0268265_10016607
2182 Ga0268265_10018358
2183 Ga0268265_10099648
2184 Ga0268265_10135273
2185 Ga0268265_10263673
2186 Ga0268265_10421918
2187 Ga0268264_10000299
2188 Ga0268264_10013145
2189 Ga0268264_10024972
2190 Ga0268264_10072281
2191 Ga0268264_10327148
2192 Ga0265334_10018682
2193 Ga0265336_10007212
2194 Ga0307517_10000024
2195 Ga0307515_10000043
2196 Ga0265338_10000058
2197 Ga0265338_10006256
2198 Ga0265338_10008827
2199 Ga0265324_10007430
2200 Ga0307511_10011888
2201 Ga0265330_10000156
2202 Ga0265330_10000564
2203 Ga0265332_10000085
2204 Ga0265332_10000157
2205 Ga0265328_10001015
2206 Ga0265328_10002908
2207 Ga0265320_10014626
2208 Ga0265325_10000396
2209 Ga0265340_10003568
2210 Ga0265340_10041778
2211 Ga0265339_10007765
2212 Ga0265331_10001313
2213 Ga0265331_10022500
2214 Ga0265327_10000549
2215 Ga0265316_10004897
2216 Ga0265316_10033511
2217 Ga0307513_10027559
2218 Ga0307509_10000001
2219 Ga0307509_10000018
2220 Ga0307509_10000109
2221 Ga0307408_100060345
2222 Ga0307408_100067510
2223 Ga0307408_100264610
2224 Ga0265313_10000729
2225 Ga0307508_10007662
2226 Ga0307508_10041267
2227 Ga0307514_10048870
2228 Ga0316575_10006556
2229 Ga0265314_10000036
2230 Ga0265314_10000446
2231 Ga0265342_10000765
2232 Ga0316578_10019647
2233 Ga0307516_10054864
2234 Ga0307405_10010260
2235 Ga0307405_10115913
2236 Ga0307405_10157866
2237 Ga0307410_10006700
2238 Ga0307410_10136581
2239 Ga0307406_10261223
2240 Ga0307407_10028986
2241 Ga0307412_10047607
2242 Ga0307412_10070451
2243 Ga0307412_10211161
2244 Ga0307416_100067305
2245 Ga0307416_100083196
2246 Ga0307416_100090074
2247 Ga0307416_100099458
2248 Ga0307416_100175122
2249 Ga0307416_100175163
2250 Ga0307416_100263547
2251 Ga0307416_100357342
2252 Ga0307411_10000606
2253 Ga0307411_10136334
2254 Ga0307411_10486995
2255 Ga0307415_100013217
2256 Ga0307415_100239284
2257 Ga0307415_100318512
2258 Ga0316583_10006551
2259 Ga0316583_10007061
2260 Ga0373930_0000484
2261 Ga0373938_0004945
2262 Ga0373938_0022085
2263 Ga0373934_0009726
2264 Ga0373940_0001325
2265 Ga0373944_0044708
2266 Ga0373949_0004944
2267 Ga0373952_0002430
2268 Ga0373923_0013458
2269 Ga0373932_0001860
2270 Ga0373932_0002355
2271 Ga0373936_0003169
2272 Ga0373936_0006544
2273 Ga0373945_0018321
2274 Ga0373953_0001139
2275 Ga0373956_0026985
2276 Ga0373957_0031285
2277 Ga0373960_0010732
2278 Ga0373960_0016610
2279 Ga0373943_0014340
2280 Ga0373943_0103771
2281 Ga0373955_0020888
2282 Ga0373955_0064615
2283 Ga0373961_0006886
2284 Ga0373961_0007299
2285 Ga0373961_0023801
2286 Ga0373962_0004968
2287 Ga0316574_0195504
2288 Ga0373924_0002265
2289 Ga0373924_0008436
2290 Ga0373924_0013759
2291 Ga0373924_0120039
2292 Ga0373931_0001851
2293 Ga0373931_0002614
2294 Ga0373931_0009572
2295 Ga0373931_0049571
2296 Ga0373931_0224752
2297 Ga0373935_0051018
2298 Ga0373935_0057983
2299 Ga0373927_0034159
2300 Ga0373933_0005006
2301 Ga0373933_0350295
2302 Ga0373937_0005534
2303 Ga0373937_0006172
2304 Ga0373937_0022263
2305 Ga0373937_0078668
2306 Ga0373937_0189572
2307 Ga0316582_0025856
2308 Ga0373925_0005195
2309 Ga0373925_0008462
2310 Ga0373925_0009800
2311 Ga0373925_0013565
2312 Ga0373925_0076340
