F493626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1395 | 576 | 1332 | 391 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501025504|2501407421 |
| Length | 356 |
| Sequence | LERAGVKPEQVSDVIMGQVLTAGSGQNAARQASIKAGLPTAVPAMTINKVCGSGLKAVMLAANAIIAGDSDIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLIDSMIVDGLWDVYNQYHMGVTAENVAREYGITREEQDAFAALSQNKAEAAQKAGRFDAEIVPVAIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFSKEGTVTAANASGINDGAAAVVVMSAKKAEALGLAPLARIKAYASGGVDPKVMGMGPVPASKRALERAGWSVNDLDLMEINEAFAAQALAVNKQMGWDTSKINVNGGAIAIGHPIGASGCRILVTLLHEMQRRDAKRGLASLCIGGGMGVALALERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 5 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 6 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 7 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 8 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 9 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 10 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 11 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 12 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 13 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 14 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 15 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 16 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 17 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 18 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 19 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 20 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 21 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 22 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 23 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 24 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 25 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 26 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 27 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 28 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 29 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 30 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 31 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 32 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 33 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 34 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 35 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 36 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 37 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 38 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 39 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 40 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 41 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 42 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 43 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 44 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 45 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 46 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 47 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 48 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 49 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 50 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 51 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 52 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 53 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 54 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 55 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 56 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 57 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 58 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 59 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 60 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 61 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 62 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 63 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 64 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 65 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 66 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 67 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 68 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 73 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 74 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 75 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 76 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 77 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 78 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 79 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 81 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 89 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 93 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 94 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 100 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 106 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 126 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 127 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 133 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 134 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 142 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 143 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 144 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 146 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 147 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 148 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 149 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 150 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 151 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 152 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 153 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 154 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 155 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 156 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 157 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 158 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 159 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 161 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 162 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 164 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 165 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 166 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 167 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 168 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 169 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 170 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 171 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 172 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 174 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 175 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 176 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 177 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 192 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 202 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 206 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 207 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 208 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 209 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 210 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 211 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 212 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 223 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 226 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 234 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 295 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 297 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 301 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 302 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 303 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 304 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 305 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 306 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 307 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 308 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 309 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 310 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 311 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 312 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 313 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 314 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 315 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 316 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 317 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 318 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 320 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 321 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 323 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 324 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 325 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 326 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 327 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 328 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 329 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 330 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 331 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 332 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 334 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 336 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 337 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 338 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 339 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 340 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 341 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 343 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 344 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 345 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 346 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 347 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 348 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 349 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 350 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 351 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 352 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 353 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 354 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 355 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 356 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 357 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 358 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 359 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 360 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 361 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 362 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 363 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 364 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 365 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 366 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 367 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 368 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 369 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 370 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 371 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 372 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 467 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 468 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 469 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 470 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 471 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 472 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 473 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 474 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 475 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 476 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 477 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 478 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 479 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 480 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 481 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 482 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 483 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 484 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 485 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 486 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 487 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 488 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 489 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 490 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 491 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 492 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 493 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 495 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 496 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 499 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 511 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 516 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 518 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 519 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 520 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 521 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 526 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 527 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 531 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 532 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 533 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 534 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 542 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 543 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 545 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 546 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 547 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 548 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 549 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 575 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 576 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.04 |
| Metatranscriptomes | 4.44 |
| Isolates | 4.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.88 |
| Nodule | 0.72 |
| Rhizoplane | 3.37 |
| Rhizosphere | 81.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000224 | 3300002704 | Bacteria | 22214 |
| 2 | JGI25156J39149_1000357 | 3300002705 | Bacteria | 29554 |
| 3 | JGI25156J39149_1004830 | 3300002705 | Bacteria | 4021 |
| 4 | JGI25154J39366_1000298 | 3300002738 | Bacteria | 29516 |
| 5 | JGI25154J39366_1000314 | 3300002738 | Bacteria | 28089 |
| 6 | JGI25154J39366_1001528 | 3300002738 | Bacteria | 8049 |
| 7 | JGI25157J39369_1000262 | 3300002741 | Bacteria | 38795 |
| 8 | JGI25152J39213_1001968 | 3300002773 | Bacteria | 8132 |
| 9 | JGI25150J39212_1004788 | 3300002774 | Bacteria | 2965 |
| 10 | JGI25159J45721_1001503 | 3300002987 | Bacteria | 9560 |
| 11 | JGI25159J45721_1001567 | 3300002987 | Bacteria | 9372 |
| 12 | JGI25159J45721_1001931 | 3300002987 | Bacteria | 8273 |
| 13 | Ga0006759J45824_1029604 | 3300003163 | Bacteria | 2456 |
| 14 | Ga0006759J45824_1036116 | 3300003163 | Bacteria | 2720 |
| 15 | Ga0006759J45824_1038593 | 3300003163 | Bacteria | 2093 |
