F493638

General Info

Members Datasets Scaffolds Average Seq Length
1397 412 1390 124

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10872978|Ga0157377_108729782
Length 138
Sequence VQRPYANFETLRHVKLVIAYIRHEAFEPIRTELLNLGFPSLTVSEVKGSGRQKGITERYRGAELTNYLRPKVKLEVGVADRDVQTIVDTVLKHGRSGAVGDGKVFVLPIEDAFRVRTGESGEDILQAHPDAADSIAGA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
103 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
104 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
230 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
235 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
238 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
239 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
240 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
241 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
244 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
249 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
299 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
300 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
351 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
352 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
371 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.48
Metatranscriptomes 7.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 7.37
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1014085 3300000546 Bacteria 852
2 LJNas_1031457 3300000546 Bacteria 571
3 JGI24737J22298_10059458 3300001990 Bacteria 1151
4 Ga0006778J45830_1015811 3300003162 Bacteria 861
5 Ga0006778J45830_1020736 3300003162 Bacteria 856
6 JGI25406J46586_10007378 3300003203 Bacteria 5020
7 JGI25406J46586_10018647 3300003203 Bacteria 2848
8 JGI25406J46586_10062418 3300003203 Bacteria 1197
9 JGI25404J52841_10017318 3300003659 Bacteria 1562
10 Ga0032354_1045473 3300003693 Bacteria 524
11 Ga0058859_11831538 3300004798 Bacteria 653
12 Ga0070658_10593295 3300005327 Bacteria 960
13 Ga0070658_10635509 3300005327 Bacteria 926
14 Ga0070658_11134820 3300005327 Archaea 680
15 Ga0070676_10296477 3300005328 Bacteria 1095
16 Ga0070676_10321262 3300005328 Bacteria 1056
17 Ga0070676_10494622 3300005328 Bacteria 867
18 Ga0070676_10647229 3300005328 Bacteria 767
19 Ga0070683_100051324 3300005329 Bacteria 3818
20 Ga0070683_100116690 3300005329 Bacteria 2520
21 Ga0070683_100121872 3300005329 Bacteria 2464
22 Ga0070683_100151659 3300005329 Bacteria 2197
23 Ga0070683_100265306 3300005329 Bacteria 1633
24 Ga0070683_100356148 3300005329 Bacteria 1394
25 Ga0070683_100414621 3300005329 Bacteria 1285
26 Ga0070683_100491041 3300005329 Bacteria 1173
27 Ga0070683_101514468 3300005329 Bacteria 645
28 Ga0070670_100470316 3300005331 Bacteria 1115
29 Ga0070670_101550851 3300005331 Bacteria 608
30 Ga0070670_101588541 3300005331 Bacteria 601
31 Ga0070670_101870797 3300005331 Bacteria 553
32 Ga0068869_100274480 3300005334 Bacteria 1354
33 Ga0068869_100420561 3300005334 Bacteria 1102
34 Ga0068869_100644375 3300005334 Bacteria 899
35 Ga0068869_100693939 3300005334 Unclassified 867
36 Ga0068869_101515359 3300005334 Bacteria 596
37 Ga0068869_101905015 3300005334 Bacteria 533
38 Ga0070666_10113046 3300005335 Bacteria 1879
39 Ga0070666_11031018 3300005335 Bacteria 611
40 Ga0070680_100272870 3300005336 Bacteria 1432
41 Ga0070680_100854299 3300005336 Bacteria 785
42 Ga0070680_101260367 3300005336 Bacteria 640
43 Ga0070682_100099466 3300005337 Bacteria 1917
44 Ga0070682_100319266 3300005337 Bacteria 1146
45 Ga0070682_100367458 3300005337 Bacteria 1078
46 Ga0070682_100521177 3300005337 Bacteria 925
47 Ga0070682_100656257 3300005337 Bacteria 836
48 Ga0070682_100827185 3300005337 Bacteria 755
49 Ga0070682_101024234 3300005337 Bacteria 687
50 Ga0068868_100016021 3300005338 Bacteria 5559
51 Ga0068868_100308492 3300005338 Bacteria 1346
52 Ga0068868_100476267 3300005338 Bacteria 1090
53 Ga0068868_101064359 3300005338 Bacteria 743
54 Ga0068868_101240472 3300005338 Bacteria 691
55 Ga0068868_101581277 3300005338 Bacteria 615
56 Ga0070660_100140608 3300005339 Bacteria 1936
57 Ga0070660_100423975 3300005339 Bacteria 1102
58 Ga0070660_100853905 3300005339 Bacteria 767
59 Ga0070689_100038988 3300005340 Bacteria 3636
60 Ga0070689_101753360 3300005340 Bacteria 566
61 Ga0070689_101970422 3300005340 Bacteria 534
62 Ga0070691_10093675 3300005341 Bacteria 1484
63 Ga0070691_10307744 3300005341 Bacteria 868
64 Ga0070691_10332744 3300005341 Bacteria 839
65 Ga0070691_10418284 3300005341 Bacteria 759
66 Ga0070687_100020592 3300005343 Bacteria 3086
67 Ga0070687_100747175 3300005343 Bacteria 688
68 Ga0070661_100629140 3300005344 Bacteria 870
69 Ga0070661_100909685 3300005344 Bacteria 727
70 Ga0070661_101055252 3300005344 Bacteria 676
71 Ga0070692_10047289 3300005345 Bacteria 2226
72 Ga0070692_10079422 3300005345 Bacteria 1764
73 Ga0070692_10575134 3300005345 Bacteria 742
74 Ga0070668_100118572 3300005347 Bacteria 2113
75 Ga0070668_100139788 3300005347 Bacteria 1951
76 Ga0070668_100260224 3300005347 Bacteria 1443
77 Ga0070668_100386794 3300005347 Bacteria 1192
78 Ga0070668_100517418 3300005347 Bacteria 1035
79 Ga0070668_100724419 3300005347 Bacteria 879
80 Ga0070668_101123442 3300005347 Bacteria 710
81 Ga0070669_100282301 3300005353 Bacteria 1331
82 Ga0070669_100513204 3300005353 Bacteria 995
83 Ga0070669_100772454 3300005353 Bacteria 815
84 Ga0070669_101216205 3300005353 Bacteria 651
85 Ga0070675_100996606 3300005354 Bacteria 769
86 Ga0070675_101170476 3300005354 Bacteria 708
87 Ga0070675_101849259 3300005354 Bacteria 557
88 Ga0070671_100080642 3300005355 Bacteria 2721
89 Ga0070671_100266291 3300005355 Bacteria 1456
90 Ga0070671_100500176 3300005355 Bacteria 1046
91 Ga0070671_100615686 3300005355 Bacteria 939
92 Ga0070674_100038197 3300005356 Bacteria 3234
93 Ga0070674_100096632 3300005356 Bacteria 2144
94 Ga0070674_100215262 3300005356 Bacteria 1492
95 Ga0070674_100218774 3300005356 Bacteria 1481
96 Ga0070674_100549481 3300005356 Bacteria 969
97 Ga0070674_101070892 3300005356 Bacteria 711
98 Ga0070673_100204274 3300005364 Bacteria 1703
99 Ga0070673_100751474 3300005364 Bacteria 898
100 Ga0070688_100039738 3300005365 Bacteria 2881
101 Ga0070688_100416194 3300005365 Bacteria 998
102 Ga0070688_100488552 3300005365 Archaea 927
103 Ga0070688_100813135 3300005365 Bacteria 732
104 Ga0070659_100040376 3300005366 Bacteria 3646
105 Ga0070659_100120966 3300005366 Bacteria 2120
106 Ga0070659_100150803 3300005366 Bacteria 1896
107 Ga0070659_100393023 3300005366 Bacteria 1170
108 Ga0070659_100960467 3300005366 Bacteria 749
109 Ga0070659_101377486 3300005366 Bacteria 627
110 Ga0070667_100302672 3300005367 Bacteria 1440
111 Ga0070667_100442726 3300005367 Bacteria 1187
112 Ga0070667_100690707 3300005367 Bacteria 944
113 Ga0070710_10352262 3300005437 Bacteria 975
114 Ga0070701_10127161 3300005438 Bacteria 1443
115 Ga0070701_10252672 3300005438 Bacteria 1065
116 Ga0070701_10640210 3300005438 Bacteria 709
117 Ga0070705_100249597 3300005440 Bacteria 1245
118 Ga0070705_100492662 3300005440 Bacteria 929
119 Ga0070705_100600977 3300005440 Bacteria 851
120 Ga0070700_100043414 3300005441 Bacteria 2765
121 Ga0070700_100209387 3300005441 Bacteria 1375
122 Ga0070700_100281217 3300005441 Bacteria 1206
123 Ga0070700_100485257 3300005441 Bacteria 947
124 Ga0070700_101186975 3300005441 Bacteria 637
125 Ga0070663_100406793 3300005455 Bacteria 1114
126 Ga0070663_100521345 3300005455 Bacteria 989
127 Ga0070663_100693677 3300005455 Bacteria 865
128 Ga0070663_101081162 3300005455 Bacteria 701
129 Ga0070678_100151378 3300005456 Bacteria 1869
130 Ga0070678_100505564 3300005456 Bacteria 1067
131 Ga0070678_100785307 3300005456 Bacteria 864
132 Ga0070678_101392306 3300005456 Bacteria 655
133 Ga0070662_100143713 3300005457 Bacteria 1851
134 Ga0070662_100234969 3300005457 Bacteria 1468
135 Ga0070662_100288182 3300005457 Bacteria 1330
136 Ga0070662_100293951 3300005457 Bacteria 1318
137 Ga0070662_101017560 3300005457 Bacteria 710
138 Ga0070681_11157520 3300005458 Bacteria 695
139 Ga0068867_100055824 3300005459 Bacteria 2920
140 Ga0068867_100151776 3300005459 Bacteria 1820
141 Ga0068867_100381689 3300005459 Bacteria 1184
142 Ga0068867_100431970 3300005459 Bacteria 1118
143 Ga0068867_100867314 3300005459 Bacteria 810
144 Ga0068867_100908972 3300005459 Bacteria 793
145 Ga0070685_10203345 3300005466 Bacteria 1289
146 Ga0070685_10203716 3300005466 Bacteria 1287
147 Ga0070685_10770568 3300005466 Bacteria 707
148 Ga0070679_100051303 3300005530 Bacteria 4109
149 Ga0070679_100351847 3300005530 Bacteria 1421
150 Ga0070684_100057876 3300005535 Bacteria 3385
151 Ga0070684_100261637 3300005535 Bacteria 1583
152 Ga0070684_100269053 3300005535 Bacteria 1560
153 Ga0070684_100402780 3300005535 Bacteria 1262
154 Ga0070684_100593411 3300005535 Bacteria 1030
155 Ga0070684_100792565 3300005535 Bacteria 886
156 Ga0070684_101106282 3300005535 Bacteria 745
157 Ga0070684_101856416 3300005535 Bacteria 569
158 Ga0068853_100069373 3300005539 Bacteria 3066
159 Ga0068853_100680196 3300005539 Bacteria 981
160 Ga0068853_100756847 3300005539 Unclassified 929
161 Ga0068853_102168220 3300005539 Archaea 539
162 Ga0070672_100283746 3300005543 Bacteria 1401
163 Ga0070672_100330160 3300005543 Bacteria 1297
164 Ga0070672_100405805 3300005543 Bacteria 1169
165 Ga0070672_100473606 3300005543 Bacteria 1081
166 Ga0070672_100474666 3300005543 Bacteria 1079
167 Ga0070672_100493223 3300005543 Bacteria 1059
168 Ga0070672_100620458 3300005543 Bacteria 943
169 Ga0070695_100340924 3300005545 Bacteria 1120
170 Ga0070696_101018138 3300005546 Bacteria 693
171 Ga0070693_100181331 3300005547 Bacteria 1356
172 Ga0070693_100581335 3300005547 Bacteria 806
173 Ga0070693_100758648 3300005547 Bacteria 716
174 Ga0070665_100018292 3300005548 Bacteria 7026
175 Ga0070665_100067826 3300005548 Bacteria 3577
176 Ga0070665_100087858 3300005548 Bacteria 3114
177 Ga0070665_100703332 3300005548 Bacteria 1024
178 Ga0070665_100780019 3300005548 Bacteria 969
179 Ga0070665_101151332 3300005548 Bacteria 787
180 Ga0070665_101568300 3300005548 Bacteria 666
181 Ga0070704_100410535 3300005549 Bacteria 1157
182 Ga0070664_100139176 3300005564 Bacteria 2136
183 Ga0070664_100403703 3300005564 Bacteria 1250
184 Ga0070664_100461999 3300005564 Bacteria 1166
185 Ga0070664_101020894 3300005564 Bacteria 778
186 Ga0070664_101105757 3300005564 Bacteria 746
187 Ga0070664_101443056 3300005564 Bacteria 651
188 Ga0070664_101818784 3300005564 Bacteria 578
189 Ga0070664_101907313 3300005564 Bacteria 564
190 Ga0068857_100147796 3300005577 Bacteria 2127
191 Ga0068857_100362406 3300005577 Bacteria 1344
192 Ga0068857_100362554 3300005577 Bacteria 1344
193 Ga0068857_100613860 3300005577 Bacteria 1029
194 Ga0068854_100131479 3300005578 Bacteria 1912
195 Ga0068854_100415995 3300005578 Bacteria 1116
196 Ga0068854_100428685 3300005578 Bacteria 1100
197 Ga0068854_100471354 3300005578 Bacteria 1052
198 Ga0068854_100532794 3300005578 Bacteria 994
199 Ga0068854_100935097 3300005578 Bacteria 764
200 Ga0068854_101984972 3300005578 Unclassified 536
201 Ga0068854_102003060 3300005578 Archaea 534
202 Ga0068856_100074748 3300005614 Bacteria 3355
203 Ga0068856_100153728 3300005614 Bacteria 2310
204 Ga0068856_100290837 3300005614 Bacteria 1651
205 Ga0068856_100757814 3300005614 Bacteria 991
206 Ga0068856_100842106 3300005614 Bacteria 936
207 Ga0068856_101261551 3300005614 Bacteria 755
208 Ga0068856_102476080 3300005614 Bacteria 526
209 Ga0070702_100045115 3300005615 Bacteria 2492
210 Ga0070702_100106505 3300005615 Bacteria 1729
211 Ga0070702_100237248 3300005615 Bacteria 1229
212 Ga0070702_100395811 3300005615 Bacteria 987
213 Ga0070702_100472361 3300005615 Bacteria 915
214 Ga0070702_100572528 3300005615 Bacteria 842
215 Ga0070702_100940876 3300005615 Bacteria 680
216 Ga0070702_101158410 3300005615 Bacteria 621
217 Ga0070702_101445626 3300005615 Bacteria 564
218 Ga0068852_100090457 3300005616 Bacteria 2737
219 Ga0068852_100238710 3300005616 Bacteria 1736
220 Ga0068852_100357872 3300005616 Bacteria 1427
221 Ga0068852_101147505 3300005616 Bacteria 798
222 Ga0068852_101196682 3300005616 Bacteria 781
223 Ga0068859_100093502 3300005617 Bacteria 3058
224 Ga0068859_100923922 3300005617 Bacteria 957
225 Ga0068859_101797985 3300005617 Bacteria 677
226 Ga0068864_100161670 3300005618 Bacteria 2036
227 Ga0068864_100258303 3300005618 Bacteria 1620
228 Ga0068864_100315635 3300005618 Bacteria 1466
229 Ga0068864_100400129 3300005618 Bacteria 1305
230 Ga0068866_10040284 3300005718 Bacteria 2312
231 Ga0068866_10192524 3300005718 Archaea 1213
232 Ga0068866_10212355 3300005718 Bacteria 1163
233 Ga0068866_10758880 3300005718 Bacteria 671
234 Ga0068866_10875600 3300005718 Bacteria 630
235 Ga0068866_10900409 3300005718 Unclassified 622
236 Ga0068861_100036002 3300005719 Bacteria 3670
237 Ga0068861_100175211 3300005719 Bacteria 1781
238 Ga0068861_100788839 3300005719 Bacteria 890
239 Ga0068870_10069979 3300005840 Bacteria 1911
240 Ga0068870_10077969 3300005840 Bacteria 1824
241 Ga0068870_10726182 3300005840 Bacteria 688
242 Ga0068870_11014427 3300005840 Bacteria 592
243 Ga0068863_100298371 3300005841 Bacteria 1563
244 Ga0068863_100582290 3300005841 Bacteria 1107
245 Ga0068863_100656170 3300005841 Bacteria 1041
246 Ga0068863_100911261 3300005841 Bacteria 880
247 Ga0068858_100204302 3300005842 Bacteria 1869
248 Ga0068858_100332756 3300005842 Bacteria 1453
249 Ga0068860_100371933 3300005843 Bacteria 1409
250 Ga0068860_100407517 3300005843 Bacteria 1346
251 Ga0068860_100728155 3300005843 Bacteria 1003
252 Ga0068860_101426524 3300005843 Bacteria 714
253 Ga0068862_100754446 3300005844 Bacteria 947
254 Ga0068862_100871440 3300005844 Bacteria 884
255 Ga0081455_10004985 3300005937 Bacteria 14689
256 Ga0081455_10067585 3300005937 Bacteria 2978
257 Ga0081455_10337642 3300005937 Bacteria 1067
258 Ga0081455_10554011 3300005937 Bacteria 760
259 Ga0081455_10622851 3300005937 Bacteria 700
260 Ga0081455_10799491 3300005937 Bacteria 592
261 Ga0081455_11051931 3300005937 Bacteria 503
262 Ga0081538_10001765 3300005981 Bacteria 21875
263 Ga0081538_10004007 3300005981 Bacteria 13720
264 Ga0081538_10013354 3300005981 Bacteria 6508
265 Ga0081538_10371468 3300005981 Bacteria 516
266 Ga0081540_1000550 3300005983 Bacteria 36321
267 Ga0081540_1062443 3300005983 Bacteria 1769
268 Ga0081540_1070266 3300005983 Bacteria 1622
269 Ga0081539_10003476 3300005985 Bacteria 19246
270 Ga0081539_10003515 3300005985 Bacteria 19108
271 Ga0081539_10004853 3300005985 Bacteria 14380
272 Ga0081539_10009483 3300005985 Bacteria 8121
273 Ga0081539_10319266 3300005985 Bacteria 661
274 Ga0075365_10492995 3300006038 Bacteria 866
275 Ga0075365_10712546 3300006038 Bacteria 709
276 Ga0075365_11046031 3300006038 Bacteria 575
277 Ga0075364_10670595 3300006051 Bacteria 708
278 Ga0075364_10749821 3300006051 Bacteria 666
279 Ga0075432_10039271 3300006058 Bacteria 1651
280 Ga0070715_10638236 3300006163 Bacteria 629
281 Ga0070712_100336693 3300006175 Bacteria 1231
282 Ga0075367_10458485 3300006178 Bacteria 808
283 Ga0097621_100427470 3300006237 Bacteria 1190
284 Ga0097621_101270149 3300006237 Bacteria 695
285 Ga0068871_100632171 3300006358 Bacteria 976
286 Ga0068871_101824976 3300006358 Bacteria 577
287 Ga0075428_100257996 3300006844 Bacteria 1877
288 Ga0075428_100285968 3300006844 Bacteria 1774
289 Ga0075428_100539909 3300006844 Bacteria 1247
290 Ga0075428_101125448 3300006844 Bacteria 829
291 Ga0075428_101135735 3300006844 Bacteria 825
292 Ga0075428_101429077 3300006844 Bacteria 726
293 Ga0075428_101794810 3300006844 Bacteria 639
294 Ga0075430_100017272 3300006846 Bacteria 6146
295 Ga0075430_100639117 3300006846 Bacteria 878
296 Ga0075430_101151897 3300006846 Bacteria 638
297 Ga0075430_101244177 3300006846 Bacteria 612
298 Ga0075430_101514232 3300006846 Bacteria 551
299 Ga0075433_10109250 3300006852 Bacteria 2454
300 Ga0075434_100750585 3300006871 Bacteria 993
301 Ga0075429_100423024 3300006880 Bacteria 1167
302 Ga0068865_100140352 3300006881 Bacteria 1821
303 Ga0068865_100166349 3300006881 Bacteria 1687
304 Ga0068865_100330119 3300006881 Bacteria 1229
305 Ga0068865_100361059 3300006881 Bacteria 1179
306 Ga0068865_100433990 3300006881 Bacteria 1083
307 Ga0068865_102012820 3300006881 Bacteria 524
308 Ga0075436_100256311 3300006914 Bacteria 1247
309 Ga0097620_100093505 3300006931 Bacteria 3058
310 Ga0097620_100923949 3300006931 Bacteria 957
311 Ga0097620_101797828 3300006931 Bacteria 677
312 Ga0105251_10229607 3300009011 Bacteria 836
313 Ga0105250_10307657 3300009092 Bacteria 686
314 Ga0105240_10648748 3300009093 Bacteria 1157
315 Ga0105240_11310090 3300009093 Bacteria 764
316 Ga0105240_12314041 3300009093 Bacteria 557
317 Ga0111539_10057434 3300009094 Bacteria 4622
318 Ga0111539_10108496 3300009094 Bacteria 3258
319 Ga0111539_10258245 3300009094 Bacteria 2028
320 Ga0111539_10428965 3300009094 Bacteria 1539
321 Ga0111539_10702163 3300009094 Bacteria 1177
322 Ga0111539_11817463 3300009094 Bacteria 707
323 Ga0111539_12949973 3300009094 Bacteria 550
324 Ga0105245_10025825 3300009098 Bacteria 5166
325 Ga0105245_10111186 3300009098 Bacteria 2548
326 Ga0105245_10193170 3300009098 Bacteria 1951
327 Ga0105245_10289391 3300009098 Bacteria 1604
328 Ga0105245_10336096 3300009098 Bacteria 1492
329 Ga0105245_10339718 3300009098 Bacteria 1485
330 Ga0105245_10568017 3300009098 Bacteria 1158
331 Ga0105245_10668325 3300009098 Bacteria 1070
332 Ga0105245_10782759 3300009098 Bacteria 991
333 Ga0105245_10903523 3300009098 Bacteria 925
334 Ga0105245_11071834 3300009098 Bacteria 852
335 Ga0105245_11501737 3300009098 Bacteria 725
336 Ga0105247_10050230 3300009101 Bacteria 2566
337 Ga0105247_10129762 3300009101 Bacteria 1642
338 Ga0105247_10242139 3300009101 Bacteria 1229
339 Ga0105247_10320799 3300009101 Bacteria 1081
340 Ga0105247_10401821 3300009101 Bacteria 976
341 Ga0105247_10635784 3300009101 Bacteria 795
342 Ga0114129_10239089 3300009147 Bacteria 2442
343 Ga0114129_10649393 3300009147 Bacteria 1362
344 Ga0114129_10685884 3300009147 Bacteria 1318
345 Ga0114129_10969028 3300009147 Bacteria 1073
346 Ga0114129_12160057 3300009147 Bacteria 670
347 Ga0114129_12464361 3300009147 Bacteria 622
348 Ga0105243_10082125 3300009148 Bacteria 2633
349 Ga0105243_10248043 3300009148 Bacteria 1588
350 Ga0105243_10334476 3300009148 Bacteria 1385
351 Ga0105243_10402268 3300009148 Bacteria 1272
352 Ga0105243_10547474 3300009148 Bacteria 1105
353 Ga0105243_10566717 3300009148 Bacteria 1088
354 Ga0105243_11249002 3300009148 Bacteria 758
355 Ga0105243_12172535 3300009148 Bacteria 591
356 Ga0105241_11037140 3300009174 Bacteria 769
357 Ga0105242_10044851 3300009176 Bacteria 3582
358 Ga0105242_10075825 3300009176 Bacteria 2801
359 Ga0105242_10084876 3300009176 Bacteria 2654
360 Ga0105242_10134803 3300009176 Bacteria 2136
361 Ga0105242_10267363 3300009176 Bacteria 1547
362 Ga0105242_10313974 3300009176 Bacteria 1435
363 Ga0105242_10646604 3300009176 Bacteria 1028
364 Ga0105242_10739212 3300009176 Bacteria 967
365 Ga0105242_11727306 3300009176 Bacteria 663
366 Ga0105242_11948061 3300009176 Bacteria 629
367 Ga0105248_10045886 3300009177 Bacteria 4898
368 Ga0105248_10479995 3300009177 Bacteria 1401
369 Ga0105248_10748475 3300009177 Bacteria 1103
370 Ga0105248_11560415 3300009177 Bacteria 748
371 Ga0105237_10319849 3300009545 Bacteria 1555
372 Ga0105237_11580045 3300009545 Bacteria 663
373 Ga0105237_11744990 3300009545 Bacteria 630