2313 Ga0373925_0098336
2314 Ga0373925_0115562
2315 Ga0373925_0154818
2316 Ga0373925_0423294
2317 Ga0373925_0605854
2318 Ga0395899_0119945
2319 Ga0395905_0002868
2320 Ga0395905_0010024
2321 Ga0395901_0056428
2322 Ga0436360_0867881
2323 Ga0436361_0106893
2324 Ga0436361_0115046
2325 Ga0436361_0149387
2326 Ga0436361_0298613
2327 Ga0436361_1015109
2328 Ga0436361_1035781
2329 Ga0436363_0441792
2330 Ga0439447_029963
2331 Ga0439466_0001370
2332 Ga0451853_3964788
2333 Ga0439431_0003640
2334 Ga0439448_0002019
2335 Ga0439432_011742
2336 Ga0439450_021130
2337 Ga0439455_0002250
2338 Ga0450888_006722
2339 Ga0439464_0010768
2340 Ga0439460_0004047
2341 Ga0451577_0002804
2342 Ga0451577_0003002
2343 Ga0451577_0029523
2344 Ga0451577_0051298
2345 Ga0451577_0056299
2346 Ga0451577_0116278
2347 Ga0451577_0125332
2348 Ga0466969_0001856
2349 Ga0466969_0002107
2350 Ga0453683_0017707
2351 Ga0453683_0024472
2352 Ga0453683_0026181
2353 Ga0453683_0067113
2354 Ga0466966_0003642
2355 Ga0466961_0001050
2356 Ga0466964_0001846
2357 Ga0453684_0000789
2358 Ga0453684_0001404
2359 Ga0453684_0005874
2360 Ga0453684_0021384
2361 Ga0453684_0056579
2362 Ga0453684_0111559
2363 Ga0453684_0584459
2364 Ga0453684_0665782
2365 Ga0453684_0735601
2366 Ga0466971_0000216
2367 Ga0466970_0005778
2368 Ga0466957_0055856
2369 Ga0451576_0000674
2370 Ga0451576_0015471
2371 Ga0451576_0025255
2372 Ga0451576_0043727
2373 Ga0451576_0054139
2374 Ga0451576_0061972
2375 Ga0451576_0069622
2376 Ga0451576_0075225
2377 Ga0451576_0366656
2378 Ga0466967_0023171
2379 Ga0495592_0031259
2380 Ga0495592_0054489
2381 Ga0495603_0001866
2382 Ga0495603_0006042
2383 Ga0495603_0031425
2384 Ga0495603_0059548
2385 Ga0495603_0078298
2386 Ga0495591_008842
2387 Ga0495629_0000224
2388 Ga0495629_0030251
2389 Ga0495629_0100995
2390 Ga0495629_0140797
2391 Ga0495629_0238256
2392 Ga0495638_0002026
2393 Ga0495638_0010227
2394 Ga0495638_0229638
2395 Ga0495641_0007096
2396 Ga0495651_0014853
2397 Ga0495653_0001151
2398 Ga0495653_0001599
2399 Ga0495653_0017344
2400 Ga0495650_0002288
2401 Ga0495580_0000700
2402 Ga0495580_0001538
2403 Ga0495580_0002263
2404 Ga0495580_0003902
2405 Ga0495580_0008595
2406 Ga0495580_0009699
2407 Ga0495580_0025496
2408 Ga0495580_0033047
2409 Ga0495580_0033173
2410 Ga0495580_0082434
2411 Ga0495582_0019073
2412 Ga0495582_0052523
2413 Ga0495605_0006406
2414 Ga0495605_0007666
2415 Ga0495639_0001641
2416 Ga0495639_0046076
2417 Ga0495662_0013582
2418 Ga0495664_0000429
2419 Ga0495664_0000685
2420 Ga0495664_0018928
2421 Ga0495664_0071398
2422 Ga0495664_0078990
2423 Ga0495664_0088622
2424 Ga0495584_0045122
2425 Ga0495594_0020522
2426 Ga0495596_0007864
2427 Ga0495607_0084173
2428 Ga0495583_0006963
2429 Ga0495583_0118856
2430 Ga0495606_0116395
2431 Ga0495608_0043714
2432 Ga0495608_0046901
2433 Ga0495616_0020071
2434 Ga0495616_0064025
2435 Ga0495618_0010454
2436 Ga0495618_0056472
2437 Ga0495618_0108921
2438 Ga0495628_0000831
2439 Ga0495628_0003725
2440 Ga0495628_0055138
2441 Ga0495628_0114914
2442 Ga0495630_0002201
2443 Ga0495630_0014399
2444 Ga0495630_0077992
2445 Ga0495632_0057179
2446 Ga0495632_0104489
2447 Ga0495648_0002762
2448 Ga0495648_0015139
2449 Ga0495648_0016753