| 16 | JGI25153J46596_10021355 | 3300003215 | Bacteria | 2415 |
| 17 | JGI25160J50197_1002629 | 3300003354 | Bacteria | 8274 |
| 18 | JGI25161J50226_1000851 | 3300003374 | Bacteria | 11351 |
| 19 | Ga0007417J51691_1019026 | 3300003544 | Bacteria | 3000 |
| 20 | Ga0007417J51691_1035094 | 3300003544 | Bacteria | 2190 |
| 21 | Ga0007410J51695_1004766 | 3300003574 | Bacteria | 2306 |
| 22 | Ga0007410J51695_1015802 | 3300003574 | Bacteria | 3127 |
| 23 | Ga0007410J51695_1016077 | 3300003574 | Bacteria | 2482 |
| 24 | Ga0007409J51694_1008022 | 3300003575 | Bacteria | 3060 |
| 25 | Ga0007416J51690_1008222 | 3300003577 | Bacteria | 2920 |
| 26 | Ga0007416J51690_1048588 | 3300003577 | Bacteria | 2167 |
| 27 | Ga0007411J51799_105301 | 3300003611 | Bacteria | 2495 |
| 28 | Ga0007411J51799_107039 | 3300003611 | Bacteria | 2590 |
| 29 | Ga0032354_1017755 | 3300003693 | Bacteria | 3192 |
| 30 | Ga0055538_1000110 | 3300003751 | Bacteria | 64583 |
| 31 | Ga0055539_1000159 | 3300003752 | Bacteria | 64583 |
| 32 | Ga0055533_1000161 | 3300003756 | Bacteria | 64583 |
| 33 | Ga0055532_1000059 | 3300003758 | Bacteria | 152948 |
| 34 | Ga0055525_1000023 | 3300003759 | Bacteria | 359920 |
| 35 | Ga0055525_1000214 | 3300003759 | Bacteria | 64583 |
| 36 | Ga0055535_1003465 | 3300003761 | Bacteria | 4456 |
| 37 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 38 | Ga0055526_1000127 | 3300003771 | Bacteria | 67487 |
| 39 | Ga0055526_1000236 | 3300003771 | Bacteria | 46607 |
| 40 | Ga0055526_1000251 | 3300003771 | Bacteria | 45724 |
| 41 | Ga0055526_1002785 | 3300003771 | Bacteria | 11581 |
| 42 | Ga0055526_1007677 | 3300003771 | Bacteria | 5549 |
| 43 | Ga0055526_1013753 | 3300003771 | Bacteria | 3393 |
| 44 | Ga0055537_1000121 | 3300003773 | Bacteria | 59656 |
| 45 | Ga0055524_1000017 | 3300003775 | Bacteria | 235608 |
| 46 | Ga0055524_1003529 | 3300003775 | Bacteria | 7560 |
| 47 | Ga0055524_1005101 | 3300003775 | Bacteria | 5937 |
| 48 | Ga0055524_1009191 | 3300003775 | Bacteria | 4042 |
| 49 | Ga0055534_1000033 | 3300003784 | Bacteria | 116700 |
| 50 | Ga0055534_1011135 | 3300003784 | Bacteria | 1844 |
| 51 | Ga0055528_1000020 | 3300003790 | Bacteria | 144617 |
| 52 | Ga0055528_1004648 | 3300003790 | Bacteria | 6567 |
| 53 | Ga0055530_10011502 | 3300003791 | Bacteria | 3173 |
| 54 | Ga0055531_10005155 | 3300003794 | Bacteria | 7705 |
| 55 | Ga0055541_1000105 | 3300003841 | Bacteria | 64583 |
| 56 | Ga0055543_1001887 | 3300004625 | Bacteria | 7614 |
| 57 | Ga0055543_1005974 | 3300004625 | Bacteria | 3022 |
| 58 | Ga0065165_1000045 | 3300005262 | Bacteria | 198887 |
| 59 | Ga0065165_1000305 | 3300005262 | Bacteria | 81255 |
| 60 | Ga0065165_1005109 | 3300005262 | Bacteria | 7614 |
| 61 | Ga0065165_1006783 | 3300005262 | Bacteria | 5853 |
| 62 | Ga0070676_10047019 | 3300005328 | Bacteria | 2518 |
| 63 | Ga0070670_100016728 | 3300005331 | Bacteria | 6295 |
| 64 | Ga0070670_100150404 | 3300005331 | Bacteria | 2015 |
| 65 | Ga0068869_100001616 | 3300005334 | Bacteria | 13395 |
| 66 | Ga0068869_100071471 | 3300005334 | Bacteria | 2569 |
| 67 | Ga0070666_10006248 | 3300005335 | Bacteria | 7330 |
| 68 | Ga0070680_100024156 | 3300005336 | Bacteria | 4851 |
| 69 | Ga0070680_100033182 | 3300005336 | Bacteria | 4160 |
| 70 | Ga0070680_100153535 | 3300005336 | Bacteria | 1934 |
| 71 | Ga0070682_100064222 | 3300005337 | Bacteria | 2330 |
| 72 | Ga0068868_100000209 | 3300005338 | Bacteria | 39624 |
| 73 | Ga0068868_100009979 | 3300005338 | Bacteria | 6860 |
| 74 | Ga0068868_100016011 | 3300005338 | Bacteria | 5560 |
| 75 | Ga0070660_100004370 | 3300005339 | Bacteria | 9759 |
| 76 | Ga0070660_100087616 | 3300005339 | Bacteria | 2450 |
| 77 | Ga0070689_100003869 | 3300005340 | Bacteria | 10035 |
| 78 | Ga0070691_10001291 | 3300005341 | Bacteria | 10621 |
| 79 | Ga0070687_100000190 | 3300005343 | Bacteria | 21399 |
| 80 | Ga0070661_100031382 | 3300005344 | Bacteria | 3842 |
| 81 | Ga0070661_100126000 | 3300005344 | Bacteria | 1921 |
| 82 | Ga0070692_10047798 | 3300005345 | Bacteria | 2215 |
| 83 | Ga0070668_100039237 | 3300005347 | Bacteria | 3622 |
| 84 | Ga0070669_100003300 | 3300005353 | Bacteria | 11600 |
| 85 | Ga0070675_100131700 | 3300005354 | Bacteria | 2132 |
| 86 | Ga0070671_100006266 | 3300005355 | Bacteria | 9480 |
| 87 | Ga0070671_100025746 | 3300005355 | Bacteria | 4830 |
| 88 | Ga0070674_100089309 | 3300005356 | Bacteria | 2220 |
| 89 | Ga0070659_100010488 | 3300005366 | Bacteria | 6818 |
| 90 | Ga0070667_100001572 | 3300005367 | Bacteria | 20458 |
| 91 | Ga0070667_100003611 | 3300005367 | Bacteria | 13159 |
| 92 | Ga0070667_100195824 | 3300005367 | Bacteria | 1791 |
| 93 | Ga0070667_100204380 | 3300005367 | Bacteria | 1753 |
| 94 | Ga0070667_100334754 | 3300005367 | Bacteria | 1368 |
| 95 | Ga0070703_10010227 | 3300005406 | Bacteria | 2645 |
| 96 | Ga0070713_100023776 | 3300005436 | Bacteria | 4762 |
| 97 | Ga0070701_10006881 | 3300005438 | Bacteria | 4812 |
| 98 | Ga0070711_100052190 | 3300005439 | Bacteria | 2813 |
| 99 | Ga0070711_100294368 | 3300005439 | Bacteria | 1288 |
| 100 | Ga0070705_100000320 | 3300005440 | Bacteria | 28430 |
| 101 | Ga0070705_100006868 | 3300005440 | Bacteria | 5592 |
| 102 | Ga0070700_100000571 | 3300005441 | Bacteria | 18444 |
| 103 | Ga0070700_100000733 | 3300005441 | Bacteria | 16216 |
| 104 | Ga0070694_100000802 | 3300005444 | Bacteria | 17651 |
| 105 | Ga0070694_100009200 | 3300005444 | Bacteria | 6059 |
| 106 | Ga0070662_100074596 | 3300005457 | Bacteria | 2510 |
| 107 | Ga0070681_10000172 | 3300005458 | Bacteria | 49288 |
| 108 | Ga0068867_100000417 | 3300005459 | Bacteria | 28383 |
| 109 | Ga0068867_100003986 | 3300005459 | Bacteria | 10387 |
| 110 | Ga0070706_100020063 | 3300005467 | Bacteria | 6159 |
| 111 | Ga0070707_100150780 | 3300005468 | Bacteria | 2264 |
| 112 | Ga0070698_100084098 | 3300005471 | Bacteria | 3171 |
| 113 | Ga0070679_100071859 | 3300005530 | Bacteria | 3452 |
| 114 | Ga0070697_100001858 | 3300005536 | Bacteria | 16143 |
| 115 | Ga0070697_100003503 | 3300005536 | Bacteria | 12063 |
| 116 | Ga0070697_100004877 | 3300005536 | Bacteria | 10295 |
| 117 | Ga0068853_100090661 | 3300005539 | Bacteria | 2687 |
| 118 | Ga0070686_100000825 | 3300005544 | Bacteria | 17899 |
| 119 | Ga0070686_100062733 | 3300005544 | Bacteria | 2405 |
| 120 | Ga0070686_100111726 | 3300005544 | Bacteria | 1863 |
| 121 | Ga0070695_100000457 | 3300005545 | Bacteria | 21293 |
| 122 | Ga0070695_100011568 | 3300005545 | Bacteria | 5279 |
| 123 | Ga0070695_100069360 | 3300005545 | Bacteria | 2304 |
| 124 | Ga0070695_100140999 | 3300005545 | Bacteria | 1671 |
| 125 | Ga0070696_100002371 | 3300005546 | Bacteria | 12455 |
| 126 | Ga0070696_100004412 | 3300005546 | Bacteria | 9390 |
| 127 | Ga0070693_100001007 | 3300005547 | Bacteria | 12571 |
| 128 | Ga0070665_100071194 | 3300005548 | Bacteria | 3483 |
| 129 | Ga0070665_100449185 | 3300005548 | Bacteria | 1298 |
| 130 | Ga0070704_100003235 | 3300005549 | Bacteria | 9308 |
| 131 | Ga0070704_100007685 | 3300005549 | Bacteria | 6425 |
| 132 | Ga0070704_100009798 | 3300005549 | Bacteria | 5810 |
| 133 | Ga0070704_100044748 | 3300005549 | Bacteria | 3078 |
| 134 | Ga0070704_100046564 | 3300005549 | Bacteria | 3025 |
| 135 | Ga0070704_100133499 | 3300005549 | Bacteria | 1928 |
| 136 | Ga0068855_100003929 | 3300005563 | Bacteria | 18142 |
| 137 | Ga0068855_100009634 | 3300005563 | Bacteria | 11654 |
| 138 | Ga0068855_100027136 | 3300005563 | Bacteria | 6852 |
| 139 | Ga0068855_100045440 | 3300005563 | Bacteria | 5195 |
| 140 | Ga0068855_100100599 | 3300005563 | Bacteria | 3328 |
| 141 | Ga0070664_100052929 | 3300005564 | Bacteria | 3440 |
| 142 | Ga0068857_100018579 | 3300005577 | Bacteria | 6099 |
| 143 | Ga0068857_100047853 | 3300005577 | Bacteria | 3797 |
| 144 | Ga0068854_100002076 | 3300005578 | Bacteria | 12287 |
| 145 | Ga0068854_100209262 | 3300005578 | Bacteria | 1538 |
| 146 | Ga0068856_100003781 | 3300005614 | Bacteria | 15160 |
| 147 | Ga0068856_100031110 | 3300005614 | Bacteria | 5220 |
| 148 | Ga0068856_100112324 | 3300005614 | Bacteria | 2722 |
| 149 | Ga0070702_100000050 | 3300005615 | Bacteria | 32860 |
| 150 | Ga0068852_100027471 | 3300005616 | Bacteria | 4639 |
| 151 | Ga0068859_100000253 | 3300005617 | Bacteria | 53069 |
| 152 | Ga0068859_100000332 | 3300005617 | Bacteria | 47130 |
| 153 | Ga0068859_100017454 | 3300005617 | Bacteria | 7214 |
| 154 | Ga0068859_100050419 | 3300005617 | Bacteria | 4181 |
| 155 | Ga0068859_100087857 | 3300005617 | Bacteria | 3157 |
| 156 | Ga0068864_100004666 | 3300005618 | Bacteria | 11241 |
| 157 | Ga0068864_100102475 | 3300005618 | Bacteria | 2540 |
| 158 | Ga0068864_100302832 | 3300005618 | Bacteria | 1497 |
| 159 | Ga0068866_10000489 | 3300005718 | Bacteria | 18218 |
| 160 | Ga0068861_100004686 | 3300005719 | Bacteria | 9191 |
| 161 | Ga0068861_100119551 | 3300005719 | Bacteria | 2123 |
| 162 | Ga0068870_10051688 | 3300005840 | Bacteria | 2177 |
| 163 | Ga0068863_100000653 | 3300005841 | Bacteria | 35171 |
| 164 | Ga0068863_100010939 | 3300005841 | Bacteria | 8798 |
| 165 | Ga0068863_100038955 | 3300005841 | Bacteria | 4523 |
| 166 | Ga0068858_100000503 | 3300005842 | Bacteria | 40960 |
| 167 | Ga0068858_100025338 | 3300005842 | Bacteria | 5520 |
| 168 | Ga0068858_100104904 | 3300005842 | Bacteria | 2637 |
| 169 | Ga0068858_100107126 | 3300005842 | Bacteria | 2609 |
| 170 | Ga0068860_100001764 | 3300005843 | Bacteria | 23090 |
| 171 | Ga0068860_100011672 | 3300005843 | Bacteria | 8661 |
| 172 | Ga0068860_100022107 | 3300005843 | Bacteria | 6157 |
| 173 | Ga0068862_100007673 | 3300005844 | Bacteria | 8928 |
| 174 | Ga0068862_100098252 | 3300005844 | Bacteria | 2557 |
| 175 | Ga0081539_10003343 | 3300005985 | Bacteria | 19933 |
| 176 | Ga0075365_10045830 | 3300006038 | Bacteria | 2870 |
| 177 | Ga0075368_10039788 | 3300006042 | Bacteria | 1844 |
| 178 | Ga0075363_100011589 | 3300006048 | Bacteria | 4227 |
| 179 | Ga0070715_10041543 | 3300006163 | Bacteria | 1928 |
| 180 | Ga0075367_10012620 | 3300006178 | Bacteria | 4514 |
| 181 | Ga0075366_10075245 | 3300006195 | Bacteria | 2014 |
| 182 | Ga0097621_100000676 | 3300006237 | Bacteria | 23878 |
| 183 | Ga0097621_100065842 | 3300006237 | Bacteria | 2983 |
| 184 | Ga0068871_100002899 | 3300006358 | Bacteria | 11767 |
| 185 | Ga0068871_100030677 | 3300006358 | Bacteria | 4236 |
| 186 | Ga0075428_100007878 | 3300006844 | Bacteria | 11812 |
| 187 | Ga0075428_100020382 | 3300006844 | Bacteria | 7342 |
| 188 | Ga0075430_100009032 | 3300006846 | Bacteria | 8424 |
| 189 | Ga0075430_100010298 | 3300006846 | Bacteria | 7916 |
| 190 | Ga0075431_100017867 | 3300006847 | Bacteria | 7212 |
| 191 | Ga0075431_100029271 | 3300006847 | Bacteria | 5667 |
| 192 | Ga0075431_100248848 | 3300006847 | Bacteria | 1806 |
| 193 | Ga0075433_10001341 | 3300006852 | Bacteria | 18019 |
| 194 | Ga0075433_10118571 | 3300006852 | Bacteria | 2349 |
| 195 | Ga0075434_100000211 | 3300006871 | Bacteria | 39638 |
| 196 | Ga0075434_100001149 | 3300006871 | Bacteria | 21878 |
| 197 | Ga0075429_100000183 | 3300006880 | Bacteria | 40888 |
| 198 | Ga0075429_100001213 | 3300006880 | Bacteria | 20918 |
| 199 | Ga0068865_100005124 | 3300006881 | Bacteria | 7932 |
| 200 | Ga0068865_100027969 | 3300006881 | Bacteria | 3730 |
| 201 | Ga0068865_100060907 | 3300006881 | Bacteria | 2644 |
| 202 | Ga0068865_100249009 | 3300006881 | Bacteria | 1402 |
| 203 | Ga0075436_100002524 | 3300006914 | Bacteria | 12594 |
| 204 | Ga0075436_100002652 | 3300006914 | Bacteria | 12295 |
| 205 | Ga0075436_100019225 | 3300006914 | Bacteria | 4680 |
| 206 | Ga0075436_100025991 | 3300006914 | Bacteria | 4031 |
| 207 | Ga0075436_100067335 | 3300006914 | Bacteria | 2475 |
| 208 | Ga0097620_100000253 | 3300006931 | Bacteria | 53069 |
| 209 | Ga0097620_100000332 | 3300006931 | Bacteria | 47130 |
| 210 | Ga0097620_100017455 | 3300006931 | Bacteria | 7214 |
| 211 | Ga0097620_100050420 | 3300006931 | Bacteria | 4181 |
| 212 | Ga0097620_100087858 | 3300006931 | Bacteria | 3157 |
| 213 | Ga0079104_1006363 | 3300006946 | Bacteria | 4490 |
| 214 | Ga0099826_10000008 | 3300006948 | Bacteria | 380974 |
| 215 | Ga0075435_100000938 | 3300007076 | Bacteria | 18379 |
| 216 | Ga0075435_100002363 | 3300007076 | Bacteria | 12510 |
| 217 | Ga0075435_100006459 | 3300007076 | Bacteria | 8292 |
| 218 | Ga0075435_100064346 | 3300007076 | Bacteria | 2980 |
| 219 | Ga0075435_100094099 | 3300007076 | Bacteria | 2476 |
| 220 | Ga0099795_10000045 | 3300007788 | Bacteria | 27712 |
| 221 | Ga0105251_10016033 | 3300009011 | Bacteria | 4067 |
| 222 | Ga0105244_10000791 | 3300009036 | Bacteria | 26909 |
| 223 | Ga0105244_10003927 | 3300009036 | Bacteria | 10446 |
| 224 | Ga0105244_10033860 | 3300009036 | Bacteria | 2692 |
| 225 | Ga0105244_10062285 | 3300009036 | Bacteria | 1875 |
| 226 | Ga0105240_10000787 | 3300009093 | Bacteria | 57466 |
| 227 | Ga0105240_10013732 | 3300009093 | Bacteria | 11101 |
| 228 | Ga0105240_10082386 | 3300009093 | Bacteria | 3951 |
| 229 | Ga0111539_10079922 | 3300009094 | Bacteria | 3847 |
| 230 | Ga0111539_10153767 | 3300009094 | Bacteria | 2692 |
| 231 | Ga0105245_10000115 | 3300009098 | Bacteria | 77632 |
| 232 | Ga0105245_10008434 | 3300009098 | Bacteria | 8999 |
| 233 | Ga0105245_10057074 | 3300009098 | Bacteria | 3511 |
| 234 | Ga0105247_10000643 | 3300009101 | Bacteria | 27978 |
| 235 | Ga0105247_10009912 | 3300009101 | Bacteria | 5771 |
| 236 | Ga0114129_10001051 | 3300009147 | Bacteria | 36178 |
| 237 | Ga0114129_10051993 | 3300009147 | Bacteria | 5751 |
| 238 | Ga0114129_10223526 | 3300009147 | Bacteria | 2539 |
| 239 | Ga0114129_10339915 | 3300009147 | Bacteria | 1991 |
| 240 | Ga0105243_10001566 | 3300009148 | Bacteria | 19983 |
| 241 | Ga0105243_10014419 | 3300009148 | Bacteria | 5983 |
| 242 | Ga0105241_10031834 | 3300009174 | Bacteria | 3950 |
| 243 | Ga0105241_10055916 | 3300009174 | Bacteria | 3024 |
| 244 | Ga0105242_10005505 | 3300009176 | Bacteria | 9776 |
| 245 | Ga0105242_10028849 | 3300009176 | Bacteria | 4420 |
| 246 | Ga0105242_10209075 | 3300009176 | Bacteria | 1738 |
| 247 | Ga0105242_10312153 | 3300009176 | Bacteria | 1439 |
| 248 | Ga0105248_10019135 | 3300009177 | Bacteria | 7574 |
| 249 | Ga0105248_10222492 | 3300009177 | Bacteria | 2125 |
| 250 | Ga0105237_10017152 | 3300009545 | Bacteria | 7511 |
| 251 | Ga0105237_10048963 | 3300009545 | Bacteria | 4248 |
| 252 | Ga0105238_10000537 | 3300009551 | Bacteria | 39712 |
| 253 | Ga0105249_10001691 | 3300009553 | Bacteria | 19321 |
| 254 | Ga0105249_10001995 | 3300009553 | Bacteria | 17726 |
| 255 | Ga0105249_10083668 | 3300009553 | Bacteria | 2970 |
| 256 | Ga0105249_10194629 | 3300009553 | Bacteria | 1981 |
| 257 | Ga0099796_10000053 | 3300010159 | Bacteria | 20931 |
| 258 | Ga0105239_10019688 | 3300010375 | Bacteria | 7449 |
| 259 | Ga0105239_10103578 | 3300010375 | Bacteria | 3150 |
| 260 | Ga0105239_10118690 | 3300010375 | Bacteria | 2935 |
| 261 | Ga0157373_10086080 | 3300013100 | Bacteria | 2215 |
| 262 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 263 | Ga0157374_10000173 | 3300013296 | Bacteria | 59752 |
| 264 | Ga0157374_10118484 | 3300013296 | Bacteria | 2553 |
| 265 | Ga0157374_10131187 | 3300013296 | Bacteria | 2425 |
| 266 | Ga0157378_10001030 | 3300013297 | Bacteria | 25495 |
| 267 | Ga0157378_10013562 | 3300013297 | Bacteria | 7130 |
| 268 | Ga0163162_10046451 | 3300013306 | Bacteria | 4353 |
| 269 | Ga0163162_10351100 | 3300013306 | Bacteria | 1608 |
| 270 | Ga0163162_10415320 | 3300013306 | Bacteria | 1478 |
| 271 | Ga0157372_10508074 | 3300013307 | Bacteria | 1405 |
| 272 | Ga0163163_10001456 | 3300014325 | Bacteria | 20014 |
| 273 | Ga0157380_10159145 | 3300014326 | Bacteria | 1961 |
| 274 | Ga0182008_10015273 | 3300014497 | Bacteria | 4009 |
| 275 | Ga0157377_10057202 | 3300014745 | Bacteria | 2217 |
| 276 | Ga0157379_10004821 | 3300014968 | Bacteria | 11592 |