374 Ga0105238_10425432 3300009551 Bacteria 1323
375 Ga0105238_10889997 3300009551 Bacteria 908
376 Ga0105238_11065646 3300009551 Bacteria 830
377 Ga0105238_11117779 3300009551 Bacteria 811
378 Ga0105238_11905542 3300009551 Bacteria 627
379 Ga0105249_10313929 3300009553 Bacteria 1577
380 Ga0105249_10341863 3300009553 Bacteria 1513
381 Ga0105249_11059459 3300009553 Bacteria 880
382 Ga0105249_11076352 3300009553 Bacteria 874
383 Ga0105249_11647832 3300009553 Bacteria 714
384 Ga0105239_10467442 3300010375 Bacteria 1432
385 Ga0105239_10574951 3300010375 Bacteria 1284
386 Ga0105239_10592698 3300010375 Bacteria 1264
387 Ga0105239_11137379 3300010375 Bacteria 899
388 Ga0105239_11166236 3300010375 Bacteria 887
389 Ga0105246_10426850 3300011119 Bacteria 1108
390 Ga0105246_10436892 3300011119 Bacteria 1096
391 Ga0105246_10574459 3300011119 Bacteria 970
392 Ga0105246_10597331 3300011119 Bacteria 953
393 Ga0105246_10613513 3300011119 Bacteria 942
394 Ga0105246_11374094 3300011119 Bacteria 658
395 Ga0105246_11650191 3300011119 Bacteria 607
396 Ga0105246_11697286 3300011119 Bacteria 600
397 Ga0105246_11877864 3300011119 Bacteria 574
398 Ga0157336_1015194 3300012477 Bacteria 641
399 Ga0157318_1028273 3300012482 Bacteria 540
400 Ga0157342_1084233 3300012507 Bacteria 505
401 Ga0157373_10873591 3300013100 Bacteria 666
402 Ga0157371_10200697 3300013102 Bacteria 1430
403 Ga0157371_10485342 3300013102 Bacteria 911
404 Ga0157371_10610484 3300013102 Bacteria 812
405 Ga0157370_11383061 3300013104 Bacteria 633
406 Ga0157369_10544152 3300013105 Bacteria 1200
407 Ga0157369_10555936 3300013105 Bacteria 1186
408 Ga0157369_10803073 3300013105 Bacteria 967
409 Ga0157369_10880943 3300013105 Bacteria 918
410 Ga0157369_11150789 3300013105 Bacteria 792
411 Ga0157369_11593201 3300013105 Bacteria 664
412 Ga0157374_10847945 3300013296 Bacteria 930
413 Ga0157374_11732481 3300013296 Bacteria 650
414 Ga0157374_12099442 3300013296 Bacteria 592
415 Ga0157374_12128245 3300013296 Bacteria 588
416 Ga0157374_12132399 3300013296 Bacteria 587
417 Ga0157374_12634893 3300013296 Archaea 530
418 Ga0157378_11352172 3300013297 Bacteria 754
419 Ga0157378_12103067 3300013297 Bacteria 615
420 Ga0163162_10185460 3300013306 Bacteria 2207
421 Ga0163162_10205781 3300013306 Bacteria 2097
422 Ga0163162_10466330 3300013306 Bacteria 1394
423 Ga0163162_10589714 3300013306 Bacteria 1238
424 Ga0163162_11183426 3300013306 Bacteria 867
425 Ga0163162_11204053 3300013306 Bacteria 859
426 Ga0157372_10071464 3300013307 Bacteria 3908
427 Ga0157372_10100366 3300013307 Bacteria 3303
428 Ga0157372_10294395 3300013307 Bacteria 1888
429 Ga0157372_10735659 3300013307 Bacteria 1147
430 Ga0157372_10855830 3300013307 Bacteria 1055
431 Ga0157372_10922986 3300013307 Bacteria 1012
432 Ga0157372_10971141 3300013307 Bacteria 984
433 Ga0157372_11110793 3300013307 Bacteria 914
434 Ga0157372_11544201 3300013307 Bacteria 765
435 Ga0157372_11747067 3300013307 Bacteria 716
436 Ga0157372_12087251 3300013307 Bacteria 651
437 Ga0157372_12811828 3300013307 Bacteria 558
438 Ga0157375_10580896 3300013308 Bacteria 1281
439 Ga0157375_10837494 3300013308 Bacteria 1067
440 Ga0157375_10921532 3300013308 Bacteria 1017
441 Ga0157375_11181724 3300013308 Bacteria 897
442 Ga0157375_11200337 3300013308 Bacteria 890
443 Ga0157375_12581945 3300013308 Bacteria 607
444 Ga0157375_13528554 3300013308 Bacteria 520
445 Ga0163163_10117802 3300014325 Bacteria 2688
446 Ga0157380_10100377 3300014326 Bacteria 2409
447 Ga0157380_10142125 3300014326 Bacteria 2064
448 Ga0157380_10162665 3300014326 Bacteria 1942
449 Ga0157380_10189770 3300014326 Bacteria 1813
450 Ga0157380_11079669 3300014326 Bacteria 841
451 Ga0157380_11159133 3300014326 Bacteria 815
452 Ga0157380_11682040 3300014326 Bacteria 692
453 Ga0157380_11901991 3300014326 Bacteria 655
454 Ga0182008_10170544 3300014497 Bacteria 1098
455 Ga0182008_10193009 3300014497 Bacteria 1034
456 Ga0182008_10247895 3300014497 Bacteria 918
457 Ga0182008_10326857 3300014497 Bacteria 808
458 Ga0182008_10357452 3300014497 Bacteria 776
459 Ga0182008_10649718 3300014497 Bacteria 597
460 Ga0157377_10020770 3300014745 Bacteria 3445
461 Ga0157377_10128778 3300014745 Bacteria 1543
462 Ga0157377_10238951 3300014745 Bacteria 1172
463 Ga0157377_10338783 3300014745 Bacteria 1005
464 Ga0157377_10420429 3300014745 Bacteria 915
465 Ga0157377_10490118 3300014745 Bacteria 857
466 Ga0157377_10872978 3300014745 Bacteria 670
467 Ga0157377_11081579 3300014745 Bacteria 613
468 Ga0157379_10023358 3300014968 Bacteria 5486
469 Ga0157379_10196916 3300014968 Bacteria 1821
470 Ga0157379_10207695 3300014968 Bacteria 1772
471 Ga0157379_10338043 3300014968 Bacteria 1377
472 Ga0157379_12267749 3300014968 Bacteria 540
473 Ga0157376_10542070 3300014969 Bacteria 1150
474 Ga0157376_10839564 3300014969 Bacteria 933
475 Ga0157376_11660125 3300014969 Bacteria 674
476 Ga0157376_11949059 3300014969 Bacteria 625
477 Ga0182007_10438280 3300015262 Bacteria 502
478 Ga0163161_10238745 3300017792 Bacteria 1413
479 Ga0163161_10499234 3300017792 Bacteria 991
480 Ga0163161_10612252 3300017792 Bacteria 899
481 Ga0163161_10691468 3300017792 Bacteria 848
482 Ga0163161_10765765 3300017792 Bacteria 809
483 Ga0163161_10896721 3300017792 Bacteria 751
484 Ga0163161_10972792 3300017792 Bacteria 723
485 Ga0163161_11332793 3300017792 Bacteria 625
486 Ga0197907_10232531 3300020069 Bacteria 526
487 Ga0197907_10384862 3300020069 Bacteria 552
488 Ga0197907_11110283 3300020069 Bacteria 678
489 Ga0206356_10203078 3300020070 Bacteria 518
490 Ga0206356_10721767 3300020070 Bacteria 764
491 Ga0206356_11352269 3300020070 Bacteria 514
492 Ga0206349_1745234 3300020075 Bacteria 804
493 Ga0206355_1259147 3300020076 Bacteria 530
494 Ga0206351_10097990 3300020077 Bacteria 575
495 Ga0206352_10524090 3300020078 Bacteria 592
496 Ga0206354_10224768 3300020081 Bacteria 778
497 Ga0206354_10246270 3300020081 Bacteria 584
498 Ga0206354_10436244 3300020081 Bacteria 504
499 Ga0206354_10725166 3300020081 Bacteria 540
500 Ga0206354_10793033 3300020081 Bacteria 537
501 Ga0206353_10055073 3300020082 Bacteria 1010
502 Ga0206353_10820068 3300020082 Bacteria 594
503 Ga0206353_11325071 3300020082 Bacteria 632
504 Ga0206353_12059057 3300020082 Bacteria 708
505 Ga0154015_1181469 3300020610 Bacteria 684
506 Ga0224712_10141889 3300022467 Bacteria 1058
507 Ga0224712_10174522 3300022467 Bacteria 965
508 Ga0224712_10387380 3300022467 Bacteria 665
509 Ga0224712_10635067 3300022467 Bacteria 523
510 Ga0207656_10079229 3300025321 Bacteria 1474
511 Ga0207656_10288302 3300025321 Bacteria 811
512 Ga0207656_10295101 3300025321 Bacteria 802
513 Ga0207653_10176805 3300025885 Bacteria 797
514 Ga0207682_10342607 3300025893 Bacteria 704
515 Ga0207692_10286646 3300025898 Bacteria 998
516 Ga0207642_10015682 3300025899 Bacteria 2832
517 Ga0207642_10044113 3300025899 Bacteria 1971
518 Ga0207642_10225905 3300025899 Bacteria 1049
519 Ga0207642_10533274 3300025899 Bacteria 723
520 Ga0207710_10322247 3300025900 Bacteria 784
521 Ga0207688_10038756 3300025901 Bacteria 2646
522 Ga0207688_10049002 3300025901 Bacteria 2360
523 Ga0207688_10107004 3300025901 Bacteria 1620
524 Ga0207688_10162969 3300025901 Bacteria 1323
525 Ga0207688_10293760 3300025901 Bacteria 992
526 Ga0207688_10480310 3300025901 Bacteria 777
527 Ga0207688_10660194 3300025901 Bacteria 660
528 Ga0207688_10756940 3300025901 Bacteria 615
529 Ga0207688_10831990 3300025901 Bacteria 585
530 Ga0207680_10234709 3300025903 Bacteria 1262
531 Ga0207680_10505724 3300025903 Bacteria 861
532 Ga0207680_10605706 3300025903 Bacteria 784
533 Ga0207680_11085023 3300025903 Bacteria 572
534 Ga0207685_10281308 3300025905 Bacteria 816
535 Ga0207645_10192134 3300025907 Bacteria 1342
536 Ga0207645_10711025 3300025907 Bacteria 683
537 Ga0207643_10011614 3300025908 Bacteria 4755
538 Ga0207643_10109227 3300025908 Bacteria 1628
539 Ga0207643_10110412 3300025908 Bacteria 1620
540 Ga0207643_10397516 3300025908 Bacteria 871
541 Ga0207643_10755710 3300025908 Bacteria 629
542 Ga0207705_10075732 3300025909 Bacteria 2445
543 Ga0207705_10309432 3300025909 Bacteria 1213
544 Ga0207705_10334258 3300025909 Bacteria 1165
545 Ga0207705_10354533 3300025909 Bacteria 1131
546 Ga0207705_10541877 3300025909 Bacteria 904
547 Ga0207705_11267426 3300025909 Bacteria 564
548 Ga0207654_10367428 3300025911 Bacteria 994
549 Ga0207671_10822196 3300025914 Bacteria 736
550 Ga0207671_11342390 3300025914 Bacteria 556
551 Ga0207693_10569278 3300025915 Bacteria 883
552 Ga0207660_10230804 3300025917 Bacteria 1455
553 Ga0207660_10352814 3300025917 Bacteria 1179
554 Ga0207660_10635191 3300025917 Bacteria 870
555 Ga0207662_10004071 3300025918 Bacteria 7632
556 Ga0207662_10067062 3300025918 Bacteria 2163
557 Ga0207662_10080281 3300025918 Bacteria 1989
558 Ga0207662_10584744 3300025918 Bacteria 776
559 Ga0207662_11321581 3300025918 Bacteria 512
560 Ga0207657_10065082 3300025919 Bacteria 3109
561 Ga0207657_10068286 3300025919 Bacteria 3020
562 Ga0207657_10072323 3300025919 Bacteria 2917
563 Ga0207657_10360388 3300025919 Bacteria 1146
564 Ga0207657_10874093 3300025919 Bacteria 693
565 Ga0207657_10899764 3300025919 Bacteria 682
566 Ga0207649_10261673 3300025920 Bacteria 1250
567 Ga0207649_10506876 3300025920 Bacteria 918
568 Ga0207649_10975119 3300025920 Bacteria 666
569 Ga0207652_10040524 3300025921 Bacteria 3956
570 Ga0207652_10264121 3300025921 Bacteria 1553
571 Ga0207652_10377046 3300025921 Bacteria 1280
572 Ga0207652_11053085 3300025921 Bacteria 713
573 Ga0207652_11146213 3300025921 Bacteria 679
574 Ga0207646_10047792 3300025922 Bacteria 3837
575 Ga0207681_10253560 3300025923 Bacteria 1375
576 Ga0207681_10579252 3300025923 Bacteria 926
577 Ga0207681_10812607 3300025923 Bacteria 781
578 Ga0207694_10280458 3300025924 Bacteria 1369
579 Ga0207694_10388088 3300025924 Bacteria 1160
580 Ga0207694_10400123 3300025924 Bacteria 1142
581 Ga0207694_10607460 3300025924 Bacteria 920
582 Ga0207650_10845729 3300025925 Bacteria 776
583 Ga0207650_11231598 3300025925 Bacteria 637
584 Ga0207659_10196601 3300025926 Bacteria 1608
585 Ga0207659_10527923 3300025926 Bacteria 1001
586 Ga0207659_10741311 3300025926 Bacteria 842
587 Ga0207687_10104053 3300025927 Bacteria 2095
588 Ga0207687_10123251 3300025927 Bacteria 1942
589 Ga0207687_10177693 3300025927 Bacteria 1647
590 Ga0207687_10185293 3300025927 Bacteria 1615
591 Ga0207687_10238153 3300025927 Bacteria 1441
592 Ga0207687_10256176 3300025927 Bacteria 1393
593 Ga0207687_10563328 3300025927 Bacteria 957
594 Ga0207687_10566222 3300025927 Bacteria 955
595 Ga0207687_10634501 3300025927 Bacteria 903
596 Ga0207644_10787687 3300025931 Bacteria 795
597 Ga0207644_11039401 3300025931 Bacteria 688
598 Ga0207690_10333004 3300025932 Bacteria 1196
599 Ga0207690_10433539 3300025932 Bacteria 1053
600 Ga0207690_10596780 3300025932 Bacteria 901
601 Ga0207690_10735308 3300025932 Bacteria 813
602 Ga0207690_10891360 3300025932 Bacteria 737
603 Ga0207690_11101087 3300025932 Bacteria 662
604 Ga0207706_10118774 3300025933 Bacteria 2325
605 Ga0207706_10147174 3300025933 Bacteria 2072
606 Ga0207706_10198538 3300025933 Bacteria 1759
607 Ga0207706_10231488 3300025933 Bacteria 1616
608 Ga0207706_10321097 3300025933 Bacteria 1348
609 Ga0207706_10409143 3300025933 Bacteria 1176
610 Ga0207706_10810395 3300025933 Bacteria 795
611 Ga0207686_10142567 3300025934 Bacteria 1658
612 Ga0207686_10210516 3300025934 Bacteria 1397
613 Ga0207686_10320912 3300025934 Bacteria 1157
614 Ga0207686_10496249 3300025934 Bacteria 946
615 Ga0207686_11548626 3300025934 Bacteria 547
616 Ga0207709_10034384 3300025935 Bacteria 2987
617 Ga0207709_10139658 3300025935 Bacteria 1664
618 Ga0207709_10215475 3300025935 Bacteria 1381
619 Ga0207709_10293302 3300025935 Bacteria 1206
620 Ga0207709_10622428 3300025935 Bacteria 857
621 Ga0207709_10734135 3300025935 Bacteria 793
622 Ga0207709_10976152 3300025935 Bacteria 692
623 Ga0207709_11275598 3300025935 Bacteria 607
624 Ga0207709_11429863 3300025935 Bacteria 573
625 Ga0207670_10095471 3300025936 Bacteria 2112
626 Ga0207670_10403396 3300025936 Bacteria 1093
627 Ga0207669_10150422 3300025937 Bacteria 1630
628 Ga0207669_10262636 3300025937 Bacteria 1292
629 Ga0207669_10338533 3300025937 Bacteria 1158
630 Ga0207669_11690725 3300025937 Bacteria 540
631 Ga0207704_10049596 3300025938 Bacteria 2527
632 Ga0207704_10146633 3300025938 Bacteria 1659
633 Ga0207704_10382564 3300025938 Bacteria 1105
634 Ga0207704_10438108 3300025938 Bacteria 1040
635 Ga0207665_10984033 3300025939 Bacteria 671
636 Ga0207691_10035600 3300025940 Bacteria 4619
637 Ga0207691_10108944 3300025940 Bacteria 2464
638 Ga0207691_10188703 3300025940 Bacteria 1799
639 Ga0207691_10334811 3300025940 Bacteria 1296
640 Ga0207691_10384578 3300025940 Bacteria 1198
641 Ga0207691_10528881 3300025940 Bacteria 1000
642 Ga0207691_11211932 3300025940 Unclassified 626
643 Ga0207711_10049839 3300025941 Bacteria 3585
644 Ga0207711_10328999 3300025941 Bacteria 1413
645 Ga0207689_10090886 3300025942 Bacteria 2508
646 Ga0207689_10327349 3300025942 Bacteria 1272
647 Ga0207689_10602820 3300025942 Bacteria 924
648 Ga0207689_10929745 3300025942 Bacteria 734
649 Ga0207689_11283108 3300025942 Bacteria 615
650 Ga0207661_10063711 3300025944 Bacteria 2987
651 Ga0207661_10074063 3300025944 Bacteria 2791
652 Ga0207661_10169380 3300025944 Bacteria 1900
653 Ga0207661_10170037 3300025944 Bacteria 1897
654 Ga0207661_10241546 3300025944 Bacteria 1603
655 Ga0207661_10275785 3300025944 Bacteria 1502
656 Ga0207661_10511325 3300025944 Bacteria 1098
657 Ga0207661_10528488 3300025944 Bacteria 1079
658 Ga0207661_10900515 3300025944 Bacteria 815
659 Ga0207661_11063445 3300025944 Bacteria 745
660 Ga0207679_10335314 3300025945 Bacteria 1314
661 Ga0207679_10358004 3300025945 Bacteria 1274
662 Ga0207679_11107094 3300025945 Bacteria 727
663 Ga0207679_11192301 3300025945 Bacteria 699
664 Ga0207679_11667264 3300025945 Bacteria 584
665 Ga0207651_10419054 3300025960 Bacteria 1143
666 Ga0207651_10489497 3300025960 Bacteria 1061
667 Ga0207712_10165622 3300025961 Bacteria 1723
668 Ga0207712_10248937 3300025961 Bacteria 1435
669 Ga0207712_10356209 3300025961 Bacteria 1218
670 Ga0207712_10370361 3300025961 Bacteria 1196
671 Ga0207712_10558538 3300025961 Bacteria 985
672 Ga0207712_11372288 3300025961 Archaea 632
673 Ga0207668_10149108 3300025972 Bacteria 1808
674 Ga0207668_10164665 3300025972 Bacteria 1732
675 Ga0207668_10459650 3300025972 Bacteria 1088
676 Ga0207668_10486021 3300025972 Bacteria 1060
677 Ga0207668_10566430 3300025972 Bacteria 986
678 Ga0207640_10105510 3300025981 Bacteria 1986
679 Ga0207640_10143236 3300025981 Bacteria 1745
680 Ga0207640_10581291 3300025981 Bacteria 945
681 Ga0207640_11585437 3300025981 Bacteria 590
682 Ga0207640_11749122 3300025981 Bacteria 562
683 Ga0207640_11836897 3300025981 Bacteria 548
684 Ga0207658_10351909 3300025986 Bacteria 1283
685 Ga0207658_10648222 3300025986 Bacteria 952
686 Ga0207677_10010008 3300026023 Bacteria 5352
687 Ga0207677_10030536 3300026023 Bacteria 3441
688 Ga0207677_10820723 3300026023 Bacteria 834
689 Ga0207677_10999851 3300026023 Bacteria 758
690 Ga0207677_11074500 3300026023 Bacteria 733
691 Ga0207703_10091509 3300026035 Bacteria 2559
692 Ga0207703_10986450 3300026035 Bacteria 808
693 Ga0207639_10294847 3300026041 Bacteria 1431
694 Ga0207678_10165252 3300026067 Bacteria 1890
695 Ga0207678_10173390 3300026067 Bacteria 1841
696 Ga0207678_10240364 3300026067 Bacteria 1551
697 Ga0207678_10299192 3300026067 Bacteria 1382
698 Ga0207678_10487972 3300026067 Bacteria 1073
699 Ga0207678_10552218 3300026067 Bacteria 1007
700 Ga0207678_10576551 3300026067 Bacteria 985
701 Ga0207708_10026021 3300026075 Bacteria 4426
702 Ga0207708_10047555 3300026075 Bacteria 3265
703 Ga0207708_10159883 3300026075 Bacteria 1778
704 Ga0207708_10313482 3300026075 Bacteria 1278
705 Ga0207702_10128162 3300026078 Bacteria 2281
706 Ga0207702_10181797 3300026078 Bacteria 1937
707 Ga0207702_10548081 3300026078 Bacteria 1131
708 Ga0207702_10755168 3300026078 Bacteria 960
709 Ga0207702_11280820 3300026078 Bacteria 727
710 Ga0207702_11286484 3300026078 Bacteria 725
711 Ga0207702_11578128 3300026078 Bacteria 650
712 Ga0207641_10416547 3300026088 Bacteria 1293
713 Ga0207641_10627487 3300026088 Bacteria 1054
714 Ga0207641_11151007 3300026088 Bacteria 775
715 Ga0207641_11435499 3300026088 Bacteria 691
716 Ga0207641_12339609 3300026088 Bacteria 534
717 Ga0207648_10020448 3300026089 Bacteria 5960
718 Ga0207648_10208099 3300026089 Bacteria 1736
719 Ga0207648_10259037 3300026089 Bacteria 1552
720 Ga0207648_10340198 3300026089 Bacteria 1351
721 Ga0207648_10397376 3300026089 Bacteria 1248
722 Ga0207648_10465993 3300026089 Bacteria 1152
723 Ga0207648_11026620 3300026089 Bacteria 773
724 Ga0207676_10073788 3300026095 Bacteria 2747
725 Ga0207676_10223280 3300026095 Bacteria 1679
726 Ga0207676_10309086 3300026095 Bacteria 1446
727 Ga0207676_10628477 3300026095 Bacteria 1034
728 Ga0207676_12162678 3300026095 Bacteria 555
729 Ga0207674_10067747 3300026116 Bacteria 3593
730 Ga0207674_10111219 3300026116 Bacteria 2714
731 Ga0207674_10441263 3300026116 Bacteria 1258
732 Ga0207674_10654578 3300026116 Bacteria 1014
733 Ga0207674_10841400 3300026116 Bacteria 885
734 Ga0207674_11734974 3300026116 Bacteria 592
735 Ga0207675_100083363 3300026118 Bacteria 2998
736 Ga0207675_100103200 3300026118 Bacteria 2687
737 Ga0207675_100103208 3300026118 Bacteria 2687
738 Ga0207675_100139204 3300026118 Bacteria 2305
739 Ga0207675_100211620 3300026118 Bacteria 1865
740 Ga0207675_100392168 3300026118 Bacteria 1367
741 Ga0207675_100421210 3300026118 Bacteria 1319
742 Ga0207675_100647523 3300026118 Bacteria 1063
743 Ga0207675_100755732 3300026118 Bacteria 984
744 Ga0207683_10038043 3300026121 Bacteria 4191
745 Ga0207683_10168222 3300026121 Bacteria 1984
746 Ga0207683_10387809 3300026121 Bacteria 1284
747 Ga0207683_10693236 3300026121 Bacteria 944
748 Ga0207683_10903286 3300026121 Bacteria 820
749 Ga0207683_11261811 3300026121 Bacteria 684
750 Ga0207698_10148692 3300026142 Bacteria 2030
751 Ga0207698_10292487 3300026142 Bacteria 1512
752 Ga0207698_10343128 3300026142 Bacteria 1407
753 Ga0207698_11023923 3300026142 Bacteria 837
754 Ga0207428_10092583 3300027907 Bacteria 2346
755 Ga0207428_10167845 3300027907 Bacteria 1663
756 Ga0268266_10010730 3300028379 Bacteria 7983
757 Ga0268266_10040841 3300028379 Bacteria 3955
758 Ga0268266_10153694 3300028379 Bacteria 2077
759 Ga0268266_10468057 3300028379 Bacteria 1200
760 Ga0268265_10043016 3300028380 Bacteria 3355
761 Ga0268265_10910034 3300028380 Bacteria 864
762 Ga0268265_11080963 3300028380 Bacteria 796
763 Ga0268264_10402101 3300028381 Bacteria 1316
764 Ga0268264_10717132 3300028381 Bacteria 994
765 Ga0268264_11323057 3300028381 Bacteria 731
766 Ga0265334_10169910 3300028573 Bacteria 764
767 Ga0307408_100263430 3300031548 Bacteria 1428
768 Ga0307408_100811071 3300031548 Bacteria 850
769 Ga0307408_101609561 3300031548 Bacteria 617
770 Ga0307408_101771023 3300031548 Bacteria 590
771 Ga0307408_102054890 3300031548 Bacteria 550
772 Ga0307405_10018026 3300031731 Bacteria 3887
773 Ga0307405_10206717 3300031731 Bacteria 1430
774 Ga0307405_10336492 3300031731 Bacteria 1159
775 Ga0307405_10342682 3300031731 Bacteria 1150
776 Ga0307405_10668377 3300031731 Bacteria 856
777 Ga0307405_10849563 3300031731 Bacteria 768
778 Ga0307405_11387473 3300031731 Bacteria 614