2450 Ga0495648_0058926
2451 Ga0495648_0097364
2452 Ga0495666_0000299
2453 Ga0495666_0058413
2454 Ga0495642_0022914
2455 Ga0495652_0001797
2456 Ga0495652_0014692
2457 Ga0495652_0073952
2458 Ga0495665_0000415
2459 Ga0495665_0000879
2460 Ga0495665_0014148
2461 Ga0495665_0019069
2462 Ga0495665_0049929
2463 Ga0495665_0059945
2464 Ga0495640_0014707
2465 Ga0495640_0034387
2466 Ga0495586_0063979
2467 Ga0495586_0105781
2468 Ga0495586_0129104
2469 Ga0495586_0204706
2470 Ga0495587_0000686
2471 Ga0495587_0015593
2472 Ga0495598_0048507
2473 Ga0495621_0002198
2474 Ga0495621_0059634
2475 Ga0495645_0001756
2476 Ga0495667_0014831
2477 Ga0495667_0021574
2478 Ga0495634_0002194
2479 Ga0495634_0022609
2480 Ga0495611_0051663
2481 Ga0495625_0079604
2482 Ga0495635_0031672
2483 Ga0495635_0100569
2484 Ga0495635_0115000
2485 Ga0495635_0137592
2486 Ga0495661_0001293
2487 Ga0495661_0005687
2488 Ga0495657_0035778
2489 Ga0495657_0046331
2490 Ga0495657_0073700
2491 Ga0495657_0260342
2492 Ga0495599_0002006
2493 Ga0495599_0004056
2494 Ga0495599_0006027
2495 Ga0495599_0025854
2496 Ga0495599_0052227
2497 Ga0495623_0003332
2498 Ga0495623_0011928
2499 Ga0495623_0051308
2500 Ga0495646_0012481
2501 Ga0495646_0133343
2502 Ga0495647_0007459
2503 Ga0495647_0032350
2504 Ga0495647_0050172
2505 Ga0495658_0002904
2506 Ga0495658_0005709
2507 Ga0495658_0034592
2508 Ga0495658_0167427
2509 Ga0495669_0006310
2510 Ga0495669_0188450
2511 Ga0495613_0064614
2512 Ga0495613_0356406
2513 Ga0495624_0000062
2514 Ga0495624_0000540
2515 Ga0495624_0000958
2516 Ga0495624_0008355
2517 Ga0495624_0065966
2518 Ga0495670_0008307
2519 Ga0495670_0212559
2520 Ga0495671_0049495
2521 Ga0495671_0179386
2522 Ga0495649_0132632
2523 Ga0495589_0003015
2524 Ga0495589_0005218
2525 Ga0495589_0022660
2526 Ga0495589_0119397
2527 Ga0495600_0165220
2528 Ga0495581_0004550
2529 Ga0495581_0140908
2530 Ga0495604_0001008
2531 Ga0495604_0002577
2532 Ga0495604_0054559
2533 Ga0495604_0059375
2534 Ga0495604_0088452
2535 Ga0495604_0187178
2536 Ga0495604_0221862
2537 Ga0495636_0001185
2538 Ga0495674_0000741
2539 Ga0495674_0005345
2540 Ga0495674_0008223
2541 Ga0495674_0008525
2542 Ga0495674_0014935
2543 Ga0495674_0016022
2544 Ga0495674_0022797
2545 Ga0495674_0094474
2546 Ga0495674_0141256
2547 Ga0495672_0005393
2548 Ga0495672_0010282
2549 Ga0495672_0025979
2550 Ga0495676_0031125
2551 Ga0495680_0001805
2552 Ga0495680_0024289
2553 Ga0495680_0062618
2554 Ga0495680_0102662
2555 Ga0495680_0168969
2556 Ga0495683_0031837
2557 Ga0495687_019854
2558 Ga0495687_034998
2559 Ga0495687_053767
2560 Ga0495675_0002322
2561 Ga0495675_0016280
2562 Ga0495675_0048455
2563 Ga0495675_0132809
2564 Ga0495675_0175933
2565 Ga0495679_000473
2566 Ga0495679_000897
2567 Ga0495679_074363
2568 Ga0495685_080701
2569 Ga0495673_0014021
2570 Ga0495673_0016141
2571 Ga0495673_0016813
2572 Ga0495684_0029557
2573 Ga0495684_0055680
2574 Ga0495593_0009257
2575 Ga0495593_0076523
2576 Ga0495593_0087487
2577 Ga0495602_0001774
2578 Ga0495602_0068433
2579 Ga0495602_0085720
2580 Ga0495602_0092490
2581 Ga0495602_0168588
2582 Ga0495614_0000191
2583 Ga0495614_0023072
2584 Ga0495626_0056015
2585 Ga0496100_0004002