| 277 | Ga0157379_10010074 | 3300014968 | Bacteria | 8239 |
| 278 | Ga0157376_10002960 | 3300014969 | Bacteria | 11654 |
| 279 | Ga0157376_10013177 | 3300014969 | Bacteria | 6160 |
| 280 | Ga0157376_10029396 | 3300014969 | Bacteria | 4377 |
| 281 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 282 | Ga0182006_1000059 | 3300015261 | Bacteria | 164868 |
| 283 | Ga0182006_1034133 | 3300015261 | Bacteria | 2037 |
| 284 | Ga0182007_10000068 | 3300015262 | Bacteria | 82301 |
| 285 | Ga0182007_10026974 | 3300015262 | Bacteria | 1985 |
| 286 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 287 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 288 | Ga0206351_10268376 | 3300020077 | Bacteria | 1620 |
| 289 | Ga0213872_10001492 | 3300021361 | Bacteria | 15102 |
| 290 | Ga0213872_10002646 | 3300021361 | Bacteria | 10393 |
| 291 | Ga0213872_10003230 | 3300021361 | Bacteria | 9105 |
| 292 | Ga0224712_10018126 | 3300022467 | Bacteria | 2347 |
| 293 | Ga0209435_100032 | 3300025206 | Bacteria | 153068 |
| 294 | Ga0209435_100146 | 3300025206 | Bacteria | 23627 |
| 295 | Ga0209436_100314 | 3300025208 | Bacteria | 22212 |
| 296 | Ga0209436_101267 | 3300025208 | Bacteria | 9072 |
| 297 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 298 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 299 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 300 | Ga0209147_100109 | 3300025229 | Bacteria | 153068 |
| 301 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 302 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 303 | Ga0209437_100512 | 3300025233 | Bacteria | 27460 |
| 304 | Ga0209258_100190 | 3300025242 | Bacteria | 126878 |
| 305 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 306 | Ga0207425_1000325 | 3300025245 | Bacteria | 34014 |
| 307 | Ga0207425_1001909 | 3300025245 | Bacteria | 7908 |
| 308 | Ga0209646_1000042 | 3300025246 | Bacteria | 343923 |
| 309 | Ga0209646_1000113 | 3300025246 | Bacteria | 153068 |
| 310 | Ga0209646_1000950 | 3300025246 | Bacteria | 9086 |
| 311 | Ga0209026_1000102 | 3300025250 | Bacteria | 153068 |
| 312 | Ga0209026_1001388 | 3300025250 | Bacteria | 10789 |
| 313 | Ga0209026_1002229 | 3300025250 | Bacteria | 7463 |
| 314 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 315 | Ga0209677_100944 | 3300025253 | Bacteria | 14198 |
| 316 | Ga0209148_1000199 | 3300025254 | Bacteria | 108936 |
| 317 | Ga0209759_1000104 | 3300025256 | Bacteria | 153068 |
| 318 | Ga0209759_1000944 | 3300025256 | Bacteria | 20864 |
| 319 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 320 | Ga0209565_1000032 | 3300025263 | Bacteria | 316777 |
| 321 | Ga0209565_1000508 | 3300025263 | Bacteria | 28236 |
| 322 | Ga0209565_1002887 | 3300025263 | Bacteria | 5891 |
| 323 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 324 | Ga0209455_1005995 | 3300025272 | Bacteria | 3657 |
| 325 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 326 | Ga0209130_1000043 | 3300025284 | Bacteria | 254257 |
| 327 | Ga0209130_1001889 | 3300025284 | Bacteria | 11871 |
| 328 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 329 | Ga0209675_1007208 | 3300025291 | Bacteria | 4306 |
| 330 | Ga0209025_1000044 | 3300025294 | Bacteria | 349480 |
| 331 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 332 | Ga0209564_1000067 | 3300025295 | Bacteria | 311242 |
| 333 | Ga0209564_1000115 | 3300025295 | Bacteria | 208988 |
| 334 | Ga0209564_1000173 | 3300025295 | Bacteria | 154202 |
| 335 | Ga0209564_1002315 | 3300025295 | Bacteria | 15453 |
| 336 | Ga0209564_1005639 | 3300025295 | Bacteria | 7036 |
| 337 | Ga0209758_1000579 | 3300025297 | Bacteria | 57238 |
| 338 | Ga0209758_1001522 | 3300025297 | Bacteria | 26846 |
| 339 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 340 | Ga0209050_1000123 | 3300025298 | Bacteria | 195061 |
| 341 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 342 | Ga0209256_1000058 | 3300025299 | Bacteria | 272934 |
| 343 | Ga0209256_1000142 | 3300025299 | Bacteria | 152245 |
| 344 | Ga0209256_1001305 | 3300025299 | Bacteria | 26827 |
| 345 | Ga0207426_1001242 | 3300025302 | Bacteria | 22421 |
| 346 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 347 | Ga0207655_1002048 | 3300025728 | Bacteria | 17014 |
| 348 | Ga0207655_1003905 | 3300025728 | Bacteria | 10822 |
| 349 | Ga0207655_1046281 | 3300025728 | Bacteria | 1808 |
| 350 | Ga0207653_10017786 | 3300025885 | Bacteria | 2238 |
| 351 | Ga0207710_10000961 | 3300025900 | Bacteria | 15182 |
| 352 | Ga0207680_10017527 | 3300025903 | Bacteria | 3786 |
| 353 | Ga0207645_10007199 | 3300025907 | Bacteria | 7885 |
| 354 | Ga0207684_10029150 | 3300025910 | Bacteria | 4701 |
| 355 | Ga0207654_10009008 | 3300025911 | Bacteria | 5065 |
| 356 | Ga0207654_10011031 | 3300025911 | Bacteria | 4599 |
| 357 | Ga0207707_10003624 | 3300025912 | Bacteria | 13691 |
| 358 | Ga0207695_10001940 | 3300025913 | Bacteria | 32143 |
| 359 | Ga0207695_10003997 | 3300025913 | Bacteria | 20338 |
| 360 | Ga0207695_10010887 | 3300025913 | Bacteria | 11073 |
| 361 | Ga0207660_10036373 | 3300025917 | Bacteria | 3422 |
| 362 | Ga0207662_10000333 | 3300025918 | Bacteria | 21392 |
| 363 | Ga0207657_10000785 | 3300025919 | Bacteria | 33729 |
| 364 | Ga0207657_10002897 | 3300025919 | Bacteria | 18425 |
| 365 | Ga0207657_10047008 | 3300025919 | Bacteria | 3777 |
| 366 | Ga0207649_10014765 | 3300025920 | Bacteria | 4380 |
| 367 | Ga0207649_10028428 | 3300025920 | Bacteria | 3292 |
| 368 | Ga0207652_10290955 | 3300025921 | Bacteria | 1474 |
| 369 | Ga0207646_10143728 | 3300025922 | Bacteria | 2149 |
| 370 | Ga0207681_10016637 | 3300025923 | Bacteria | 4604 |
| 371 | Ga0207694_10000384 | 3300025924 | Bacteria | 41184 |
| 372 | Ga0207659_10051993 | 3300025926 | Bacteria | 2917 |
| 373 | Ga0207659_10091349 | 3300025926 | Bacteria | 2274 |
| 374 | Ga0207687_10011184 | 3300025927 | Bacteria | 5861 |
| 375 | Ga0207687_10118271 | 3300025927 | Bacteria | 1978 |
| 376 | Ga0207644_10004139 | 3300025931 | Bacteria | 9406 |
| 377 | Ga0207644_10124009 | 3300025931 | Bacteria | 1970 |
| 378 | Ga0207690_10008966 | 3300025932 | Bacteria | 5937 |
| 379 | Ga0207690_10202646 | 3300025932 | Bacteria | 1508 |
| 380 | Ga0207686_10030670 | 3300025934 | Bacteria | 3186 |
| 381 | Ga0207686_10061245 | 3300025934 | Bacteria | 2385 |
| 382 | Ga0207709_10000917 | 3300025935 | Bacteria | 22229 |
| 383 | Ga0207709_10114240 | 3300025935 | Bacteria | 1811 |
| 384 | Ga0207670_10003240 | 3300025936 | Bacteria | 8630 |
| 385 | Ga0207670_10072295 | 3300025936 | Bacteria | 2387 |
| 386 | Ga0207669_10008554 | 3300025937 | Bacteria | 4813 |
| 387 | Ga0207704_10000141 | 3300025938 | Bacteria | 38563 |
| 388 | Ga0207704_10033887 | 3300025938 | Bacteria | 2909 |
| 389 | Ga0207704_10264051 | 3300025938 | Bacteria | 1299 |
| 390 | Ga0207691_10012268 | 3300025940 | Bacteria | 8215 |
| 391 | Ga0207689_10001663 | 3300025942 | Bacteria | 21091 |
| 392 | Ga0207689_10191052 | 3300025942 | Bacteria | 1689 |
| 393 | Ga0207679_10005829 | 3300025945 | Bacteria | 7736 |
| 394 | Ga0207679_10047371 | 3300025945 | Bacteria | 3122 |
| 395 | Ga0207667_10000146 | 3300025949 | Bacteria | 106926 |
| 396 | Ga0207667_10007911 | 3300025949 | Bacteria | 12694 |
| 397 | Ga0207667_10021874 | 3300025949 | Bacteria | 7077 |
| 398 | Ga0207667_10035181 | 3300025949 | Bacteria | 5374 |
| 399 | Ga0207667_10061566 | 3300025949 | Bacteria | 3926 |
| 400 | Ga0207712_10000763 | 3300025961 | Bacteria | 24183 |
| 401 | Ga0207712_10001549 | 3300025961 | Bacteria | 15507 |
| 402 | Ga0207668_10029618 | 3300025972 | Bacteria | 3589 |
| 403 | Ga0207640_10005459 | 3300025981 | Bacteria | 6933 |
| 404 | Ga0207640_10031450 | 3300025981 | Bacteria | 3279 |
| 405 | Ga0207658_10010157 | 3300025986 | Bacteria | 6398 |
| 406 | Ga0207658_10036037 | 3300025986 | Bacteria | 3546 |
| 407 | Ga0207677_10001911 | 3300026023 | Bacteria | 11006 |
| 408 | Ga0207677_10030442 | 3300026023 | Bacteria | 3445 |
| 409 | Ga0207703_10011030 | 3300026035 | Bacteria | 7041 |
| 410 | Ga0207703_10022984 | 3300026035 | Bacteria | 4895 |
| 411 | Ga0207703_10070081 | 3300026035 | Bacteria | 2893 |
| 412 | Ga0207639_10022306 | 3300026041 | Bacteria | 4559 |
| 413 | Ga0207639_10085764 | 3300026041 | Bacteria | 2505 |
| 414 | Ga0207678_10044135 | 3300026067 | Bacteria | 3857 |
| 415 | Ga0207708_10000114 | 3300026075 | Bacteria | 61971 |
| 416 | Ga0207708_10065819 | 3300026075 | Bacteria | 2770 |
| 417 | Ga0207708_10140881 | 3300026075 | Bacteria | 1891 |
| 418 | Ga0207702_10030333 | 3300026078 | Bacteria | 4506 |
| 419 | Ga0207702_10041091 | 3300026078 | Bacteria | 3877 |
| 420 | Ga0207702_10109756 | 3300026078 | Bacteria | 2450 |
| 421 | Ga0207702_10317408 | 3300026078 | Bacteria | 1483 |
| 422 | Ga0207641_10000078 | 3300026088 | Bacteria | 143842 |
| 423 | Ga0207641_10029235 | 3300026088 | Bacteria | 4556 |
| 424 | Ga0207648_10000113 | 3300026089 | Bacteria | 78626 |
| 425 | Ga0207648_10010664 | 3300026089 | Bacteria | 8687 |
| 426 | Ga0207648_10097267 | 3300026089 | Bacteria | 2576 |
| 427 | Ga0207676_10292723 | 3300026095 | Bacteria | 1483 |
| 428 | Ga0207674_10076131 | 3300026116 | Bacteria | 3364 |
| 429 | Ga0207674_10105420 | 3300026116 | Bacteria | 2797 |
| 430 | Ga0207675_100005429 | 3300026118 | Bacteria | 12215 |
| 431 | Ga0207675_100010262 | 3300026118 | Bacteria | 8777 |
| 432 | Ga0207683_10134453 | 3300026121 | Bacteria | 2226 |
| 433 | Ga0207698_10091744 | 3300026142 | Bacteria | 2488 |
| 434 | Ga0209981_1000930 | 3300027378 | Bacteria | 3667 |
| 435 | Ga0209981_1009769 | 3300027378 | Bacteria | 1314 |
| 436 | Ga0209996_1004501 | 3300027395 | Bacteria | 1769 |
| 437 | Ga0210000_1002707 | 3300027462 | Bacteria | 2526 |
| 438 | Ga0209995_1000961 | 3300027471 | Bacteria | 4462 |
| 439 | Ga0209179_1000021 | 3300027512 | Bacteria | 45587 |
| 440 | Ga0209968_1011722 | 3300027526 | Bacteria | 1362 |
| 441 | Ga0209999_1009583 | 3300027543 | Bacteria | 1749 |
| 442 | Ga0209983_1005075 | 3300027665 | Bacteria | 2743 |
| 443 | Ga0209282_1000005 | 3300027666 | Bacteria | 380858 |
| 444 | Ga0209966_1001145 | 3300027695 | Bacteria | 4737 |
| 445 | Ga0207428_10000624 | 3300027907 | Bacteria | 41590 |
| 446 | Ga0207428_10051818 | 3300027907 | Bacteria | 3279 |
| 447 | Ga0268266_10129910 | 3300028379 | Bacteria | 2252 |
| 448 | Ga0268265_10003785 | 3300028380 | Bacteria | 10725 |
| 449 | Ga0268265_10006425 | 3300028380 | Bacteria | 7967 |
| 450 | Ga0268264_10000380 | 3300028381 | Bacteria | 64910 |
| 451 | Ga0268264_10002945 | 3300028381 | Bacteria | 14789 |
| 452 | Ga0268264_10006475 | 3300028381 | Bacteria | 9861 |
| 453 | Ga0268264_10236896 | 3300028381 | Bacteria | 1688 |
| 454 | Ga0268264_10257045 | 3300028381 | Bacteria | 1625 |
| 455 | Ga0265336_10000097 | 3300028666 | Bacteria | 66270 |
| 456 | Ga0265324_10000001 | 3300029957 | Bacteria | 562975 |
| 457 | Ga0316182_1045184 | 3300030745 | Bacteria | 2669 |
| 458 | Ga0265328_10000050 | 3300031239 | Bacteria | 79086 |
| 459 | Ga0265325_10000358 | 3300031241 | Bacteria | 32097 |
| 460 | Ga0265316_10171943 | 3300031344 | Bacteria | 1616 |
| 461 | Ga0307408_100000237 | 3300031548 | Bacteria | 57856 |
| 462 | Ga0307408_100000238 | 3300031548 | Bacteria | 57786 |
| 463 | Ga0307408_100002450 | 3300031548 | Bacteria | 13012 |
| 464 | Ga0307408_100046907 | 3300031548 | Bacteria | 3092 |
| 465 | Ga0316575_10002687 | 3300031665 | Bacteria | 5999 |
| 466 | Ga0316575_10005611 | 3300031665 | Bacteria | 4479 |
| 467 | Ga0316579_10001345 | 3300031691 | Bacteria | 8884 |
| 468 | Ga0307516_10002891 | 3300031730 | Bacteria | 22553 |
| 469 | Ga0316577_10156705 | 3300031733 | Bacteria | 1284 |
| 470 | Ga0307416_100003997 | 3300032002 | Bacteria | 8794 |
| 471 | Ga0307416_100068070 | 3300032002 | Bacteria | 2940 |
| 472 | Ga0307416_100187738 | 3300032002 | Bacteria | 1945 |
| 473 | Ga0307414_10007162 | 3300032004 | Bacteria | 6257 |
| 474 | Ga0373930_0005971 | 3300034816 | Bacteria | 2043 |
| 475 | Ga0373959_0011344 | 3300034820 | Bacteria | 1572 |
| 476 | Ga0373926_0010491 | 3300035083 | Bacteria | 3107 |
| 477 | Ga0373928_0005604 | 3300035084 | Bacteria | 2402 |
| 478 | Ga0373934_0005673 | 3300035086 | Bacteria | 4623 |
| 479 | Ga0373944_0004560 | 3300035089 | Bacteria | 3615 |
| 480 | Ga0373949_0025849 | 3300035090 | Bacteria | 1372 |
| 481 | Ga0373923_0017164 | 3300035111 | Bacteria | 2764 |
| 482 | Ga0373923_0076734 | 3300035111 | Bacteria | 1444 |
| 483 | Ga0373932_0000563 | 3300035112 | Bacteria | 11404 |
| 484 | Ga0373936_0020490 | 3300035113 | Bacteria | 2569 |
| 485 | Ga0373939_0006348 | 3300035114 | Bacteria | 2847 |
| 486 | Ga0373941_0019817 | 3300035115 | Bacteria | 1878 |
| 487 | Ga0373945_0006048 | 3300035116 | Bacteria | 3890 |
| 488 | Ga0373953_0015634 | 3300035117 | Bacteria | 2755 |
| 489 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 490 | Ga0373957_0014165 | 3300035120 | Bacteria | 2721 |
| 491 | Ga0373946_0008207 | 3300035171 | Bacteria | 3832 |
| 492 | Ga0373955_0058370 | 3300035172 | Bacteria | 2123 |
| 493 | Ga0373942_0004466 | 3300035207 | Bacteria | 3244 |
| 494 | Ga0373942_0028518 | 3300035207 | Bacteria | 1459 |
| 495 | Ga0373942_0037642 | 3300035207 | Bacteria | 1309 |
| 496 | Ga0373961_0011726 | 3300035241 | Bacteria | 2180 |
| 497 | Ga0373961_0013493 | 3300035241 | Bacteria | 2061 |
| 498 | Ga0373961_0025722 | 3300035241 | Bacteria | 1603 |
| 499 | Ga0316574_0001268 | 3300035398 | Bacteria | 11785 |
| 500 | Ga0373924_0020509 | 3300035410 | Bacteria | 2570 |
| 501 | Ga0373924_0042206 | 3300035410 | Bacteria | 1870 |
| 502 | Ga0373931_0001933 | 3300035691 | Bacteria | 9078 |
| 503 | Ga0373931_0018621 | 3300035691 | Bacteria | 3455 |
| 504 | Ga0373931_0022619 | 3300035691 | Bacteria | 3165 |
| 505 | Ga0373935_0021639 | 3300035692 | Bacteria | 3939 |
| 506 | Ga0373927_0002341 | 3300035695 | Bacteria | 13812 |
| 507 | Ga0373927_0016007 | 3300035695 | Bacteria | 4950 |
| 508 | Ga0373933_0007378 | 3300035724 | Bacteria | 5996 |
| 509 | Ga0373933_0017196 | 3300035724 | Bacteria | 4054 |
| 510 | Ga0373933_0089282 | 3300035724 | Bacteria | 1900 |
| 511 | Ga0373933_0107633 | 3300035724 | Bacteria | 1736 |
| 512 | Ga0373947_0009399 | 3300035725 | Bacteria | 5615 |
| 513 | Ga0373947_0170455 | 3300035725 | Bacteria | 1412 |
| 514 | Ga0373937_0000524 | 3300036401 | Bacteria | 34277 |
| 515 | Ga0373937_0005139 | 3300036401 | Bacteria | 11155 |
| 516 | Ga0373925_0040447 | 3300037068 | Bacteria | 3452 |
| 517 | Ga0395899_0000019 | 3300037312 | Bacteria | 411777 |
| 518 | Ga0395899_0000798 | 3300037312 | Bacteria | 30830 |
| 519 | Ga0395899_0007820 | 3300037312 | Bacteria | 8244 |
| 520 | Ga0395899_0012712 | 3300037312 | Bacteria | 6450 |
| 521 | Ga0395900_0000094 | 3300037418 | Bacteria | 165903 |
| 522 | Ga0395900_0011030 | 3300037418 | Bacteria | 9233 |
| 523 | Ga0395900_0011936 | 3300037418 | Bacteria | 8883 |
| 524 | Ga0395898_0120646 | 3300037466 | Bacteria | 2512 |
| 525 | Ga0395905_0007080 | 3300037471 | Bacteria | 11212 |
| 526 | Ga0395905_0010604 | 3300037471 | Bacteria | 8945 |
| 527 | Ga0395905_0075873 | 3300037471 | Bacteria | 3150 |
| 528 | Ga0395905_0164472 | 3300037471 | Bacteria | 2085 |
| 529 | Ga0395905_0256220 | 3300037471 | Bacteria | 1634 |
| 530 | Ga0316581_0003799 | 3300037588 | Bacteria | 3794 |
| 531 | Ga0395901_0003213 | 3300038443 | Bacteria | 16455 |
| 532 | Ga0395901_0004893 | 3300038443 | Bacteria | 13516 |
| 533 | Ga0395901_0039068 | 3300038443 | Bacteria | 4910 |
| 534 | Ga0395901_0046737 | 3300038443 | Bacteria | 4496 |
| 535 | Ga0436361_0173709 | 3300039447 | Bacteria | 11505 |
| 536 | Ga0436361_0568855 | 3300039447 | Bacteria | 14834 |
| 537 | Ga0436361_0687629 | 3300039447 | Bacteria | 8660 |
| 538 | Ga0436361_1015529 | 3300039447 | Bacteria | 2775 |
| 539 | Ga0436361_1028139 | 3300039447 | Bacteria | 2426 |
| 540 | Ga0436361_1082582 | 3300039447 | Bacteria | 32081 |
| 541 | Ga0436361_1117918 | 3300039447 | Bacteria | 2632 |
| 542 | Ga0436363_0742819 | 3300039450 | Bacteria | 1763 |