779 Ga0307405_11767680 3300031731 Bacteria 549
780 Ga0307413_10018352 3300031824 Bacteria 3669
781 Ga0307413_11266610 3300031824 Bacteria 644
782 Ga0307413_11304186 3300031824 Bacteria 635
783 Ga0307413_11365063 3300031824 Bacteria 622
784 Ga0307410_10046627 3300031852 Bacteria 2892
785 Ga0307410_10116404 3300031852 Bacteria 1942
786 Ga0326468_10034483 3300031889 Bacteria 690
787 Ga0326468_10053337 3300031889 Bacteria 620
788 Ga0307406_10035677 3300031901 Bacteria 3060
789 Ga0307406_10159165 3300031901 Bacteria 1621
790 Ga0307406_10189737 3300031901 Bacteria 1503
791 Ga0307406_10319922 3300031901 Bacteria 1200
792 Ga0307406_10329679 3300031901 Bacteria 1184
793 Ga0307406_10401120 3300031901 Bacteria 1087
794 Ga0307406_10538563 3300031901 Bacteria 953
795 Ga0307406_10892028 3300031901 Bacteria 756
796 Ga0307406_10975322 3300031901 Bacteria 726
797 Ga0307406_11067631 3300031901 Bacteria 696
798 Ga0307406_11102232 3300031901 Bacteria 685
799 Ga0307407_10251198 3300031903 Bacteria 1212
800 Ga0307407_10271145 3300031903 Bacteria 1171
801 Ga0307407_10284081 3300031903 Bacteria 1147
802 Ga0307407_10326932 3300031903 Bacteria 1078
803 Ga0307407_10521809 3300031903 Bacteria 874
804 Ga0307412_10542026 3300031911 Bacteria 976
805 Ga0307412_11569487 3300031911 Bacteria 600
806 Ga0307409_100011619 3300031995 Bacteria 5564
807 Ga0307409_100122047 3300031995 Bacteria 2209
808 Ga0307409_100166699 3300031995 Bacteria 1934
809 Ga0307409_100172588 3300031995 Bacteria 1905
810 Ga0307409_100192922 3300031995 Bacteria 1815
811 Ga0307409_100367986 3300031995 Bacteria 1362
812 Ga0307409_100419847 3300031995 Bacteria 1283
813 Ga0307409_100448575 3300031995 Bacteria 1244
814 Ga0307409_100653492 3300031995 Bacteria 1046
815 Ga0307409_101436061 3300031995 Bacteria 717
816 Ga0307409_102025905 3300031995 Bacteria 605
817 Ga0307409_102123374 3300031995 Bacteria 591
818 Ga0307409_102152164 3300031995 Bacteria 587
819 Ga0307409_102220240 3300031995 Bacteria 578
820 Ga0307409_102364805 3300031995 Bacteria 560
821 Ga0307416_100023931 3300032002 Bacteria 4445
822 Ga0307416_100035805 3300032002 Bacteria 3797
823 Ga0307416_100099435 3300032002 Bacteria 2526
824 Ga0307416_100105578 3300032002 Bacteria 2466
825 Ga0307416_100156388 3300032002 Bacteria 2099
826 Ga0307416_100313159 3300032002 Bacteria 1567
827 Ga0307416_100365485 3300032002 Bacteria 1467
828 Ga0307416_100507998 3300032002 Bacteria 1271
829 Ga0307416_100509756 3300032002 Bacteria 1269
830 Ga0307416_100515417 3300032002 Bacteria 1263
831 Ga0307416_100567454 3300032002 Bacteria 1210
832 Ga0307416_101026980 3300032002 Bacteria 928
833 Ga0307416_101495972 3300032002 Bacteria 781
834 Ga0307416_101546498 3300032002 Bacteria 769
835 Ga0307414_10187917 3300032004 Bacteria 1669
836 Ga0307414_10226784 3300032004 Bacteria 1538
837 Ga0307414_10553640 3300032004 Bacteria 1025
838 Ga0307414_12286552 3300032004 Bacteria 505
839 Ga0307411_10227774 3300032005 Bacteria 1451
840 Ga0307411_10368226 3300032005 Bacteria 1178
841 Ga0307411_10538342 3300032005 Bacteria 994
842 Ga0307411_10801653 3300032005 Bacteria 829
843 Ga0307411_11013902 3300032005 Bacteria 744
844 Ga0307411_11067358 3300032005 Bacteria 726
845 Ga0307411_11859127 3300032005 Bacteria 560
846 Ga0307411_11871514 3300032005 Bacteria 558
847 Ga0307415_100000865 3300032126 Bacteria 13846
848 Ga0307415_100004934 3300032126 Bacteria 7015
849 Ga0307415_100011011 3300032126 Bacteria 5152
850 Ga0307415_100025326 3300032126 Bacteria 3720
851 Ga0307415_100142877 3300032126 Bacteria 1831
852 Ga0307415_100440293 3300032126 Bacteria 1124
853 Ga0307415_100515467 3300032126 Bacteria 1048
854 Ga0307415_100529734 3300032126 Bacteria 1036
855 Ga0307415_100592120 3300032126 Bacteria 985
856 Ga0307415_100606936 3300032126 Bacteria 975
857 Ga0307415_100817414 3300032126 Unclassified 852
858 Ga0307415_101047529 3300032126 Bacteria 761
859 Ga0307415_101220381 3300032126 Bacteria 709
860 Ga0307415_101370525 3300032126 Bacteria 672
861 Ga0307415_101957909 3300032126 Bacteria 570
862 Ga0373938_0131878 3300034957 Bacteria 652
863 Ga0373928_0058024 3300035084 Bacteria 930
864 Ga0373929_0063694 3300035085 Bacteria 868
865 Ga0373939_0224292 3300035114 Bacteria 721
866 Ga0373939_0272474 3300035114 Bacteria 666
867 Ga0373941_0417081 3300035115 Bacteria 558
868 Ga0373960_0130129 3300035121 Bacteria 843
869 Ga0373943_0619091 3300035170 Bacteria 638
870 Ga0373946_0106180 3300035171 Bacteria 1265
871 Ga0373942_0215606 3300035207 Bacteria 642
872 Ga0373961_0157114 3300035241 Bacteria 779
873 Ga0373962_0024242 3300035242 Bacteria 1621
874 Ga0373931_0112941 3300035691 Bacteria 1544
875 Ga0373925_0063262 3300037068 Bacteria 2784
876 Ga0395899_0372907 3300037312 Bacteria 950
877 Ga0395899_0465021 3300037312 Bacteria 826
878 Ga0395899_0470337 3300037312 Bacteria 820
879 Ga0395900_0146389 3300037418 Bacteria 2415
880 Ga0395900_0154402 3300037418 Bacteria 2345
881 Ga0395900_0348477 3300037418 Bacteria 1455
882 Ga0395900_0798824 3300037418 Bacteria 872
883 Ga0395900_1235278 3300037418 Bacteria 662
884 Ga0395900_1351678 3300037418 Bacteria 626
885 Ga0395898_0027563 3300037466 Bacteria 5700
886 Ga0395898_0252540 3300037466 Bacteria 1682
887 Ga0395898_0334569 3300037466 Bacteria 1444
888 Ga0395898_0344531 3300037466 Bacteria 1421
889 Ga0395898_0661771 3300037466 Bacteria 987
890 Ga0395898_1956885 3300037466 Bacteria 506
891 Ga0395901_0075057 3300038443 Bacteria 3527
892 Ga0395901_0108199 3300038443 Bacteria 2918
893 Ga0395901_0451672 3300038443 Bacteria 1314
894 Ga0395901_0577520 3300038443 Bacteria 1136
895 Ga0395901_0791584 3300038443 Bacteria 938
896 Ga0395901_0798282 3300038443 Bacteria 933
897 Ga0395901_0984411 3300038443 Bacteria 820
898 Ga0395901_1163967 3300038443 Bacteria 739
899 Ga0395901_1232731 3300038443 Bacteria 712
900 Ga0395901_1506197 3300038443 Bacteria 628
901 Ga0395901_1647596 3300038443 Bacteria 594
902 Ga0395901_1857740 3300038443 Bacteria 551
903 Ga0436365_1721523 3300039437 Bacteria 868
904 Ga0451791_1411759 3300041451 Bacteria 543
905 Ga0451793_0725399 3300041452 Bacteria 515
906 Ga0451797_0412393 3300041453 Bacteria 1064
907 Ga0451795_1354184 3300041456 Bacteria 600
908 Ga0451798_1062351 3300041458 Bacteria 751
909 Ga0451802_1015816 3300041460 Bacteria 537
910 Ga0451802_1480357 3300041460 Bacteria 564
911 Ga0451802_1995787 3300041460 Bacteria 1015
912 Ga0451802_2048603 3300041460 Bacteria 737
913 Ga0451804_0250385 3300041463 Bacteria 655
914 Ga0451807_0215562 3300041486 Bacteria 1185
915 Ga0451807_1229425 3300041486 Bacteria 634
916 Ga0451807_2136418 3300041486 Bacteria 643
917 Ga0451833_1477395 3300041491 Bacteria 899
918 Ga0451849_0585503 3300041505 Bacteria 724
919 Ga0451851_1085305 3300041507 Bacteria 636
920 Ga0451855_1871989 3300041511 Bacteria 725
921 Ga0451853_0754395 3300041512 Bacteria 731
922 Ga0451853_0998362 3300041512 Bacteria 850
923 Ga0451853_1890795 3300041512 Bacteria 589
924 Ga0451853_1979563 3300041512 Bacteria 947
925 Ga0451853_3543220 3300041512 Bacteria 642
926 Ga0451853_3970753 3300041512 Bacteria 1161
927 Ga0439448_0150994 3300042005 Bacteria 806
928 Ga0439448_0351647 3300042005 Bacteria 525
929 Ga0439450_140605 3300042008 Bacteria 629
930 Ga0439454_121012 3300042011 Bacteria 507
931 Ga0439455_0048306 3300042012 Bacteria 1107
932 Ga0439463_022473 3300042016 Bacteria 1578
933 Ga0450905_008526 3300042142 Bacteria 1405
934 Ga0439446_0347990 3300042156 Bacteria 528
935 Ga0439464_0038745 3300042439 Bacteria 1354
936 Ga0439460_0041852 3300042461 Bacteria 1348
937 Ga0450901_039827 3300042533 Bacteria 529
938 Ga0439440_0121218 3300042993 Bacteria 728
939 Ga0466972_0217533 3300044658 Bacteria 894
940 Ga0466972_0382577 3300044658 Bacteria 659
941 Ga0466965_0692644 3300044683 Bacteria 584
942 Ga0466965_0762513 3300044683 Bacteria 558
943 Ga0466966_0038129 3300044684 Bacteria 3097
944 Ga0466966_0306749 3300044684 Bacteria 954
945 Ga0466961_0282884 3300044693 Bacteria 1015
946 Ga0466961_0551306 3300044693 Bacteria 694
947 Ga0466961_0553249 3300044693 Bacteria 693
948 Ga0466961_0815570 3300044693 Bacteria 557
949 Ga0466961_0958965 3300044693 Bacteria 509
950 Ga0466963_0167887 3300044694 Bacteria 1529
951 Ga0466963_0196182 3300044694 Bacteria 1411
952 Ga0466963_0200599 3300044694 Bacteria 1395
953 Ga0466963_0209014 3300044694 Bacteria 1365
954 Ga0466963_0227978 3300044694 Bacteria 1305
955 Ga0466963_0549954 3300044694 Bacteria 815
956 Ga0466963_0732948 3300044694 Bacteria 697
957 Ga0466963_0770926 3300044694 Bacteria 678
958 Ga0466963_1009388 3300044694 Bacteria 586
959 Ga0466964_0045960 3300044706 Bacteria 1778
960 Ga0466964_0309344 3300044706 Bacteria 799
961 Ga0466964_0369663 3300044706 Bacteria 741
962 Ga0466964_0703332 3300044706 Bacteria 563
963 Ga0466971_0038628 3300044719 Bacteria 2142
964 Ga0466970_0152005 3300044765 Bacteria 1278
965 Ga0466970_0462904 3300044765 Bacteria 728
966 Ga0466957_0083439 3300044842 Bacteria 1993
967 Ga0466957_0166009 3300044842 Bacteria 1436
968 Ga0466957_0226180 3300044842 Bacteria 1237
969 Ga0466957_0850641 3300044842 Bacteria 650
970 Ga0466960_0000017 3300044901 Bacteria 55906
971 Ga0466960_0016459 3300044901 Bacteria 3209
972 Ga0466960_0036714 3300044901 Bacteria 2296
973 Ga0466960_0039210 3300044901 Bacteria 2233
974 Ga0466960_0067023 3300044901 Bacteria 1777
975 Ga0466960_0148265 3300044901 Bacteria 1251
976 Ga0466960_0212559 3300044901 Bacteria 1061
977 Ga0466960_0249704 3300044901 Bacteria 985
978 Ga0466960_0311171 3300044901 Bacteria 890
979 Ga0466960_0313866 3300044901 Bacteria 886
980 Ga0466960_0619590 3300044901 Bacteria 644
981 Ga0466960_0738752 3300044901 Bacteria 592
982 Ga0466960_0873270 3300044901 Bacteria 547
983 Ga0466960_0925622 3300044901 Bacteria 533
984 Ga0466960_0965618 3300044901 Bacteria 522
985 Ga0466959_0327975 3300045049 Bacteria 1046
986 Ga0466959_0853910 3300045049 Bacteria 608
987 Ga0466959_1035317 3300045049 Bacteria 546
988 Ga0466958_1171227 3300045836 Bacteria 502
989 Ga0466967_0019634 3300045976 Bacteria 5440
990 Ga0466967_0021046 3300045976 Bacteria 5284
991 Ga0466967_0026995 3300045976 Bacteria 4768
992 Ga0466967_0042010 3300045976 Bacteria 3947
993 Ga0466967_0044758 3300045976 Bacteria 3841
994 Ga0466967_0046581 3300045976 Bacteria 3776
995 Ga0466967_0057076 3300045976 Bacteria 3445
996 Ga0466967_0070203 3300045976 Bacteria 3133
997 Ga0466967_0092058 3300045976 Bacteria 2756
998 Ga0466967_0179334 3300045976 Bacteria 1997
999 Ga0466967_0244190 3300045976 Bacteria 1713
1000 Ga0466967_0456945 3300045976 Bacteria 1249
1001 Ga0466967_0458083 3300045976 Bacteria 1247
1002 Ga0466967_0765299 3300045976 Bacteria 958
1003 Ga0466967_0908881 3300045976 Bacteria 875
1004 Ga0466967_0968367 3300045976 Bacteria 847
1005 Ga0466967_1077448 3300045976 Bacteria 800
1006 Ga0466967_1274036 3300045976 Bacteria 732
1007 Ga0466967_1566325 3300045976 Bacteria 656
1008 Ga0466967_1597849 3300045976 Bacteria 649
1009 Ga0495603_0093542 3300046455 Bacteria 1757
1010 Ga0495603_0209031 3300046455 Bacteria 1127
1011 Ga0495590_0051742 3300046457 Bacteria 1435
1012 Ga0495650_0000566 3300046471 Bacteria 51980
1013 Ga0495650_0314904 3300046471 Bacteria 522
1014 Ga0495582_0414993 3300046473 Bacteria 776
1015 Ga0495605_0211017 3300046474 Bacteria 843
1016 Ga0495584_0241267 3300046491 Bacteria 919
1017 Ga0495585_0456345 3300046492 Bacteria 611
1018 Ga0495594_0646716 3300046499 Bacteria 599
1019 Ga0495620_0039962 3300046515 Bacteria 2069
1020 Ga0495620_0085541 3300046515 Bacteria 1271
1021 Ga0495620_0117829 3300046515 Bacteria 1049
1022 Ga0495620_0154082 3300046515 Bacteria 895
1023 Ga0495620_0182491 3300046515 Bacteria 811
1024 Ga0495620_0235030 3300046515 Bacteria 700
1025 Ga0495630_0186990 3300046517 Bacteria 1580
1026 Ga0495631_0288535 3300046518 Bacteria 698
1027 Ga0495637_0158884 3300046520 Bacteria 849
1028 Ga0495644_0212590 3300046523 Bacteria 747
1029 Ga0495663_0114491 3300046525 Bacteria 899
1030 Ga0495663_0340393 3300046525 Bacteria 545
1031 Ga0495642_0235052 3300046528 Bacteria 801
1032 Ga0495640_0285904 3300046533 Bacteria 1026
1033 Ga0495598_0303967 3300046537 Bacteria 604
1034 Ga0495609_0146052 3300046538 Bacteria 1008
1035 Ga0495667_0778782 3300046559 Bacteria 590
1036 Ga0495656_0545415 3300046615 Bacteria 618
1037 Ga0495634_0665465 3300046642 Bacteria 601
1038 Ga0495611_0469286 3300046648 Bacteria 573
1039 Ga0495635_0112424 3300046663 Bacteria 1860
1040 Ga0495661_0373451 3300046665 Bacteria 698
1041 Ga0495624_0640533 3300046690 Bacteria 633
1042 Ga0495670_0428630 3300046691 Bacteria 716
1043 Ga0495670_0759456 3300046691 Bacteria 529
1044 Ga0495671_0438443 3300046692 Bacteria 625
1045 Ga0495649_0221011 3300046694 Bacteria 980
1046 Ga0495649_0320321 3300046694 Bacteria 787
1047 Ga0495604_0445568 3300047317 Bacteria 847
1048 Ga0495674_1347031 3300047319 Bacteria 534
1049 Ga0495677_0139707 3300047445 Bacteria 930
1050 Ga0495684_0462476 3300047471 Bacteria 879
1051 Ga0495686_0212159 3300047472 Bacteria 1106
1052 Ga0495615_0069328 3300048090 Bacteria 947
1053 Ga0496100_0149215 3300048903 Bacteria 1665
1054 Ga0496100_0151320 3300048903 Bacteria 1655
1055 Ga0496100_0436661 3300048903 Bacteria 1002
1056 Ga0496100_0847878 3300048903 Bacteria 717
1057 Ga0496100_1111706 3300048903 Bacteria 623
1058 Ga0496100_1371421 3300048903 Bacteria 558
1059 Ga0496101_0167646 3300048904 Bacteria 1687
1060 Ga0496101_0205128 3300048904 Bacteria 1525
1061 Ga0496101_0585121 3300048904 Bacteria 882
1062 Ga0496101_1098135 3300048904 Bacteria 624
1063 Ga0496102_0058418 3300048905 Bacteria 3524
1064 Ga0496102_0067979 3300048905 Bacteria 3269
1065 Ga0496102_0099537 3300048905 Bacteria 2699
1066 Ga0496102_0375310 3300048905 Bacteria 1338
1067 Ga0496102_0395831 3300048905 Bacteria 1299
1068 Ga0496102_0479754 3300048905 Bacteria 1165
1069 Ga0496102_0535571 3300048905 Bacteria 1094
1070 Ga0496103_0201620 3300048906 Bacteria 1279
1071 Ga0496103_0408005 3300048906 Bacteria 873
1072 Ga0496104_0021049 3300048907 Bacteria 5983
1073 Ga0496104_0026964 3300048907 Bacteria 5311
1074 Ga0496104_0088832 3300048907 Bacteria 2952
1075 Ga0496104_0189639 3300048907 Bacteria 1967
1076 Ga0496104_0436379 3300048907 Bacteria 1221
1077 Ga0496104_0609815 3300048907 Bacteria 1001
1078 Ga0496105_0027918 3300048908 Bacteria 4615
1079 Ga0496105_0307823 3300048908 Bacteria 1272
1080 Ga0496105_0716040 3300048908 Bacteria 767
1081 Ga0496106_0046043 3300048909 Bacteria 3278
1082 Ga0496106_0138182 3300048909 Bacteria 1915
1083 Ga0496106_0610098 3300048909 Bacteria 874
1084 Ga0496107_0027679 3300048910 Bacteria 4026
1085 Ga0496107_0280329 3300048910 Bacteria 1241
1086 Ga0496107_0591368 3300048910 Bacteria 820
1087 Ga0496108_0029709 3300048911 Bacteria 4528
1088 Ga0496108_0060353 3300048911 Bacteria 3191
1089 Ga0496108_0116020 3300048911 Bacteria 2293
1090 Ga0496108_0194117 3300048911 Bacteria 1760
1091 Ga0496108_0219097 3300048911 Bacteria 1653
1092 Ga0496108_0350524 3300048911 Bacteria 1288
1093 Ga0496108_0413108 3300048911 Bacteria 1179
1094 Ga0496108_1007291 3300048911 Bacteria 711
1095 Ga0496109_0004551 3300048912 Bacteria 11585
1096 Ga0496109_0048079 3300048912 Bacteria 3881
1097 Ga0496109_0170519 3300048912 Bacteria 2041
1098 Ga0496109_0196568 3300048912 Bacteria 1896
1099 Ga0496109_0258995 3300048912 Bacteria 1638
1100 Ga0496109_0310061 3300048912 Bacteria 1489
1101 Ga0496109_0487592 3300048912 Bacteria 1163
1102 Ga0496109_0559154 3300048912 Bacteria 1079
1103 Ga0496109_0847242 3300048912 Bacteria 852
1104 Ga0496109_1121820 3300048912 Bacteria 723
1105 Ga0496109_1127126 3300048912 Bacteria 721
1106 Ga0496109_1185367 3300048912 Bacteria 700
1107 Ga0496109_1325844 3300048912 Bacteria 656
1108 Ga0496109_1874523 3300048912 Bacteria 532
1109 Ga0496110_0057251 3300048913 Bacteria 3431
1110 Ga0496110_0253244 3300048913 Bacteria 1602
1111 Ga0496110_0254775 3300048913 Bacteria 1597
1112 Ga0496110_0261575 3300048913 Bacteria 1575
1113 Ga0496110_0469861 3300048913 Bacteria 1146
1114 Ga0496110_1028679 3300048913 Bacteria 731
1115 Ga0496111_0059962 3300048914 Bacteria 2757
1116 Ga0496111_0098383 3300048914 Bacteria 2148
1117 Ga0496111_0236685 3300048914 Bacteria 1356
1118 Ga0496111_0259853 3300048914 Bacteria 1288
1119 Ga0496111_0339758 3300048914 Bacteria 1111
1120 Ga0496111_0549757 3300048914 Bacteria 848
1121 Ga0496111_0550465 3300048914 Bacteria 847
1122 Ga0496111_0561930 3300048914 Bacteria 837
1123 Ga0496111_1160091 3300048914 Bacteria 549
1124 Ga0496112_0030068 3300048915 Bacteria 5256
1125 Ga0496112_0049779 3300048915 Bacteria 4107
1126 Ga0496112_0096816 3300048915 Bacteria 2921
1127 Ga0496112_0162114 3300048915 Bacteria 2203
1128 Ga0496112_0180725 3300048915 Bacteria 2073
1129 Ga0496112_0528099 3300048915 Bacteria 1114
1130 Ga0496112_0810889 3300048915 Bacteria 860
1131 Ga0496112_0878414 3300048915 Bacteria 819
1132 Ga0496113_0030942 3300048916 Bacteria 3879
1133 Ga0496113_0067695 3300048916 Bacteria 2708
1134 Ga0496113_0138844 3300048916 Bacteria 1911
1135 Ga0496113_0146359 3300048916 Bacteria 1861
1136 Ga0496113_0437138 3300048916 Bacteria 1051
1137 Ga0496113_1102388 3300048916 Bacteria 623
1138 Ga0496114_0289043 3300048917 Bacteria 1446
1139 Ga0496114_0317234 3300048917 Bacteria 1377
1140 Ga0496114_1099278 3300048917 Bacteria 680
1141 Ga0496115_0164862 3300048918 Bacteria 1832
1142 Ga0496115_0537282 3300048918 Bacteria 936
1143 Ga0496121_0032411 3300048924 Bacteria 4750
1144 Ga0496121_0568557 3300048924 Bacteria 706
1145 Ga0496124_0140574 3300048927 Bacteria 1906
1146 Ga0496124_0444668 3300048927 Bacteria 886
1147 Ga0496126_0277341 3300048929 Bacteria 1390
1148 Ga0501307_046780 3300049162 Bacteria 641
1149 Ga0501307_080858 3300049162 Bacteria 530
1150 Ga0495682_0325457 3300049460 Bacteria 542
1151 Ga0501311_033778 3300049527 Bacteria 751
1152 Ga0501313_046863 3300049529 Bacteria 591
1153 Ga0501315_098163 3300049531 Bacteria 515
1154 Ga0501316_069163 3300049532 Archaea 532
1155 Ga0501317_070561 3300049533 Bacteria 589
1156 Ga0501318_081787 3300049534 Bacteria 524
1157 Ga0501031_0002052 3300049568 Bacteria 12667
1158 Ga0501031_0052523 3300049568 Bacteria 2656
1159 Ga0501031_0089543 3300049568 Bacteria 2007
1160 Ga0501031_0187601 3300049568 Bacteria 1350
1161 Ga0501031_0568078 3300049568 Bacteria 730
1162 Ga0501032_0043917 3300049569 Bacteria 3025
1163 Ga0501032_0159552 3300049569 Bacteria 1481
1164 Ga0501033_0013168 3300049570 Bacteria 6301
1165 Ga0501033_0068007 3300049570 Bacteria 2620
1166 Ga0501034_0003511 3300049571 Bacteria 17801
1167 Ga0501034_0039519 3300049571 Bacteria 4778
1168 Ga0501034_0506872 3300049571 Bacteria 1120
1169 Ga0501034_1000070 3300049571 Bacteria 720
1170 Ga0501036_0011780 3300049572 Bacteria 7246
1171 Ga0501036_0403509 3300049572 Bacteria 1140
1172 Ga0501036_0431529 3300049572 Bacteria 1098
1173 Ga0501036_1192300 3300049572 Bacteria 621
1174 Ga0501036_1293002 3300049572 Bacteria 593
1175 Ga0501037_0047752 3300049573 Bacteria 3136
1176 Ga0501037_0077455 3300049573 Bacteria 2413
1177 Ga0501037_0680500 3300049573 Bacteria 686
1178 Ga0501038_0047781 3300049574 Bacteria 3706
1179 Ga0501038_0339634 3300049574 Bacteria 1171
1180 Ga0501038_0655888 3300049574 Bacteria 790
1181 Ga0501039_0060007 3300049575 Bacteria 2945
1182 Ga0501039_0250892 3300049575 Bacteria 1391
1183 Ga0501039_0340549 3300049575 Bacteria 1179
1184 Ga0501039_1007940 3300049575 Bacteria 647
1185 Ga0501040_0228764 3300049576 Bacteria 1324
1186 Ga0501041_0025816 3300049577 Bacteria 3532