2586 Ga0496100_0047886
2587 Ga0496100_0126104
2588 Ga0496100_0368867
2589 Ga0496101_0003676
2590 Ga0496102_0023692
2591 Ga0496102_0069473
2592 Ga0496102_0669216
2593 Ga0496104_0010082
2594 Ga0496104_0012559
2595 Ga0496104_0093923
2596 Ga0496104_0351787
2597 Ga0496105_0019505
2598 Ga0496105_0033233
2599 Ga0496105_0087117
2600 Ga0496106_0151386
2601 Ga0496106_0227393
2602 Ga0496107_0021955
2603 Ga0496107_0037468
2604 Ga0496107_0196603
2605 Ga0496108_0095747
2606 Ga0496108_0172355
2607 Ga0496109_0275245
2608 Ga0496109_0319091
2609 Ga0496109_0490838
2610 Ga0496110_0094014
2611 Ga0496110_0154892
2612 Ga0496111_0013080
2613 Ga0496112_0002424
2614 Ga0496112_0036367
2615 Ga0496112_0111487
2616 Ga0496113_0002098
2617 Ga0496113_0038684
2618 Ga0496114_0031008
2619 Ga0496114_0088369
2620 Ga0496115_0010346
2621 Ga0496116_0028474
2622 Ga0496117_0046288
2623 Ga0496118_0013636
2624 Ga0496118_0046932
2625 Ga0496119_0001412
2626 Ga0496119_0111837
2627 Ga0496120_0000061
2628 Ga0496121_0003416
2629 Ga0496121_0008989
2630 Ga0496121_0010073
2631 Ga0496125_0001329
2632 Ga0496125_0009379
2633 Ga0496126_0000102
2634 Ga0496126_0111733
2635 Ga0495682_0003413
2636 Ga0501031_0094581
2637 Ga0501031_0183505
2638 Ga0501034_0432680
2639 Ga0501036_0481422
2640 Ga0501038_0144568
2641 Ga0501039_0001318
2642 Ga0501039_0152724
2643 Ga0501040_0002506
2644 Ga0501041_0002441
2645 Ga0501041_0068175
2646 Ga0501041_0127106
2647 Ga0501041_0268240
2648 Ga0501042_0005640
2649 Ga0501042_0013689
2650 Ga0501046_0113159
2651 Ga0501047_0004510
2652 Ga0501047_0008637
2653 Ga0501048_0010224
2654 Ga0501067_0176324
2655 Ga0501068_0000336
2656 Ga0501068_0220190
2657 Ga0501069_0001252
2658 Ga0501070_0000975
2659 Ga0501070_0002573
2660 Ga0501071_0001594
2661 Ga0501071_0011264
2662 Ga0501071_0012654
2663 Ga0501071_0063039
2664 Ga0501071_0094639
2665 Ga0501071_0140456
2666 Ga0501071_0164187
2667 Ga0501072_0008439
2668 Ga0501072_0010897
2669 Ga0501072_0037994
2670 Ga0501072_0080857
2671 Ga0501073_0001472
2672 Ga0501073_0003148
2673 Ga0501073_0214512
2674 Ga0501074_0012536
2675 Ga0501074_0036304
2676 Ga0501074_0142932
2677 Ga0501075_0000301
2678 Ga0501075_0340812
2679 Ga0501076_0000098
2680 Ga0501076_0009249
2681 Ga0501076_0143264
2682 Ga0501076_0201726
2683 Ga0501077_0000288
2684 Ga0501077_0004557
2685 Ga0501198_000136
2686 Ga0501222_000203
2687 Ga0501079_0000932
2688 Ga0501079_0003630
2689 Ga0501079_0022877
2690 Ga0501079_0038501
2691 Ga0501079_0245411
2692 Ga0501079_0293452
2693 Ga0501080_0001504
2694 Ga0501080_0002429
2695 Ga0501080_0003832
2696 Ga0501080_0006561
2697 Ga0501080_0056729
2698 Ga0501081_0007365
2699 Ga0501081_0129722
2700 Ga0501083_0002934
2701 Ga0501083_0005053
2702 Ga0501083_0195215
2703 Ga0501035_0056514
2704 Ga0501035_0069902
2705 Ga0501035_0108421
2706 Ga0501044_0011796
2707 Ga0501044_0049492
2708 Ga0501044_0083540
2709 Ga0501044_0384198
2710 Ga0501045_0005445
2711 nmdc:mga06z11_10234_c1
2712 nmdc:mga07m45_17021_c1
2713 nmdc:mga07m45_1741_c1
2714 nmdc:mga05p37_137_c1
2715 nmdc:mga05p37_243420_c1
2716 nmdc:mga05p37_67_c1
2717 nmdc:mga05p37_8988_c1
2718 nmdc:mga09592_1642_c1
2719 nmdc:mga09592_255336_c1