| 543 | Ga0439465_0035971 | 3300041413 | Bacteria | 1589 |
| 544 | Ga0439449_0011991 | 3300042007 | Bacteria | 3256 |
| 545 | Ga0439450_013487 | 3300042008 | Bacteria | 1643 |
| 546 | Ga0439451_021958 | 3300042009 | Bacteria | 1287 |
| 547 | Ga0439462_0025472 | 3300042015 | Bacteria | 1557 |
| 548 | Ga0439446_0000980 | 3300042156 | Bacteria | 6218 |
| 549 | Ga0439434_0000592 | 3300042435 | Bacteria | 10453 |
| 550 | Ga0439435_0000150 | 3300042436 | Bacteria | 9449 |
| 551 | Ga0439444_0000591 | 3300042437 | Bacteria | 4162 |
| 552 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 553 | Ga0451577_0017865 | 3300042876 | Bacteria | 6544 |
| 554 | Ga0466972_0000608 | 3300044658 | Bacteria | 17506 |
| 555 | Ga0466972_0002716 | 3300044658 | Bacteria | 8756 |
| 556 | Ga0466972_0021883 | 3300044658 | Bacteria | 3185 |
| 557 | Ga0466972_0102123 | 3300044658 | Bacteria | 1357 |
| 558 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 559 | Ga0466965_0000165 | 3300044683 | Bacteria | 20020 |
| 560 | Ga0466965_0001132 | 3300044683 | Bacteria | 10441 |
| 561 | Ga0466966_0015800 | 3300044684 | Bacteria | 4988 |
| 562 | Ga0466966_0038508 | 3300044684 | Bacteria | 3081 |
| 563 | Ga0466963_0192259 | 3300044694 | Bacteria | 1426 |
| 564 | Ga0466964_0001917 | 3300044706 | Bacteria | 7275 |
| 565 | Ga0466964_0004838 | 3300044706 | Bacteria | 4978 |
| 566 | Ga0466964_0006354 | 3300044706 | Bacteria | 4401 |
| 567 | Ga0466964_0018428 | 3300044706 | Bacteria | 2679 |
| 568 | Ga0466964_0041673 | 3300044706 | Bacteria | 1858 |
| 569 | Ga0466964_0046243 | 3300044706 | Bacteria | 1773 |
| 570 | Ga0453684_0000075 | 3300044712 | Bacteria | 437715 |
| 571 | Ga0453684_0000585 | 3300044712 | Bacteria | 135647 |
| 572 | Ga0466968_0009986 | 3300044735 | Bacteria | 3666 |
| 573 | Ga0466957_0000353 | 3300044842 | Bacteria | 22548 |
| 574 | Ga0466957_0020442 | 3300044842 | Bacteria | 3896 |
| 575 | Ga0466959_0022802 | 3300045049 | Bacteria | 4628 |
| 576 | Ga0466959_0065137 | 3300045049 | Bacteria | 2644 |
| 577 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 578 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 579 | Ga0451576_0006716 | 3300045051 | Bacteria | 14020 |
| 580 | Ga0451576_0080077 | 3300045051 | Bacteria | 3399 |
| 581 | Ga0451576_0112670 | 3300045051 | Bacteria | 2831 |
| 582 | Ga0451576_0121077 | 3300045051 | Bacteria | 2724 |
| 583 | Ga0466967_0007734 | 3300045976 | Bacteria | 7792 |
| 584 | Ga0466967_0083453 | 3300045976 | Bacteria | 2889 |
| 585 | Ga0466967_0263811 | 3300045976 | Bacteria | 1648 |
| 586 | Ga0495617_000017 | 3300046452 | Bacteria | 253066 |
| 587 | Ga0495617_000025 | 3300046452 | Bacteria | 164547 |
| 588 | Ga0495617_000161 | 3300046452 | Bacteria | 42643 |
| 589 | Ga0495617_001604 | 3300046452 | Bacteria | 9770 |
| 590 | Ga0495617_001680 | 3300046452 | Bacteria | 9512 |
| 591 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 592 | Ga0495627_002605 | 3300046453 | Bacteria | 8500 |
| 593 | Ga0495627_006780 | 3300046453 | Bacteria | 4455 |
| 594 | Ga0495627_017149 | 3300046453 | Bacteria | 2466 |
| 595 | Ga0495592_0000330 | 3300046454 | Bacteria | 39376 |
| 596 | Ga0495603_0026086 | 3300046455 | Bacteria | 3532 |
| 597 | Ga0495603_0034431 | 3300046455 | Bacteria | 3045 |
| 598 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 599 | Ga0495590_0000084 | 3300046457 | Bacteria | 62246 |
| 600 | Ga0495590_0001338 | 3300046457 | Bacteria | 10720 |
| 601 | Ga0495590_0002892 | 3300046457 | Bacteria | 7069 |
| 602 | Ga0495590_0003601 | 3300046457 | Bacteria | 6304 |
| 603 | Ga0495590_0016705 | 3300046457 | Bacteria | 2649 |
| 604 | Ga0495591_000034 | 3300046458 | Bacteria | 170328 |
| 605 | Ga0495629_0004476 | 3300046459 | Bacteria | 10471 |
| 606 | Ga0495629_0027130 | 3300046459 | Bacteria | 4068 |
| 607 | Ga0495629_0036197 | 3300046459 | Bacteria | 3486 |
| 608 | Ga0495629_0104326 | 3300046459 | Bacteria | 1977 |
| 609 | Ga0495629_0138423 | 3300046459 | Bacteria | 1694 |
| 610 | Ga0495638_0000133 | 3300046460 | Bacteria | 119393 |
| 611 | Ga0495638_0008243 | 3300046460 | Bacteria | 7405 |
| 612 | Ga0495638_0013742 | 3300046460 | Bacteria | 5499 |
| 613 | Ga0495638_0015650 | 3300046460 | Bacteria | 5089 |
| 614 | Ga0495638_0028761 | 3300046460 | Bacteria | 3587 |
| 615 | Ga0495653_0000016 | 3300046463 | Bacteria | 200976 |
| 616 | Ga0495653_0010559 | 3300046463 | Bacteria | 7562 |
| 617 | Ga0495653_0099149 | 3300046463 | Bacteria | 2114 |
| 618 | Ga0495650_0000062 | 3300046471 | Bacteria | 277977 |
| 619 | Ga0495650_0000084 | 3300046471 | Bacteria | 235690 |
| 620 | Ga0495650_0000136 | 3300046471 | Bacteria | 171758 |
| 621 | Ga0495650_0000141 | 3300046471 | Bacteria | 168676 |
| 622 | Ga0495650_0000201 | 3300046471 | Bacteria | 130128 |
| 623 | Ga0495650_0000255 | 3300046471 | Bacteria | 103396 |
| 624 | Ga0495650_0001140 | 3300046471 | Bacteria | 28800 |
| 625 | Ga0495650_0016111 | 3300046471 | Bacteria | 3802 |
| 626 | Ga0495650_0027985 | 3300046471 | Bacteria | 2595 |
| 627 | Ga0495580_0000673 | 3300046472 | Bacteria | 29171 |
| 628 | Ga0495580_0055254 | 3300046472 | Bacteria | 2799 |
| 629 | Ga0495582_0022123 | 3300046473 | Bacteria | 3478 |
| 630 | Ga0495582_0034372 | 3300046473 | Bacteria | 2786 |
| 631 | Ga0495605_0000043 | 3300046474 | Bacteria | 185216 |
| 632 | Ga0495605_0000077 | 3300046474 | Bacteria | 127523 |
| 633 | Ga0495605_0000471 | 3300046474 | Bacteria | 35776 |
| 634 | Ga0495605_0003656 | 3300046474 | Bacteria | 9129 |
| 635 | Ga0495605_0003838 | 3300046474 | Bacteria | 8914 |
| 636 | Ga0495605_0020215 | 3300046474 | Bacteria | 3541 |
| 637 | Ga0495605_0033409 | 3300046474 | Bacteria | 2610 |
| 638 | Ga0495605_0046049 | 3300046474 | Bacteria | 2146 |
| 639 | Ga0495639_0040528 | 3300046475 | Bacteria | 2095 |
| 640 | Ga0495662_0009077 | 3300046476 | Bacteria | 4882 |
| 641 | Ga0495584_0000004 | 3300046491 | Bacteria | 314714 |
| 642 | Ga0495584_0000274 | 3300046491 | Bacteria | 36593 |
| 643 | Ga0495584_0003655 | 3300046491 | Bacteria | 8384 |
| 644 | Ga0495584_0005749 | 3300046491 | Bacteria | 6546 |
| 645 | Ga0495584_0013146 | 3300046491 | Bacteria | 4223 |
| 646 | Ga0495584_0023302 | 3300046491 | Bacteria | 3139 |
| 647 | Ga0495584_0025806 | 3300046491 | Bacteria | 2978 |
| 648 | Ga0495584_0033378 | 3300046491 | Bacteria | 2603 |
| 649 | Ga0495584_0050213 | 3300046491 | Bacteria | 2100 |
| 650 | Ga0495584_0056745 | 3300046491 | Bacteria | 1970 |
| 651 | Ga0495584_0076091 | 3300046491 | Bacteria | 1688 |
| 652 | Ga0495585_0000578 | 3300046492 | Bacteria | 34546 |
| 653 | Ga0495585_0000713 | 3300046492 | Bacteria | 29877 |
| 654 | Ga0495585_0001437 | 3300046492 | Bacteria | 18679 |
| 655 | Ga0495585_0003217 | 3300046492 | Bacteria | 11146 |
| 656 | Ga0495585_0005567 | 3300046492 | Bacteria | 7915 |
| 657 | Ga0495585_0006781 | 3300046492 | Bacteria | 7069 |
| 658 | Ga0495585_0007257 | 3300046492 | Bacteria | 6804 |
| 659 | Ga0495585_0013513 | 3300046492 | Bacteria | 4772 |
| 660 | Ga0495585_0016813 | 3300046492 | Bacteria | 4238 |
| 661 | Ga0495585_0017689 | 3300046492 | Bacteria | 4116 |
| 662 | Ga0495585_0028018 | 3300046492 | Bacteria | 3215 |
| 663 | Ga0495585_0028728 | 3300046492 | Bacteria | 3169 |
| 664 | Ga0495585_0030624 | 3300046492 | Bacteria | 3059 |
| 665 | Ga0495585_0036250 | 3300046492 | Bacteria | 2783 |
| 666 | Ga0495585_0040725 | 3300046492 | Bacteria | 2607 |
| 667 | Ga0495585_0061019 | 3300046492 | Bacteria | 2074 |
| 668 | Ga0495585_0066378 | 3300046492 | Bacteria | 1975 |
| 669 | Ga0495594_0010456 | 3300046499 | Bacteria | 4814 |
| 670 | Ga0495594_0010939 | 3300046499 | Bacteria | 4707 |
| 671 | Ga0495594_0012276 | 3300046499 | Bacteria | 4462 |
| 672 | Ga0495594_0014538 | 3300046499 | Bacteria | 4126 |
| 673 | Ga0495594_0108762 | 3300046499 | Bacteria | 1562 |
| 674 | Ga0495596_0000508 | 3300046500 | Bacteria | 24723 |
| 675 | Ga0495596_0002024 | 3300046500 | Bacteria | 11143 |
| 676 | Ga0495596_0002076 | 3300046500 | Bacteria | 11002 |
| 677 | Ga0495596_0006098 | 3300046500 | Bacteria | 5606 |
| 678 | Ga0495596_0009155 | 3300046500 | Bacteria | 4367 |
| 679 | Ga0495596_0010488 | 3300046500 | Bacteria | 4032 |
| 680 | Ga0495596_0016195 | 3300046500 | Bacteria | 3101 |
| 681 | Ga0495596_0020366 | 3300046500 | Bacteria | 2716 |
| 682 | Ga0495607_0000806 | 3300046501 | Bacteria | 29657 |
| 683 | Ga0495607_0003187 | 3300046501 | Bacteria | 12671 |
| 684 | Ga0495607_0005471 | 3300046501 | Bacteria | 9086 |
| 685 | Ga0495607_0006127 | 3300046501 | Bacteria | 8506 |
| 686 | Ga0495607_0009350 | 3300046501 | Bacteria | 6638 |
| 687 | Ga0495607_0025650 | 3300046501 | Bacteria | 3664 |
| 688 | Ga0495607_0046268 | 3300046501 | Bacteria | 2556 |
| 689 | Ga0495583_0000044 | 3300046506 | Bacteria | 226264 |
| 690 | Ga0495583_0000091 | 3300046506 | Bacteria | 158961 |
| 691 | Ga0495583_0000099 | 3300046506 | Bacteria | 148167 |
| 692 | Ga0495583_0000246 | 3300046506 | Bacteria | 89354 |
| 693 | Ga0495583_0000936 | 3300046506 | Bacteria | 34112 |
| 694 | Ga0495583_0002959 | 3300046506 | Bacteria | 13651 |
| 695 | Ga0495583_0004328 | 3300046506 | Bacteria | 10247 |
| 696 | Ga0495583_0008047 | 3300046506 | Bacteria | 6502 |
| 697 | Ga0495583_0010011 | 3300046506 | Bacteria | 5585 |
| 698 | Ga0495583_0024362 | 3300046506 | Bacteria | 3042 |
| 699 | Ga0495583_0027526 | 3300046506 | Bacteria | 2805 |
| 700 | Ga0495606_0000046 | 3300046507 | Bacteria | 210855 |
| 701 | Ga0495606_0000051 | 3300046507 | Bacteria | 201659 |
| 702 | Ga0495606_0000093 | 3300046507 | Bacteria | 152281 |
| 703 | Ga0495606_0000476 | 3300046507 | Bacteria | 65896 |
| 704 | Ga0495606_0000532 | 3300046507 | Bacteria | 61394 |
| 705 | Ga0495606_0000929 | 3300046507 | Bacteria | 43166 |
| 706 | Ga0495606_0000986 | 3300046507 | Bacteria | 41479 |
| 707 | Ga0495606_0005680 | 3300046507 | Bacteria | 11808 |
| 708 | Ga0495606_0014034 | 3300046507 | Bacteria | 6279 |
| 709 | Ga0495606_0015400 | 3300046507 | Bacteria | 5893 |
| 710 | Ga0495606_0016063 | 3300046507 | Bacteria | 5730 |
| 711 | Ga0495606_0019821 | 3300046507 | Bacteria | 4982 |
| 712 | Ga0495606_0037849 | 3300046507 | Bacteria | 3271 |
| 713 | Ga0495606_0039552 | 3300046507 | Bacteria | 3176 |
| 714 | Ga0495606_0062176 | 3300046507 | Bacteria | 2384 |
| 715 | Ga0495608_0002611 | 3300046511 | Bacteria | 12950 |
| 716 | Ga0495610_0000027 | 3300046512 | Bacteria | 275273 |
| 717 | Ga0495610_0001625 | 3300046512 | Bacteria | 19763 |
| 718 | Ga0495610_0002161 | 3300046512 | Bacteria | 16719 |
| 719 | Ga0495610_0005034 | 3300046512 | Bacteria | 9548 |
| 720 | Ga0495616_0000253 | 3300046513 | Bacteria | 43324 |
| 721 | Ga0495616_0000504 | 3300046513 | Bacteria | 29591 |
| 722 | Ga0495616_0000544 | 3300046513 | Bacteria | 28388 |
| 723 | Ga0495616_0000591 | 3300046513 | Bacteria | 27295 |
| 724 | Ga0495616_0002867 | 3300046513 | Bacteria | 11249 |
| 725 | Ga0495616_0003323 | 3300046513 | Bacteria | 10335 |
| 726 | Ga0495616_0005983 | 3300046513 | Bacteria | 7421 |
| 727 | Ga0495616_0026912 | 3300046513 | Bacteria | 3055 |
| 728 | Ga0495616_0032132 | 3300046513 | Bacteria | 2744 |
| 729 | Ga0495616_0040587 | 3300046513 | Bacteria | 2377 |
| 730 | Ga0495616_0059352 | 3300046513 | Bacteria | 1881 |
| 731 | Ga0495616_0071683 | 3300046513 | Bacteria | 1674 |
| 732 | Ga0495616_0079182 | 3300046513 | Bacteria | 1575 |
| 733 | Ga0495616_0099479 | 3300046513 | Bacteria | 1365 |
| 734 | Ga0495618_0024257 | 3300046514 | Bacteria | 3755 |
| 735 | Ga0495620_0005087 | 3300046515 | Bacteria | 7363 |
| 736 | Ga0495628_0169820 | 3300046516 | Bacteria | 1654 |
| 737 | Ga0495630_0002124 | 3300046517 | Bacteria | 13785 |
| 738 | Ga0495630_0204089 | 3300046517 | Bacteria | 1508 |
| 739 | Ga0495631_0000278 | 3300046518 | Bacteria | 35695 |
| 740 | Ga0495631_0000604 | 3300046518 | Bacteria | 23574 |
| 741 | Ga0495631_0006277 | 3300046518 | Bacteria | 6152 |
| 742 | Ga0495631_0009643 | 3300046518 | Bacteria | 4813 |
| 743 | Ga0495631_0012275 | 3300046518 | Bacteria | 4191 |
| 744 | Ga0495631_0014582 | 3300046518 | Bacteria | 3787 |
| 745 | Ga0495631_0020621 | 3300046518 | Bacteria | 3077 |
| 746 | Ga0495631_0038171 | 3300046518 | Bacteria | 2136 |
| 747 | Ga0495631_0049186 | 3300046518 | Bacteria | 1846 |
| 748 | Ga0495632_0000092 | 3300046519 | Bacteria | 92510 |
| 749 | Ga0495632_0000136 | 3300046519 | Bacteria | 74659 |
| 750 | Ga0495632_0001025 | 3300046519 | Bacteria | 24154 |
| 751 | Ga0495632_0003825 | 3300046519 | Bacteria | 10464 |
| 752 | Ga0495632_0007739 | 3300046519 | Bacteria | 6704 |
| 753 | Ga0495632_0015274 | 3300046519 | Bacteria | 4314 |
| 754 | Ga0495632_0025563 | 3300046519 | Bacteria | 3121 |
| 755 | Ga0495632_0048895 | 3300046519 | Bacteria | 2092 |
| 756 | Ga0495632_0070186 | 3300046519 | Bacteria | 1685 |
| 757 | Ga0495637_0000003 | 3300046520 | Bacteria | 623293 |
| 758 | Ga0495637_0000058 | 3300046520 | Bacteria | 96841 |
| 759 | Ga0495637_0000494 | 3300046520 | Bacteria | 28654 |
| 760 | Ga0495637_0004779 | 3300046520 | Bacteria | 6987 |
| 761 | Ga0495637_0038654 | 3300046520 | Bacteria | 2064 |
| 762 | Ga0495643_0000129 | 3300046522 | Bacteria | 122235 |
| 763 | Ga0495643_0000139 | 3300046522 | Bacteria | 117261 |
| 764 | Ga0495643_0000184 | 3300046522 | Bacteria | 100035 |
| 765 | Ga0495643_0004217 | 3300046522 | Bacteria | 10175 |
| 766 | Ga0495643_0014171 | 3300046522 | Bacteria | 4750 |
| 767 | Ga0495643_0014568 | 3300046522 | Bacteria | 4674 |
| 768 | Ga0495643_0018624 | 3300046522 | Bacteria | 4030 |
| 769 | Ga0495643_0037871 | 3300046522 | Bacteria | 2643 |
| 770 | Ga0495643_0050242 | 3300046522 | Bacteria | 2246 |
| 771 | Ga0495644_0001715 | 3300046523 | Bacteria | 8869 |
| 772 | Ga0495644_0008067 | 3300046523 | Bacteria | 4050 |
| 773 | Ga0495644_0011752 | 3300046523 | Bacteria | 3370 |
| 774 | Ga0495644_0014504 | 3300046523 | Bacteria | 3019 |
| 775 | Ga0495644_0017725 | 3300046523 | Bacteria | 2720 |
| 776 | Ga0495644_0025292 | 3300046523 | Bacteria | 2254 |
| 777 | Ga0495644_0034658 | 3300046523 | Bacteria | 1905 |
| 778 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 779 | Ga0495648_0000127 | 3300046524 | Bacteria | 89962 |
| 780 | Ga0495648_0001350 | 3300046524 | Bacteria | 24244 |
| 781 | Ga0495648_0001892 | 3300046524 | Bacteria | 19996 |
| 782 | Ga0495648_0004786 | 3300046524 | Bacteria | 11445 |
| 783 | Ga0495648_0013469 | 3300046524 | Bacteria | 6043 |
| 784 | Ga0495648_0016855 | 3300046524 | Bacteria | 5251 |
| 785 | Ga0495648_0040029 | 3300046524 | Bacteria | 2976 |
| 786 | Ga0495648_0057606 | 3300046524 | Bacteria | 2328 |
| 787 | Ga0495648_0066893 | 3300046524 | Bacteria | 2104 |
| 788 | Ga0495648_0090471 | 3300046524 | Bacteria | 1715 |
| 789 | Ga0495648_0110518 | 3300046524 | Bacteria | 1497 |
| 790 | Ga0495663_0006459 | 3300046525 | Bacteria | 3240 |
| 791 | Ga0495666_0000358 | 3300046526 | Bacteria | 20068 |
| 792 | Ga0495666_0003925 | 3300046526 | Bacteria | 7515 |
| 793 | Ga0495666_0023321 | 3300046526 | Bacteria | 3060 |
| 794 | Ga0495666_0046082 | 3300046526 | Bacteria | 2103 |
| 795 | Ga0495642_0000014 | 3300046528 | Bacteria | 122339 |
| 796 | Ga0495642_0000601 | 3300046528 | Bacteria | 18108 |
| 797 | Ga0495642_0001447 | 3300046528 | Bacteria | 10627 |
| 798 | Ga0495642_0001848 | 3300046528 | Bacteria | 9055 |
| 799 | Ga0495642_0002139 | 3300046528 | Bacteria | 8151 |
| 800 | Ga0495642_0002176 | 3300046528 | Bacteria | 8049 |
| 801 | Ga0495642_0006905 | 3300046528 | Bacteria | 4352 |
| 802 | Ga0495642_0015932 | 3300046528 | Bacteria | 2926 |
| 803 | Ga0495642_0017775 | 3300046528 | Bacteria | 2778 |
| 804 | Ga0495642_0017777 | 3300046528 | Bacteria | 2778 |
| 805 | Ga0495642_0052798 | 3300046528 | Bacteria | 1674 |
| 806 | Ga0495652_0019446 | 3300046529 | Bacteria | 6049 |
| 807 | Ga0495652_0060024 | 3300046529 | Bacteria | 3215 |
| 808 | Ga0495652_0085345 | 3300046529 | Bacteria | 2595 |
| 809 | Ga0495654_0000022 | 3300046530 | Bacteria | 260104 |
| 810 | Ga0495654_0001794 | 3300046530 | Bacteria | 14300 |