1187 Ga0501041_0088015 3300049577 Bacteria 1917
1188 Ga0501041_0299195 3300049577 Bacteria 1014
1189 Ga0501041_0871000 3300049577 Bacteria 578
1190 Ga0501042_0167085 3300049578 Bacteria 1587
1191 Ga0501042_0204956 3300049578 Bacteria 1422
1192 Ga0501042_0714829 3300049578 Bacteria 728
1193 Ga0501042_1124776 3300049578 Bacteria 573
1194 Ga0501043_0030298 3300049579 Bacteria 4251
1195 Ga0501046_0142269 3300049580 Bacteria 1814
1196 Ga0501046_0271438 3300049580 Bacteria 1244
1197 Ga0501046_0621397 3300049580 Bacteria 765
1198 Ga0501047_0019196 3300049581 Bacteria 6557
1199 Ga0501047_0282837 3300049581 Bacteria 1503
1200 Ga0501048_0053309 3300049582 Bacteria 2877
1201 Ga0501048_0176655 3300049582 Bacteria 1513
1202 Ga0501048_0327046 3300049582 Bacteria 1092
1203 Ga0501048_0544335 3300049582 Bacteria 833
1204 Ga0501067_0003581 3300049583 Bacteria 8555
1205 Ga0501067_0242589 3300049583 Bacteria 1003
1206 Ga0501067_0433607 3300049583 Bacteria 734
1207 Ga0501067_0484993 3300049583 Bacteria 691
1208 Ga0501067_0574941 3300049583 Bacteria 631
1209 Ga0501067_0648475 3300049583 Bacteria 593
1210 Ga0501068_0020333 3300049584 Bacteria 3866
1211 Ga0501068_0087549 3300049584 Bacteria 1918
1212 Ga0501068_0114250 3300049584 Bacteria 1681
1213 Ga0501068_0126074 3300049584 Bacteria 1599
1214 Ga0501068_0553081 3300049584 Bacteria 748
1215 Ga0501068_0727319 3300049584 Bacteria 649
1216 Ga0501068_0926427 3300049584 Bacteria 574
1217 Ga0501069_0018025 3300049585 Bacteria 3807
1218 Ga0501069_0037819 3300049585 Bacteria 2663
1219 Ga0501069_0041616 3300049585 Bacteria 2540
1220 Ga0501069_0135753 3300049585 Bacteria 1410
1221 Ga0501070_0055764 3300049586 Bacteria 3275
1222 Ga0501070_1471363 3300049586 Bacteria 516
1223 Ga0501071_0019658 3300049587 Bacteria 4687
1224 Ga0501071_0070230 3300049587 Bacteria 2551
1225 Ga0501071_0134302 3300049587 Bacteria 1840
1226 Ga0501071_0150950 3300049587 Bacteria 1733
1227 Ga0501071_0170845 3300049587 Bacteria 1627
1228 Ga0501071_1462450 3300049587 Bacteria 527
1229 Ga0501072_0083622 3300049588 Bacteria 2530
1230 Ga0501072_0365175 3300049588 Bacteria 1146
1231 Ga0501072_0943262 3300049588 Bacteria 673
1232 Ga0501073_0005264 3300049589 Bacteria 9702
1233 Ga0501074_0048450 3300049590 Bacteria 3069
1234 Ga0501074_0136996 3300049590 Bacteria 1751
1235 Ga0501074_0736174 3300049590 Bacteria 695
1236 Ga0501074_0852229 3300049590 Bacteria 642
1237 Ga0501075_0087061 3300049591 Bacteria 2367
1238 Ga0501075_0340881 3300049591 Bacteria 1142
1239 Ga0501075_0647914 3300049591 Bacteria 805
1240 Ga0501075_0708847 3300049591 Bacteria 766
1241 Ga0501076_0004681 3300049592 Bacteria 9758
1242 Ga0501076_0193056 3300049592 Bacteria 1662
1243 Ga0501076_0271945 3300049592 Bacteria 1387
1244 Ga0501076_0692352 3300049592 Bacteria 841
1245 Ga0501076_1750121 3300049592 Bacteria 510
1246 Ga0501077_0028590 3300049593 Bacteria 3544
1247 Ga0501217_167175 3300049661 Bacteria 667
1248 Ga0501223_131142 3300049663 Bacteria 535
1249 Ga0501225_0132133 3300049705 Bacteria 749
1250 Ga0501079_0010735 3300049741 Bacteria 6975
1251 Ga0501079_0255842 3300049741 Bacteria 1369
1252 Ga0501079_0567726 3300049741 Bacteria 892
1253 Ga0501079_0616561 3300049741 Bacteria 854
1254 Ga0501079_0896309 3300049741 Bacteria 698
1255 Ga0501079_1168121 3300049741 Bacteria 606
1256 Ga0501080_0050553 3300049742 Bacteria 3868
1257 Ga0501080_0158128 3300049742 Bacteria 2093
1258 Ga0501080_1205307 3300049742 Bacteria 651
1259 Ga0501081_0106967 3300049743 Bacteria 1983
1260 Ga0501081_1303894 3300049743 Bacteria 551
1261 Ga0501083_0040499 3300049744 Bacteria 3162
1262 Ga0501083_0140140 3300049744 Bacteria 1584
1263 Ga0501083_0342006 3300049744 Bacteria 973
1264 Ga0501035_0013517 3300049822 Bacteria 7534
1265 Ga0501035_0248237 3300049822 Bacteria 1512
1266 Ga0501035_0866745 3300049822 Bacteria 717
1267 Ga0501044_0034000 3300049823 Bacteria 5351
1268 Ga0501044_0144182 3300049823 Bacteria 2368
1269 Ga0501044_0200904 3300049823 Bacteria 1952
1270 Ga0501044_1213772 3300049823 Bacteria 622
1271 Ga0501045_0077355 3300049824 Bacteria 2452
1272 nmdc:mga0yw44_85061_c1 3300050492 Bacteria 1989
1273 nmdc:mga05p37_664561_c1 3300050507 Bacteria 1164
1274 nmdc:mga09592_407107_c1 3300050508 Bacteria 1175
1275 nmdc:mga09592_465223_c1 3300050508 Bacteria 1090
1276 nmdc:mga09592_619471_c1 3300050508 Bacteria 926
1277 nmdc:mga0qj67_127531_c1 3300050509 Bacteria 2059
1278 nmdc:mga0qj67_217892_c1 3300050509 Bacteria 1550
1279 nmdc:mga0qj67_481453_c1 3300050509 Bacteria 998
1280 nmdc:mga06r32_141033_c1 3300050510 Bacteria 2386
1281 nmdc:mga08y16_237567_c1 3300050511 Bacteria 1884
1282 nmdc:mga08y16_261935_c1 3300050511 Bacteria 1785
1283 nmdc:mga08y16_300162_c1 3300050511 Bacteria 1655
1284 nmdc:mga08y16_48142_c1 3300050511 Bacteria 4461
1285 nmdc:mga08y16_609173_c1 3300050511 Bacteria 1100
1286 nmdc:mga08y16_642472_c1 3300050511 Bacteria 1066
1287 nmdc:mga08y16_815240_c1 3300050511 Bacteria 925
1288 nmdc:mga08y16_935983_c1 3300050511 Bacteria 850
1289 nmdc:mga0n895_1203212_c1 3300050512 Bacteria 731
1290 nmdc:mga0n895_136503_c1 3300050512 Bacteria 2479
1291 nmdc:mga0rr50_1814252_c1 3300050513 Bacteria 513
1292 nmdc:mga08x19_213931_c1 3300050514 Bacteria 1323
1293 nmdc:mga0a205_176014_c1 3300050515 Bacteria 2035
1294 Ga0495655_0011905 3300053083 Bacteria 1760
1295 Ga0495655_0017982 3300053083 Bacteria 1548
1296 Ga0495655_0026743 3300053083 Bacteria 1362
1297 Ga0495655_0117197 3300053083 Bacteria 807
1298 Ga0495655_0134371 3300053083 Bacteria 765
1299 Ga0495595_0175833 3300053084 Bacteria 1061
1300 Ga0495595_0338074 3300053084 Bacteria 759
1301 Ga0495619_0851612 3300053085 Bacteria 615
1302 Ga0500556_0000922 3300053104 Bacteria 16088
1303 Ga0500616_0001951 3300053153 Bacteria 18401
1304 Ga0500616_0002891 3300053153 Bacteria 13758
1305 Ga0500616_0003323 3300053153 Bacteria 12403
1306 Ga0501084_0021713 3300054114 Bacteria 5352
1307 Ga0501084_0170638 3300054114 Bacteria 1836
1308 Ga0501084_0218917 3300054114 Bacteria 1606
1309 Ga0501084_0502899 3300054114 Bacteria 1024
1310 Ga0590077_123148 3300059426 Bacteria 614
1311 Ga0587084_036359 3300059477 Bacteria 817
1312 Ga0587084_074528 3300059477 Bacteria 647
1313 Ga0587084_129932 3300059477 Bacteria 538
1314 Ga0587066_133449 3300059490 Bacteria 599
1315 Ga0587073_0025765 3300059492 Bacteria 1172
1316 Ga0587073_0031374 3300059492 Bacteria 1100
1317 Ga0587073_0034945 3300059492 Bacteria 1063
1318 Ga0587073_0118919 3300059492 Bacteria 711
1319 Ga0587073_0186492 3300059492 Bacteria 612
1320 Ga0587073_0334260 3300059492 Unclassified 504
1321 Ga0587080_032831 3300059503 Bacteria 913
1322 Ga0587080_057973 3300059503 Bacteria 747
1323 Ga0587080_059085 3300059503 Bacteria 743
1324 Ga0587080_068107 3300059503 Bacteria 707
1325 Ga0587080_184689 3300059503 Bacteria 502
1326 Ga0587082_067717 3300059504 Bacteria 719
1327 Ga0587083_0038486 3300059505 Bacteria 990
1328 Ga0587083_0038626 3300059505 Bacteria 988
1329 Ga0587083_0129207 3300059505 Bacteria 661
1330 Ga0587083_0184469 3300059505 Bacteria 586
1331 Ga0587085_133056 3300059506 Bacteria 558
1332 Ga0587086_048151 3300059507 Bacteria 680
1333 Ga0587086_091467 3300059507 Bacteria 550
1334 Ga0587088_098217 3300059508 Bacteria 651
1335 Ga0587088_099851 3300059508 Bacteria 647
1336 Ga0587088_136400 3300059508 Bacteria 582
1337 Ga0587088_142665 3300059508 Bacteria 573
1338 Ga0587090_097579 3300059510 Bacteria 611
1339 Ga0587091_116723 3300059511 Bacteria 644
1340 Ga0587091_168429 3300059511 Bacteria 568
1341 Ga0587091_169061 3300059511 Bacteria 568
1342 Ga0587095_033587 3300059514 Bacteria 539
1343 Ga0587098_030352 3300059604 Bacteria 741
1344 Ga0587098_091523 3300059604 Bacteria 519
1345 Ga0587106_054870 3300059605 Bacteria 717
1346 Ga0587106_092308 3300059605 Bacteria 606
1347 Ga0587099_006092 3300059622 Bacteria 1105
1348 Ga0587099_034613 3300059622 Bacteria 627
1349 Ga0587099_037402 3300059622 Bacteria 611
1350 Ga0587099_045635 3300059622 Bacteria 573
1351 Ga0587109_134757 3300059624 Bacteria 598
1352 Ga0587115_041770 3300059626 Bacteria 718
1353 Ga0587117_078442 3300059627 Bacteria 597
1354 Ga0587122_048884 3300059628 Bacteria 544
1355 Ga0587130_029153 3300059631 Bacteria 630
1356 Ga0587067_096945 3300059640 Bacteria 677
1357 Ga0587067_176929 3300059640 Bacteria 553
1358 Ga0587069_043120 3300059642 Bacteria 777
1359 Ga0587072_159572 3300059643 Bacteria 550
1360 Ga0587075_043973 3300059644 Bacteria 758
1361 Ga0587075_047571 3300059644 Bacteria 739
1362 Ga0587075_061634 3300059644 Bacteria 678
1363 Ga0587076_030658 3300059645 Bacteria 951
1364 Ga0587076_093925 3300059645 Bacteria 660
1365 Ga0587076_205263 3300059645 Bacteria 509
1366 Ga0587079_167659 3300059647 Bacteria 579
1367 Ga0587104_011119 3300059650 Bacteria 667
1368 Ga0587105_008909 3300059651 Bacteria 736
1369 Ga0587107_014226 3300059652 Bacteria 1020
1370 Ga0587107_074991 3300059652 Bacteria 625
1371 Ga0587119_048763 3300059658 Bacteria 627
1372 Ga0587119_062225 3300059658 Bacteria 577
1373 Ga0587120_034204 3300059659 Bacteria 528
1374 Ga0587071_054132 3300060344 Bacteria 837
1375 Ga0587071_093702 3300060344 Bacteria 686
1376 Ga0587071_103449 3300060344 Bacteria 662
1377 Ga0587071_125746 3300060344 Bacteria 617
1378 Ga0587111_0259159 3300060346 Bacteria 517
1379 Ga0587111_0259175 3300060346 Bacteria 517
1380 Ga0501082_0046693 3300060353 Bacteria 3732
1381 Ga0501082_0054632 3300060353 Bacteria 3442
1382 Ga0501082_0088923 3300060353 Bacteria 2666
1383 Ga0501082_0273011 3300060353 Bacteria 1472
1384 Ga0501082_1092083 3300060353 Bacteria 697
1385 Ga0466962_0021387 3300061719 Bacteria 3107
1386 Ga0466962_0166459 3300061719 Bacteria 1072
1387 Ga0530510_0022900 3300061734 Bacteria 4451
1388 Ga0530510_0114770 3300061734 Bacteria 1974
1389 Ga0530510_0535901 3300061734 Bacteria 889
1390 Ga0530510_0674344 3300061734 Bacteria 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_11697286 Ga0105246_116972862 111
2 3300005338 Ga0068868_101064359 Ga0068868_1010643591 112
3 3300005843 Ga0068860_100407517 Ga0068860_1004075172 112
4 3300006846 Ga0075430_101514232 Ga0075430_1015142322 112
5 3300028573 Ga0265334_10169910 Ga0265334_101699101 112
6 3300047445 Ga0495677_0139707 Ga0495677_0139707_220_558 112
7 3300049573 Ga0501037_0680500 Ga0501037_0680500_302_640 112
8 3300025944 Ga0207661_10511325 Ga0207661_105113252 114
9 3300053083 Ga0495655_0011905 Ga0495655_0011905_274_645 114
10 3300026118 Ga0207675_100103208 Ga0207675_1001032083 116
11 3300011119 Ga0105246_10574459 Ga0105246_105744591 119
12 3300032126 Ga0307415_101220381 Ga0307415_1012203812 119
13 3300005336 Ga0070680_100272870 Ga0070680_1002728702 120
14 3300005339 Ga0070660_100423975 Ga0070660_1004239752 120
15 3300005530 Ga0070679_100051303 Ga0070679_1000513035 120
16 3300006038 Ga0075365_10712546 Ga0075365_107125461 120
17 3300006051 Ga0075364_10670595 Ga0075364_106705952 120
18 3300025909 Ga0207705_10309432 Ga0207705_103094322 120
19 3300025917 Ga0207660_10230804 Ga0207660_102308042 120
20 3300025919 Ga0207657_10360388 Ga0207657_103603882 120
21 3300025921 Ga0207652_10040524 Ga0207652_100405242 120
22 3300041460 Ga0451802_1015816 Ga0451802_1015816_107_469 120
23 3300041486 Ga0451807_1229425 Ga0451807_1229425_41_403 120
24 3300041505 Ga0451849_0585503 Ga0451849_0585503_126_488 120
25 3300041512 Ga0451853_0754395 Ga0451853_0754395_300_671 120
26 3300049584 Ga0501068_0553081 Ga0501068_0553081_301_663 120
27 3300049585 Ga0501069_0037819 Ga0501069_0037819_1101_1463 120
28 3300049590 Ga0501074_0136996 Ga0501074_0136996_1331_1693 120
29 3300049741 Ga0501079_0616561 Ga0501079_0616561_290_652 120
30 3300049742 Ga0501080_0158128 Ga0501080_0158128_45_407 120
31 3300005546 Ga0070696_101018138 Ga0070696_1010181381 121
32 3300005937 Ga0081455_10337642 Ga0081455_103376423 121
33 3300006846 Ga0075430_100017272 Ga0075430_1000172723 121
34 3300048927 Ga0496124_0444668 Ga0496124_0444668_476_850 121
35 3300050509 nmdc:mga0qj67_127531_c1 nmdc:mga0qj67_127531_c1_63_428 121
36 3300050509 nmdc:mga0qj67_217892_c1 nmdc:mga0qj67_217892_c1_309_674 121
37 3300059477 Ga0587084_074528 Ga0587084_074528_121_486 121
38 3300059508 Ga0587088_136400 Ga0587088_136400_130_495 121
39 3300059645 Ga0587076_030658 Ga0587076_030658_60_425 121
40 3300059652 Ga0587107_074991 Ga0587107_074991_93_458 121
41 3300000546 LJNas_1031457 LJNas_10314571 122
42 3300003162 Ga0006778J45830_1020736 Ga0006778J45830_10207362 122
43 3300005329 Ga0070683_100116690 Ga0070683_1001166902 122
44 3300005331 Ga0070670_101550851 Ga0070670_1015508511 122
45 3300005334 Ga0068869_100644375 Ga0068869_1006443751 122
46 3300005336 Ga0070680_100854299 Ga0070680_1008542991 122
47 3300005337 Ga0070682_100319266 Ga0070682_1003192662 122
48 3300005337 Ga0070682_100656257 Ga0070682_1006562571 122
49 3300005347 Ga0070668_100517418 Ga0070668_1005174182 122
50 3300005366 Ga0070659_100960467 Ga0070659_1009604672 122
51 3300005457 Ga0070662_101017560 Ga0070662_1010175602 122
52 3300005458 Ga0070681_11157520 Ga0070681_111575201 122
53 3300005535 Ga0070684_100792565 Ga0070684_1007925652 122
54 3300005564 Ga0070664_100139176 Ga0070664_1001391762 122
55 3300005564 Ga0070664_101020894 Ga0070664_1010208942 122
56 3300005577 Ga0068857_100362406 Ga0068857_1003624062 122
57 3300005577 Ga0068857_100362554 Ga0068857_1003625542 122
58 3300005578 Ga0068854_100532794 Ga0068854_1005327942 122
59 3300005614 Ga0068856_100153728 Ga0068856_1001537282 122
60 3300005614 Ga0068856_100842106 Ga0068856_1008421062 122
61 3300005615 Ga0070702_100237248 Ga0070702_1002372482 122
62 3300005615 Ga0070702_100395811 Ga0070702_1003958112 122
63 3300005841 Ga0068863_100582290 Ga0068863_1005822902 122
64 3300005983 Ga0081540_1070266 Ga0081540_10702662 122
65 3300005985 Ga0081539_10009483 Ga0081539_100094838 122
66 3300006051 Ga0075364_10749821 Ga0075364_107498211 122
67 3300006163 Ga0070715_10638236 Ga0070715_106382362 122
68 3300009093 Ga0105240_10648748 Ga0105240_106487481 122
69 3300009098 Ga0105245_11501737 Ga0105245_115017372 122
70 3300009174 Ga0105241_11037140 Ga0105241_110371402 122
71 3300009176 Ga0105242_10267363 Ga0105242_102673632 122
72 3300009176 Ga0105242_10313974 Ga0105242_103139742 122
73 3300009545 Ga0105237_11744990 Ga0105237_117449902 122
74 3300009551 Ga0105238_11905542 Ga0105238_119055422 122
75 3300013105 Ga0157369_10544152 Ga0157369_105441522 122
76 3300013297 Ga0157378_12103067 Ga0157378_121030672 122
77 3300013307 Ga0157372_12087251 Ga0157372_120872512 122
78 3300013307 Ga0157372_12811828 Ga0157372_128118282 122
79 3300014497 Ga0182008_10170544 Ga0182008_101705442 122
80 3300017792 Ga0163161_10499234 Ga0163161_104992342 122
81 3300020081 Ga0206354_10793033 Ga0206354_107930332 122
82 3300020082 Ga0206353_11325071 Ga0206353_113250711 122
83 3300025905 Ga0207685_10281308 Ga0207685_102813082 122
84 3300025917 Ga0207660_10635191 Ga0207660_106351912 122
85 3300025918 Ga0207662_11321581 Ga0207662_113215812 122
86 3300025925 Ga0207650_10845729 Ga0207650_108457292 122
87 3300025927 Ga0207687_10185293 Ga0207687_101852932 122
88 3300025931 Ga0207644_11039401 Ga0207644_110394012 122
89 3300025932 Ga0207690_10735308 Ga0207690_107353082 122
90 3300025933 Ga0207706_10118774 Ga0207706_101187742 122
91 3300025934 Ga0207686_10496249 Ga0207686_104962492 122
92 3300025935 Ga0207709_11429863 Ga0207709_114298632 122
93 3300025944 Ga0207661_10169380 Ga0207661_101693802 122
94 3300025945 Ga0207679_11107094 Ga0207679_111070942 122
95 3300025972 Ga0207668_10566430 Ga0207668_105664302 122
96 3300025981 Ga0207640_11836897 Ga0207640_118368971 122
97 3300026067 Ga0207678_10240364 Ga0207678_102403641 122
98 3300026078 Ga0207702_10128162 Ga0207702_101281622 122
99 3300026078 Ga0207702_10755168 Ga0207702_107551682 122
100 3300026088 Ga0207641_10627487 Ga0207641_106274872 122
101 3300026089 Ga0207648_11026620 Ga0207648_110266202 122
102 3300026116 Ga0207674_10067747 Ga0207674_100677473 122
103 3300026116 Ga0207674_11734974 Ga0207674_117349741 122
104 3300026121 Ga0207683_10903286 Ga0207683_109032862 122
105 3300031901 Ga0307406_10975322 Ga0307406_109753221 122
106 3300032002 Ga0307416_100023931 Ga0307416_1000239313 122
107 3300032005 Ga0307411_11871514 Ga0307411_118715141 122
108 3300035084 Ga0373928_0058024 Ga0373928_0058024_379_747 122
109 3300035170 Ga0373943_0619091 Ga0373943_0619091_224_592 122
110 3300035171 Ga0373946_0106180 Ga0373946_0106180_599_967 122
111 3300037068 Ga0373925_0063262 Ga0373925_0063262_39_407 122
112 3300037418 Ga0395900_0348477 Ga0395900_0348477_887_1255 122
113 3300038443 Ga0395901_1857740 Ga0395901_1857740_33_401 122
114 3300039437 Ga0436365_1721523 Ga0436365_1721523_215_583 122
115 3300041451 Ga0451791_1411759 Ga0451791_1411759_103_471 122
116 3300041452 Ga0451793_0725399 Ga0451793_0725399_63_431 122
117 3300041463 Ga0451804_0250385 Ga0451804_0250385_21_389 122
118 3300041486 Ga0451807_2136418 Ga0451807_2136418_47_415 122
119 3300041512 Ga0451853_0998362 Ga0451853_0998362_45_413 122
120 3300041512 Ga0451853_3543220 Ga0451853_3543220_44_535 122
121 3300044901 Ga0466960_0925622 Ga0466960_0925622_137_505 122
122 3300045976 Ga0466967_1566325 Ga0466967_1566325_135_503 122
123 3300046455 Ga0495603_0093542 Ga0495603_0093542_249_617 122
124 3300046474 Ga0495605_0211017 Ga0495605_0211017_104_472 122
125 3300046499 Ga0495594_0646716 Ga0495594_0646716_22_390 122
126 3300046515 Ga0495620_0117829 Ga0495620_0117829_582_950 122
127 3300046517 Ga0495630_0186990 Ga0495630_0186990_478_846 122
128 3300046520 Ga0495637_0158884 Ga0495637_0158884_40_408 122
129 3300046533 Ga0495640_0285904 Ga0495640_0285904_36_404 122
130 3300046559 Ga0495667_0778782 Ga0495667_0778782_103_471 122
131 3300046642 Ga0495634_0665465 Ga0495634_0665465_26_394 122
132 3300046663 Ga0495635_0112424 Ga0495635_0112424_484_852 122
133 3300047317 Ga0495604_0445568 Ga0495604_0445568_172_540 122
134 3300047471 Ga0495684_0462476 Ga0495684_0462476_343_711 122
135 3300048903 Ga0496100_0436661 Ga0496100_0436661_508_876 122
136 3300048905 Ga0496102_0375310 Ga0496102_0375310_150_518 122
137 3300048907 Ga0496104_0436379 Ga0496104_0436379_161_529 122
138 3300048908 Ga0496105_0716040 Ga0496105_0716040_295_663 122
139 3300048911 Ga0496108_0116020 Ga0496108_0116020_197_565 122
140 3300048912 Ga0496109_0258995 Ga0496109_0258995_76_444 122
141 3300048913 Ga0496110_0057251 Ga0496110_0057251_265_633 122
142 3300048914 Ga0496111_0059962 Ga0496111_0059962_2130_2498 122
143 3300048916 Ga0496113_0437138 Ga0496113_0437138_469_837 122
144 3300049460 Ga0495682_0325457 Ga0495682_0325457_128_496 122
145 3300049583 Ga0501067_0574941 Ga0501067_0574941_114_482 122
146 3300053083 Ga0495655_0017982 Ga0495655_0017982_1079_1447 122
147 3300053083 Ga0495655_0117197 Ga0495655_0117197_392_760 122
148 3300053083 Ga0495655_0134371 Ga0495655_0134371_279_647 122
149 3300053084 Ga0495595_0175833 Ga0495595_0175833_133_501 122
150 3300053085 Ga0495619_0851612 Ga0495619_0851612_87_455 122
151 3300053153 Ga0500616_0003323 Ga0500616_0003323_6053_6421 122
152 3300059658 Ga0587119_062225 Ga0587119_062225_120_494 122
153 3300001990 JGI24737J22298_10059458 JGI24737J22298_100594582 123
154 3300003203 JGI25406J46586_10018647 JGI25406J46586_100186472 123
155 3300003203 JGI25406J46586_10062418 JGI25406J46586_100624182 123
156 3300003659 JGI25404J52841_10017318 JGI25404J52841_100173181 123
157 3300004798 Ga0058859_11831538 Ga0058859_118315382 123
158 3300005328 Ga0070676_10296477 Ga0070676_102964772 123