2720 nmdc:mga09592_258_c1
2721 nmdc:mga09592_45_c1
2722 nmdc:mga09592_5545_c1
2723 nmdc:mga09592_69998_c1
2724 nmdc:mga09592_986_c2
2725 nmdc:mga0qj67_13357_c1
2726 nmdc:mga0qj67_47189_c1
2727 nmdc:mga0qj67_7447_c1
2728 nmdc:mga06r32_115_c1
2729 nmdc:mga06r32_19264_c1
2730 nmdc:mga06r32_379684_c1
2731 nmdc:mga06r32_9078_c1
2732 nmdc:mga06r32_95468_c1
2733 nmdc:mga06r32_9718_c1
2734 nmdc:mga08y16_1100_c1
2735 nmdc:mga08y16_125548_c1
2736 nmdc:mga08y16_266_c1
2737 nmdc:mga08y16_335512_c1
2738 nmdc:mga08y16_34996_c1
2739 nmdc:mga08y16_3923_c1
2740 nmdc:mga08y16_84619_c1
2741 nmdc:mga08y16_99374_c1
2742 nmdc:mga0n895_456072_c1
2743 nmdc:mga0rr50_12678_c1
2744 nmdc:mga0rr50_480_c1
2745 nmdc:mga0rr50_69392_c1
2746 nmdc:mga0a205_402_c1
2747 Ga0495601_0040475
2748 Ga0495612_0013915
2749 Ga0500610_0000061
2750 Ga0495595_0007920
2751 Ga0495619_0077481
2752 Ga0495619_0158501
2753 Ga0500643_003261
2754 Ga0500583_0029107
2755 Ga0500583_0133237
2756 Ga0500583_0154631
2757 Ga0500608_000226
2758 Ga0500561_0009144
2759 Ga0500574_035921
2760 Ga0501084_0023456
2761 Ga0590071_001242
2762 Ga0501082_0001136
2763 Ga0501082_0008333
2764 Ga0501082_0033418
2765 Ga0501082_0117225
2766 Ga0530510_0013711
2767 Ga0530510_0154518
2768 2501071946
2769 2501411818
2770 2511100818
2771 2511107472
2772 2512350029
2773 2513552531
2774 2513560733
2775 2514047656
2776 2515682017
2777 2516017169
2778 2563056892
2779 2563064566
2780 2599744999
2781 2600206820
2782 2600811090
2783 2676743273
2784 2713472871
2785 2713481087
2786 2723878249
2787 2792837089
2788 2819620063
2789 2870076548
2790 2885279927
2791 2891636331
2792 2902685429
2793 2904620163
2794 2928110379
2795 2928138487
2796 2928505451
2797 2990710481
2798 642597772
2799 8003958309
2800 8020948220

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

8

300

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8912 2 316
7z0t-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure) 0.8883 2 316
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8802 9 316
7z0s-assembly1.cif.gz_D structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8667 9 316
6u8y-assembly1.cif.gz_m structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.7932 5 310
ID Description Score Start End Superfamily
af_Q58046_10_211_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.3415 66 246 1.20.58.220
af_P37340_17_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.317 138 314 1.10.1760.20
af_A0A1D8PCB5_370_524_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3157 104 313 1.20.1250.20
af_Q58046_10_211_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.3135 66 246 1.20.58.220
af_P37340_17_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3111 138 314 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A522AP15-F1-model_v4 Formate hydrogenlyase 0.9565 1 199 GO:0005886
GO:0016829
AF-A0A522M4U8-F1-model_v4 Formate hydrogenlyase 0.9562 2 149 GO:0005886
GO:0016829
AF-A0A534DSG4-F1-model_v4 deleted 0.9561 1 149
AF-A0A522AP15-F1-model_v4 Formate hydrogenlyase 0.9518 1 199 GO:0005886
GO:0016829
AF-A0A3D3AY45-F1-model_v4 Formate hydrogenlyase 0.9508 68 195 GO:0005886
GO:0016829

Map