| 811 | Ga0495654_0006359 | 3300046530 | Bacteria | 6718 |
| 812 | Ga0495665_0005000 | 3300046531 | Bacteria | 7146 |
| 813 | Ga0495665_0011946 | 3300046531 | Bacteria | 4700 |
| 814 | Ga0495665_0029779 | 3300046531 | Bacteria | 2924 |
| 815 | Ga0495640_0000361 | 3300046533 | Bacteria | 31989 |
| 816 | Ga0495640_0037901 | 3300046533 | Bacteria | 3396 |
| 817 | Ga0495586_0002047 | 3300046535 | Bacteria | 10948 |
| 818 | Ga0495586_0002540 | 3300046535 | Bacteria | 9883 |
| 819 | Ga0495586_0004893 | 3300046535 | Bacteria | 7164 |
| 820 | Ga0495587_0021357 | 3300046536 | Bacteria | 3992 |
| 821 | Ga0495587_0081796 | 3300046536 | Bacteria | 1871 |
| 822 | Ga0495598_0010589 | 3300046537 | Bacteria | 2213 |
| 823 | Ga0495609_0000068 | 3300046538 | Bacteria | 129809 |
| 824 | Ga0495609_0000071 | 3300046538 | Bacteria | 126994 |
| 825 | Ga0495609_0001980 | 3300046538 | Bacteria | 12946 |
| 826 | Ga0495609_0003897 | 3300046538 | Bacteria | 8370 |
| 827 | Ga0495609_0003956 | 3300046538 | Bacteria | 8297 |
| 828 | Ga0495609_0004612 | 3300046538 | Bacteria | 7484 |
| 829 | Ga0495609_0006626 | 3300046538 | Bacteria | 5883 |
| 830 | Ga0495609_0007470 | 3300046538 | Bacteria | 5451 |
| 831 | Ga0495609_0020429 | 3300046538 | Bacteria | 3060 |
| 832 | Ga0495609_0035974 | 3300046538 | Bacteria | 2239 |
| 833 | Ga0495597_0000051 | 3300046542 | Bacteria | 97079 |
| 834 | Ga0495597_0000978 | 3300046542 | Bacteria | 22029 |
| 835 | Ga0495597_0002537 | 3300046542 | Bacteria | 11454 |
| 836 | Ga0495597_0003589 | 3300046542 | Bacteria | 8942 |
| 837 | Ga0495597_0003947 | 3300046542 | Bacteria | 8350 |
| 838 | Ga0495597_0004146 | 3300046542 | Bacteria | 8044 |
| 839 | Ga0495597_0006044 | 3300046542 | Bacteria | 6304 |
| 840 | Ga0495597_0007663 | 3300046542 | Bacteria | 5462 |
| 841 | Ga0495597_0019435 | 3300046542 | Bacteria | 3179 |
| 842 | Ga0495597_0030936 | 3300046542 | Bacteria | 2437 |
| 843 | Ga0495597_0054653 | 3300046542 | Bacteria | 1753 |
| 844 | Ga0495622_0000045 | 3300046557 | Bacteria | 114324 |
| 845 | Ga0495622_0000136 | 3300046557 | Bacteria | 62960 |
| 846 | Ga0495622_0003680 | 3300046557 | Bacteria | 7182 |
| 847 | Ga0495622_0060291 | 3300046557 | Bacteria | 1757 |
| 848 | Ga0495622_0072683 | 3300046557 | Bacteria | 1587 |
| 849 | Ga0495633_0000202 | 3300046558 | Bacteria | 76324 |
| 850 | Ga0495633_0000277 | 3300046558 | Bacteria | 59502 |
| 851 | Ga0495633_0001894 | 3300046558 | Bacteria | 15254 |
| 852 | Ga0495633_0002629 | 3300046558 | Bacteria | 12561 |
| 853 | Ga0495633_0004167 | 3300046558 | Bacteria | 9291 |
| 854 | Ga0495633_0004897 | 3300046558 | Bacteria | 8361 |
| 855 | Ga0495633_0005717 | 3300046558 | Bacteria | 7517 |
| 856 | Ga0495633_0008856 | 3300046558 | Bacteria | 5616 |
| 857 | Ga0495633_0012063 | 3300046558 | Bacteria | 4615 |
| 858 | Ga0495633_0021002 | 3300046558 | Bacteria | 3272 |
| 859 | Ga0495633_0022102 | 3300046558 | Bacteria | 3170 |
| 860 | Ga0495633_0024891 | 3300046558 | Bacteria | 2953 |
| 861 | Ga0495633_0068939 | 3300046558 | Bacteria | 1651 |
| 862 | Ga0495667_0043518 | 3300046559 | Bacteria | 2975 |
| 863 | Ga0495656_0015428 | 3300046615 | Bacteria | 2883 |
| 864 | Ga0495656_0027619 | 3300046615 | Bacteria | 2268 |
| 865 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 866 | Ga0495668_0000148 | 3300046616 | Bacteria | 105875 |
| 867 | Ga0495668_0000174 | 3300046616 | Bacteria | 95737 |
| 868 | Ga0495668_0000232 | 3300046616 | Bacteria | 79391 |
| 869 | Ga0495668_0000993 | 3300046616 | Bacteria | 30714 |
| 870 | Ga0495668_0001360 | 3300046616 | Bacteria | 23981 |
| 871 | Ga0495668_0001677 | 3300046616 | Bacteria | 20554 |
| 872 | Ga0495668_0003626 | 3300046616 | Bacteria | 11433 |
| 873 | Ga0495668_0018136 | 3300046616 | Bacteria | 4070 |
| 874 | Ga0495668_0028213 | 3300046616 | Bacteria | 3175 |
| 875 | Ga0495668_0033283 | 3300046616 | Bacteria | 2896 |
| 876 | Ga0495668_0037131 | 3300046616 | Bacteria | 2727 |
| 877 | Ga0495668_0042026 | 3300046616 | Bacteria | 2545 |
| 878 | Ga0495668_0077160 | 3300046616 | Bacteria | 1829 |
| 879 | Ga0495668_0108994 | 3300046616 | Bacteria | 1514 |
| 880 | Ga0495634_0004040 | 3300046642 | Bacteria | 11641 |
| 881 | Ga0495634_0023044 | 3300046642 | Bacteria | 4382 |
| 882 | Ga0495611_0000064 | 3300046648 | Bacteria | 74760 |
| 883 | Ga0495611_0021883 | 3300046648 | Bacteria | 2763 |
| 884 | Ga0495611_0022996 | 3300046648 | Bacteria | 2700 |
| 885 | Ga0495611_0027825 | 3300046648 | Bacteria | 2474 |
| 886 | Ga0495611_0037629 | 3300046648 | Bacteria | 2150 |
| 887 | Ga0495625_0000220 | 3300046660 | Bacteria | 90406 |
| 888 | Ga0495625_0001632 | 3300046660 | Bacteria | 26410 |
| 889 | Ga0495625_0005340 | 3300046660 | Bacteria | 11764 |
| 890 | Ga0495625_0006694 | 3300046660 | Bacteria | 10224 |
| 891 | Ga0495625_0007550 | 3300046660 | Bacteria | 9441 |
| 892 | Ga0495625_0022190 | 3300046660 | Bacteria | 4871 |
| 893 | Ga0495625_0025488 | 3300046660 | Bacteria | 4484 |
| 894 | Ga0495625_0032509 | 3300046660 | Bacteria | 3866 |
| 895 | Ga0495625_0049335 | 3300046660 | Bacteria | 3026 |
| 896 | Ga0495625_0051022 | 3300046660 | Bacteria | 2967 |
| 897 | Ga0495625_0053232 | 3300046660 | Bacteria | 2896 |
| 898 | Ga0495625_0100822 | 3300046660 | Bacteria | 1984 |
| 899 | Ga0495625_0168856 | 3300046660 | Bacteria | 1462 |
| 900 | Ga0495635_0002684 | 3300046663 | Bacteria | 12161 |
| 901 | Ga0495635_0049501 | 3300046663 | Bacteria | 2896 |
| 902 | Ga0495659_0000072 | 3300046664 | Bacteria | 42932 |
| 903 | Ga0495659_0001178 | 3300046664 | Bacteria | 9074 |
| 904 | Ga0495659_0001711 | 3300046664 | Bacteria | 7325 |
| 905 | Ga0495661_0000214 | 3300046665 | Bacteria | 66777 |
| 906 | Ga0495661_0000695 | 3300046665 | Bacteria | 33448 |
| 907 | Ga0495661_0004010 | 3300046665 | Bacteria | 10733 |
| 908 | Ga0495661_0008198 | 3300046665 | Bacteria | 7238 |
| 909 | Ga0495661_0011114 | 3300046665 | Bacteria | 6112 |
| 910 | Ga0495661_0015331 | 3300046665 | Bacteria | 5117 |
| 911 | Ga0495661_0026626 | 3300046665 | Bacteria | 3723 |
| 912 | Ga0495661_0028879 | 3300046665 | Bacteria | 3545 |
| 913 | Ga0495661_0035609 | 3300046665 | Bacteria | 3121 |
| 914 | Ga0495661_0036583 | 3300046665 | Bacteria | 3072 |
| 915 | Ga0495661_0052376 | 3300046665 | Bacteria | 2459 |
| 916 | Ga0495661_0056619 | 3300046665 | Bacteria | 2344 |
| 917 | Ga0495661_0061482 | 3300046665 | Bacteria | 2229 |
| 918 | Ga0495661_0080183 | 3300046665 | Bacteria | 1884 |
| 919 | Ga0495661_0080487 | 3300046665 | Bacteria | 1879 |
| 920 | Ga0495661_0134772 | 3300046665 | Bacteria | 1349 |
| 921 | Ga0495588_0000141 | 3300046674 | Bacteria | 104615 |
| 922 | Ga0495588_0004794 | 3300046674 | Bacteria | 5985 |
| 923 | Ga0495588_0019034 | 3300046674 | Bacteria | 3358 |
| 924 | Ga0495588_0023447 | 3300046674 | Bacteria | 3055 |
| 925 | Ga0495588_0071398 | 3300046674 | Bacteria | 1805 |
| 926 | Ga0495588_0087467 | 3300046674 | Bacteria | 1630 |
| 927 | Ga0495588_0098991 | 3300046674 | Bacteria | 1531 |
| 928 | Ga0495599_0108620 | 3300046678 | Bacteria | 1728 |
| 929 | Ga0495623_0011773 | 3300046679 | Bacteria | 5666 |
| 930 | Ga0495623_0115105 | 3300046679 | Bacteria | 1625 |
| 931 | Ga0495646_0062820 | 3300046680 | Bacteria | 2207 |
| 932 | Ga0495647_0000474 | 3300046681 | Bacteria | 11658 |
| 933 | Ga0495658_0003242 | 3300046683 | Bacteria | 8101 |
| 934 | Ga0495658_0005980 | 3300046683 | Bacteria | 5976 |
| 935 | Ga0495669_0000061 | 3300046684 | Bacteria | 72014 |
| 936 | Ga0495669_0000541 | 3300046684 | Bacteria | 16924 |
| 937 | Ga0495669_0001956 | 3300046684 | Bacteria | 8466 |
| 938 | Ga0495669_0010797 | 3300046684 | Bacteria | 3865 |
| 939 | Ga0495669_0017316 | 3300046684 | Bacteria | 3091 |
| 940 | Ga0495669_0021589 | 3300046684 | Bacteria | 2795 |
| 941 | Ga0495669_0024322 | 3300046684 | Bacteria | 2638 |
| 942 | Ga0495669_0034561 | 3300046684 | Bacteria | 2229 |
| 943 | Ga0495613_0006712 | 3300046689 | Bacteria | 8592 |
| 944 | Ga0495613_0043012 | 3300046689 | Bacteria | 3342 |
| 945 | Ga0495624_0001779 | 3300046690 | Bacteria | 16487 |
| 946 | Ga0495624_0038646 | 3300046690 | Bacteria | 3065 |
| 947 | Ga0495624_0066340 | 3300046690 | Bacteria | 2253 |
| 948 | Ga0495624_0086078 | 3300046690 | Bacteria | 1941 |
| 949 | Ga0495670_0001678 | 3300046691 | Bacteria | 10870 |
| 950 | Ga0495670_0004159 | 3300046691 | Bacteria | 7092 |
| 951 | Ga0495670_0010550 | 3300046691 | Bacteria | 4541 |
| 952 | Ga0495670_0020306 | 3300046691 | Bacteria | 3274 |
| 953 | Ga0495670_0021699 | 3300046691 | Bacteria | 3168 |
| 954 | Ga0495670_0035935 | 3300046691 | Bacteria | 2468 |
| 955 | Ga0495670_0072394 | 3300046691 | Bacteria | 1745 |
| 956 | Ga0495670_0074831 | 3300046691 | Bacteria | 1718 |
| 957 | Ga0495670_0075274 | 3300046691 | Bacteria | 1714 |
| 958 | Ga0495671_0000064 | 3300046692 | Bacteria | 106374 |
| 959 | Ga0495671_0000281 | 3300046692 | Bacteria | 42628 |
| 960 | Ga0495671_0001813 | 3300046692 | Bacteria | 13801 |
| 961 | Ga0495671_0007401 | 3300046692 | Bacteria | 6264 |
| 962 | Ga0495671_0025617 | 3300046692 | Bacteria | 3063 |
| 963 | Ga0495671_0033801 | 3300046692 | Bacteria | 2603 |
| 964 | Ga0495649_0000918 | 3300046694 | Bacteria | 23314 |
| 965 | Ga0495649_0002189 | 3300046694 | Bacteria | 13980 |
| 966 | Ga0495649_0013798 | 3300046694 | Bacteria | 4651 |
| 967 | Ga0495649_0015468 | 3300046694 | Bacteria | 4343 |
| 968 | Ga0495649_0028513 | 3300046694 | Bacteria | 3094 |
| 969 | Ga0495589_0000084 | 3300046794 | Bacteria | 86500 |
| 970 | Ga0495589_0000770 | 3300046794 | Bacteria | 20466 |
| 971 | Ga0495589_0003941 | 3300046794 | Bacteria | 7966 |
| 972 | Ga0495589_0004657 | 3300046794 | Bacteria | 7285 |
| 973 | Ga0495589_0007237 | 3300046794 | Bacteria | 5813 |
| 974 | Ga0495589_0010759 | 3300046794 | Bacteria | 4755 |
| 975 | Ga0495589_0040631 | 3300046794 | Bacteria | 2321 |
| 976 | Ga0495589_0066482 | 3300046794 | Bacteria | 1765 |
| 977 | Ga0495600_0085173 | 3300046809 | Bacteria | 2062 |
| 978 | Ga0495660_0000200 | 3300046810 | Bacteria | 62557 |
| 979 | Ga0495660_0001390 | 3300046810 | Bacteria | 16607 |
| 980 | Ga0495660_0001407 | 3300046810 | Bacteria | 16520 |
| 981 | Ga0495660_0001424 | 3300046810 | Bacteria | 16374 |
| 982 | Ga0495660_0002477 | 3300046810 | Bacteria | 11772 |
| 983 | Ga0495660_0011896 | 3300046810 | Bacteria | 5048 |
| 984 | Ga0495660_0012525 | 3300046810 | Bacteria | 4923 |
| 985 | Ga0495660_0015786 | 3300046810 | Bacteria | 4360 |
| 986 | Ga0495660_0029879 | 3300046810 | Bacteria | 3072 |
| 987 | Ga0495660_0046806 | 3300046810 | Bacteria | 2371 |
| 988 | Ga0495660_0051027 | 3300046810 | Bacteria | 2251 |
| 989 | Ga0495660_0059913 | 3300046810 | Bacteria | 2046 |
| 990 | Ga0495581_0001405 | 3300047315 | Bacteria | 13339 |
| 991 | Ga0495581_0135696 | 3300047315 | Bacteria | 1434 |
| 992 | Ga0495604_0004964 | 3300047317 | Bacteria | 10549 |
| 993 | Ga0495604_0014498 | 3300047317 | Bacteria | 6285 |
| 994 | Ga0495604_0048113 | 3300047317 | Bacteria | 3317 |
| 995 | Ga0495636_0000994 | 3300047318 | Bacteria | 10594 |
| 996 | Ga0495636_0002196 | 3300047318 | Bacteria | 7490 |
| 997 | Ga0495636_0003868 | 3300047318 | Bacteria | 5842 |
| 998 | Ga0495636_0014612 | 3300047318 | Bacteria | 3123 |
| 999 | Ga0495636_0081334 | 3300047318 | Bacteria | 1395 |
| 1000 | Ga0495674_0030847 | 3300047319 | Bacteria | 4871 |
| 1001 | Ga0495672_0000026 | 3300047320 | Bacteria | 340319 |
| 1002 | Ga0495672_0000075 | 3300047320 | Bacteria | 175957 |
| 1003 | Ga0495672_0000089 | 3300047320 | Bacteria | 150897 |
| 1004 | Ga0495672_0000127 | 3300047320 | Bacteria | 117475 |
| 1005 | Ga0495672_0000453 | 3300047320 | Bacteria | 48724 |
| 1006 | Ga0495672_0002837 | 3300047320 | Bacteria | 15410 |
| 1007 | Ga0495672_0006451 | 3300047320 | Bacteria | 9079 |
| 1008 | Ga0495672_0007734 | 3300047320 | Bacteria | 8042 |
| 1009 | Ga0495672_0023375 | 3300047320 | Bacteria | 4001 |
| 1010 | Ga0495672_0036465 | 3300047320 | Bacteria | 3019 |
| 1011 | Ga0495672_0058257 | 3300047320 | Bacteria | 2240 |
| 1012 | Ga0495672_0059651 | 3300047320 | Bacteria | 2206 |
| 1013 | Ga0495672_0081131 | 3300047320 | Bacteria | 1807 |
| 1014 | Ga0495676_0000025 | 3300047321 | Bacteria | 149350 |
| 1015 | Ga0495676_0015658 | 3300047321 | Bacteria | 6744 |
| 1016 | Ga0495676_0028408 | 3300047321 | Bacteria | 4776 |
| 1017 | Ga0495676_0058168 | 3300047321 | Bacteria | 3043 |
| 1018 | Ga0495676_0077630 | 3300047321 | Bacteria | 2532 |
| 1019 | Ga0495680_0004529 | 3300047322 | Bacteria | 13277 |
| 1020 | Ga0495680_0021996 | 3300047322 | Bacteria | 5328 |
| 1021 | Ga0495680_0058611 | 3300047322 | Bacteria | 2975 |
| 1022 | Ga0495683_0000155 | 3300047323 | Bacteria | 67620 |
| 1023 | Ga0495683_0000174 | 3300047323 | Bacteria | 63168 |
| 1024 | Ga0495683_0001196 | 3300047323 | Bacteria | 17704 |
| 1025 | Ga0495683_0001709 | 3300047323 | Bacteria | 13920 |
| 1026 | Ga0495683_0006093 | 3300047323 | Bacteria | 6612 |
| 1027 | Ga0495683_0008116 | 3300047323 | Bacteria | 5637 |
| 1028 | Ga0495683_0024755 | 3300047323 | Bacteria | 3079 |
| 1029 | Ga0495683_0030699 | 3300047323 | Bacteria | 2741 |
| 1030 | Ga0495683_0034343 | 3300047323 | Bacteria | 2579 |
| 1031 | Ga0495683_0078272 | 3300047323 | Bacteria | 1616 |
| 1032 | Ga0495687_000101 | 3300047443 | Bacteria | 129682 |
| 1033 | Ga0495687_000117 | 3300047443 | Bacteria | 122591 |
| 1034 | Ga0495687_000282 | 3300047443 | Bacteria | 66967 |
| 1035 | Ga0495687_000314 | 3300047443 | Bacteria | 63156 |
| 1036 | Ga0495687_000918 | 3300047443 | Bacteria | 30658 |
| 1037 | Ga0495687_001051 | 3300047443 | Bacteria | 27331 |
| 1038 | Ga0495687_001544 | 3300047443 | Bacteria | 20928 |
| 1039 | Ga0495687_033530 | 3300047443 | Bacteria | 2327 |
| 1040 | Ga0495675_0007787 | 3300047444 | Bacteria | 6611 |
| 1041 | Ga0495675_0009593 | 3300047444 | Bacteria | 6028 |
| 1042 | Ga0495677_0000015 | 3300047445 | Bacteria | 129962 |
| 1043 | Ga0495677_0000569 | 3300047445 | Bacteria | 15189 |
| 1044 | Ga0495677_0000679 | 3300047445 | Bacteria | 13773 |
| 1045 | Ga0495677_0002429 | 3300047445 | Bacteria | 7315 |
| 1046 | Ga0495677_0004887 | 3300047445 | Bacteria | 5110 |
| 1047 | Ga0495677_0005652 | 3300047445 | Bacteria | 4739 |
| 1048 | Ga0495677_0009353 | 3300047445 | Bacteria | 3621 |
| 1049 | Ga0495677_0010826 | 3300047445 | Bacteria | 3341 |
| 1050 | Ga0495677_0022559 | 3300047445 | Bacteria | 2283 |
| 1051 | Ga0495677_0024284 | 3300047445 | Bacteria | 2198 |
| 1052 | Ga0495677_0027933 | 3300047445 | Bacteria | 2047 |
| 1053 | Ga0495677_0030599 | 3300047445 | Bacteria | 1959 |
| 1054 | Ga0495679_005376 | 3300047446 | Bacteria | 5682 |
| 1055 | Ga0495679_007325 | 3300047446 | Bacteria | 4613 |
| 1056 | Ga0495679_013525 | 3300047446 | Bacteria | 3059 |
| 1057 | Ga0495679_027420 | 3300047446 | Bacteria | 1879 |
| 1058 | Ga0495685_000008 | 3300047447 | Bacteria | 95629 |
| 1059 | Ga0495685_000199 | 3300047447 | Bacteria | 20154 |
| 1060 | Ga0495685_011820 | 3300047447 | Bacteria | 2952 |
| 1061 | Ga0495685_012632 | 3300047447 | Bacteria | 2861 |
| 1062 | Ga0495685_014336 | 3300047447 | Bacteria | 2692 |
| 1063 | Ga0495685_020018 | 3300047447 | Bacteria | 2299 |
| 1064 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 1065 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 1066 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 1067 | Ga0495673_0015767 | 3300047469 | Bacteria | 3883 |
| 1068 | Ga0495681_0000700 | 3300047470 | Bacteria | 25596 |
| 1069 | Ga0495681_0003376 | 3300047470 | Bacteria | 11109 |
| 1070 | Ga0495681_0011812 | 3300047470 | Bacteria | 5171 |
| 1071 | Ga0495681_0024264 | 3300047470 | Bacteria | 3199 |
| 1072 | Ga0495681_0027563 | 3300047470 | Bacteria | 2936 |
| 1073 | Ga0495681_0030815 | 3300047470 | Bacteria | 2725 |
| 1074 | Ga0495681_0037283 | 3300047470 | Bacteria | 2396 |
| 1075 | Ga0495681_0061210 | 3300047470 | Bacteria | 1734 |
| 1076 | Ga0495681_0067778 | 3300047470 | Bacteria | 1625 |