159 3300005328 Ga0070676_10494622 Ga0070676_104946222 123
160 3300005329 Ga0070683_100121872 Ga0070683_1001218722 123
161 3300005329 Ga0070683_100151659 Ga0070683_1001516592 123
162 3300005329 Ga0070683_100491041 Ga0070683_1004910412 123
163 3300005331 Ga0070670_100470316 Ga0070670_1004703162 123
164 3300005334 Ga0068869_100420561 Ga0068869_1004205612 123
165 3300005334 Ga0068869_101515359 Ga0068869_1015153591 123
166 3300005335 Ga0070666_10113046 Ga0070666_101130462 123
167 3300005337 Ga0070682_100099466 Ga0070682_1000994662 123
168 3300005338 Ga0068868_100476267 Ga0068868_1004762671 123
169 3300005338 Ga0068868_101581277 Ga0068868_1015812772 123
170 3300005339 Ga0070660_100140608 Ga0070660_1001406082 123
171 3300005339 Ga0070660_100853905 Ga0070660_1008539052 123
172 3300005340 Ga0070689_100038988 Ga0070689_1000389883 123
173 3300005341 Ga0070691_10093675 Ga0070691_100936752 123
174 3300005341 Ga0070691_10307744 Ga0070691_103077441 123
175 3300005341 Ga0070691_10418284 Ga0070691_104182841 123
176 3300005344 Ga0070661_100909685 Ga0070661_1009096851 123
177 3300005345 Ga0070692_10079422 Ga0070692_100794222 123
178 3300005347 Ga0070668_100118572 Ga0070668_1001185723 123
179 3300005347 Ga0070668_100139788 Ga0070668_1001397882 123
180 3300005347 Ga0070668_100386794 Ga0070668_1003867941 123
181 3300005347 Ga0070668_100724419 Ga0070668_1007244192 123
182 3300005347 Ga0070668_101123442 Ga0070668_1011234422 123
183 3300005353 Ga0070669_100513204 Ga0070669_1005132042 123
184 3300005355 Ga0070671_100080642 Ga0070671_1000806423 123
185 3300005356 Ga0070674_100038197 Ga0070674_1000381972 123
186 3300005356 Ga0070674_100218774 Ga0070674_1002187743 123
187 3300005356 Ga0070674_100549481 Ga0070674_1005494812 123
188 3300005356 Ga0070674_101070892 Ga0070674_1010708922 123
189 3300005364 Ga0070673_100204274 Ga0070673_1002042742 123
190 3300005365 Ga0070688_100039738 Ga0070688_1000397382 123
191 3300005365 Ga0070688_100488552 Ga0070688_1004885521 123
192 3300005366 Ga0070659_100040376 Ga0070659_1000403762 123
193 3300005366 Ga0070659_100150803 Ga0070659_1001508032 123
194 3300005367 Ga0070667_100302672 Ga0070667_1003026721 123
195 3300005437 Ga0070710_10352262 Ga0070710_103522622 123
196 3300005438 Ga0070701_10127161 Ga0070701_101271612 123
197 3300005440 Ga0070705_100249597 Ga0070705_1002495972 123
198 3300005440 Ga0070705_100600977 Ga0070705_1006009772 123
199 3300005441 Ga0070700_100043414 Ga0070700_1000434145 123
200 3300005441 Ga0070700_100485257 Ga0070700_1004852572 123
201 3300005455 Ga0070663_101081162 Ga0070663_1010811622 123
202 3300005456 Ga0070678_100151378 Ga0070678_1001513782 123
203 3300005457 Ga0070662_100143713 Ga0070662_1001437132 123
204 3300005457 Ga0070662_100293951 Ga0070662_1002939512 123
205 3300005459 Ga0068867_100151776 Ga0068867_1001517762 123
206 3300005466 Ga0070685_10203716 Ga0070685_102037162 123
207 3300005466 Ga0070685_10770568 Ga0070685_107705682 123
208 3300005535 Ga0070684_100402780 Ga0070684_1004027802 123
209 3300005539 Ga0068853_100069373 Ga0068853_1000693732 123
210 3300005539 Ga0068853_102168220 Ga0068853_1021682201 123
211 3300005543 Ga0070672_100330160 Ga0070672_1003301602 123
212 3300005543 Ga0070672_100473606 Ga0070672_1004736061 123
213 3300005543 Ga0070672_100493223 Ga0070672_1004932232 123
214 3300005545 Ga0070695_100340924 Ga0070695_1003409241 123
215 3300005547 Ga0070693_100181331 Ga0070693_1001813312 123
216 3300005547 Ga0070693_100581335 Ga0070693_1005813352 123
217 3300005548 Ga0070665_100067826 Ga0070665_1000678263 123
218 3300005548 Ga0070665_101568300 Ga0070665_1015683002 123
219 3300005549 Ga0070704_100410535 Ga0070704_1004105352 123
220 3300005564 Ga0070664_100403703 Ga0070664_1004037032 123
221 3300005564 Ga0070664_100461999 Ga0070664_1004619992 123
222 3300005564 Ga0070664_101907313 Ga0070664_1019073132 123
223 3300005577 Ga0068857_100147796 Ga0068857_1001477963 123
224 3300005578 Ga0068854_100471354 Ga0068854_1004713542 123
225 3300005578 Ga0068854_101984972 Ga0068854_1019849722 123
226 3300005578 Ga0068854_102003060 Ga0068854_1020030602 123
227 3300005614 Ga0068856_100074748 Ga0068856_1000747482 123
228 3300005614 Ga0068856_100757814 Ga0068856_1007578142 123
229 3300005614 Ga0068856_102476080 Ga0068856_1024760801 123
230 3300005615 Ga0070702_100472361 Ga0070702_1004723612 123
231 3300005615 Ga0070702_100940876 Ga0070702_1009408761 123
232 3300005616 Ga0068852_100090457 Ga0068852_1000904572 123
233 3300005616 Ga0068852_100238710 Ga0068852_1002387102 123
234 3300005617 Ga0068859_100093502 Ga0068859_1000935022 123
235 3300005617 Ga0068859_101797985 Ga0068859_1017979851 123
236 3300005618 Ga0068864_100315635 Ga0068864_1003156352 123
237 3300005618 Ga0068864_100400129 Ga0068864_1004001292 123
238 3300005718 Ga0068866_10192524 Ga0068866_101925243 123
239 3300005719 Ga0068861_100036002 Ga0068861_1000360024 123
240 3300005840 Ga0068870_10069979 Ga0068870_100699792 123
241 3300005840 Ga0068870_10077969 Ga0068870_100779692 123
242 3300005840 Ga0068870_10726182 Ga0068870_107261821 123
243 3300005841 Ga0068863_100656170 Ga0068863_1006561702 123
244 3300005842 Ga0068858_100332756 Ga0068858_1003327562 123
245 3300005843 Ga0068860_100371933 Ga0068860_1003719332 123
246 3300005844 Ga0068862_100871440 Ga0068862_1008714402 123
247 3300005937 Ga0081455_10799491 Ga0081455_107994912 123
248 3300005981 Ga0081538_10001765 Ga0081538_100017655 123
249 3300005981 Ga0081538_10371468 Ga0081538_103714681 123
250 3300005983 Ga0081540_1000550 Ga0081540_100055031 123
251 3300005985 Ga0081539_10003515 Ga0081539_1000351516 123
252 3300005985 Ga0081539_10004853 Ga0081539_100048538 123
253 3300006175 Ga0070712_100336693 Ga0070712_1003366932 123
254 3300006237 Ga0097621_100427470 Ga0097621_1004274702 123
255 3300006846 Ga0075430_101151897 Ga0075430_1011518972 123
256 3300006846 Ga0075430_101244177 Ga0075430_1012441771 123
257 3300006852 Ga0075433_10109250 Ga0075433_101092502 123
258 3300006871 Ga0075434_100750585 Ga0075434_1007505852 123
259 3300006880 Ga0075429_100423024 Ga0075429_1004230242 123
260 3300006881 Ga0068865_100140352 Ga0068865_1001403522 123
261 3300006931 Ga0097620_100093505 Ga0097620_1000935052 123
262 3300006931 Ga0097620_101797828 Ga0097620_1017978282 123
263 3300009011 Ga0105251_10229607 Ga0105251_102296072 123
264 3300009092 Ga0105250_10307657 Ga0105250_103076572 123
265 3300009093 Ga0105240_11310090 Ga0105240_113100902 123
266 3300009094 Ga0111539_10108496 Ga0111539_101084963 123
267 3300009094 Ga0111539_10428965 Ga0111539_104289652 123
268 3300009094 Ga0111539_11817463 Ga0111539_118174632 123
269 3300009098 Ga0105245_10025825 Ga0105245_100258255 123
270 3300009098 Ga0105245_10193170 Ga0105245_101931702 123
271 3300009098 Ga0105245_10336096 Ga0105245_103360962 123
272 3300009098 Ga0105245_10568017 Ga0105245_105680172 123
273 3300009098 Ga0105245_11071834 Ga0105245_110718342 123
274 3300009101 Ga0105247_10050230 Ga0105247_100502303 123
275 3300009101 Ga0105247_10242139 Ga0105247_102421392 123
276 3300009101 Ga0105247_10320799 Ga0105247_103207992 123
277 3300009147 Ga0114129_10649393 Ga0114129_106493932 123
278 3300009147 Ga0114129_12160057 Ga0114129_121600571 123
279 3300009148 Ga0105243_10402268 Ga0105243_104022682 123
280 3300009148 Ga0105243_10547474 Ga0105243_105474742 123
281 3300009148 Ga0105243_10566717 Ga0105243_105667172 123
282 3300009176 Ga0105242_10075825 Ga0105242_100758253 123
283 3300009176 Ga0105242_10084876 Ga0105242_100848763 123
284 3300009177 Ga0105248_10045886 Ga0105248_100458863 123
285 3300009545 Ga0105237_10319849 Ga0105237_103198492 123
286 3300009551 Ga0105238_10425432 Ga0105238_104254322 123
287 3300009551 Ga0105238_11065646 Ga0105238_110656462 123
288 3300009551 Ga0105238_11117779 Ga0105238_111177791 123
289 3300009553 Ga0105249_11076352 Ga0105249_110763522 123
290 3300010375 Ga0105239_10592698 Ga0105239_105926982 123
291 3300010375 Ga0105239_11137379 Ga0105239_111373792 123
292 3300010375 Ga0105239_11166236 Ga0105239_111662361 123
293 3300011119 Ga0105246_10436892 Ga0105246_104368921 123
294 3300011119 Ga0105246_11877864 Ga0105246_118778642 123
295 3300012482 Ga0157318_1028273 Ga0157318_10282731 123
296 3300012507 Ga0157342_1084233 Ga0157342_10842332 123
297 3300013102 Ga0157371_10200697 Ga0157371_102006972 123
298 3300013105 Ga0157369_10555936 Ga0157369_105559362 123
299 3300013105 Ga0157369_10880943 Ga0157369_108809432 123
300 3300013296 Ga0157374_10847945 Ga0157374_108479452 123
301 3300013296 Ga0157374_12128245 Ga0157374_121282452 123
302 3300013296 Ga0157374_12634893 Ga0157374_126348932 123
303 3300013297 Ga0157378_11352172 Ga0157378_113521722 123
304 3300013306 Ga0163162_10185460 Ga0163162_101854602 123
305 3300013306 Ga0163162_11204053 Ga0163162_112040532 123
306 3300013307 Ga0157372_10071464 Ga0157372_100714643 123
307 3300013307 Ga0157372_10100366 Ga0157372_101003665 123
308 3300013307 Ga0157372_10294395 Ga0157372_102943952 123
309 3300013307 Ga0157372_10971141 Ga0157372_109711412 123
310 3300013307 Ga0157372_11747067 Ga0157372_117470672 123
311 3300013308 Ga0157375_10837494 Ga0157375_108374942 123
312 3300013308 Ga0157375_10921532 Ga0157375_109215323 123
313 3300013308 Ga0157375_12581945 Ga0157375_125819451 123
314 3300014325 Ga0163163_10117802 Ga0163163_101178022 123
315 3300014326 Ga0157380_10162665 Ga0157380_101626652 123
316 3300014326 Ga0157380_10189770 Ga0157380_101897702 123
317 3300014326 Ga0157380_11159133 Ga0157380_111591331 123
318 3300014326 Ga0157380_11682040 Ga0157380_116820402 123
319 3300014497 Ga0182008_10193009 Ga0182008_101930092 123
320 3300014497 Ga0182008_10247895 Ga0182008_102478952 123
321 3300014497 Ga0182008_10649718 Ga0182008_106497182 123
322 3300014745 Ga0157377_10338783 Ga0157377_103387832 123
323 3300014968 Ga0157379_10023358 Ga0157379_100233581 123
324 3300014968 Ga0157379_10207695 Ga0157379_102076952 123
325 3300014969 Ga0157376_10542070 Ga0157376_105420702 123
326 3300015262 Ga0182007_10438280 Ga0182007_104382802 123
327 3300017792 Ga0163161_10238745 Ga0163161_102387452 123
328 3300017792 Ga0163161_10765765 Ga0163161_107657652 123
329 3300017792 Ga0163161_10896721 Ga0163161_108967211 123
330 3300017792 Ga0163161_11332793 Ga0163161_113327932 123
331 3300020069 Ga0197907_10384862 Ga0197907_103848622 123
332 3300020070 Ga0206356_10203078 Ga0206356_102030782 123
333 3300020077 Ga0206351_10097990 Ga0206351_100979901 123
334 3300020081 Ga0206354_10246270 Ga0206354_102462702 123
335 3300020081 Ga0206354_10436244 Ga0206354_104362442 123
336 3300020082 Ga0206353_10820068 Ga0206353_108200681 123
337 3300020610 Ga0154015_1181469 Ga0154015_11814691 123
338 3300022467 Ga0224712_10141889 Ga0224712_101418892 123
339 3300022467 Ga0224712_10174522 Ga0224712_101745221 123
340 3300022467 Ga0224712_10635067 Ga0224712_106350672 123
341 3300025321 Ga0207656_10079229 Ga0207656_100792292 123
342 3300025893 Ga0207682_10342607 Ga0207682_103426072 123
343 3300025898 Ga0207692_10286646 Ga0207692_102866462 123
344 3300025899 Ga0207642_10044113 Ga0207642_100441132 123
345 3300025900 Ga0207710_10322247 Ga0207710_103222472 123
346 3300025901 Ga0207688_10049002 Ga0207688_100490022 123
347 3300025901 Ga0207688_10107004 Ga0207688_101070042 123
348 3300025901 Ga0207688_10162969 Ga0207688_101629692 123
349 3300025901 Ga0207688_10480310 Ga0207688_104803102 123
350 3300025901 Ga0207688_10756940 Ga0207688_107569401 123
351 3300025903 Ga0207680_10234709 Ga0207680_102347092 123
352 3300025907 Ga0207645_10192134 Ga0207645_101921342 123
353 3300025908 Ga0207643_10011614 Ga0207643_100116143 123
354 3300025908 Ga0207643_10109227 Ga0207643_101092272 123
355 3300025909 Ga0207705_10075732 Ga0207705_100757323 123
356 3300025909 Ga0207705_10354533 Ga0207705_103545332 123
357 3300025911 Ga0207654_10367428 Ga0207654_103674282 123
358 3300025914 Ga0207671_10822196 Ga0207671_108221962 123
359 3300025915 Ga0207693_10569278 Ga0207693_105692782 123
360 3300025917 Ga0207660_10352814 Ga0207660_103528142 123
361 3300025918 Ga0207662_10067062 Ga0207662_100670622 123
362 3300025919 Ga0207657_10065082 Ga0207657_100650823 123
363 3300025920 Ga0207649_10261673 Ga0207649_102616732 123
364 3300025921 Ga0207652_10377046 Ga0207652_103770462 123
365 3300025921 Ga0207652_11053085 Ga0207652_110530852 123
366 3300025923 Ga0207681_10253560 Ga0207681_102535602 123
367 3300025923 Ga0207681_10579252 Ga0207681_105792522 123
368 3300025924 Ga0207694_10280458 Ga0207694_102804582 123
369 3300025925 Ga0207650_11231598 Ga0207650_112315982 123
370 3300025927 Ga0207687_10104053 Ga0207687_101040533 123
371 3300025927 Ga0207687_10123251 Ga0207687_101232512 123
372 3300025927 Ga0207687_10177693 Ga0207687_101776932 123
373 3300025927 Ga0207687_10563328 Ga0207687_105633282 123
374 3300025927 Ga0207687_10634501 Ga0207687_106345012 123
375 3300025931 Ga0207644_10787687 Ga0207644_107876872 123
376 3300025932 Ga0207690_10333004 Ga0207690_103330042 123
377 3300025932 Ga0207690_10596780 Ga0207690_105967802 123
378 3300025933 Ga0207706_10198538 Ga0207706_101985382 123
379 3300025933 Ga0207706_10409143 Ga0207706_104091432 123
380 3300025934 Ga0207686_10210516 Ga0207686_102105162 123
381 3300025934 Ga0207686_11548626 Ga0207686_115486262 123
382 3300025935 Ga0207709_10034384 Ga0207709_100343843 123
383 3300025935 Ga0207709_10293302 Ga0207709_102933022 123
384 3300025935 Ga0207709_10976152 Ga0207709_109761522 123
385 3300025936 Ga0207670_10095471 Ga0207670_100954712 123
386 3300025936 Ga0207670_10403396 Ga0207670_104033962 123
387 3300025937 Ga0207669_10150422 Ga0207669_101504223 123
388 3300025937 Ga0207669_10338533 Ga0207669_103385332 123
389 3300025937 Ga0207669_11690725 Ga0207669_116907251 123
390 3300025938 Ga0207704_10049596 Ga0207704_100495962 123
391 3300025940 Ga0207691_10035600 Ga0207691_100356002 123
392 3300025940 Ga0207691_10188703 Ga0207691_101887032 123
393 3300025940 Ga0207691_10334811 Ga0207691_103348111 123
394 3300025940 Ga0207691_10384578 Ga0207691_103845782 123
395 3300025941 Ga0207711_10049839 Ga0207711_100498393 123
396 3300025942 Ga0207689_10602820 Ga0207689_106028202 123
397 3300025942 Ga0207689_10929745 Ga0207689_109297451 123
398 3300025944 Ga0207661_10074063 Ga0207661_100740634 123
399 3300025945 Ga0207679_10335314 Ga0207679_103353142 123
400 3300025945 Ga0207679_10358004 Ga0207679_103580042 123
401 3300025960 Ga0207651_10419054 Ga0207651_104190542 123
402 3300025960 Ga0207651_10489497 Ga0207651_104894972 123
403 3300025961 Ga0207712_10165622 Ga0207712_101656222 123
404 3300025961 Ga0207712_10356209 Ga0207712_103562093 123
405 3300025961 Ga0207712_10558538 Ga0207712_105585382 123
406 3300025972 Ga0207668_10149108 Ga0207668_101491082 123
407 3300025981 Ga0207640_10105510 Ga0207640_101055102 123
408 3300025981 Ga0207640_11585437 Ga0207640_115854372 123
409 3300025986 Ga0207658_10648222 Ga0207658_106482222 123
410 3300026023 Ga0207677_10030536 Ga0207677_100305362 123
411 3300026041 Ga0207639_10294847 Ga0207639_102948472 123
412 3300026067 Ga0207678_10173390 Ga0207678_101733902 123
413 3300026078 Ga0207702_11286484 Ga0207702_112864842 123
414 3300026088 Ga0207641_11435499 Ga0207641_114354992 123
415 3300026089 Ga0207648_10020448 Ga0207648_100204484 123
416 3300026089 Ga0207648_10208099 Ga0207648_102080992 123
417 3300026095 Ga0207676_10309086 Ga0207676_103090862 123
418 3300026116 Ga0207674_10111219 Ga0207674_101112192 123
419 3300026116 Ga0207674_10441263 Ga0207674_104412632 123
420 3300026116 Ga0207674_10841400 Ga0207674_108414002 123
421 3300026118 Ga0207675_100083363 Ga0207675_1000833633 123
422 3300026118 Ga0207675_100139204 Ga0207675_1001392043 123
423 3300026118 Ga0207675_100392168 Ga0207675_1003921682 123
424 3300026118 Ga0207675_100421210 Ga0207675_1004212102 123
425 3300026121 Ga0207683_10038043 Ga0207683_100380434 123
426 3300026142 Ga0207698_10148692 Ga0207698_101486922 123
427 3300028379 Ga0268266_10040841 Ga0268266_100408412 123
428 3300028379 Ga0268266_10468057 Ga0268266_104680572 123
429 3300028380 Ga0268265_10043016 Ga0268265_100430163 123
430 3300028380 Ga0268265_11080963 Ga0268265_110809632 123
431 3300028381 Ga0268264_10402101 Ga0268264_104021012 123
432 3300028381 Ga0268264_10717132 Ga0268264_107171322 123
433 3300028381 Ga0268264_11323057 Ga0268264_113230572 123
434 3300031548 Ga0307408_100263430 Ga0307408_1002634302 123
435 3300031548 Ga0307408_101771023 Ga0307408_1017710232 123
436 3300031731 Ga0307405_10206717 Ga0307405_102067172 123
437 3300031731 Ga0307405_10668377 Ga0307405_106683771 123
438 3300031824 Ga0307413_11266610 Ga0307413_112666101 123
439 3300031889 Ga0326468_10053337 Ga0326468_100533371 123
440 3300031901 Ga0307406_10538563 Ga0307406_105385632 123
441 3300031903 Ga0307407_10251198 Ga0307407_102511982 123
442 3300031903 Ga0307407_10326932 Ga0307407_103269321 123
443 3300031911 Ga0307412_11569487 Ga0307412_115694872 123
444 3300031995 Ga0307409_100122047 Ga0307409_1001220473 123
445 3300031995 Ga0307409_100172588 Ga0307409_1001725883 123
446 3300031995 Ga0307409_100367986 Ga0307409_1003679862 123
447 3300031995 Ga0307409_102025905 Ga0307409_1020259051 123
448 3300032002 Ga0307416_100515417 Ga0307416_1005154172 123
449 3300032004 Ga0307414_10187917 Ga0307414_101879173 123
450 3300032005 Ga0307411_11013902 Ga0307411_110139022 123
451 3300032005 Ga0307411_11067358 Ga0307411_110673582 123
452 3300032126 Ga0307415_100011011 Ga0307415_1000110114 123
453 3300032126 Ga0307415_100440293 Ga0307415_1004402932 123
454 3300032126 Ga0307415_100515467 Ga0307415_1005154672 123
455 3300032126 Ga0307415_100817414 Ga0307415_1008174142 123
456 3300034957 Ga0373938_0131878 Ga0373938_0131878_20_391 123
457 3300035085 Ga0373929_0063694 Ga0373929_0063694_153_524 123
458 3300035114 Ga0373939_0224292 Ga0373939_0224292_241_612 123
459 3300035114 Ga0373939_0272474 Ga0373939_0272474_179_550 123
460 3300035115 Ga0373941_0417081 Ga0373941_0417081_41_412 123
461 3300035121 Ga0373960_0130129 Ga0373960_0130129_386_757 123
462 3300035207 Ga0373942_0215606 Ga0373942_0215606_250_621 123
463 3300035241 Ga0373961_0157114 Ga0373961_0157114_177_548 123
464 3300035242 Ga0373962_0024242 Ga0373962_0024242_225_596 123
465 3300037312 Ga0395899_0465021 Ga0395899_0465021_146_517 123
466 3300037418 Ga0395900_0154402 Ga0395900_0154402_960_1331 123
467 3300037418 Ga0395900_1235278 Ga0395900_1235278_136_507 123
468 3300037418 Ga0395900_1351678 Ga0395900_1351678_87_458 123
469 3300037466 Ga0395898_0661771 Ga0395898_0661771_224_595 123
470 3300038443 Ga0395901_0075057 Ga0395901_0075057_2608_2979 123
471 3300038443 Ga0395901_1163967 Ga0395901_1163967_150_521 123
472 3300038443 Ga0395901_1232731 Ga0395901_1232731_86_457 123
473 3300038443 Ga0395901_1506197 Ga0395901_1506197_141_512 123
474 3300041453 Ga0451797_0412393 Ga0451797_0412393_339_710 123
475 3300041460 Ga0451802_1995787 Ga0451802_1995787_242_613 123
476 3300041491 Ga0451833_1477395 Ga0451833_1477395_46_417 123
477 3300041507 Ga0451851_1085305 Ga0451851_1085305_194_565 123
478 3300041512 Ga0451853_1890795 Ga0451853_1890795_83_454 123
479 3300041512 Ga0451853_3970753 Ga0451853_3970753_307_678 123
480 3300042005 Ga0439448_0150994 Ga0439448_0150994_55_426 123
481 3300042005 Ga0439448_0351647 Ga0439448_0351647_39_410 123
482 3300042011 Ga0439454_121012 Ga0439454_121012_76_447 123
483 3300042016 Ga0439463_022473 Ga0439463_022473_185_556 123
484 3300042533 Ga0450901_039827 Ga0450901_039827_22_393 123
485 3300042993 Ga0439440_0121218 Ga0439440_0121218_239_610 123