| 1077 | Ga0495686_0000163 | 3300047472 | Bacteria | 126514 |
| 1078 | Ga0495686_0001540 | 3300047472 | Bacteria | 24691 |
| 1079 | Ga0495686_0002255 | 3300047472 | Bacteria | 18587 |
| 1080 | Ga0495686_0026085 | 3300047472 | Bacteria | 3825 |
| 1081 | Ga0495686_0078606 | 3300047472 | Bacteria | 2019 |
| 1082 | Ga0495593_0001956 | 3300047673 | Bacteria | 12295 |
| 1083 | Ga0495593_0026634 | 3300047673 | Bacteria | 3190 |
| 1084 | Ga0495602_0000323 | 3300048088 | Bacteria | 44156 |
| 1085 | Ga0495602_0014971 | 3300048088 | Bacteria | 7846 |
| 1086 | Ga0495614_0009833 | 3300048089 | Bacteria | 4225 |
| 1087 | Ga0495614_0012614 | 3300048089 | Bacteria | 3707 |
| 1088 | Ga0495614_0039758 | 3300048089 | Bacteria | 2019 |
| 1089 | Ga0495614_0048154 | 3300048089 | Bacteria | 1828 |
| 1090 | Ga0495626_0000182 | 3300048091 | Bacteria | 76384 |
| 1091 | Ga0495626_0001143 | 3300048091 | Bacteria | 22159 |
| 1092 | Ga0495626_0002715 | 3300048091 | Bacteria | 11949 |
| 1093 | Ga0495626_0010792 | 3300048091 | Bacteria | 4854 |
| 1094 | Ga0495626_0010964 | 3300048091 | Bacteria | 4812 |
| 1095 | Ga0495626_0012497 | 3300048091 | Bacteria | 4448 |
| 1096 | Ga0495626_0018137 | 3300048091 | Bacteria | 3541 |
| 1097 | Ga0495626_0020785 | 3300048091 | Bacteria | 3266 |
| 1098 | Ga0495626_0027079 | 3300048091 | Bacteria | 2788 |
| 1099 | Ga0495626_0061724 | 3300048091 | Bacteria | 1703 |
| 1100 | Ga0495626_0075258 | 3300048091 | Bacteria | 1509 |
| 1101 | Ga0495626_0119831 | 3300048091 | Bacteria | 1132 |
| 1102 | Ga0496100_0115312 | 3300048903 | Bacteria | 1873 |
| 1103 | Ga0496100_0207315 | 3300048903 | Bacteria | 1432 |
| 1104 | Ga0496101_0027763 | 3300048904 | Bacteria | 3946 |
| 1105 | Ga0496101_0033957 | 3300048904 | Bacteria | 3602 |
| 1106 | Ga0496101_0180814 | 3300048904 | Bacteria | 1624 |
| 1107 | Ga0496102_0000024 | 3300048905 | Bacteria | 227873 |
| 1108 | Ga0496102_0000154 | 3300048905 | Bacteria | 93518 |
| 1109 | Ga0496102_0026028 | 3300048905 | Bacteria | 5213 |
| 1110 | Ga0496102_0082748 | 3300048905 | Bacteria | 2960 |
| 1111 | Ga0496102_0129461 | 3300048905 | Bacteria | 2361 |
| 1112 | Ga0496102_0207244 | 3300048905 | Bacteria | 1848 |
| 1113 | Ga0496103_0006301 | 3300048906 | Bacteria | 7091 |
| 1114 | Ga0496103_0028900 | 3300048906 | Bacteria | 3367 |
| 1115 | Ga0496103_0062928 | 3300048906 | Bacteria | 2310 |
| 1116 | Ga0496104_0013736 | 3300048907 | Bacteria | 7305 |
| 1117 | Ga0496104_0024049 | 3300048907 | Bacteria | 5605 |
| 1118 | Ga0496104_0046944 | 3300048907 | Bacteria | 4069 |
| 1119 | Ga0496105_0000967 | 3300048908 | Bacteria | 19748 |
| 1120 | Ga0496105_0015981 | 3300048908 | Bacteria | 5986 |
| 1121 | Ga0496105_0208179 | 3300048908 | Bacteria | 1595 |
| 1122 | Ga0496105_0229440 | 3300048908 | Bacteria | 1509 |
| 1123 | Ga0496106_0269751 | 3300048909 | Bacteria | 1362 |
| 1124 | Ga0496106_0353616 | 3300048909 | Bacteria | 1180 |
| 1125 | Ga0496107_0014903 | 3300048910 | Bacteria | 5443 |
| 1126 | Ga0496107_0056252 | 3300048910 | Bacteria | 2842 |
| 1127 | Ga0496108_0079390 | 3300048911 | Bacteria | 2778 |
| 1128 | Ga0496108_0090016 | 3300048911 | Bacteria | 2608 |
| 1129 | Ga0496109_0066229 | 3300048912 | Bacteria | 3307 |
| 1130 | Ga0496109_0230265 | 3300048912 | Bacteria | 1743 |
| 1131 | Ga0496110_0000229 | 3300048913 | Bacteria | 36388 |
| 1132 | Ga0496110_0007614 | 3300048913 | Bacteria | 8657 |
| 1133 | Ga0496110_0038075 | 3300048913 | Bacteria | 4183 |
| 1134 | Ga0496110_0048976 | 3300048913 | Bacteria | 3705 |
| 1135 | Ga0496110_0060061 | 3300048913 | Bacteria | 3352 |
| 1136 | Ga0496111_0012670 | 3300048914 | Bacteria | 5714 |
| 1137 | Ga0496111_0065800 | 3300048914 | Bacteria | 2631 |
| 1138 | Ga0496112_0071785 | 3300048915 | Bacteria | 3422 |
| 1139 | Ga0496113_0185920 | 3300048916 | Bacteria | 1648 |
| 1140 | Ga0496114_0005092 | 3300048917 | Bacteria | 10242 |
| 1141 | Ga0496114_0064750 | 3300048917 | Bacteria | 3062 |
| 1142 | Ga0496114_0090766 | 3300048917 | Bacteria | 2594 |
| 1143 | Ga0496114_0179600 | 3300048917 | Bacteria | 1848 |
| 1144 | Ga0496115_0009194 | 3300048918 | Bacteria | 7335 |
| 1145 | Ga0496115_0062018 | 3300048918 | Bacteria | 3015 |
| 1146 | Ga0496115_0170188 | 3300048918 | Bacteria | 1802 |
| 1147 | Ga0496115_0196201 | 3300048918 | Bacteria | 1668 |
| 1148 | Ga0496116_0012782 | 3300048919 | Bacteria | 6822 |
| 1149 | Ga0496116_0013047 | 3300048919 | Bacteria | 6737 |
| 1150 | Ga0496116_0055260 | 3300048919 | Bacteria | 2609 |
| 1151 | Ga0496116_0084320 | 3300048919 | Bacteria | 1958 |
| 1152 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 1153 | Ga0496117_0003151 | 3300048920 | Bacteria | 19665 |
| 1154 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 1155 | Ga0496118_0079447 | 3300048921 | Bacteria | 2315 |
| 1156 | Ga0496119_0001121 | 3300048922 | Bacteria | 33781 |
| 1157 | Ga0496120_0000014 | 3300048923 | Bacteria | 323163 |
| 1158 | Ga0496120_0088968 | 3300048923 | Bacteria | 1654 |
| 1159 | Ga0496121_0004138 | 3300048924 | Bacteria | 19854 |
| 1160 | Ga0496121_0028870 | 3300048924 | Bacteria | 5152 |
| 1161 | Ga0496121_0086796 | 3300048924 | Bacteria | 2458 |
| 1162 | Ga0496122_0000648 | 3300048925 | Bacteria | 70509 |
| 1163 | Ga0496122_0001132 | 3300048925 | Bacteria | 45868 |
| 1164 | Ga0496122_0005577 | 3300048925 | Bacteria | 14900 |
| 1165 | Ga0496122_0007186 | 3300048925 | Bacteria | 12469 |
| 1166 | Ga0496122_0033482 | 3300048925 | Bacteria | 4225 |
| 1167 | Ga0496123_0000473 | 3300048926 | Bacteria | 70071 |
| 1168 | Ga0496123_0004457 | 3300048926 | Bacteria | 14707 |
| 1169 | Ga0496123_0004484 | 3300048926 | Bacteria | 14641 |
| 1170 | Ga0496123_0013688 | 3300048926 | Bacteria | 6786 |
| 1171 | Ga0496123_0014227 | 3300048926 | Bacteria | 6614 |
| 1172 | Ga0496123_0029164 | 3300048926 | Bacteria | 4071 |
| 1173 | Ga0496124_0002033 | 3300048927 | Bacteria | 27478 |
| 1174 | Ga0496124_0008922 | 3300048927 | Bacteria | 10390 |
| 1175 | Ga0496124_0050628 | 3300048927 | Bacteria | 3538 |
| 1176 | Ga0496124_0054048 | 3300048927 | Bacteria | 3401 |
| 1177 | Ga0496124_0060877 | 3300048927 | Bacteria | 3166 |
| 1178 | Ga0496124_0100000 | 3300048927 | Bacteria | 2351 |
| 1179 | Ga0496124_0106386 | 3300048927 | Bacteria | 2265 |
| 1180 | Ga0496124_0121737 | 3300048927 | Bacteria | 2084 |
| 1181 | Ga0496125_0000545 | 3300048928 | Bacteria | 64939 |
| 1182 | Ga0496125_0013723 | 3300048928 | Bacteria | 7945 |
| 1183 | Ga0496125_0046260 | 3300048928 | Bacteria | 3652 |
| 1184 | Ga0496125_0076545 | 3300048928 | Bacteria | 2583 |
| 1185 | Ga0496125_0085738 | 3300048928 | Bacteria | 2385 |
| 1186 | Ga0496125_0103848 | 3300048928 | Bacteria | 2084 |
| 1187 | Ga0496126_0000657 | 3300048929 | Bacteria | 64181 |
| 1188 | Ga0496126_0008484 | 3300048929 | Bacteria | 11078 |
| 1189 | Ga0501306_003609 | 3300049127 | Bacteria | 1678 |
| 1190 | Ga0501308_000821 | 3300049128 | Bacteria | 2238 |
| 1191 | Ga0501309_001464 | 3300049129 | Bacteria | 2329 |
| 1192 | Ga0501304_000296 | 3300049160 | Bacteria | 2358 |
| 1193 | Ga0495678_000012 | 3300049459 | Bacteria | 333905 |
| 1194 | Ga0495678_000051 | 3300049459 | Bacteria | 159383 |
| 1195 | Ga0495678_000114 | 3300049459 | Bacteria | 96823 |
| 1196 | Ga0495678_001536 | 3300049459 | Bacteria | 17826 |
| 1197 | Ga0495678_002134 | 3300049459 | Bacteria | 13998 |
| 1198 | Ga0495678_002302 | 3300049459 | Bacteria | 13180 |
| 1199 | Ga0495678_008849 | 3300049459 | Bacteria | 5034 |
| 1200 | Ga0495678_017479 | 3300049459 | Bacteria | 3249 |
| 1201 | Ga0495682_0001124 | 3300049460 | Bacteria | 15548 |
| 1202 | Ga0495682_0003033 | 3300049460 | Bacteria | 7631 |
| 1203 | Ga0495682_0006100 | 3300049460 | Bacteria | 4915 |
| 1204 | Ga0495682_0009071 | 3300049460 | Bacteria | 3900 |
| 1205 | Ga0495682_0009960 | 3300049460 | Bacteria | 3696 |
| 1206 | Ga0495682_0015910 | 3300049460 | Bacteria | 2848 |
| 1207 | Ga0501316_000625 | 3300049532 | Bacteria | 2582 |
| 1208 | Ga0501316_001723 | 3300049532 | Bacteria | 1918 |
| 1209 | Ga0501033_0002988 | 3300049570 | Bacteria | 14117 |
| 1210 | Ga0501034_0000730 | 3300049571 | Bacteria | 49754 |
| 1211 | Ga0501036_0000592 | 3300049572 | Bacteria | 26278 |
| 1212 | Ga0501038_0000396 | 3300049574 | Bacteria | 37861 |
| 1213 | Ga0501038_0147246 | 3300049574 | Bacteria | 1922 |
| 1214 | Ga0501039_0015051 | 3300049575 | Bacteria | 5918 |
| 1215 | Ga0501040_0019336 | 3300049576 | Bacteria | 4529 |
| 1216 | Ga0501040_0034666 | 3300049576 | Bacteria | 3419 |
| 1217 | Ga0501041_0000044 | 3300049577 | Bacteria | 43476 |
| 1218 | Ga0501041_0016520 | 3300049577 | Bacteria | 4389 |
| 1219 | Ga0501042_0086053 | 3300049578 | Bacteria | 2254 |
| 1220 | Ga0501043_0002105 | 3300049579 | Bacteria | 16990 |
| 1221 | Ga0501046_0000460 | 3300049580 | Bacteria | 40737 |
| 1222 | Ga0501048_0001330 | 3300049582 | Bacteria | 18732 |
| 1223 | Ga0501068_0003417 | 3300049584 | Bacteria | 8543 |
| 1224 | Ga0501070_0007224 | 3300049586 | Bacteria | 9431 |
| 1225 | Ga0501070_0014537 | 3300049586 | Bacteria | 6623 |
| 1226 | Ga0501071_0003002 | 3300049587 | Bacteria | 10441 |
| 1227 | Ga0501071_0003992 | 3300049587 | Bacteria | 9311 |
| 1228 | Ga0501071_0132397 | 3300049587 | Bacteria | 1853 |
| 1229 | Ga0501072_0003291 | 3300049588 | Bacteria | 12152 |
| 1230 | Ga0501072_0011956 | 3300049588 | Bacteria | 6630 |
| 1231 | Ga0501072_0069537 | 3300049588 | Bacteria | 2780 |
| 1232 | Ga0501073_0009003 | 3300049589 | Bacteria | 7372 |
| 1233 | Ga0501075_0008691 | 3300049591 | Bacteria | 7083 |
| 1234 | Ga0501075_0188258 | 3300049591 | Bacteria | 1574 |
| 1235 | Ga0501076_0000973 | 3300049592 | Bacteria | 18756 |
| 1236 | Ga0501077_0000598 | 3300049593 | Bacteria | 21812 |
| 1237 | Ga0501077_0075456 | 3300049593 | Bacteria | 2135 |
| 1238 | Ga0501230_000237 | 3300049667 | Bacteria | 4961 |
| 1239 | Ga0501238_000615 | 3300049671 | Bacteria | 4083 |
| 1240 | Ga0501225_0026361 | 3300049705 | Bacteria | 1598 |
| 1241 | Ga0501079_0000184 | 3300049741 | Bacteria | 35607 |
| 1242 | Ga0501079_0059984 | 3300049741 | Bacteria | 2934 |
| 1243 | Ga0501080_0001609 | 3300049742 | Bacteria | 19194 |
| 1244 | Ga0501080_0030734 | 3300049742 | Bacteria | 5004 |
| 1245 | Ga0501080_0232767 | 3300049742 | Bacteria | 1683 |
| 1246 | Ga0501081_0013380 | 3300049743 | Bacteria | 5397 |
| 1247 | Ga0501083_0106966 | 3300049744 | Bacteria | 1841 |
| 1248 | Ga0501269_000236 | 3300049766 | Bacteria | 16134 |
| 1249 | Ga0501279_000406 | 3300049775 | Bacteria | 5723 |
| 1250 | Ga0501035_0000697 | 3300049822 | Bacteria | 36586 |
| 1251 | Ga0501035_0054360 | 3300049822 | Bacteria | 3578 |
| 1252 | Ga0501044_0069197 | 3300049823 | Bacteria | 3594 |
| 1253 | Ga0501044_0178686 | 3300049823 | Bacteria | 2090 |
| 1254 | Ga0501044_0212174 | 3300049823 | Bacteria | 1890 |
| 1255 | Ga0501044_0255494 | 3300049823 | Bacteria | 1692 |
| 1256 | Ga0501045_0043083 | 3300049824 | Bacteria | 3286 |
| 1257 | Ga0501045_0100336 | 3300049824 | Bacteria | 2143 |
| 1258 | nmdc:mga03683_23551_c1 | 3300050489 | Bacteria | 2400 |
| 1259 | nmdc:mga0yw44_52134_c1 | 3300050492 | Bacteria | 2480 |
| 1260 | nmdc:mga0k408_113030_c1 | 3300050493 | Bacteria | 1606 |
| 1261 | nmdc:mga06z11_61878_c1 | 3300050494 | Bacteria | 1954 |
| 1262 | nmdc:mga05p37_2303_c1 | 3300050507 | Bacteria | 22270 |
| 1263 | nmdc:mga05p37_416_c1 | 3300050507 | Bacteria | 46050 |
| 1264 | nmdc:mga09592_1897_c1 | 3300050508 | Bacteria | 16816 |
| 1265 | nmdc:mga09592_778_c1 | 3300050508 | Bacteria | 24622 |
| 1266 | nmdc:mga0qj67_163513_c1 | 3300050509 | Bacteria | 1807 |
| 1267 | nmdc:mga0qj67_3855_c1 | 3300050509 | Bacteria | 10834 |
| 1268 | nmdc:mga06r32_24306_c1 | 3300050510 | Bacteria | 5621 |
| 1269 | nmdc:mga06r32_8862_c1 | 3300050510 | Bacteria | 9066 |
| 1270 | nmdc:mga08y16_15480_c1 | 3300050511 | Bacteria | 8021 |
| 1271 | nmdc:mga08y16_6963_c1 | 3300050511 | Bacteria | 11852 |
| 1272 | nmdc:mga0n895_1134_c1 | 3300050512 | Bacteria | 19498 |
| 1273 | nmdc:mga0n895_1424_c1 | 3300050512 | Bacteria | 17895 |
| 1274 | nmdc:mga0n895_29985_c1 | 3300050512 | Bacteria | 5194 |
| 1275 | nmdc:mga0rr50_4637_c1 | 3300050513 | Bacteria | 8098 |
| 1276 | nmdc:mga0rr50_7627_c1 | 3300050513 | Bacteria | 6689 |
| 1277 | nmdc:mga08x19_12096_c1 | 3300050514 | Bacteria | 5193 |
| 1278 | nmdc:mga08x19_21639_c1 | 3300050514 | Bacteria | 3973 |
| 1279 | nmdc:mga08x19_4999_c1 | 3300050514 | Bacteria | 7839 |
| 1280 | nmdc:mga0a205_672_c1 | 3300050515 | Bacteria | 27265 |
| 1281 | Ga0495601_0003708 | 3300053077 | Bacteria | 8793 |
| 1282 | Ga0500594_0026979 | 3300053118 | Bacteria | 1484 |
| 1283 | Ga0500618_000207 | 3300053125 | Bacteria | 46848 |
| 1284 | Ga0500586_000121 | 3300053145 | Bacteria | 14126 |
| 1285 | Ga0501084_0003932 | 3300054114 | Bacteria | 12101 |
| 1286 | Ga0501084_0064163 | 3300054114 | Bacteria | 3074 |
| 1287 | Ga0501084_0154952 | 3300054114 | Bacteria | 1932 |
| 1288 | Ga0590071_014234 | 3300059421 | Bacteria | 1865 |
| 1289 | Ga0587084_003334 | 3300059477 | Bacteria | 1757 |
| 1290 | Ga0587084_006428 | 3300059477 | Bacteria | 1427 |
| 1291 | Ga0587070_007463 | 3300059491 | Bacteria | 1517 |
| 1292 | Ga0587070_009644 | 3300059491 | Bacteria | 1401 |
| 1293 | Ga0587073_0006579 | 3300059492 | Bacteria | 1796 |
| 1294 | Ga0587077_002988 | 3300059493 | Bacteria | 2082 |
| 1295 | Ga0587077_003600 | 3300059493 | Bacteria | 1963 |
| 1296 | Ga0587082_003198 | 3300059504 | Bacteria | 1941 |
| 1297 | Ga0587083_0005807 | 3300059505 | Bacteria | 1805 |
| 1298 | Ga0587085_006964 | 3300059506 | Bacteria | 1394 |
| 1299 | Ga0587088_001835 | 3300059508 | Bacteria | 2292 |
| 1300 | Ga0587088_008950 | 3300059508 | Bacteria | 1429 |
| 1301 | Ga0587088_011027 | 3300059508 | Bacteria | 1338 |
| 1302 | Ga0587090_003028 | 3300059510 | Bacteria | 1908 |
| 1303 | Ga0587091_003231 | 3300059511 | Bacteria | 2029 |
| 1304 | Ga0587091_009524 | 3300059511 | Bacteria | 1465 |
| 1305 | Ga0587092_001738 | 3300059512 | Bacteria | 2194 |
| 1306 | Ga0587092_007058 | 3300059512 | Bacteria | 1443 |
| 1307 | Ga0587101_001197 | 3300059623 | Bacteria | 2160 |
| 1308 | Ga0587109_011379 | 3300059624 | Bacteria | 1437 |
| 1309 | Ga0587067_008976 | 3300059640 | Bacteria | 1477 |
| 1310 | Ga0587068_001597 | 3300059641 | Bacteria | 2587 |
| 1311 | Ga0587068_002278 | 3300059641 | Bacteria | 2310 |
| 1312 | Ga0587068_004624 | 3300059641 | Bacteria | 1830 |
| 1313 | Ga0587068_007582 | 3300059641 | Bacteria | 1552 |
| 1314 | Ga0587068_009042 | 3300059641 | Bacteria | 1459 |
| 1315 | Ga0587069_001889 | 3300059642 | Bacteria | 2025 |
| 1316 | Ga0587072_010925 | 3300059643 | Bacteria | 1475 |
| 1317 | Ga0587075_002218 | 3300059644 | Bacteria | 2025 |
| 1318 | Ga0587076_003127 | 3300059645 | Bacteria | 1937 |
| 1319 | Ga0587076_003974 | 3300059645 | Bacteria | 1811 |
| 1320 | Ga0587076_008300 | 3300059645 | Bacteria | 1446 |
| 1321 | Ga0587078_003654 | 3300059646 | Bacteria | 1574 |
| 1322 | Ga0587079_002034 | 3300059647 | Bacteria | 2402 |
| 1323 | Ga0587079_013310 | 3300059647 | Bacteria | 1360 |
| 1324 | Ga0587102_000544 | 3300059649 | Bacteria | 2209 |
| 1325 | Ga0587124_002118 | 3300059660 | Bacteria | 1367 |
| 1326 | Ga0587071_009860 | 3300060344 | Bacteria | 1582 |
| 1327 | Ga0587071_013688 | 3300060344 | Bacteria | 1401 |
| 1328 | Ga0587111_0002989 | 3300060346 | Bacteria | 2346 |
| 1329 | Ga0501082_0002475 | 3300060353 | Bacteria | 16199 |
| 1330 | Ga0501082_0131451 | 3300060353 | Bacteria | 2172 |
| 1331 | Ga0501082_0164433 | 3300060353 | Bacteria | 1928 |
| 1332 | Ga0530510_0004819 | 3300061734 | Bacteria | 9337 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048091 | Ga0495626_0119831 | Ga0495626_0119831_48_1112 | 354 |
| 2 | iso_pu_bacteria | 2501025504 | 2501407421 | 354 |
| 3 | 3300044658 | Ga0466972_0000608 | Ga0466972_0000608_15696_16871 | 356 |
| 4 | 3300005339 | Ga0070660_100004370 | Ga0070660_1000043706 | 357 |
| 5 | 3300005344 | Ga0070661_100126000 | Ga0070661_1001260002 | 357 |
| 6 | 3300005366 | Ga0070659_100010488 | Ga0070659_1000104887 | 357 |
| 7 | 3300005457 | Ga0070662_100074596 | Ga0070662_1000745962 | 357 |
| 8 | 3300005564 | Ga0070664_100052929 | Ga0070664_1000529292 | 357 |
| 9 | 3300025919 | Ga0207657_10000785 | Ga0207657_1000078532 | 357 |
| 10 | 3300025920 | Ga0207649_10014765 | Ga0207649_100147654 | 357 |
| 11 | 3300025932 | Ga0207690_10008966 | Ga0207690_100089664 | 357 |
| 12 | 3300025945 | Ga0207679_10005829 | Ga0207679_100058295 | 357 |
| 13 | 3300049578 | Ga0501042_0086053 | Ga0501042_0086053_178_1254 | 358 |
| 14 | 3300046524 | Ga0495648_0110518 | Ga0495648_0110518_388_1470 | 359 |
| 15 | 3300039447 | Ga0436361_1015529 | Ga0436361_1015529_27_1121 | 363 |
| 16 | 3300048909 | Ga0496106_0353616 | Ga0496106_0353616_64_1155 | 363 |
| 17 | iso_pu_bacteria | 2919046199 | 2919050667 | 367 |
| 18 | 3300042009 | Ga0439451_021958 | Ga0439451_021958_71_1246 | 373 |
| 19 | 3300009098 | Ga0105245_10008434 | Ga0105245_100084347 | 375 |
| 20 | 3300049127 | Ga0501306_003609 | Ga0501306_003609_80_1258 | 376 |
| 21 | 3300035083 | Ga0373926_0010491 | Ga0373926_0010491_1624_2799 | 377 |
| 22 | 3300035089 | Ga0373944_0004560 | Ga0373944_0004560_1740_2915 | 377 |
| 23 | 3300035111 | Ga0373923_0017164 | Ga0373923_0017164_610_1785 | 377 |
| 24 | 3300035116 | Ga0373945_0006048 | Ga0373945_0006048_1277_2452 | 377 |
| 25 | 3300035171 | Ga0373946_0008207 | Ga0373946_0008207_1229_2404 | 377 |
| 26 | 3300035410 | Ga0373924_0020509 | Ga0373924_0020509_982_2157 | 377 |
| 27 | 3300035692 | Ga0373935_0021639 | Ga0373935_0021639_410_1585 | 377 |
| 28 | 3300035725 | Ga0373947_0009399 | Ga0373947_0009399_828_2003 | 377 |
| 29 | 3300046455 | Ga0495603_0026086 | Ga0495603_0026086_1850_3025 | 377 |
| 30 | 3300046535 | Ga0495586_0002047 | Ga0495586_0002047_1189_2364 | 377 |
| 31 | 3300046674 | Ga0495588_0004794 | Ga0495588_0004794_4460_5635 | 377 |
| 32 | 3300046681 | Ga0495647_0000474 | Ga0495647_0000474_4198_5373 | 377 |
| 33 | 3300046683 | Ga0495658_0005980 | Ga0495658_0005980_1315_2490 | 377 |
| 34 | 3300046690 | Ga0495624_0066340 | Ga0495624_0066340_469_1644 | 377 |
| 35 | 3300047321 | Ga0495676_0015658 | Ga0495676_0015658_4349_5524 | 377 |
| 36 | 3300005545 | Ga0070695_100140999 | Ga0070695_1001409992 | 378 |
| 37 | 3300015261 | Ga0182006_1000059 | Ga0182006_100005974 | 378 |
| 38 | 3300035691 | Ga0373931_0018621 | Ga0373931_0018621_1246_2382 | 378 |
| 39 | 3300039450 | Ga0436363_0742819 | Ga0436363_0742819_11_1147 | 378 |
| 40 | 3300046457 | Ga0495590_0000014 | Ga0495590_0000014_14483_15622 | 378 |
| 41 | 3300046616 | Ga0495668_0001360 | Ga0495668_0001360_2168_3307 | 378 |
| 42 | 3300035691 | Ga0373931_0022619 | Ga0373931_0022619_1686_2861 | 382 |
| 43 | 3300048918 | Ga0496115_0062018 | Ga0496115_0062018_593_1768 | 382 |
| 44 | 3300046523 | Ga0495644_0014504 | Ga0495644_0014504_1846_3006 | 385 |
| 45 | iso_pu_bacteria | 2671180330 | 2672337674 | 386 |
| 46 | iso_pu_bacteria | 2816332186 | 2816861940 | 386 |
| 47 | iso_pu_bacteria | 2842682962 | 2842686785 | 386 |
| 48 | iso_pu_bacteria | 2849139964 | 2849141733 | 386 |
| 49 | iso_pu_bacteria | 2857581216 | 2857583812 | 386 |
| 50 | iso_pu_bacteria | 2921643360 | 2921649974 | 386 |
| 51 | iso_pu_bacteria | 2511231003 | 2511248696 | 387 |
| 52 | iso_pu_bacteria | 2511231026 | 2511387836 | 387 |
| 53 | iso_pu_bacteria | 2521172590 | 2521560960 | 387 |
| 54 | iso_pu_bacteria | 2548876994 | 2550695964 | 387 |
| 55 | iso_pu_bacteria | 2551306416 | 2553006157 | 387 |
| 56 | iso_pu_bacteria | 2600255292 | 2601671334 | 387 |
| 57 | iso_pu_bacteria | 2643221554 | 2643789973 | 387 |
| 58 | iso_pu_bacteria | 2643221556 | 2643801809 | 387 |
| 59 | iso_pu_bacteria | 2643221603 | 2644031392 | 387 |
| 60 | iso_pu_bacteria | 2643221638 | 2644212499 | 387 |
| 61 | iso_pu_bacteria | 2643221645 | 2644255043 | 387 |
| 62 | iso_pu_bacteria | 2643221664 | 2644359168 | 387 |
| 63 | iso_pu_bacteria | 2643221684 | 2644474397 | 387 |
| 64 | iso_pu_bacteria | 2738541280 | 2738738414 | 387 |
| 65 | iso_pu_bacteria | 2738541297 | 2738826500 | 387 |
| 66 | iso_pu_bacteria | 2738541300 | 2738842789 | 387 |
| 67 | iso_pu_bacteria | 2738541357 | 2739150297 | 387 |
| 68 | iso_pu_bacteria | 2738543003 | 2739192216 | 387 |
| 69 | iso_pu_bacteria | 2738543018 | 2739273536 | 387 |
| 70 | iso_pu_bacteria | 2738543026 | 2739318693 | 387 |
| 71 | iso_pu_bacteria | 2738543029 | 2739336934 | 387 |
| 72 | iso_pu_bacteria | 2738543030 | 2739342580 | 387 |
| 73 | iso_pu_bacteria | 2765235838 | 2765567389 | 387 |
| 74 | iso_pu_bacteria | 2808606418 | 2809146160 | 387 |
| 75 | iso_pu_bacteria | 2818991445 | 2819594905 | 387 |
| 76 | iso_pu_bacteria | 2818991449 | 2819617345 | 387 |
| 77 | iso_pu_bacteria | 2821131069 | 2821135213 | 387 |
| 78 | iso_pu_bacteria | 2839094727 | 2839095269 | 387 |
| 79 | iso_pu_bacteria | 2842711865 | 2842717090 | 387 |
| 80 | iso_pu_bacteria | 2857349434 | 2857357169 | 387 |
| 81 | iso_pu_bacteria | 2857547612 | 2857548827 | 387 |
| 82 | iso_pu_bacteria | 2857553236 | 2857556809 | 387 |
| 83 | iso_pu_bacteria | 2857558681 | 2857559043 | 387 |
| 84 | iso_pu_bacteria | 2857564685 | 2857567694 | 387 |
| 85 | iso_pu_bacteria | 2869162929 | 2869164908 | 387 |
| 86 | iso_pu_bacteria | 2884811622 | 2884816129 | 387 |
| 87 | iso_pu_bacteria | 2884836552 | 2884838245 | 387 |
| 88 | iso_pu_bacteria | 2884852848 | 2884854537 | 387 |
| 89 | iso_pu_bacteria | 2885080285 | 2885080378 | 387 |
| 90 | iso_pu_bacteria | 2896154374 | 2896159206 | 387 |
| 91 | iso_pu_bacteria | 2904424332 | 2904428061 | 387 |
| 92 | iso_pu_bacteria | 2904439833 | 2904442421 | 387 |
| 93 | iso_pu_bacteria | 2904530477 | 2904533688 | 387 |
| 94 | iso_pu_bacteria | 2904584206 | 2904586645 | 387 |
| 95 | iso_pu_bacteria | 2904589729 | 2904591541 | 387 |
| 96 | iso_pu_bacteria | 2904601388 | 2904602321 | 387 |
| 97 | iso_pu_bacteria | 2919079590 | 2919083354 | 387 |
| 98 | iso_pu_bacteria | 2919476304 | 2919476672 | 387 |
| 99 | iso_pu_bacteria | 2923510766 | 2923514799 | 387 |
| 100 | iso_pu_bacteria | 2928130867 | 2928133696 | 387 |
| 101 | iso_pu_bacteria | 2932410948 | 2932415476 | 387 |
| 102 | iso_pu_bacteria | 2932416698 | 2932421363 | 387 |
| 103 | iso_pu_bacteria | 2987636660 | 2987644559 | 387 |
| 104 | iso_pu_bacteria | 8047673197 | 8047676374 | 387 |
| 105 | iso_pu_bacteria | 3005445848 | 3005452628 | 388 |
| 106 | 3300048914 | Ga0496111_0012670 | Ga0496111_0012670_1568_2743 | 390 |
| 107 | 3300049705 | Ga0501225_0026361 | Ga0501225_0026361_378_1553 | 390 |
| 108 | 3300002704 | JGI25155J39150_1000224 | JGI25155J39150_10002243 | 391 |
| 109 | 3300002705 | JGI25156J39149_1000357 | JGI25156J39149_10003573 | 391 |
| 110 | 3300002705 | JGI25156J39149_1004830 | JGI25156J39149_10048303 | 391 |
| 111 | 3300002738 | JGI25154J39366_1000298 | JGI25154J39366_10002983 | 391 |
| 112 | 3300002738 | JGI25154J39366_1000314 | JGI25154J39366_10003143 | 391 |
| 113 | 3300002738 | JGI25154J39366_1001528 | JGI25154J39366_10015287 | 391 |
| 114 | 3300002741 | JGI25157J39369_1000262 | JGI25157J39369_100026218 | 391 |
| 115 | 3300002773 | JGI25152J39213_1001968 | JGI25152J39213_10019682 | 391 |
| 116 | 3300002774 | JGI25150J39212_1004788 | JGI25150J39212_10047882 | 391 |
| 117 | 3300002987 | JGI25159J45721_1001503 | JGI25159J45721_10015038 | 391 |
| 118 | 3300002987 | JGI25159J45721_1001567 | JGI25159J45721_10015679 | 391 |
| 119 | 3300002987 | JGI25159J45721_1001931 | JGI25159J45721_10019317 | 391 |
| 120 | 3300003163 | Ga0006759J45824_1029604 | Ga0006759J45824_10296042 | 391 |
| 121 | 3300003163 | Ga0006759J45824_1036116 | Ga0006759J45824_10361161 | 391 |
| 122 | 3300003163 | Ga0006759J45824_1038593 | Ga0006759J45824_10385931 | 391 |
| 123 | 3300003215 | JGI25153J46596_10021355 | JGI25153J46596_100213552 | 391 |
| 124 | 3300003354 | JGI25160J50197_1002629 | JGI25160J50197_10026297 | 391 |
| 125 | 3300003374 | JGI25161J50226_1000851 | JGI25161J50226_10008518 | 391 |
| 126 | 3300003544 | Ga0007417J51691_1019026 | Ga0007417J51691_10190262 | 391 |
| 127 | 3300003544 | Ga0007417J51691_1035094 | Ga0007417J51691_10350941 | 391 |
| 128 | 3300003574 | Ga0007410J51695_1004766 | Ga0007410J51695_10047661 | 391 |
| 129 | 3300003574 | Ga0007410J51695_1015802 | Ga0007410J51695_10158022 | 391 |
| 130 | 3300003574 | Ga0007410J51695_1016077 | Ga0007410J51695_10160772 | 391 |
| 131 | 3300003575 | Ga0007409J51694_1008022 | Ga0007409J51694_10080222 | 391 |
| 132 | 3300003577 | Ga0007416J51690_1008222 | Ga0007416J51690_10082222 | 391 |
| 133 | 3300003577 | Ga0007416J51690_1048588 | Ga0007416J51690_10485881 | 391 |
| 134 | 3300003611 | Ga0007411J51799_105301 | Ga0007411J51799_1053012 | 391 |
| 135 | 3300003611 | Ga0007411J51799_107039 | Ga0007411J51799_1070391 | 391 |
| 136 | 3300003693 | Ga0032354_1017755 | Ga0032354_10177551 | 391 |
| 137 | 3300003751 | Ga0055538_1000110 | Ga0055538_100011014 | 391 |
| 138 | 3300003752 | Ga0055539_1000159 | Ga0055539_100015914 | 391 |
| 139 | 3300003756 | Ga0055533_1000161 | Ga0055533_100016114 | 391 |
| 140 | 3300003758 | Ga0055532_1000059 | Ga0055532_100005930 | 391 |
| 141 | 3300003759 | Ga0055525_1000023 | Ga0055525_1000023133 | 391 |
| 142 | 3300003759 | Ga0055525_1000214 | Ga0055525_100021414 | 391 |
| 143 | 3300003761 | Ga0055535_1003465 | Ga0055535_10034653 | 391 |
| 144 | 3300003763 | Ga0055529_1000015 | Ga0055529_1000015339 | 391 |
| 145 | 3300003771 | Ga0055526_1000127 | Ga0055526_100012714 | 391 |
| 146 | 3300003771 | Ga0055526_1000236 | Ga0055526_100023650 | 391 |
| 147 | 3300003771 | Ga0055526_1000251 | Ga0055526_100025131 | 391 |
| 148 | 3300003771 | Ga0055526_1002785 | Ga0055526_100278514 | 391 |
| 149 | 3300003771 | Ga0055526_1007677 | Ga0055526_10076773 | 391 |
| 150 | 3300003771 | Ga0055526_1013753 | Ga0055526_10137534 | 391 |
| 151 | 3300003773 | Ga0055537_1000121 | Ga0055537_100012111 | 391 |
| 152 | 3300003775 | Ga0055524_1000017 | Ga0055524_1000017130 | 391 |
| 153 | 3300003775 | Ga0055524_1003529 | Ga0055524_10035294 | 391 |
| 154 | 3300003775 | Ga0055524_1005101 | Ga0055524_10051017 | 391 |
| 155 | 3300003775 | Ga0055524_1009191 | Ga0055524_10091912 | 391 |
| 156 | 3300003784 | Ga0055534_1000033 | Ga0055534_100003395 | 391 |
| 157 | 3300003784 | Ga0055534_1011135 | Ga0055534_10111351 | 391 |
| 158 | 3300003790 | Ga0055528_1000020 | Ga0055528_100002095 | 391 |
| 159 | 3300003790 | Ga0055528_1004648 | Ga0055528_10046486 | 391 |
| 160 | 3300003791 | Ga0055530_10011502 | Ga0055530_100115024 | 391 |
| 161 | 3300003794 | Ga0055531_10005155 | Ga0055531_100051557 | 391 |
| 162 | 3300003841 | Ga0055541_1000105 | Ga0055541_100010514 | 391 |
| 163 | 3300004625 | Ga0055543_1001887 | Ga0055543_10018878 | 391 |
| 164 | 3300004625 | Ga0055543_1005974 | Ga0055543_10059742 | 391 |
| 165 | 3300005262 | Ga0065165_1000045 | Ga0065165_100004596 | 391 |
| 166 | 3300005262 | Ga0065165_1000305 | Ga0065165_100030518 | 391 |
| 167 | 3300005262 | Ga0065165_1005109 | Ga0065165_10051098 | 391 |
| 168 | 3300005262 | Ga0065165_1006783 | Ga0065165_10067835 | 391 |
| 169 | 3300005328 | Ga0070676_10047019 | Ga0070676_100470192 | 391 |
| 170 | 3300005331 | Ga0070670_100016728 | Ga0070670_1000167282 | 391 |
| 171 | 3300005331 | Ga0070670_100150404 | Ga0070670_1001504042 | 391 |
| 172 | 3300005334 | Ga0068869_100001616 | Ga0068869_1000016169 | 391 |
| 173 | 3300005334 | Ga0068869_100071471 | Ga0068869_1000714712 | 391 |
| 174 | 3300005335 | Ga0070666_10006248 | Ga0070666_100062486 | 391 |
| 175 | 3300005336 | Ga0070680_100024156 | Ga0070680_1000241562 | 391 |
| 176 | 3300005336 | Ga0070680_100033182 | Ga0070680_1000331824 | 391 |
| 177 | 3300005336 | Ga0070680_100153535 | Ga0070680_1001535352 | 391 |
| 178 | 3300005337 | Ga0070682_100064222 | Ga0070682_1000642222 | 391 |
| 179 | 3300005338 | Ga0068868_100000209 | Ga0068868_10000020924 | 391 |
| 180 | 3300005338 | Ga0068868_100009979 | Ga0068868_1000099793 | 391 |
| 181 | 3300005338 | Ga0068868_100016011 | Ga0068868_1000160112 | 391 |
| 182 | 3300005339 | Ga0070660_100087616 | Ga0070660_1000876162 | 391 |
| 183 | 3300005340 | Ga0070689_100003869 | Ga0070689_1000038692 | 391 |
| 184 | 3300005341 | Ga0070691_10001291 | Ga0070691_100012918 | 391 |
| 185 | 3300005343 | Ga0070687_100000190 | Ga0070687_10000019016 | 391 |
| 186 | 3300005344 | Ga0070661_100031382 | Ga0070661_1000313822 | 391 |
| 187 | 3300005345 | Ga0070692_10047798 | Ga0070692_100477982 | 391 |
| 188 | 3300005347 | Ga0070668_100039237 | Ga0070668_1000392372 | 391 |
| 189 | 3300005353 | Ga0070669_100003300 | Ga0070669_1000033003 | 391 |
| 190 | 3300005354 | Ga0070675_100131700 | Ga0070675_1001317002 | 391 |
| 191 | 3300005355 | Ga0070671_100006266 | Ga0070671_1000062668 | 391 |
| 192 | 3300005355 | Ga0070671_100025746 | Ga0070671_1000257465 | 391 |
| 193 | 3300005356 | Ga0070674_100089309 | Ga0070674_1000893092 | 391 |
| 194 | 3300005367 | Ga0070667_100001572 | Ga0070667_10000157215 | 391 |
| 195 | 3300005367 | Ga0070667_100003611 | Ga0070667_10000361110 | 391 |
| 196 | 3300005367 | Ga0070667_100195824 | Ga0070667_1001958241 | 391 |
| 197 | 3300005367 | Ga0070667_100204380 | Ga0070667_1002043802 | 391 |
| 198 | 3300005367 | Ga0070667_100334754 | Ga0070667_1003347542 | 391 |
| 199 | 3300005406 | Ga0070703_10010227 | Ga0070703_100102272 | 391 |
| 200 | 3300005436 | Ga0070713_100023776 | Ga0070713_1000237762 | 391 |
| 201 | 3300005438 | Ga0070701_10006881 | Ga0070701_100068812 | 391 |
| 202 | 3300005439 | Ga0070711_100052190 | Ga0070711_1000521902 | 391 |
| 203 | 3300005439 | Ga0070711_100294368 | Ga0070711_1002943681 | 391 |
| 204 | 3300005440 | Ga0070705_100000320 | Ga0070705_1000003206 | 391 |
| 205 | 3300005440 | Ga0070705_100006868 | Ga0070705_1000068685 | 391 |
| 206 | 3300005441 | Ga0070700_100000571 | Ga0070700_1000005714 | 391 |
| 207 | 3300005441 | Ga0070700_100000733 | Ga0070700_10000073315 | 391 |
| 208 | 3300005444 | Ga0070694_100000802 | Ga0070694_10000080210 | 391 |
| 209 | 3300005444 | Ga0070694_100009200 | Ga0070694_1000092006 | 391 |
| 210 | 3300005458 | Ga0070681_10000172 | Ga0070681_1000017215 | 391 |
| 211 | 3300005459 | Ga0068867_100000417 | Ga0068867_10000041715 | 391 |
| 212 | 3300005459 | Ga0068867_100003986 | Ga0068867_1000039867 | 391 |
| 213 | 3300005467 | Ga0070706_100020063 | Ga0070706_1000200632 | 391 |
| 214 | 3300005468 | Ga0070707_100150780 | Ga0070707_1001507802 | 391 |
| 215 | 3300005471 | Ga0070698_100084098 | Ga0070698_1000840983 | 391 |
| 216 | 3300005530 | Ga0070679_100071859 | Ga0070679_1000718592 | 391 |
| 217 | 3300005536 | Ga0070697_100001858 | Ga0070697_1000018585 | 391 |
| 218 | 3300005536 | Ga0070697_100003503 | Ga0070697_1000035038 | 391 |
| 219 | 3300005536 | Ga0070697_100004877 | Ga0070697_1000048774 | 391 |
| 220 | 3300005539 | Ga0068853_100090661 | Ga0068853_1000906612 | 391 |
| 221 | 3300005544 | Ga0070686_100000825 | Ga0070686_10000082515 | 391 |
| 222 | 3300005544 | Ga0070686_100062733 | Ga0070686_1000627332 | 391 |
| 223 | 3300005544 | Ga0070686_100111726 | Ga0070686_1001117262 | 391 |
| 224 | 3300005545 | Ga0070695_100000457 | Ga0070695_10000045717 | 391 |
| 225 | 3300005545 | Ga0070695_100011568 | Ga0070695_1000115685 | 391 |
| 226 | 3300005545 | Ga0070695_100069360 | Ga0070695_1000693602 | 391 |
| 227 | 3300005546 | Ga0070696_100002371 | Ga0070696_1000023714 | 391 |
| 228 | 3300005546 | Ga0070696_100004412 | Ga0070696_1000044125 | 391 |
| 229 | 3300005547 | Ga0070693_100001007 | Ga0070693_1000010074 | 391 |
| 230 | 3300005548 | Ga0070665_100071194 | Ga0070665_1000711944 | 391 |
| 231 | 3300005548 | Ga0070665_100449185 | Ga0070665_1004491851 | 391 |
| 232 | 3300005549 | Ga0070704_100003235 | Ga0070704_1000032354 | 391 |
| 233 | 3300005549 | Ga0070704_100007685 | Ga0070704_1000076852 | 391 |
| 234 | 3300005549 | Ga0070704_100009798 | Ga0070704_1000097984 | 391 |
| 235 | 3300005549 | Ga0070704_100044748 | Ga0070704_1000447482 | 391 |
| 236 | 3300005549 | Ga0070704_100046564 | Ga0070704_1000465643 | 391 |
| 237 | 3300005549 | Ga0070704_100133499 | Ga0070704_1001334991 | 391 |