486 3300044658 Ga0466972_0217533 Ga0466972_0217533_33_404 123
487 3300044683 Ga0466965_0692644 Ga0466965_0692644_52_423 123
488 3300044684 Ga0466966_0038129 Ga0466966_0038129_2371_2742 123
489 3300044693 Ga0466961_0551306 Ga0466961_0551306_59_430 123
490 3300044694 Ga0466963_1009388 Ga0466963_1009388_71_442 123
491 3300044901 Ga0466960_0000017 Ga0466960_0000017_4677_5048 123
492 3300044901 Ga0466960_0016459 Ga0466960_0016459_1421_1792 123
493 3300044901 Ga0466960_0039210 Ga0466960_0039210_390_761 123
494 3300044901 Ga0466960_0148265 Ga0466960_0148265_726_1097 123
495 3300044901 Ga0466960_0212559 Ga0466960_0212559_298_669 123
496 3300044901 Ga0466960_0873270 Ga0466960_0873270_29_400 123
497 3300045049 Ga0466959_0327975 Ga0466959_0327975_544_915 123
498 3300045836 Ga0466958_1171227 Ga0466958_1171227_62_433 123
499 3300045976 Ga0466967_0092058 Ga0466967_0092058_2226_2597 123
500 3300045976 Ga0466967_0244190 Ga0466967_0244190_18_389 123
501 3300045976 Ga0466967_0456945 Ga0466967_0456945_724_1095 123
502 3300045976 Ga0466967_0458083 Ga0466967_0458083_268_639 123
503 3300045976 Ga0466967_0968367 Ga0466967_0968367_278_649 123
504 3300046457 Ga0495590_0051742 Ga0495590_0051742_856_1227 123
505 3300046471 Ga0495650_0000566 Ga0495650_0000566_21103_21474 123
506 3300046473 Ga0495582_0414993 Ga0495582_0414993_381_752 123
507 3300046492 Ga0495585_0456345 Ga0495585_0456345_151_522 123
508 3300046515 Ga0495620_0039962 Ga0495620_0039962_1589_1966 123
509 3300046515 Ga0495620_0154082 Ga0495620_0154082_248_619 123
510 3300046525 Ga0495663_0114491 Ga0495663_0114491_442_813 123
511 3300046528 Ga0495642_0235052 Ga0495642_0235052_118_489 123
512 3300046690 Ga0495624_0640533 Ga0495624_0640533_85_456 123
513 3300046691 Ga0495670_0428630 Ga0495670_0428630_174_545 123
514 3300046692 Ga0495671_0438443 Ga0495671_0438443_160_531 123
515 3300046694 Ga0495649_0221011 Ga0495649_0221011_131_502 123
516 3300046694 Ga0495649_0320321 Ga0495649_0320321_322_693 123
517 3300047472 Ga0495686_0212159 Ga0495686_0212159_344_715 123
518 3300048903 Ga0496100_0149215 Ga0496100_0149215_962_1333 123
519 3300048903 Ga0496100_0151320 Ga0496100_0151320_1218_1589 123
520 3300048903 Ga0496100_1371421 Ga0496100_1371421_102_473 123
521 3300048904 Ga0496101_0205128 Ga0496101_0205128_931_1302 123
522 3300048904 Ga0496101_0585121 Ga0496101_0585121_472_843 123
523 3300048904 Ga0496101_1098135 Ga0496101_1098135_231_602 123
524 3300048905 Ga0496102_0058418 Ga0496102_0058418_2428_2799 123
525 3300048905 Ga0496102_0067979 Ga0496102_0067979_2197_2568 123
526 3300048906 Ga0496103_0201620 Ga0496103_0201620_180_551 123
527 3300048907 Ga0496104_0021049 Ga0496104_0021049_1638_2009 123
528 3300048907 Ga0496104_0088832 Ga0496104_0088832_2563_2934 123
529 3300048907 Ga0496104_0189639 Ga0496104_0189639_927_1298 123
530 3300048908 Ga0496105_0027918 Ga0496105_0027918_282_653 123
531 3300048909 Ga0496106_0138182 Ga0496106_0138182_176_547 123
532 3300048909 Ga0496106_0610098 Ga0496106_0610098_453_824 123
533 3300048910 Ga0496107_0280329 Ga0496107_0280329_14_385 123
534 3300048910 Ga0496107_0591368 Ga0496107_0591368_162_533 123
535 3300048911 Ga0496108_0029709 Ga0496108_0029709_3969_4340 123
536 3300048911 Ga0496108_0060353 Ga0496108_0060353_2729_3100 123
537 3300048911 Ga0496108_0194117 Ga0496108_0194117_1147_1518 123
538 3300048911 Ga0496108_0219097 Ga0496108_0219097_1106_1483 123
539 3300048912 Ga0496109_0004551 Ga0496109_0004551_1341_1712 123
540 3300048912 Ga0496109_0487592 Ga0496109_0487592_659_1030 123
541 3300048912 Ga0496109_1185367 Ga0496109_1185367_194_565 123
542 3300048913 Ga0496110_0253244 Ga0496110_0253244_305_676 123
543 3300048913 Ga0496110_0254775 Ga0496110_0254775_452_823 123
544 3300048913 Ga0496110_0261575 Ga0496110_0261575_395_766 123
545 3300048914 Ga0496111_0259853 Ga0496111_0259853_25_396 123
546 3300048914 Ga0496111_0339758 Ga0496111_0339758_121_492 123
547 3300048914 Ga0496111_0550465 Ga0496111_0550465_440_811 123
548 3300048915 Ga0496112_0030068 Ga0496112_0030068_3319_3690 123
549 3300048915 Ga0496112_0096816 Ga0496112_0096816_988_1359 123
550 3300048915 Ga0496112_0528099 Ga0496112_0528099_501_872 123
551 3300048916 Ga0496113_0067695 Ga0496113_0067695_620_991 123
552 3300048916 Ga0496113_0138844 Ga0496113_0138844_295_666 123
553 3300048916 Ga0496113_0146359 Ga0496113_0146359_978_1349 123
554 3300048916 Ga0496113_1102388 Ga0496113_1102388_235_606 123
555 3300048917 Ga0496114_0289043 Ga0496114_0289043_960_1331 123
556 3300048917 Ga0496114_0317234 Ga0496114_0317234_851_1222 123
557 3300048918 Ga0496115_0164862 Ga0496115_0164862_1265_1636 123
558 3300048924 Ga0496121_0032411 Ga0496121_0032411_3973_4344 123
559 3300048927 Ga0496124_0140574 Ga0496124_0140574_347_718 123
560 3300049533 Ga0501317_070561 Ga0501317_070561_149_520 123
561 3300049568 Ga0501031_0002052 Ga0501031_0002052_9761_10132 123
562 3300049569 Ga0501032_0043917 Ga0501032_0043917_399_770 123
563 3300049570 Ga0501033_0013168 Ga0501033_0013168_918_1289 123
564 3300049571 Ga0501034_0003511 Ga0501034_0003511_5647_6018 123
565 3300049571 Ga0501034_0039519 Ga0501034_0039519_4005_4376 123
566 3300049572 Ga0501036_0011780 Ga0501036_0011780_6295_6666 123
567 3300049572 Ga0501036_1192300 Ga0501036_1192300_233_604 123
568 3300049573 Ga0501037_0047752 Ga0501037_0047752_2425_2796 123
569 3300049574 Ga0501038_0047781 Ga0501038_0047781_2350_2721 123
570 3300049574 Ga0501038_0655888 Ga0501038_0655888_134_505 123
571 3300049575 Ga0501039_0060007 Ga0501039_0060007_1265_1636 123
572 3300049577 Ga0501041_0299195 Ga0501041_0299195_533_904 123
573 3300049578 Ga0501042_0204956 Ga0501042_0204956_811_1182 123
574 3300049579 Ga0501043_0030298 Ga0501043_0030298_606_977 123
575 3300049580 Ga0501046_0142269 Ga0501046_0142269_862_1233 123
576 3300049581 Ga0501047_0019196 Ga0501047_0019196_3907_4278 123
577 3300049582 Ga0501048_0327046 Ga0501048_0327046_112_483 123
578 3300049583 Ga0501067_0003581 Ga0501067_0003581_6852_7223 123
579 3300049583 Ga0501067_0433607 Ga0501067_0433607_25_396 123
580 3300049584 Ga0501068_0020333 Ga0501068_0020333_2192_2563 123
581 3300049584 Ga0501068_0114250 Ga0501068_0114250_1237_1608 123
582 3300049584 Ga0501068_0727319 Ga0501068_0727319_94_465 123
583 3300049585 Ga0501069_0018025 Ga0501069_0018025_1122_1493 123
584 3300049585 Ga0501069_0041616 Ga0501069_0041616_186_557 123
585 3300049586 Ga0501070_0055764 Ga0501070_0055764_2673_3044 123
586 3300049587 Ga0501071_0134302 Ga0501071_0134302_1001_1372 123
587 3300049587 Ga0501071_1462450 Ga0501071_1462450_139_510 123
588 3300049588 Ga0501072_0943262 Ga0501072_0943262_71_442 123
589 3300049589 Ga0501073_0005264 Ga0501073_0005264_2536_2907 123
590 3300049590 Ga0501074_0048450 Ga0501074_0048450_1287_1658 123
591 3300049590 Ga0501074_0852229 Ga0501074_0852229_246_617 123
592 3300049663 Ga0501223_131142 Ga0501223_131142_52_423 123
593 3300049705 Ga0501225_0132133 Ga0501225_0132133_33_404 123
594 3300049741 Ga0501079_0567726 Ga0501079_0567726_74_445 123
595 3300049742 Ga0501080_0050553 Ga0501080_0050553_2155_2526 123
596 3300049744 Ga0501083_0040499 Ga0501083_0040499_1239_1610 123
597 3300049822 Ga0501035_0013517 Ga0501035_0013517_4861_5232 123
598 3300049823 Ga0501044_0144182 Ga0501044_0144182_994_1365 123
599 3300050508 nmdc:mga09592_619471_c1 nmdc:mga09592_619471_c1_74_445 123
600 3300050510 nmdc:mga06r32_141033_c1 nmdc:mga06r32_141033_c1_601_972 123
601 3300050511 nmdc:mga08y16_237567_c1 nmdc:mga08y16_237567_c1_122_493 123
602 3300050511 nmdc:mga08y16_261935_c1 nmdc:mga08y16_261935_c1_1317_1688 123
603 3300050511 nmdc:mga08y16_609173_c1 nmdc:mga08y16_609173_c1_205_582 123
604 3300050512 nmdc:mga0n895_136503_c1 nmdc:mga0n895_136503_c1_172_543 123
605 3300050513 nmdc:mga0rr50_1814252_c1 nmdc:mga0rr50_1814252_c1_87_458 123
606 3300050514 nmdc:mga08x19_213931_c1 nmdc:mga08x19_213931_c1_159_530 123
607 3300050515 nmdc:mga0a205_176014_c1 nmdc:mga0a205_176014_c1_1408_1779 123
608 3300053104 Ga0500556_0000922 Ga0500556_0000922_13862_14233 123
609 3300053153 Ga0500616_0001951 Ga0500616_0001951_1842_2213 123
610 3300053153 Ga0500616_0002891 Ga0500616_0002891_662_1033 123
611 3300059505 Ga0587083_0038626 Ga0587083_0038626_139_510 123
612 3300059507 Ga0587086_048151 Ga0587086_048151_59_430 123
613 3300059511 Ga0587091_169061 Ga0587091_169061_182_553 123
614 3300059631 Ga0587130_029153 Ga0587130_029153_133_504 123
615 3300059645 Ga0587076_093925 Ga0587076_093925_276_647 123
616 3300059645 Ga0587076_205263 Ga0587076_205263_46_417 123
617 3300060346 Ga0587111_0259159 Ga0587111_0259159_34_405 123
618 3300060353 Ga0501082_0046693 Ga0501082_0046693_2003_2374 123
619 3300060353 Ga0501082_0273011 Ga0501082_0273011_480_851 123
620 3300061734 Ga0530510_0535901 Ga0530510_0535901_462_833 123
621 3300000546 LJNas_1014085 LJNas_10140852 124
622 3300003162 Ga0006778J45830_1015811 Ga0006778J45830_10158112 124
623 3300003203 JGI25406J46586_10007378 JGI25406J46586_100073782 124
624 3300003693 Ga0032354_1045473 Ga0032354_10454731 124
625 3300005327 Ga0070658_10593295 Ga0070658_105932952 124
626 3300005327 Ga0070658_10635509 Ga0070658_106355091 124
627 3300005327 Ga0070658_11134820 Ga0070658_111348202 124
628 3300005328 Ga0070676_10321262 Ga0070676_103212622 124
629 3300005328 Ga0070676_10647229 Ga0070676_106472291 124
630 3300005329 Ga0070683_100051324 Ga0070683_1000513243 124
631 3300005329 Ga0070683_100265306 Ga0070683_1002653062 124
632 3300005329 Ga0070683_100356148 Ga0070683_1003561482 124
633 3300005329 Ga0070683_100414621 Ga0070683_1004146212 124
634 3300005329 Ga0070683_101514468 Ga0070683_1015144681 124
635 3300005331 Ga0070670_101588541 Ga0070670_1015885412 124
636 3300005331 Ga0070670_101870797 Ga0070670_1018707971 124
637 3300005334 Ga0068869_100274480 Ga0068869_1002744802 124
638 3300005334 Ga0068869_100693939 Ga0068869_1006939392 124
639 3300005334 Ga0068869_101905015 Ga0068869_1019050151 124
640 3300005335 Ga0070666_11031018 Ga0070666_110310181 124
641 3300005336 Ga0070680_101260367 Ga0070680_1012603672 124
642 3300005337 Ga0070682_100367458 Ga0070682_1003674582 124
643 3300005337 Ga0070682_100521177 Ga0070682_1005211772 124
644 3300005337 Ga0070682_100827185 Ga0070682_1008271852 124
645 3300005337 Ga0070682_101024234 Ga0070682_1010242342 124
646 3300005338 Ga0068868_100016021 Ga0068868_1000160213 124
647 3300005338 Ga0068868_100308492 Ga0068868_1003084922 124
648 3300005338 Ga0068868_101240472 Ga0068868_1012404721 124
649 3300005340 Ga0070689_101753360 Ga0070689_1017533601 124
650 3300005340 Ga0070689_101970422 Ga0070689_1019704222 124
651 3300005341 Ga0070691_10332744 Ga0070691_103327442 124
652 3300005343 Ga0070687_100020592 Ga0070687_1000205922 124
653 3300005343 Ga0070687_100747175 Ga0070687_1007471752 124
654 3300005344 Ga0070661_100629140 Ga0070661_1006291402 124
655 3300005344 Ga0070661_101055252 Ga0070661_1010552522 124
656 3300005345 Ga0070692_10047289 Ga0070692_100472892 124
657 3300005345 Ga0070692_10575134 Ga0070692_105751342 124
658 3300005347 Ga0070668_100260224 Ga0070668_1002602242 124
659 3300005353 Ga0070669_100282301 Ga0070669_1002823012 124
660 3300005353 Ga0070669_100772454 Ga0070669_1007724542 124
661 3300005353 Ga0070669_101216205 Ga0070669_1012162052 124
662 3300005354 Ga0070675_100996606 Ga0070675_1009966061 124
663 3300005354 Ga0070675_101170476 Ga0070675_1011704762 124
664 3300005354 Ga0070675_101849259 Ga0070675_1018492591 124
665 3300005355 Ga0070671_100266291 Ga0070671_1002662912 124
666 3300005355 Ga0070671_100500176 Ga0070671_1005001761 124
667 3300005355 Ga0070671_100615686 Ga0070671_1006156862 124
668 3300005356 Ga0070674_100096632 Ga0070674_1000966322 124
669 3300005356 Ga0070674_100215262 Ga0070674_1002152622 124
670 3300005364 Ga0070673_100751474 Ga0070673_1007514742 124
671 3300005365 Ga0070688_100416194 Ga0070688_1004161942 124
672 3300005365 Ga0070688_100813135 Ga0070688_1008131351 124
673 3300005366 Ga0070659_100040376 Ga0070659_1000403764 124
674 3300005366 Ga0070659_100120966 Ga0070659_1001209662 124
675 3300005366 Ga0070659_100393023 Ga0070659_1003930232 124
676 3300005366 Ga0070659_101377486 Ga0070659_1013774862 124
677 3300005367 Ga0070667_100442726 Ga0070667_1004427262 124
678 3300005367 Ga0070667_100690707 Ga0070667_1006907072 124
679 3300005438 Ga0070701_10252672 Ga0070701_102526722 124
680 3300005438 Ga0070701_10640210 Ga0070701_106402101 124
681 3300005440 Ga0070705_100492662 Ga0070705_1004926622 124
682 3300005441 Ga0070700_100209387 Ga0070700_1002093872 124
683 3300005441 Ga0070700_100281217 Ga0070700_1002812172 124
684 3300005441 Ga0070700_101186975 Ga0070700_1011869751 124
685 3300005455 Ga0070663_100406793 Ga0070663_1004067932 124
686 3300005455 Ga0070663_100521345 Ga0070663_1005213452 124
687 3300005455 Ga0070663_100693677 Ga0070663_1006936771 124
688 3300005456 Ga0070678_100505564 Ga0070678_1005055642 124
689 3300005456 Ga0070678_100785307 Ga0070678_1007853072 124
690 3300005456 Ga0070678_101392306 Ga0070678_1013923062 124
691 3300005457 Ga0070662_100234969 Ga0070662_1002349692 124
692 3300005457 Ga0070662_100288182 Ga0070662_1002881822 124
693 3300005459 Ga0068867_100055824 Ga0068867_1000558242 124
694 3300005459 Ga0068867_100381689 Ga0068867_1003816892 124
695 3300005459 Ga0068867_100431970 Ga0068867_1004319702 124
696 3300005459 Ga0068867_100867314 Ga0068867_1008673141 124
697 3300005459 Ga0068867_100908972 Ga0068867_1009089722 124
698 3300005466 Ga0070685_10203345 Ga0070685_102033451 124
699 3300005530 Ga0070679_100351847 Ga0070679_1003518472 124
700 3300005535 Ga0070684_100057876 Ga0070684_1000578763 124
701 3300005535 Ga0070684_100261637 Ga0070684_1002616372 124
702 3300005535 Ga0070684_100269053 Ga0070684_1002690532 124
703 3300005535 Ga0070684_100593411 Ga0070684_1005934112 124
704 3300005535 Ga0070684_101106282 Ga0070684_1011062822 124
705 3300005535 Ga0070684_101856416 Ga0070684_1018564161 124
706 3300005539 Ga0068853_100680196 Ga0068853_1006801962 124
707 3300005539 Ga0068853_100756847 Ga0068853_1007568471 124
708 3300005543 Ga0070672_100283746 Ga0070672_1002837462 124
709 3300005543 Ga0070672_100405805 Ga0070672_1004058052 124
710 3300005543 Ga0070672_100474666 Ga0070672_1004746661 124
711 3300005543 Ga0070672_100620458 Ga0070672_1006204582 124
712 3300005547 Ga0070693_100758648 Ga0070693_1007586482 124
713 3300005548 Ga0070665_100018292 Ga0070665_1000182925 124
714 3300005548 Ga0070665_100087858 Ga0070665_1000878582 124
715 3300005548 Ga0070665_100703332 Ga0070665_1007033322 124
716 3300005548 Ga0070665_100780019 Ga0070665_1007800192 124
717 3300005548 Ga0070665_101151332 Ga0070665_1011513322 124
718 3300005564 Ga0070664_101105757 Ga0070664_1011057572 124
719 3300005564 Ga0070664_101443056 Ga0070664_1014430562 124
720 3300005564 Ga0070664_101818784 Ga0070664_1018187841 124
721 3300005577 Ga0068857_100613860 Ga0068857_1006138602 124
722 3300005578 Ga0068854_100131479 Ga0068854_1001314792 124
723 3300005578 Ga0068854_100415995 Ga0068854_1004159952 124
724 3300005578 Ga0068854_100428685 Ga0068854_1004286852 124
725 3300005578 Ga0068854_100935097 Ga0068854_1009350972 124
726 3300005614 Ga0068856_100290837 Ga0068856_1002908372 124
727 3300005614 Ga0068856_101261551 Ga0068856_1012615512 124
728 3300005615 Ga0070702_100045115 Ga0070702_1000451152 124
729 3300005615 Ga0070702_100106505 Ga0070702_1001065052 124
730 3300005615 Ga0070702_100572528 Ga0070702_1005725281 124
731 3300005615 Ga0070702_101158410 Ga0070702_1011584102 124
732 3300005615 Ga0070702_101445626 Ga0070702_1014456261 124
733 3300005616 Ga0068852_100357872 Ga0068852_1003578722 124
734 3300005616 Ga0068852_101147505 Ga0068852_1011475052 124
735 3300005616 Ga0068852_101196682 Ga0068852_1011966822 124
736 3300005617 Ga0068859_100923922 Ga0068859_1009239222 124
737 3300005618 Ga0068864_100161670 Ga0068864_1001616702 124
738 3300005618 Ga0068864_100258303 Ga0068864_1002583032 124
739 3300005718 Ga0068866_10040284 Ga0068866_100402842 124
740 3300005718 Ga0068866_10212355 Ga0068866_102123552 124
741 3300005718 Ga0068866_10758880 Ga0068866_107588802 124
742 3300005718 Ga0068866_10875600 Ga0068866_108756001 124
743 3300005718 Ga0068866_10900409 Ga0068866_109004092 124
744 3300005719 Ga0068861_100036002 Ga0068861_1000360026 124
745 3300005719 Ga0068861_100175211 Ga0068861_1001752112 124
746 3300005719 Ga0068861_100788839 Ga0068861_1007888392 124
747 3300005840 Ga0068870_11014427 Ga0068870_110144271 124
748 3300005841 Ga0068863_100298371 Ga0068863_1002983712 124
749 3300005841 Ga0068863_100911261 Ga0068863_1009112611 124
750 3300005842 Ga0068858_100204302 Ga0068858_1002043022 124
751 3300005843 Ga0068860_100728155 Ga0068860_1007281552 124
752 3300005843 Ga0068860_101426524 Ga0068860_1014265242 124
753 3300005844 Ga0068862_100754446 Ga0068862_1007544461 124
754 3300005937 Ga0081455_10004985 Ga0081455_1000498511 124
755 3300005937 Ga0081455_10067585 Ga0081455_100675854 124
756 3300005937 Ga0081455_10554011 Ga0081455_105540111 124
757 3300005937 Ga0081455_10622851 Ga0081455_106228512 124
758 3300005937 Ga0081455_11051931 Ga0081455_110519311 124
759 3300005981 Ga0081538_10004007 Ga0081538_100040074 124
760 3300005981 Ga0081538_10013354 Ga0081538_100133543 124
761 3300005983 Ga0081540_1062443 Ga0081540_10624432 124
762 3300005985 Ga0081539_10003476 Ga0081539_100034764 124
763 3300005985 Ga0081539_10319266 Ga0081539_103192662 124
764 3300006038 Ga0075365_10492995 Ga0075365_104929952 124
765 3300006038 Ga0075365_11046031 Ga0075365_110460311 124
766 3300006058 Ga0075432_10039271 Ga0075432_100392712 124
767 3300006178 Ga0075367_10458485 Ga0075367_104584851 124
768 3300006237 Ga0097621_101270149 Ga0097621_1012701492 124
769 3300006358 Ga0068871_100632171 Ga0068871_1006321712 124
770 3300006358 Ga0068871_101824976 Ga0068871_1018249762 124
771 3300006844 Ga0075428_100257996 Ga0075428_1002579962 124
772 3300006844 Ga0075428_100285968 Ga0075428_1002859682 124
773 3300006844 Ga0075428_100539909 Ga0075428_1005399092 124
774 3300006844 Ga0075428_101125448 Ga0075428_1011254482 124
775 3300006844 Ga0075428_101135735 Ga0075428_1011357352 124
776 3300006844 Ga0075428_101429077 Ga0075428_1014290772 124
777 3300006844 Ga0075428_101794810 Ga0075428_1017948102 124
778 3300006846 Ga0075430_100639117 Ga0075430_1006391172 124
779 3300006881 Ga0068865_100166349 Ga0068865_1001663492 124
780 3300006881 Ga0068865_100330119 Ga0068865_1003301192 124
781 3300006881 Ga0068865_100361059 Ga0068865_1003610592 124
782 3300006881 Ga0068865_100433990 Ga0068865_1004339902 124
783 3300006881 Ga0068865_102012820 Ga0068865_1020128201 124
784 3300006914 Ga0075436_100256311 Ga0075436_1002563112 124
785 3300006931 Ga0097620_100923949 Ga0097620_1009239492 124
786 3300009093 Ga0105240_12314041 Ga0105240_123140411 124
787 3300009094 Ga0111539_10057434 Ga0111539_100574345 124
788 3300009094 Ga0111539_10258245 Ga0111539_102582452 124
789 3300009094 Ga0111539_10702163 Ga0111539_107021631 124
790 3300009094 Ga0111539_12949973 Ga0111539_129499731 124
791 3300009098 Ga0105245_10025825 Ga0105245_100258253 124
792 3300009098 Ga0105245_10111186 Ga0105245_101111862 124
793 3300009098 Ga0105245_10289391 Ga0105245_102893912 124
794 3300009098 Ga0105245_10339718 Ga0105245_103397182 124
795 3300009098 Ga0105245_10668325 Ga0105245_106683252 124
796 3300009098 Ga0105245_10782759 Ga0105245_107827592 124
797 3300009098 Ga0105245_10903523 Ga0105245_109035232 124
798 3300009101 Ga0105247_10129762 Ga0105247_101297622 124
799 3300009101 Ga0105247_10401821 Ga0105247_104018212 124
800 3300009101 Ga0105247_10635784 Ga0105247_106357842 124
801 3300009147 Ga0114129_10239089 Ga0114129_102390891 124
802 3300009147 Ga0114129_10685884 Ga0114129_106858842 124
803 3300009147 Ga0114129_10969028 Ga0114129_109690282 124
804 3300009147 Ga0114129_12464361 Ga0114129_124643612 124
805 3300009148 Ga0105243_10082125 Ga0105243_100821253 124
806 3300009148 Ga0105243_10248043 Ga0105243_102480432 124
807 3300009148 Ga0105243_10334476 Ga0105243_103344762 124
808 3300009148 Ga0105243_11249002 Ga0105243_112490022 124
809 3300009148 Ga0105243_12172535 Ga0105243_121725351 124
810 3300009176 Ga0105242_10044851 Ga0105242_100448513 124
811 3300009176 Ga0105242_10134803 Ga0105242_101348032 124
812 3300009176 Ga0105242_10646604 Ga0105242_106466042 124
813 3300009176 Ga0105242_10739212 Ga0105242_107392122 124
814 3300009176 Ga0105242_11727306 Ga0105242_117273062 124
815 3300009176 Ga0105242_11948061 Ga0105242_119480612 124
816 3300009177 Ga0105248_10479995 Ga0105248_104799952 124
817 3300009177 Ga0105248_10748475 Ga0105248_107484752 124
818 3300009177 Ga0105248_11560415 Ga0105248_115604152 124
819 3300009545 Ga0105237_11580045 Ga0105237_115800452 124
820 3300009551 Ga0105238_10889997 Ga0105238_108899972 124
821 3300009553 Ga0105249_10313929 Ga0105249_103139292 124
822 3300009553 Ga0105249_10341863 Ga0105249_103418632 124
823 3300009553 Ga0105249_11059459 Ga0105249_110594592 124
824 3300009553 Ga0105249_11647832 Ga0105249_116478322 124
825 3300010375 Ga0105239_10467442 Ga0105239_104674422 124
826 3300010375 Ga0105239_10574951 Ga0105239_105749512 124
827 3300011119 Ga0105246_10426850 Ga0105246_104268502 124
828 3300011119 Ga0105246_10597331 Ga0105246_105973311 124
829 3300011119 Ga0105246_10613513 Ga0105246_106135132 124
830 3300011119 Ga0105246_11374094 Ga0105246_113740942 124
831 3300011119 Ga0105246_11650191 Ga0105246_116501911 124
832 3300012477 Ga0157336_1015194 Ga0157336_10151942 124
833 3300013100 Ga0157373_10873591 Ga0157373_108735912 124
834 3300013102 Ga0157371_10485342 Ga0157371_104853421 124
835 3300013102 Ga0157371_10610484 Ga0157371_106104842 124
836 3300013104 Ga0157370_11383061 Ga0157370_113830611 124
837 3300013105 Ga0157369_10803073 Ga0157369_108030731 124
838 3300013105 Ga0157369_11150789 Ga0157369_111507892 124
839 3300013105 Ga0157369_11593201 Ga0157369_115932012 124
840 3300013296 Ga0157374_11732481 Ga0157374_117324812 124
841 3300013296 Ga0157374_12099442 Ga0157374_120994421 124
842 3300013296 Ga0157374_12132399 Ga0157374_121323992 124
843 3300013306 Ga0163162_10205781 Ga0163162_102057813 124
844 3300013306 Ga0163162_10466330 Ga0163162_104663302 124
845 3300013306 Ga0163162_10589714 Ga0163162_105897142 124
846 3300013306 Ga0163162_11183426 Ga0163162_111834262 124
847 3300013307 Ga0157372_10735659 Ga0157372_107356591 124
848 3300013307 Ga0157372_10855830 Ga0157372_108558302 124
849 3300013307 Ga0157372_10922986 Ga0157372_109229862 124
850 3300013307 Ga0157372_11110793 Ga0157372_111107932 124
851 3300013307 Ga0157372_11544201 Ga0157372_115442012 124
852 3300013308 Ga0157375_10580896 Ga0157375_105808962 124
853 3300013308 Ga0157375_11181724 Ga0157375_111817242 124
854 3300013308 Ga0157375_11200337 Ga0157375_112003372 124
855 3300013308 Ga0157375_13528554 Ga0157375_135285541 124
856 3300014326 Ga0157380_10100377 Ga0157380_101003772 124
857 3300014326 Ga0157380_10142125 Ga0157380_101421252 124
858 3300014326 Ga0157380_11079669 Ga0157380_110796692 124
859 3300014326 Ga0157380_11901991 Ga0157380_119019912 124
860 3300014497 Ga0182008_10326857 Ga0182008_103268572 124
861 3300014497 Ga0182008_10357452 Ga0182008_103574522 124
862 3300014745 Ga0157377_10020770 Ga0157377_100207702 124
863 3300014745 Ga0157377_10128778 Ga0157377_101287782 124
864 3300014745 Ga0157377_10238951 Ga0157377_102389512 124
865 3300014745 Ga0157377_10420429 Ga0157377_104204292 124
866 3300014745 Ga0157377_10490118 Ga0157377_104901182 124
867 3300014745 Ga0157377_10872978 Ga0157377_108729782 124
868 3300014745 Ga0157377_11081579 Ga0157377_110815791 124
869 3300014968 Ga0157379_10196916 Ga0157379_101969162 124
870 3300014968 Ga0157379_10338043 Ga0157379_103380432 124
871 3300014968 Ga0157379_12267749 Ga0157379_122677491 124
872 3300014969 Ga0157376_10839564 Ga0157376_108395642 124
873 3300014969 Ga0157376_11660125 Ga0157376_116601251 124
874 3300014969 Ga0157376_11949059 Ga0157376_119490591 124
875 3300017792 Ga0163161_10612252 Ga0163161_106122522 124
876 3300017792 Ga0163161_10691468 Ga0163161_106914682 124
877 3300017792 Ga0163161_10972792 Ga0163161_109727921 124
878 3300020069 Ga0197907_10232531 Ga0197907_102325312 124
879 3300020069 Ga0197907_11110283 Ga0197907_111102831 124
880 3300020070 Ga0206356_10721767 Ga0206356_107217671 124
881 3300020070 Ga0206356_11352269 Ga0206356_113522691 124
882 3300020075 Ga0206349_1745234 Ga0206349_17452342 124
883 3300020076 Ga0206355_1259147 Ga0206355_12591472 124
884 3300020078 Ga0206352_10524090 Ga0206352_105240901 124
885 3300020081 Ga0206354_10224768 Ga0206354_102247682 124
886 3300020081 Ga0206354_10725166 Ga0206354_107251662 124
887 3300020082 Ga0206353_10055073 Ga0206353_100550732 124
888 3300020082 Ga0206353_12059057 Ga0206353_120590572 124
889 3300022467 Ga0224712_10387380 Ga0224712_103873802 124
890 3300025321 Ga0207656_10288302 Ga0207656_102883022 124
891 3300025321 Ga0207656_10295101 Ga0207656_102951012 124
892 3300025885 Ga0207653_10176805 Ga0207653_101768051 124
893 3300025899 Ga0207642_10015682 Ga0207642_100156822 124
894 3300025899 Ga0207642_10225905 Ga0207642_102259052 124
895 3300025899 Ga0207642_10533274 Ga0207642_105332741 124
896 3300025901 Ga0207688_10038756 Ga0207688_100387562 124
897 3300025901 Ga0207688_10293760 Ga0207688_102937602 124
898 3300025901 Ga0207688_10660194 Ga0207688_106601941 124
899 3300025901 Ga0207688_10831990 Ga0207688_108319901 124
900 3300025903 Ga0207680_10505724 Ga0207680_105057242 124
901 3300025903 Ga0207680_10605706 Ga0207680_106057062 124
902 3300025903 Ga0207680_11085023 Ga0207680_110850231 124
903 3300025907 Ga0207645_10711025 Ga0207645_107110251 124
904 3300025908 Ga0207643_10110412 Ga0207643_101104122 124
905 3300025908 Ga0207643_10397516 Ga0207643_103975162 124
906 3300025908 Ga0207643_10755710 Ga0207643_107557102 124
907 3300025909 Ga0207705_10334258 Ga0207705_103342582 124
908 3300025909 Ga0207705_10541877 Ga0207705_105418772 124
909 3300025909 Ga0207705_11267426 Ga0207705_112674261 124
910 3300025914 Ga0207671_11342390 Ga0207671_113423902 124
911 3300025918 Ga0207662_10004071 Ga0207662_100040715 124
912 3300025918 Ga0207662_10080281 Ga0207662_100802813 124
913 3300025918 Ga0207662_10584744 Ga0207662_105847442 124
914 3300025919 Ga0207657_10068286 Ga0207657_100682862 124
915 3300025919 Ga0207657_10072323 Ga0207657_100723233 124
916 3300025919 Ga0207657_10874093 Ga0207657_108740932 124
917 3300025919 Ga0207657_10899764 Ga0207657_108997642 124
918 3300025920 Ga0207649_10506876 Ga0207649_105068762 124
919 3300025920 Ga0207649_10975119 Ga0207649_109751192 124
920 3300025921 Ga0207652_10264121 Ga0207652_102641212 124
921 3300025921 Ga0207652_11146213 Ga0207652_111462132 124
922 3300025922 Ga0207646_10047792 Ga0207646_100477924 124
923 3300025923 Ga0207681_10812607 Ga0207681_108126072 124
924 3300025924 Ga0207694_10388088 Ga0207694_103880882 124
925 3300025924 Ga0207694_10400123 Ga0207694_104001232 124
926 3300025924 Ga0207694_10607460 Ga0207694_106074602 124
927 3300025926 Ga0207659_10196601 Ga0207659_101966012 124
928 3300025926 Ga0207659_10527923 Ga0207659_105279232 124
929 3300025926 Ga0207659_10741311 Ga0207659_107413112 124
930 3300025927 Ga0207687_10238153 Ga0207687_102381532 124
931 3300025927 Ga0207687_10256176 Ga0207687_102561762 124
932 3300025927 Ga0207687_10566222 Ga0207687_105662222 124
933 3300025932 Ga0207690_10433539 Ga0207690_104335391 124
934 3300025932 Ga0207690_10891360 Ga0207690_108913602 124
935 3300025932 Ga0207690_11101087 Ga0207690_111010871 124
936 3300025933 Ga0207706_10147174 Ga0207706_101471742 124
937 3300025933 Ga0207706_10231488 Ga0207706_102314882 124
938 3300025933 Ga0207706_10321097 Ga0207706_103210972 124
939 3300025933 Ga0207706_10810395 Ga0207706_108103952 124
940 3300025934 Ga0207686_10142567 Ga0207686_101425672 124
941 3300025934 Ga0207686_10320912 Ga0207686_103209122 124
942 3300025935 Ga0207709_10139658 Ga0207709_101396582 124
943 3300025935 Ga0207709_10215475 Ga0207709_102154752 124
944 3300025935 Ga0207709_10622428 Ga0207709_106224282 124
945 3300025935 Ga0207709_10734135 Ga0207709_107341352 124
946 3300025935 Ga0207709_11275598 Ga0207709_112755982 124
947 3300025937 Ga0207669_10262636 Ga0207669_102626362 124
948 3300025938 Ga0207704_10146633 Ga0207704_101466332 124
949 3300025938 Ga0207704_10382564 Ga0207704_103825642 124
950 3300025938 Ga0207704_10438108 Ga0207704_104381082 124
951 3300025939 Ga0207665_10984033 Ga0207665_109840331 124
952 3300025940 Ga0207691_10035600 Ga0207691_100356004 124
953 3300025940 Ga0207691_10108944 Ga0207691_101089442 124
954 3300025940 Ga0207691_10528881 Ga0207691_105288812 124
955 3300025940 Ga0207691_11211932 Ga0207691_112119322 124
956 3300025941 Ga0207711_10328999 Ga0207711_103289992 124
957 3300025942 Ga0207689_10090886 Ga0207689_100908862 124
958 3300025942 Ga0207689_10327349 Ga0207689_103273491 124
959 3300025942 Ga0207689_11283108 Ga0207689_112831082 124
960 3300025944 Ga0207661_10063711 Ga0207661_100637111 124
961 3300025944 Ga0207661_10170037 Ga0207661_101700372 124
962 3300025944 Ga0207661_10241546 Ga0207661_102415462 124
963 3300025944 Ga0207661_10275785 Ga0207661_102757852 124
964 3300025944 Ga0207661_10528488 Ga0207661_105284882 124
965 3300025944 Ga0207661_10900515 Ga0207661_109005151 124
966 3300025944 Ga0207661_11063445 Ga0207661_110634451 124
967 3300025945 Ga0207679_11192301 Ga0207679_111923012 124
968 3300025945 Ga0207679_11667264 Ga0207679_116672641 124
969 3300025961 Ga0207712_10248937 Ga0207712_102489372 124
970 3300025961 Ga0207712_10370361 Ga0207712_103703612 124
971 3300025961 Ga0207712_11372288 Ga0207712_113722882 124
972 3300025972 Ga0207668_10164665 Ga0207668_101646652 124
973 3300025972 Ga0207668_10459650 Ga0207668_104596502 124
974 3300025972 Ga0207668_10486021 Ga0207668_104860212 124
975 3300025981 Ga0207640_10143236 Ga0207640_101432361 124
976 3300025981 Ga0207640_10581291 Ga0207640_105812912 124
977 3300025981 Ga0207640_11749122 Ga0207640_117491222 124
978 3300025986 Ga0207658_10351909 Ga0207658_103519092 124
979 3300026023 Ga0207677_10010008 Ga0207677_100100082 124
980 3300026023 Ga0207677_10820723 Ga0207677_108207232 124
981 3300026023 Ga0207677_10999851 Ga0207677_109998512 124
982 3300026023 Ga0207677_11074500 Ga0207677_110745002 124
983 3300026035 Ga0207703_10091509 Ga0207703_100915092 124
984 3300026035 Ga0207703_10986450 Ga0207703_109864502 124
985 3300026067 Ga0207678_10165252 Ga0207678_101652522 124
986 3300026067 Ga0207678_10299192 Ga0207678_102991922 124
987 3300026067 Ga0207678_10487972 Ga0207678_104879722 124
988 3300026067 Ga0207678_10552218 Ga0207678_105522182 124
989 3300026067 Ga0207678_10576551 Ga0207678_105765512 124
990 3300026075 Ga0207708_10026021 Ga0207708_100260213 124
991 3300026075 Ga0207708_10047555 Ga0207708_100475553 124
992 3300026075 Ga0207708_10159883 Ga0207708_101598832 124
993 3300026075 Ga0207708_10313482 Ga0207708_103134822 124
994 3300026078 Ga0207702_10181797 Ga0207702_101817972 124
995 3300026078 Ga0207702_10548081 Ga0207702_105480812 124
996 3300026078 Ga0207702_11280820 Ga0207702_112808201 124
997 3300026078 Ga0207702_11578128 Ga0207702_115781282 124
998 3300026088 Ga0207641_10416547 Ga0207641_104165471 124
999 3300026088 Ga0207641_11151007 Ga0207641_111510072 124
1000 3300026088 Ga0207641_12339609 Ga0207641_123396091 124
1001 3300026089 Ga0207648_10020448 Ga0207648_100204486 124
1002 3300026089 Ga0207648_10259037 Ga0207648_102590372 124
1003 3300026089 Ga0207648_10340198 Ga0207648_103401982 124
1004 3300026089 Ga0207648_10397376 Ga0207648_103973762 124
1005 3300026089 Ga0207648_10465993 Ga0207648_104659932 124
1006 3300026095 Ga0207676_10073788 Ga0207676_100737883 124
1007 3300026095 Ga0207676_10223280 Ga0207676_102232802 124
1008 3300026095 Ga0207676_10628477 Ga0207676_106284771 124
1009 3300026095 Ga0207676_12162678 Ga0207676_121626781 124
1010 3300026116 Ga0207674_10654578 Ga0207674_106545782 124
1011 3300026118 Ga0207675_100083363 Ga0207675_1000833635 124
1012 3300026118 Ga0207675_100103200 Ga0207675_1001032002 124
1013 3300026118 Ga0207675_100211620 Ga0207675_1002116202 124
1014 3300026118 Ga0207675_100647523 Ga0207675_1006475232 124
1015 3300026118 Ga0207675_100755732 Ga0207675_1007557322 124
1016 3300026121 Ga0207683_10168222 Ga0207683_101682222 124
1017 3300026121 Ga0207683_10387809 Ga0207683_103878092 124
1018 3300026121 Ga0207683_10693236 Ga0207683_106932362 124
1019 3300026121 Ga0207683_11261811 Ga0207683_112618112 124
1020 3300026142 Ga0207698_10292487 Ga0207698_102924872 124
1021 3300026142 Ga0207698_10343128 Ga0207698_103431282 124
1022 3300026142 Ga0207698_11023923 Ga0207698_110239232 124
1023 3300027907 Ga0207428_10092583 Ga0207428_100925833 124
1024 3300027907 Ga0207428_10167845 Ga0207428_101678452 124
1025 3300028379 Ga0268266_10010730 Ga0268266_100107303 124
1026 3300028379 Ga0268266_10153694 Ga0268266_101536942 124
1027 3300028380 Ga0268265_10910034 Ga0268265_109100342 124
1028 3300031548 Ga0307408_100811071 Ga0307408_1008110712 124
1029 3300031548 Ga0307408_101609561 Ga0307408_1016095612 124
1030 3300031548 Ga0307408_102054890 Ga0307408_1020548901 124
1031 3300031731 Ga0307405_10018026 Ga0307405_100180263 124
1032 3300031731 Ga0307405_10336492 Ga0307405_103364922 124
1033 3300031731 Ga0307405_10342682 Ga0307405_103426822 124
1034 3300031731 Ga0307405_10849563 Ga0307405_108495632 124
1035 3300031731 Ga0307405_11387473 Ga0307405_113874732 124
1036 3300031731 Ga0307405_11767680 Ga0307405_117676802 124
1037 3300031824 Ga0307413_10018352 Ga0307413_100183523 124
1038 3300031824 Ga0307413_11304186 Ga0307413_113041862 124
1039 3300031824 Ga0307413_11365063 Ga0307413_113650632 124
1040 3300031852 Ga0307410_10046627 Ga0307410_100466272 124
1041 3300031852 Ga0307410_10116404 Ga0307410_101164042 124
1042 3300031889 Ga0326468_10034483 Ga0326468_100344832 124
1043 3300031901 Ga0307406_10035677 Ga0307406_100356772 124
1044 3300031901 Ga0307406_10159165 Ga0307406_101591652 124
1045 3300031901 Ga0307406_10189737 Ga0307406_101897372 124
1046 3300031901 Ga0307406_10319922 Ga0307406_103199222 124
1047 3300031901 Ga0307406_10329679 Ga0307406_103296792 124
1048 3300031901 Ga0307406_10401120 Ga0307406_104011202 124
1049 3300031901 Ga0307406_10892028 Ga0307406_108920282 124
1050 3300031901 Ga0307406_11067631 Ga0307406_110676311 124
1051 3300031901 Ga0307406_11102232 Ga0307406_111022322 124
1052 3300031903 Ga0307407_10271145 Ga0307407_102711452 124
1053 3300031903 Ga0307407_10284081 Ga0307407_102840812 124
1054 3300031903 Ga0307407_10521809 Ga0307407_105218092 124
1055 3300031911 Ga0307412_10542026 Ga0307412_105420262 124
1056 3300031995 Ga0307409_100011619 Ga0307409_1000116194 124
1057 3300031995 Ga0307409_100166699 Ga0307409_1001666992 124
1058 3300031995 Ga0307409_100192922 Ga0307409_1001929222 124
1059 3300031995 Ga0307409_100419847 Ga0307409_1004198472 124
1060 3300031995 Ga0307409_100448575 Ga0307409_1004485752 124
1061 3300031995 Ga0307409_100653492 Ga0307409_1006534922 124
1062 3300031995 Ga0307409_101436061 Ga0307409_1014360612 124
1063 3300031995 Ga0307409_102123374 Ga0307409_1021233741 124
1064 3300031995 Ga0307409_102152164 Ga0307409_1021521641 124
1065 3300031995 Ga0307409_102220240 Ga0307409_1022202401 124
1066 3300031995 Ga0307409_102364805 Ga0307409_1023648052 124
1067 3300032002 Ga0307416_100035805 Ga0307416_1000358053 124
1068 3300032002 Ga0307416_100099435 Ga0307416_1000994352 124
1069 3300032002 Ga0307416_100105578 Ga0307416_1001055782 124
1070 3300032002 Ga0307416_100156388 Ga0307416_1001563882 124
1071 3300032002 Ga0307416_100313159 Ga0307416_1003131591 124
1072 3300032002 Ga0307416_100365485 Ga0307416_1003654852 124
1073 3300032002 Ga0307416_100507998 Ga0307416_1005079982 124
1074 3300032002 Ga0307416_100509756 Ga0307416_1005097562 124
1075 3300032002 Ga0307416_100567454 Ga0307416_1005674542 124
1076 3300032002 Ga0307416_101026980 Ga0307416_1010269802 124
1077 3300032002 Ga0307416_101495972 Ga0307416_1014959722 124
1078 3300032002 Ga0307416_101546498 Ga0307416_1015464982 124
1079 3300032004 Ga0307414_10226784 Ga0307414_102267842 124
1080 3300032004 Ga0307414_10553640 Ga0307414_105536401 124
1081 3300032004 Ga0307414_12286552 Ga0307414_122865522 124
1082 3300032005 Ga0307411_10227774 Ga0307411_102277742 124
1083 3300032005 Ga0307411_10368226 Ga0307411_103682262 124
1084 3300032005 Ga0307411_10538342 Ga0307411_105383422 124
1085 3300032005 Ga0307411_10801653 Ga0307411_108016532 124
1086 3300032005 Ga0307411_11859127 Ga0307411_118591271 124
1087 3300032126 Ga0307415_100000865 Ga0307415_1000008656 124
1088 3300032126 Ga0307415_100004934 Ga0307415_1000049345 124
1089 3300032126 Ga0307415_100025326 Ga0307415_1000253263 124
1090 3300032126 Ga0307415_100142877 Ga0307415_1001428772 124
1091 3300032126 Ga0307415_100529734 Ga0307415_1005297342 124
1092 3300032126 Ga0307415_100592120 Ga0307415_1005921202 124
1093 3300032126 Ga0307415_100606936 Ga0307415_1006069361 124
1094 3300032126 Ga0307415_101047529 Ga0307415_1010475291 124
1095 3300032126 Ga0307415_101370525 Ga0307415_1013705252 124
1096 3300032126 Ga0307415_101957909 Ga0307415_1019579092 124
1097 3300035691 Ga0373931_0112941 Ga0373931_0112941_1132_1506 124
1098 3300037312 Ga0395899_0372907 Ga0395899_0372907_283_657 124
1099 3300037312 Ga0395899_0470337 Ga0395899_0470337_102_476 124
1100 3300037418 Ga0395900_0146389 Ga0395900_0146389_2005_2379 124
1101 3300037418 Ga0395900_0798824 Ga0395900_0798824_163_537 124
1102 3300037466 Ga0395898_0027563 Ga0395898_0027563_2912_3286 124
1103 3300037466 Ga0395898_0252540 Ga0395898_0252540_1096_1470 124
1104 3300037466 Ga0395898_0334569 Ga0395898_0334569_80_454 124
1105 3300037466 Ga0395898_0344531 Ga0395898_0344531_660_1034 124
1106 3300037466 Ga0395898_1956885 Ga0395898_1956885_115_489 124
1107 3300038443 Ga0395901_0108199 Ga0395901_0108199_623_997 124
1108 3300038443 Ga0395901_0451672 Ga0395901_0451672_137_511 124
1109 3300038443 Ga0395901_0577520 Ga0395901_0577520_364_738 124
1110 3300038443 Ga0395901_0791584 Ga0395901_0791584_439_813 124
1111 3300038443 Ga0395901_0798282 Ga0395901_0798282_214_588 124
1112 3300038443 Ga0395901_0984411 Ga0395901_0984411_251_625 124
1113 3300038443 Ga0395901_1647596 Ga0395901_1647596_184_558 124
1114 3300041456 Ga0451795_1354184 Ga0451795_1354184_86_469 124
1115 3300041458 Ga0451798_1062351 Ga0451798_1062351_12_386 124
1116 3300041460 Ga0451802_1480357 Ga0451802_1480357_47_421 124
1117 3300041460 Ga0451802_2048603 Ga0451802_2048603_289_663 124
1118 3300041486 Ga0451807_0215562 Ga0451807_0215562_726_1100 124
1119 3300041511 Ga0451855_1871989 Ga0451855_1871989_160_537 124
1120 3300041512 Ga0451853_1979563 Ga0451853_1979563_49_423 124
1121 3300042008 Ga0439450_140605 Ga0439450_140605_221_595 124
1122 3300042012 Ga0439455_0048306 Ga0439455_0048306_306_680 124
1123 3300042142 Ga0450905_008526 Ga0450905_008526_862_1236 124
1124 3300042156 Ga0439446_0347990 Ga0439446_0347990_14_394 124
1125 3300042439 Ga0439464_0038745 Ga0439464_0038745_494_868 124
1126 3300042461 Ga0439460_0041852 Ga0439460_0041852_788_1162 124
1127 3300044658 Ga0466972_0382577 Ga0466972_0382577_49_423 124
1128 3300044683 Ga0466965_0762513 Ga0466965_0762513_78_452 124
1129 3300044684 Ga0466966_0306749 Ga0466966_0306749_197_571 124
1130 3300044693 Ga0466961_0282884 Ga0466961_0282884_116_493 124
1131 3300044693 Ga0466961_0553249 Ga0466961_0553249_206_580 124
1132 3300044693 Ga0466961_0815570 Ga0466961_0815570_86_460 124
1133 3300044693 Ga0466961_0958965 Ga0466961_0958965_68_442 124
1134 3300044694 Ga0466963_0167887 Ga0466963_0167887_354_728 124
1135 3300044694 Ga0466963_0196182 Ga0466963_0196182_955_1329 124
1136 3300044694 Ga0466963_0200599 Ga0466963_0200599_144_518 124
1137 3300044694 Ga0466963_0209014 Ga0466963_0209014_443_817 124
1138 3300044694 Ga0466963_0227978 Ga0466963_0227978_304_678 124
1139 3300044694 Ga0466963_0549954 Ga0466963_0549954_409_783 124
1140 3300044694 Ga0466963_0732948 Ga0466963_0732948_255_629 124
1141 3300044694 Ga0466963_0770926 Ga0466963_0770926_98_472 124
1142 3300044706 Ga0466964_0045960 Ga0466964_0045960_814_1188 124
1143 3300044706 Ga0466964_0309344 Ga0466964_0309344_366_740 124
1144 3300044706 Ga0466964_0369663 Ga0466964_0369663_183_557 124
1145 3300044706 Ga0466964_0703332 Ga0466964_0703332_93_467 124
1146 3300044719 Ga0466971_0038628 Ga0466971_0038628_52_426 124
1147 3300044765 Ga0466970_0152005 Ga0466970_0152005_82_456 124
1148 3300044765 Ga0466970_0462904 Ga0466970_0462904_153_527 124
1149 3300044842 Ga0466957_0083439 Ga0466957_0083439_443_817 124
1150 3300044842 Ga0466957_0166009 Ga0466957_0166009_705_1079 124
1151 3300044842 Ga0466957_0226180 Ga0466957_0226180_434_808 124
1152 3300044842 Ga0466957_0850641 Ga0466957_0850641_256_630 124
1153 3300044901 Ga0466960_0036714 Ga0466960_0036714_482_856 124
1154 3300044901 Ga0466960_0067023 Ga0466960_0067023_816_1193 124
1155 3300044901 Ga0466960_0249704 Ga0466960_0249704_121_495 124
1156 3300044901 Ga0466960_0311171 Ga0466960_0311171_443_817 124
1157 3300044901 Ga0466960_0313866 Ga0466960_0313866_411_785 124
1158 3300044901 Ga0466960_0619590 Ga0466960_0619590_161_535 124
1159 3300044901 Ga0466960_0738752 Ga0466960_0738752_194_577 124
1160 3300044901 Ga0466960_0965618 Ga0466960_0965618_66_440 124
1161 3300045049 Ga0466959_0853910 Ga0466959_0853910_165_539 124
1162 3300045049 Ga0466959_1035317 Ga0466959_1035317_154_528 124
1163 3300045976 Ga0466967_0019634 Ga0466967_0019634_3799_4173 124
1164 3300045976 Ga0466967_0021046 Ga0466967_0021046_3421_3795 124
1165 3300045976 Ga0466967_0026995 Ga0466967_0026995_2163_2537 124
1166 3300045976 Ga0466967_0026995 Ga0466967_0026995_679_1056 124
1167 3300045976 Ga0466967_0042010 Ga0466967_0042010_2327_2701 124
1168 3300045976 Ga0466967_0044758 Ga0466967_0044758_2967_3341 124
1169 3300045976 Ga0466967_0046581 Ga0466967_0046581_2063_2437 124
1170 3300045976 Ga0466967_0057076 Ga0466967_0057076_129_686 124
1171 3300045976 Ga0466967_0070203 Ga0466967_0070203_288_662 124
1172 3300045976 Ga0466967_0179334 Ga0466967_0179334_932_1306 124
1173 3300045976 Ga0466967_0765299 Ga0466967_0765299_445_819 124
1174 3300045976 Ga0466967_0908881 Ga0466967_0908881_475_849 124
1175 3300045976 Ga0466967_1077448 Ga0466967_1077448_145_519 124
1176 3300045976 Ga0466967_1274036 Ga0466967_1274036_39_419 124
1177 3300045976 Ga0466967_1597849 Ga0466967_1597849_155_529 124
1178 3300046455 Ga0495603_0209031 Ga0495603_0209031_359_733 124
1179 3300046471 Ga0495650_0314904 Ga0495650_0314904_133_507 124
1180 3300046491 Ga0495584_0241267 Ga0495584_0241267_433_810 124
1181 3300046515 Ga0495620_0085541 Ga0495620_0085541_135_509 124
1182 3300046515 Ga0495620_0182491 Ga0495620_0182491_232_606 124
1183 3300046515 Ga0495620_0235030 Ga0495620_0235030_14_388 124
1184 3300046518 Ga0495631_0288535 Ga0495631_0288535_51_425 124
1185 3300046523 Ga0495644_0212590 Ga0495644_0212590_168_542 124
1186 3300046525 Ga0495663_0340393 Ga0495663_0340393_108_482 124
1187 3300046537 Ga0495598_0303967 Ga0495598_0303967_98_472 124
1188 3300046538 Ga0495609_0146052 Ga0495609_0146052_328_705 124
1189 3300046615 Ga0495656_0545415 Ga0495656_0545415_169_543 124
1190 3300046648 Ga0495611_0469286 Ga0495611_0469286_63_437 124
1191 3300046665 Ga0495661_0373451 Ga0495661_0373451_23_397 124
1192 3300046691 Ga0495670_0759456 Ga0495670_0759456_98_472 124
1193 3300047319 Ga0495674_1347031 Ga0495674_1347031_93_467 124
1194 3300048090 Ga0495615_0069328 Ga0495615_0069328_97_471 124
1195 3300048903 Ga0496100_0847878 Ga0496100_0847878_58_432 124
1196 3300048903 Ga0496100_1111706 Ga0496100_1111706_23_406 124
1197 3300048904 Ga0496101_0167646 Ga0496101_0167646_826_1200 124
1198 3300048905 Ga0496102_0099537 Ga0496102_0099537_1037_1420 124
1199 3300048905 Ga0496102_0395831 Ga0496102_0395831_175_549 124
1200 3300048905 Ga0496102_0479754 Ga0496102_0479754_443_817 124
1201 3300048905 Ga0496102_0535571 Ga0496102_0535571_670_1044 124
1202 3300048906 Ga0496103_0408005 Ga0496103_0408005_348_722 124
1203 3300048907 Ga0496104_0026964 Ga0496104_0026964_2172_2546 124
1204 3300048907 Ga0496104_0609815 Ga0496104_0609815_452_826 124
1205 3300048908 Ga0496105_0307823 Ga0496105_0307823_679_1053 124
1206 3300048909 Ga0496106_0046043 Ga0496106_0046043_1707_2090 124
1207 3300048910 Ga0496107_0027679 Ga0496107_0027679_3393_3776 124
1208 3300048911 Ga0496108_0350524 Ga0496108_0350524_667_1041 124
1209 3300048911 Ga0496108_0413108 Ga0496108_0413108_234_608 124
1210 3300048911 Ga0496108_1007291 Ga0496108_1007291_218_592 124
1211 3300048912 Ga0496109_0048079 Ga0496109_0048079_3190_3573 124
1212 3300048912 Ga0496109_0170519 Ga0496109_0170519_1086_1460 124
1213 3300048912 Ga0496109_0196568 Ga0496109_0196568_1449_1823 124
1214 3300048912 Ga0496109_0310061 Ga0496109_0310061_147_524 124
1215 3300048912 Ga0496109_0559154 Ga0496109_0559154_203_577 124
1216 3300048912 Ga0496109_0847242 Ga0496109_0847242_185_559 124
1217 3300048912 Ga0496109_1121820 Ga0496109_1121820_218_592 124
1218 3300048912 Ga0496109_1127126 Ga0496109_1127126_198_572 124
1219 3300048912 Ga0496109_1325844 Ga0496109_1325844_37_417 124
1220 3300048912 Ga0496109_1874523 Ga0496109_1874523_100_474 124
1221 3300048913 Ga0496110_0469861 Ga0496110_0469861_495_869 124
1222 3300048913 Ga0496110_1028679 Ga0496110_1028679_302_676 124
1223 3300048914 Ga0496111_0098383 Ga0496111_0098383_1547_1921 124
1224 3300048914 Ga0496111_0236685 Ga0496111_0236685_211_585 124
1225 3300048914 Ga0496111_0549757 Ga0496111_0549757_217_591 124
1226 3300048914 Ga0496111_0561930 Ga0496111_0561930_36_410 124
1227 3300048914 Ga0496111_1160091 Ga0496111_1160091_133_507 124
1228 3300048915 Ga0496112_0049779 Ga0496112_0049779_3433_3807 124
1229 3300048915 Ga0496112_0162114 Ga0496112_0162114_1636_2010 124
1230 3300048915 Ga0496112_0180725 Ga0496112_0180725_366_740 124
1231 3300048915 Ga0496112_0810889 Ga0496112_0810889_387_761 124
1232 3300048915 Ga0496112_0878414 Ga0496112_0878414_400_774 124
1233 3300048916 Ga0496113_0030942 Ga0496113_0030942_434_808 124
1234 3300048917 Ga0496114_1099278 Ga0496114_1099278_173_547 124
1235 3300048918 Ga0496115_0537282 Ga0496115_0537282_105_479 124
1236 3300048924 Ga0496121_0568557 Ga0496121_0568557_81_455 124
1237 3300048929 Ga0496126_0277341 Ga0496126_0277341_501_875 124
1238 3300049162 Ga0501307_046780 Ga0501307_046780_19_393 124
1239 3300049162 Ga0501307_080858 Ga0501307_080858_13_396 124
1240 3300049527 Ga0501311_033778 Ga0501311_033778_97_471 124
1241 3300049529 Ga0501313_046863 Ga0501313_046863_123_497 124
1242 3300049531 Ga0501315_098163 Ga0501315_098163_25_408 124
1243 3300049532 Ga0501316_069163 Ga0501316_069163_33_407 124
1244 3300049534 Ga0501318_081787 Ga0501318_081787_48_431 124
1245 3300049568 Ga0501031_0052523 Ga0501031_0052523_1694_2068 124
1246 3300049568 Ga0501031_0089543 Ga0501031_0089543_915_1289 124
1247 3300049568 Ga0501031_0187601 Ga0501031_0187601_895_1269 124
1248 3300049568 Ga0501031_0568078 Ga0501031_0568078_59_433 124
1249 3300049569 Ga0501032_0159552 Ga0501032_0159552_588_962 124
1250 3300049570 Ga0501033_0068007 Ga0501033_0068007_871_1245 124
1251 3300049571 Ga0501034_0506872 Ga0501034_0506872_658_1035 124
1252 3300049571 Ga0501034_1000070 Ga0501034_1000070_136_510 124
1253 3300049572 Ga0501036_0403509 Ga0501036_0403509_169_543 124
1254 3300049572 Ga0501036_0431529 Ga0501036_0431529_699_1073 124
1255 3300049572 Ga0501036_1293002 Ga0501036_1293002_161_541 124
1256 3300049573 Ga0501037_0077455 Ga0501037_0077455_1376_1750 124
1257 3300049574 Ga0501038_0339634 Ga0501038_0339634_637_1011 124
1258 3300049575 Ga0501039_0250892 Ga0501039_0250892_874_1248 124
1259 3300049575 Ga0501039_0340549 Ga0501039_0340549_165_539 124
1260 3300049575 Ga0501039_1007940 Ga0501039_1007940_74_448 124
1261 3300049576 Ga0501040_0228764 Ga0501040_0228764_203_577 124
1262 3300049577 Ga0501041_0025816 Ga0501041_0025816_1875_2249 124
1263 3300049577 Ga0501041_0088015 Ga0501041_0088015_205_579 124
1264 3300049577 Ga0501041_0871000 Ga0501041_0871000_143_517 124
1265 3300049578 Ga0501042_0167085 Ga0501042_0167085_149_523 124
1266 3300049578 Ga0501042_0714829 Ga0501042_0714829_165_539 124
1267 3300049578 Ga0501042_1124776 Ga0501042_1124776_83_463 124
1268 3300049580 Ga0501046_0271438 Ga0501046_0271438_489_863 124
1269 3300049580 Ga0501046_0621397 Ga0501046_0621397_366_740 124
1270 3300049581 Ga0501047_0282837 Ga0501047_0282837_673_1053 124
1271 3300049582 Ga0501048_0053309 Ga0501048_0053309_713_1087 124
1272 3300049582 Ga0501048_0176655 Ga0501048_0176655_138_512 124
1273 3300049582 Ga0501048_0544335 Ga0501048_0544335_213_593 124
1274 3300049583 Ga0501067_0242589 Ga0501067_0242589_53_427 124
1275 3300049583 Ga0501067_0484993 Ga0501067_0484993_103_477 124
1276 3300049583 Ga0501067_0648475 Ga0501067_0648475_110_484 124
1277 3300049584 Ga0501068_0087549 Ga0501068_0087549_604_978 124
1278 3300049584 Ga0501068_0126074 Ga0501068_0126074_929_1303 124
1279 3300049584 Ga0501068_0926427 Ga0501068_0926427_180_554 124
1280 3300049585 Ga0501069_0135753 Ga0501069_0135753_573_947 124
1281 3300049586 Ga0501070_1471363 Ga0501070_1471363_73_447 124
1282 3300049587 Ga0501071_0019658 Ga0501071_0019658_3396_3770 124
1283 3300049587 Ga0501071_0070230 Ga0501071_0070230_1302_1676 124
1284 3300049587 Ga0501071_0150950 Ga0501071_0150950_636_1010 124
1285 3300049587 Ga0501071_0170845 Ga0501071_0170845_1226_1600 124
1286 3300049588 Ga0501072_0083622 Ga0501072_0083622_1283_1657 124
1287 3300049588 Ga0501072_0365175 Ga0501072_0365175_738_1112 124
1288 3300049590 Ga0501074_0736174 Ga0501074_0736174_124_498 124
1289 3300049591 Ga0501075_0087061 Ga0501075_0087061_1783_2157 124
1290 3300049591 Ga0501075_0340881 Ga0501075_0340881_11_385 124
1291 3300049591 Ga0501075_0647914 Ga0501075_0647914_122_496 124
1292 3300049591 Ga0501075_0708847 Ga0501075_0708847_169_543 124
1293 3300049592 Ga0501076_0004681 Ga0501076_0004681_6620_6994 124
1294 3300049592 Ga0501076_0193056 Ga0501076_0193056_781_1155 124
1295 3300049592 Ga0501076_0271945 Ga0501076_0271945_58_432 124
1296 3300049592 Ga0501076_0692352 Ga0501076_0692352_315_689 124
1297 3300049592 Ga0501076_1750121 Ga0501076_1750121_31_411 124
1298 3300049593 Ga0501077_0028590 Ga0501077_0028590_466_840 124
1299 3300049661 Ga0501217_167175 Ga0501217_167175_32_406 124
1300 3300049741 Ga0501079_0010735 Ga0501079_0010735_2868_3242 124
1301 3300049741 Ga0501079_0255842 Ga0501079_0255842_47_421 124
1302 3300049741 Ga0501079_0896309 Ga0501079_0896309_198_572 124
1303 3300049741 Ga0501079_1168121 Ga0501079_1168121_160_534 124
1304 3300049742 Ga0501080_1205307 Ga0501080_1205307_169_543 124
1305 3300049743 Ga0501081_0106967 Ga0501081_0106967_1031_1405 124
1306 3300049743 Ga0501081_1303894 Ga0501081_1303894_154_528 124
1307 3300049744 Ga0501083_0140140 Ga0501083_0140140_407_781 124
1308 3300049744 Ga0501083_0342006 Ga0501083_0342006_535_909 124
1309 3300049822 Ga0501035_0248237 Ga0501035_0248237_299_673 124
1310 3300049822 Ga0501035_0866745 Ga0501035_0866745_313_687 124
1311 3300049823 Ga0501044_0034000 Ga0501044_0034000_3075_3455 124
1312 3300049823 Ga0501044_0200904 Ga0501044_0200904_909_1283 124
1313 3300049823 Ga0501044_1213772 Ga0501044_1213772_104_478 124
1314 3300049824 Ga0501045_0077355 Ga0501045_0077355_845_1219 124
1315 3300050492 nmdc:mga0yw44_85061_c1 nmdc:mga0yw44_85061_c1_966_1340 124
1316 3300050507 nmdc:mga05p37_664561_c1 nmdc:mga05p37_664561_c1_702_1076 124
1317 3300050508 nmdc:mga09592_407107_c1 nmdc:mga09592_407107_c1_429_803 124
1318 3300050508 nmdc:mga09592_465223_c1 nmdc:mga09592_465223_c1_702_1079 124
1319 3300050509 nmdc:mga0qj67_481453_c1 nmdc:mga0qj67_481453_c1_47_421 124
1320 3300050511 nmdc:mga08y16_300162_c1 nmdc:mga08y16_300162_c1_409_783 124
1321 3300050511 nmdc:mga08y16_48142_c1 nmdc:mga08y16_48142_c1_241_615 124
1322 3300050511 nmdc:mga08y16_642472_c1 nmdc:mga08y16_642472_c1_252_626 124
1323 3300050511 nmdc:mga08y16_815240_c1 nmdc:mga08y16_815240_c1_358_732 124
1324 3300050511 nmdc:mga08y16_935983_c1 nmdc:mga08y16_935983_c1_70_453 124
1325 3300050512 nmdc:mga0n895_1203212_c1 nmdc:mga0n895_1203212_c1_204_578 124
1326 3300053083 Ga0495655_0026743 Ga0495655_0026743_959_1333 124
1327 3300053084 Ga0495595_0338074 Ga0495595_0338074_93_467 124
1328 3300054114 Ga0501084_0021713 Ga0501084_0021713_321_695 124
1329 3300054114 Ga0501084_0170638 Ga0501084_0170638_516_890 124
1330 3300054114 Ga0501084_0218917 Ga0501084_0218917_1171_1545 124
1331 3300054114 Ga0501084_0502899 Ga0501084_0502899_374_748 124
1332 3300059426 Ga0590077_123148 Ga0590077_123148_34_408 124
1333 3300059477 Ga0587084_036359 Ga0587084_036359_350_724 124
1334 3300059477 Ga0587084_129932 Ga0587084_129932_67_441 124
1335 3300059490 Ga0587066_133449 Ga0587066_133449_142_516 124
1336 3300059492 Ga0587073_0025765 Ga0587073_0025765_783_1157 124
1337 3300059492 Ga0587073_0031374 Ga0587073_0031374_101_475 124
1338 3300059492 Ga0587073_0034945 Ga0587073_0034945_53_427 124
1339 3300059492 Ga0587073_0118919 Ga0587073_0118919_143_517 124
1340 3300059492 Ga0587073_0186492 Ga0587073_0186492_144_518 124
1341 3300059492 Ga0587073_0334260 Ga0587073_0334260_16_393 124
1342 3300059503 Ga0587080_032831 Ga0587080_032831_14_388 124
1343 3300059503 Ga0587080_057973 Ga0587080_057973_181_555 124
1344 3300059503 Ga0587080_059085 Ga0587080_059085_14_388 124
1345 3300059503 Ga0587080_068107 Ga0587080_068107_10_384 124
1346 3300059503 Ga0587080_184689 Ga0587080_184689_52_426 124
1347 3300059504 Ga0587082_067717 Ga0587082_067717_67_441 124
1348 3300059505 Ga0587083_0038486 Ga0587083_0038486_90_464 124
1349 3300059505 Ga0587083_0129207 Ga0587083_0129207_209_607 124
1350 3300059505 Ga0587083_0184469 Ga0587083_0184469_189_563 124
1351 3300059506 Ga0587085_133056 Ga0587085_133056_128_502 124
1352 3300059507 Ga0587086_091467 Ga0587086_091467_128_502 124
1353 3300059508 Ga0587088_098217 Ga0587088_098217_267_641 124
1354 3300059508 Ga0587088_099851 Ga0587088_099851_260_634 124
1355 3300059508 Ga0587088_142665 Ga0587088_142665_80_457 124
1356 3300059510 Ga0587090_097579 Ga0587090_097579_217_591 124
1357 3300059511 Ga0587091_116723 Ga0587091_116723_100_474 124
1358 3300059511 Ga0587091_168429 Ga0587091_168429_147_521 124
1359 3300059514 Ga0587095_033587 Ga0587095_033587_135_509 124
1360 3300059604 Ga0587098_030352 Ga0587098_030352_22_399 124
1361 3300059604 Ga0587098_091523 Ga0587098_091523_98_472 124
1362 3300059605 Ga0587106_054870 Ga0587106_054870_97_471 124
1363 3300059605 Ga0587106_092308 Ga0587106_092308_202_576 124
1364 3300059622 Ga0587099_006092 Ga0587099_006092_87_461 124
1365 3300059622 Ga0587099_034613 Ga0587099_034613_196_570 124
1366 3300059622 Ga0587099_037402 Ga0587099_037402_145_519 124
1367 3300059622 Ga0587099_045635 Ga0587099_045635_70_444 124
1368 3300059624 Ga0587109_134757 Ga0587109_134757_201_575 124
1369 3300059626 Ga0587115_041770 Ga0587115_041770_252_626 124
1370 3300059627 Ga0587117_078442 Ga0587117_078442_25_399 124
1371 3300059628 Ga0587122_048884 Ga0587122_048884_150_524 124
1372 3300059640 Ga0587067_096945 Ga0587067_096945_252_626 124
1373 3300059640 Ga0587067_176929 Ga0587067_176929_89_463 124
1374 3300059642 Ga0587069_043120 Ga0587069_043120_35_409 124
1375 3300059643 Ga0587072_159572 Ga0587072_159572_53_427 124
1376 3300059644 Ga0587075_043973 Ga0587075_043973_67_441 124
1377 3300059644 Ga0587075_047571 Ga0587075_047571_88_462 124
1378 3300059644 Ga0587075_061634 Ga0587075_061634_48_422 124
1379 3300059647 Ga0587079_167659 Ga0587079_167659_23_400 124
1380 3300059650 Ga0587104_011119 Ga0587104_011119_270_644 124
1381 3300059651 Ga0587105_008909 Ga0587105_008909_33_407 124
1382 3300059652 Ga0587107_014226 Ga0587107_014226_433_807 124
1383 3300059658 Ga0587119_048763 Ga0587119_048763_19_396 124
1384 3300059659 Ga0587120_034204 Ga0587120_034204_18_392 124
1385 3300060344 Ga0587071_054132 Ga0587071_054132_453_827 124
1386 3300060344 Ga0587071_093702 Ga0587071_093702_202_576 124
1387 3300060344 Ga0587071_103449 Ga0587071_103449_24_398 124
1388 3300060344 Ga0587071_125746 Ga0587071_125746_109_483 124
1389 3300060346 Ga0587111_0259175 Ga0587111_0259175_13_387 124
1390 3300060353 Ga0501082_0054632 Ga0501082_0054632_3045_3419 124
1391 3300060353 Ga0501082_0088923 Ga0501082_0088923_114_488 124
1392 3300060353 Ga0501082_1092083 Ga0501082_1092083_148_522 124
1393 3300061719 Ga0466962_0021387 Ga0466962_0021387_616_990 124
1394 3300061719 Ga0466962_0166459 Ga0466962_0166459_19_393 124
1395 3300061734 Ga0530510_0022900 Ga0530510_0022900_3417_3791 124
1396 3300061734 Ga0530510_0114770 Ga0530510_0114770_294_668 124
1397 3300061734 Ga0530510_0674344 Ga0530510_0674344_169_543 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

14

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oe4-assembly1.cif.gz_A crystal structure of yeast aldh4a1 complexed with nad+ 0.7456 64 95
5af0-assembly2.cif.gz_B mael domain from bombyx mori maelstrom 0.7304 62 93
4qo6-assembly1.cif.gz_A structural studies of cdsd, a structural protein of the type iii secretion system (ttss) of chlamydia trachomatis 0.707 11 123
1hye-assembly1.cif.gz_A-2 crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure 0.6847 60 95
1hyg-assembly1.cif.gz_A crystal structure of mj0490 gene product, the family of lactate/malate dehydrogenase 0.6826 60 98
ID Description Score Start End Superfamily
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7255 58 95 3.40.190.10
1hygB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6824 60 98 3.40.50.720
af_A0A1D6IIN9_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6645 56 99 3.40.50.150
af_Q9ZWC5_41_445_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6597 57 99 3.40.50.150
af_Q9TYZ8_116_258_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6488 60 95 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A4U5LPJ2-F1-model_v4 Uncharacterized protein 0.7305 58 95
AF-A0A2H5DTJ9-F1-model_v4 Uncharacterized protein 0.6362 12 95
AF-A0A447X2B7-F1-model_v4 Nitrogen regulatory protein P-II 1 0.6285 12 84 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1H7X2X3-F1-model_v4 Nitrogen regulatory protein P-II 1/nitrogen regulatory protein P-II 2 0.6255 12 80 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A3D4Z4A8-F1-model_v4 P-II family nitrogen regulator 0.6195 12 87 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
74.64 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map