| 238 | 3300005563 | Ga0068855_100003929 | Ga0068855_10000392912 | 391 |
| 239 | 3300005563 | Ga0068855_100009634 | Ga0068855_1000096342 | 391 |
| 240 | 3300005563 | Ga0068855_100027136 | Ga0068855_1000271363 | 391 |
| 241 | 3300005563 | Ga0068855_100045440 | Ga0068855_1000454403 | 391 |
| 242 | 3300005563 | Ga0068855_100100599 | Ga0068855_1001005994 | 391 |
| 243 | 3300005577 | Ga0068857_100018579 | Ga0068857_1000185794 | 391 |
| 244 | 3300005577 | Ga0068857_100047853 | Ga0068857_1000478533 | 391 |
| 245 | 3300005578 | Ga0068854_100002076 | Ga0068854_1000020763 | 391 |
| 246 | 3300005578 | Ga0068854_100209262 | Ga0068854_1002092621 | 391 |
| 247 | 3300005614 | Ga0068856_100003781 | Ga0068856_10000378113 | 391 |
| 248 | 3300005614 | Ga0068856_100031110 | Ga0068856_1000311103 | 391 |
| 249 | 3300005614 | Ga0068856_100112324 | Ga0068856_1001123242 | 391 |
| 250 | 3300005615 | Ga0070702_100000050 | Ga0070702_1000000506 | 391 |
| 251 | 3300005616 | Ga0068852_100027471 | Ga0068852_1000274712 | 391 |
| 252 | 3300005617 | Ga0068859_100000253 | Ga0068859_10000025339 | 391 |
| 253 | 3300005617 | Ga0068859_100000332 | Ga0068859_10000033247 | 391 |
| 254 | 3300005617 | Ga0068859_100017454 | Ga0068859_1000174544 | 391 |
| 255 | 3300005617 | Ga0068859_100050419 | Ga0068859_1000504196 | 391 |
| 256 | 3300005617 | Ga0068859_100087857 | Ga0068859_1000878573 | 391 |
| 257 | 3300005618 | Ga0068864_100004666 | Ga0068864_1000046663 | 391 |
| 258 | 3300005618 | Ga0068864_100102475 | Ga0068864_1001024751 | 391 |
| 259 | 3300005618 | Ga0068864_100302832 | Ga0068864_1003028322 | 391 |
| 260 | 3300005718 | Ga0068866_10000489 | Ga0068866_1000048911 | 391 |
| 261 | 3300005719 | Ga0068861_100004686 | Ga0068861_1000046866 | 391 |
| 262 | 3300005719 | Ga0068861_100119551 | Ga0068861_1001195512 | 391 |
| 263 | 3300005840 | Ga0068870_10051688 | Ga0068870_100516882 | 391 |
| 264 | 3300005841 | Ga0068863_100000653 | Ga0068863_10000065318 | 391 |
| 265 | 3300005841 | Ga0068863_100010939 | Ga0068863_1000109396 | 391 |
| 266 | 3300005841 | Ga0068863_100038955 | Ga0068863_1000389553 | 391 |
| 267 | 3300005842 | Ga0068858_100000503 | Ga0068858_10000050329 | 391 |
| 268 | 3300005842 | Ga0068858_100025338 | Ga0068858_1000253384 | 391 |
| 269 | 3300005842 | Ga0068858_100104904 | Ga0068858_1001049043 | 391 |
| 270 | 3300005842 | Ga0068858_100107126 | Ga0068858_1001071262 | 391 |
| 271 | 3300005843 | Ga0068860_100001764 | Ga0068860_1000017647 | 391 |
| 272 | 3300005843 | Ga0068860_100011672 | Ga0068860_1000116724 | 391 |
| 273 | 3300005843 | Ga0068860_100022107 | Ga0068860_1000221074 | 391 |
| 274 | 3300005844 | Ga0068862_100007673 | Ga0068862_1000076732 | 391 |
| 275 | 3300005844 | Ga0068862_100098252 | Ga0068862_1000982522 | 391 |
| 276 | 3300005985 | Ga0081539_10003343 | Ga0081539_1000334313 | 391 |
| 277 | 3300006038 | Ga0075365_10045830 | Ga0075365_100458301 | 391 |
| 278 | 3300006042 | Ga0075368_10039788 | Ga0075368_100397882 | 391 |
| 279 | 3300006048 | Ga0075363_100011589 | Ga0075363_1000115892 | 391 |
| 280 | 3300006163 | Ga0070715_10041543 | Ga0070715_100415432 | 391 |
| 281 | 3300006178 | Ga0075367_10012620 | Ga0075367_100126204 | 391 |
| 282 | 3300006195 | Ga0075366_10075245 | Ga0075366_100752452 | 391 |
| 283 | 3300006237 | Ga0097621_100000676 | Ga0097621_10000067620 | 391 |
| 284 | 3300006237 | Ga0097621_100065842 | Ga0097621_1000658423 | 391 |
| 285 | 3300006358 | Ga0068871_100002899 | Ga0068871_1000028998 | 391 |
| 286 | 3300006358 | Ga0068871_100030677 | Ga0068871_1000306772 | 391 |
| 287 | 3300006844 | Ga0075428_100007878 | Ga0075428_10000787811 | 391 |
| 288 | 3300006844 | Ga0075428_100020382 | Ga0075428_1000203826 | 391 |
| 289 | 3300006846 | Ga0075430_100009032 | Ga0075430_1000090322 | 391 |
| 290 | 3300006846 | Ga0075430_100010298 | Ga0075430_1000102987 | 391 |
| 291 | 3300006847 | Ga0075431_100017867 | Ga0075431_1000178676 | 391 |
| 292 | 3300006847 | Ga0075431_100029271 | Ga0075431_1000292714 | 391 |
| 293 | 3300006847 | Ga0075431_100248848 | Ga0075431_1002488482 | 391 |
| 294 | 3300006852 | Ga0075433_10001341 | Ga0075433_1000134112 | 391 |
| 295 | 3300006852 | Ga0075433_10118571 | Ga0075433_101185712 | 391 |
| 296 | 3300006871 | Ga0075434_100000211 | Ga0075434_1000002116 | 391 |
| 297 | 3300006871 | Ga0075434_100001149 | Ga0075434_10000114911 | 391 |
| 298 | 3300006880 | Ga0075429_100000183 | Ga0075429_10000018321 | 391 |
| 299 | 3300006880 | Ga0075429_100001213 | Ga0075429_10000121316 | 391 |
| 300 | 3300006881 | Ga0068865_100005124 | Ga0068865_1000051247 | 391 |
| 301 | 3300006881 | Ga0068865_100027969 | Ga0068865_1000279692 | 391 |
| 302 | 3300006881 | Ga0068865_100060907 | Ga0068865_1000609072 | 391 |
| 303 | 3300006881 | Ga0068865_100249009 | Ga0068865_1002490091 | 391 |
| 304 | 3300006914 | Ga0075436_100002524 | Ga0075436_1000025246 | 391 |
| 305 | 3300006914 | Ga0075436_100002652 | Ga0075436_1000026526 | 391 |
| 306 | 3300006914 | Ga0075436_100019225 | Ga0075436_1000192252 | 391 |
| 307 | 3300006914 | Ga0075436_100025991 | Ga0075436_1000259914 | 391 |
| 308 | 3300006914 | Ga0075436_100067335 | Ga0075436_1000673352 | 391 |
| 309 | 3300006931 | Ga0097620_100000253 | Ga0097620_10000025339 | 391 |
| 310 | 3300006931 | Ga0097620_100000332 | Ga0097620_1000003326 | 391 |
| 311 | 3300006931 | Ga0097620_100017455 | Ga0097620_1000174554 | 391 |
| 312 | 3300006931 | Ga0097620_100050420 | Ga0097620_1000504206 | 391 |
| 313 | 3300006931 | Ga0097620_100087858 | Ga0097620_1000878583 | 391 |
| 314 | 3300006946 | Ga0079104_1006363 | Ga0079104_10063633 | 391 |
| 315 | 3300006948 | Ga0099826_10000008 | Ga0099826_10000008337 | 391 |
| 316 | 3300007076 | Ga0075435_100000938 | Ga0075435_10000093811 | 391 |
| 317 | 3300007076 | Ga0075435_100002363 | Ga0075435_1000023639 | 391 |
| 318 | 3300007076 | Ga0075435_100006459 | Ga0075435_1000064592 | 391 |
| 319 | 3300007076 | Ga0075435_100064346 | Ga0075435_1000643462 | 391 |
| 320 | 3300007076 | Ga0075435_100094099 | Ga0075435_1000940992 | 391 |
| 321 | 3300007788 | Ga0099795_10000045 | Ga0099795_1000004521 | 391 |
| 322 | 3300009011 | Ga0105251_10016033 | Ga0105251_100160333 | 391 |
| 323 | 3300009036 | Ga0105244_10000791 | Ga0105244_100007919 | 391 |
| 324 | 3300009036 | Ga0105244_10003927 | Ga0105244_100039279 | 391 |
| 325 | 3300009036 | Ga0105244_10033860 | Ga0105244_100338602 | 391 |
| 326 | 3300009036 | Ga0105244_10062285 | Ga0105244_100622852 | 391 |
| 327 | 3300009093 | Ga0105240_10000787 | Ga0105240_1000078743 | 391 |
| 328 | 3300009093 | Ga0105240_10013732 | Ga0105240_100137324 | 391 |
| 329 | 3300009093 | Ga0105240_10082386 | Ga0105240_100823862 | 391 |
| 330 | 3300009094 | Ga0111539_10079922 | Ga0111539_100799222 | 391 |
| 331 | 3300009094 | Ga0111539_10153767 | Ga0111539_101537672 | 391 |
| 332 | 3300009098 | Ga0105245_10000115 | Ga0105245_1000011517 | 391 |
| 333 | 3300009098 | Ga0105245_10057074 | Ga0105245_100570742 | 391 |
| 334 | 3300009101 | Ga0105247_10000643 | Ga0105247_1000064316 | 391 |
| 335 | 3300009101 | Ga0105247_10009912 | Ga0105247_100099125 | 391 |
| 336 | 3300009147 | Ga0114129_10001051 | Ga0114129_1000105115 | 391 |
| 337 | 3300009147 | Ga0114129_10051993 | Ga0114129_100519936 | 391 |
| 338 | 3300009147 | Ga0114129_10223526 | Ga0114129_102235262 | 391 |
| 339 | 3300009147 | Ga0114129_10339915 | Ga0114129_103399152 | 391 |
| 340 | 3300009148 | Ga0105243_10001566 | Ga0105243_100015669 | 391 |
| 341 | 3300009148 | Ga0105243_10014419 | Ga0105243_100144192 | 391 |
| 342 | 3300009174 | Ga0105241_10031834 | Ga0105241_100318344 | 391 |
| 343 | 3300009174 | Ga0105241_10055916 | Ga0105241_100559164 | 391 |
| 344 | 3300009176 | Ga0105242_10005505 | Ga0105242_100055052 | 391 |
| 345 | 3300009176 | Ga0105242_10028849 | Ga0105242_100288492 | 391 |
| 346 | 3300009176 | Ga0105242_10209075 | Ga0105242_102090751 | 391 |
| 347 | 3300009176 | Ga0105242_10312153 | Ga0105242_103121531 | 391 |
| 348 | 3300009177 | Ga0105248_10019135 | Ga0105248_100191354 | 391 |
| 349 | 3300009177 | Ga0105248_10222492 | Ga0105248_102224922 | 391 |
| 350 | 3300009545 | Ga0105237_10017152 | Ga0105237_100171523 | 391 |
| 351 | 3300009545 | Ga0105237_10048963 | Ga0105237_100489631 | 391 |
| 352 | 3300009551 | Ga0105238_10000537 | Ga0105238_100005372 | 391 |
| 353 | 3300009553 | Ga0105249_10001691 | Ga0105249_100016918 | 391 |
| 354 | 3300009553 | Ga0105249_10001995 | Ga0105249_1000199514 | 391 |
| 355 | 3300009553 | Ga0105249_10083668 | Ga0105249_100836683 | 391 |
| 356 | 3300009553 | Ga0105249_10194629 | Ga0105249_101946292 | 391 |
| 357 | 3300010159 | Ga0099796_10000053 | Ga0099796_1000005314 | 391 |
| 358 | 3300010375 | Ga0105239_10019688 | Ga0105239_100196882 | 391 |
| 359 | 3300010375 | Ga0105239_10103578 | Ga0105239_101035783 | 391 |
| 360 | 3300010375 | Ga0105239_10118690 | Ga0105239_101186902 | 391 |
| 361 | 3300013100 | Ga0157373_10086080 | Ga0157373_100860802 | 391 |
| 362 | 3300013102 | Ga0157371_10000003 | Ga0157371_10000003183 | 391 |
| 363 | 3300013296 | Ga0157374_10000173 | Ga0157374_1000017323 | 391 |
| 364 | 3300013296 | Ga0157374_10118484 | Ga0157374_101184842 | 391 |
| 365 | 3300013296 | Ga0157374_10131187 | Ga0157374_101311872 | 391 |
| 366 | 3300013297 | Ga0157378_10001030 | Ga0157378_1000103020 | 391 |
| 367 | 3300013297 | Ga0157378_10013562 | Ga0157378_100135627 | 391 |
| 368 | 3300013306 | Ga0163162_10046451 | Ga0163162_100464514 | 391 |
| 369 | 3300013306 | Ga0163162_10351100 | Ga0163162_103511002 | 391 |
| 370 | 3300013306 | Ga0163162_10415320 | Ga0163162_104153201 | 391 |
| 371 | 3300013307 | Ga0157372_10508074 | Ga0157372_105080742 | 391 |
| 372 | 3300014325 | Ga0163163_10001456 | Ga0163163_1000145614 | 391 |
| 373 | 3300014326 | Ga0157380_10159145 | Ga0157380_101591452 | 391 |
| 374 | 3300014497 | Ga0182008_10015273 | Ga0182008_100152732 | 391 |
| 375 | 3300014745 | Ga0157377_10057202 | Ga0157377_100572022 | 391 |
| 376 | 3300014968 | Ga0157379_10004821 | Ga0157379_1000482111 | 391 |
| 377 | 3300014968 | Ga0157379_10010074 | Ga0157379_100100746 | 391 |
| 378 | 3300014969 | Ga0157376_10002960 | Ga0157376_1000296010 | 391 |
| 379 | 3300014969 | Ga0157376_10013177 | Ga0157376_100131775 | 391 |
| 380 | 3300014969 | Ga0157376_10029396 | Ga0157376_100293962 | 391 |
| 381 | 3300015261 | Ga0182006_1000007 | Ga0182006_1000007184 | 391 |
| 382 | 3300015261 | Ga0182006_1034133 | Ga0182006_10341332 | 391 |
| 383 | 3300015262 | Ga0182007_10000068 | Ga0182007_1000006836 | 391 |
| 384 | 3300015262 | Ga0182007_10026974 | Ga0182007_100269743 | 391 |
| 385 | 3300015265 | Ga0182005_1000006 | Ga0182005_1000006282 | 391 |
| 386 | 3300015265 | Ga0182005_1000010 | Ga0182005_1000010164 | 391 |
| 387 | 3300020077 | Ga0206351_10268376 | Ga0206351_102683761 | 391 |
| 388 | 3300021361 | Ga0213872_10001492 | Ga0213872_1000149211 | 391 |
| 389 | 3300021361 | Ga0213872_10002646 | Ga0213872_100026462 | 391 |
| 390 | 3300021361 | Ga0213872_10003230 | Ga0213872_100032305 | 391 |
| 391 | 3300022467 | Ga0224712_10018126 | Ga0224712_100181261 | 391 |
| 392 | 3300025206 | Ga0209435_100032 | Ga0209435_100032110 | 391 |
| 393 | 3300025206 | Ga0209435_100146 | Ga0209435_10014620 | 391 |
| 394 | 3300025208 | Ga0209436_100314 | Ga0209436_1003148 | 391 |
| 395 | 3300025208 | Ga0209436_101267 | Ga0209436_1012678 | 391 |
| 396 | 3300025224 | Ga0209784_100035 | Ga0209784_100035236 | 391 |
| 397 | 3300025225 | Ga0209566_100040 | Ga0209566_100040236 | 391 |
| 398 | 3300025226 | Ga0209674_100057 | Ga0209674_100057236 | 391 |
| 399 | 3300025229 | Ga0209147_100109 | Ga0209147_100109110 | 391 |
| 400 | 3300025230 | Ga0209563_100011 | Ga0209563_100011447 | 391 |
| 401 | 3300025230 | Ga0209563_100059 | Ga0209563_100059236 | 391 |
| 402 | 3300025233 | Ga0209437_100512 | Ga0209437_1005125 | 391 |
| 403 | 3300025242 | Ga0209258_100190 | Ga0209258_10019083 | 391 |
| 404 | 3300025245 | Ga0207425_1000009 | Ga0207425_1000009363 | 391 |
| 405 | 3300025245 | Ga0207425_1000325 | Ga0207425_100032518 | 391 |
| 406 | 3300025245 | Ga0207425_1001909 | Ga0207425_10019099 | 391 |
| 407 | 3300025246 | Ga0209646_1000042 | Ga0209646_100004283 | 391 |
| 408 | 3300025246 | Ga0209646_1000113 | Ga0209646_1000113110 | 391 |
| 409 | 3300025246 | Ga0209646_1000950 | Ga0209646_10009504 | 391 |
| 410 | 3300025250 | Ga0209026_1000102 | Ga0209026_1000102110 | 391 |
| 411 | 3300025250 | Ga0209026_1001388 | Ga0209026_10013883 | 391 |
| 412 | 3300025250 | Ga0209026_1002229 | Ga0209026_10022294 | 391 |
| 413 | 3300025253 | Ga0209677_100036 | Ga0209677_100036236 | 391 |
| 414 | 3300025253 | Ga0209677_100944 | Ga0209677_10094410 | 391 |
| 415 | 3300025254 | Ga0209148_1000199 | Ga0209148_100019979 | 391 |
| 416 | 3300025256 | Ga0209759_1000104 | Ga0209759_1000104110 | 391 |
| 417 | 3300025256 | Ga0209759_1000944 | Ga0209759_10009447 | 391 |
| 418 | 3300025258 | Ga0209129_1000061 | Ga0209129_10000619 | 391 |
| 419 | 3300025263 | Ga0209565_1000032 | Ga0209565_1000032221 | 391 |
| 420 | 3300025263 | Ga0209565_1000508 | Ga0209565_100050823 | 391 |
| 421 | 3300025263 | Ga0209565_1002887 | Ga0209565_10028877 | 391 |
| 422 | 3300025272 | Ga0209455_1000031 | Ga0209455_1000031341 | 391 |
| 423 | 3300025272 | Ga0209455_1005995 | Ga0209455_10059952 | 391 |
| 424 | 3300025273 | Ga0209673_1000029 | Ga0209673_1000029246 | 391 |
| 425 | 3300025284 | Ga0209130_1000043 | Ga0209130_1000043135 | 391 |
| 426 | 3300025284 | Ga0209130_1001889 | Ga0209130_10018898 | 391 |
| 427 | 3300025291 | Ga0209675_1000019 | Ga0209675_100001997 | 391 |
| 428 | 3300025291 | Ga0209675_1007208 | Ga0209675_10072084 | 391 |
| 429 | 3300025294 | Ga0209025_1000044 | Ga0209025_1000044281 | 391 |
| 430 | 3300025295 | Ga0209564_1000010 | Ga0209564_1000010237 | 391 |
| 431 | 3300025295 | Ga0209564_1000067 | Ga0209564_1000067108 | 391 |
| 432 | 3300025295 | Ga0209564_1000115 | Ga0209564_1000115111 | 391 |
| 433 | 3300025295 | Ga0209564_1000173 | Ga0209564_1000173100 | 391 |
| 434 | 3300025295 | Ga0209564_1002315 | Ga0209564_100231515 | 391 |
| 435 | 3300025295 | Ga0209564_1005639 | Ga0209564_10056393 | 391 |
| 436 | 3300025297 | Ga0209758_1000579 | Ga0209758_100057915 | 391 |
| 437 | 3300025297 | Ga0209758_1001522 | Ga0209758_100152217 | 391 |
| 438 | 3300025298 | Ga0209050_1000040 | Ga0209050_1000040219 | 391 |
| 439 | 3300025298 | Ga0209050_1000123 | Ga0209050_100012311 | 391 |
| 440 | 3300025299 | Ga0209256_1000018 | Ga0209256_1000018348 | 391 |
| 441 | 3300025299 | Ga0209256_1000058 | Ga0209256_1000058194 | 391 |
| 442 | 3300025299 | Ga0209256_1000142 | Ga0209256_1000142133 | 391 |
| 443 | 3300025299 | Ga0209256_1001305 | Ga0209256_100130522 | 391 |
| 444 | 3300025302 | Ga0207426_1001242 | Ga0207426_100124215 | 391 |
| 445 | 3300025304 | Ga0209257_1000054 | Ga0209257_1000054180 | 391 |
| 446 | 3300025728 | Ga0207655_1002048 | Ga0207655_10020489 | 391 |
| 447 | 3300025728 | Ga0207655_1003905 | Ga0207655_10039055 | 391 |
| 448 | 3300025728 | Ga0207655_1046281 | Ga0207655_10462812 | 391 |
| 449 | 3300025885 | Ga0207653_10017786 | Ga0207653_100177862 | 391 |
| 450 | 3300025900 | Ga0207710_10000961 | Ga0207710_100009615 | 391 |
| 451 | 3300025903 | Ga0207680_10017527 | Ga0207680_100175273 | 391 |
| 452 | 3300025907 | Ga0207645_10007199 | Ga0207645_100071995 | 391 |
| 453 | 3300025910 | Ga0207684_10029150 | Ga0207684_100291503 | 391 |
| 454 | 3300025911 | Ga0207654_10009008 | Ga0207654_100090082 | 391 |
| 455 | 3300025911 | Ga0207654_10011031 | Ga0207654_100110313 | 391 |
| 456 | 3300025912 | Ga0207707_10003624 | Ga0207707_100036247 | 391 |
| 457 | 3300025913 | Ga0207695_10001940 | Ga0207695_1000194027 | 391 |
| 458 | 3300025913 | Ga0207695_10003997 | Ga0207695_100039973 | 391 |
| 459 | 3300025913 | Ga0207695_10010887 | Ga0207695_100108877 | 391 |
| 460 | 3300025917 | Ga0207660_10036373 | Ga0207660_100363732 | 391 |
| 461 | 3300025918 | Ga0207662_10000333 | Ga0207662_1000033316 | 391 |
| 462 | 3300025919 | Ga0207657_10002897 | Ga0207657_1000289718 | 391 |
| 463 | 3300025919 | Ga0207657_10047008 | Ga0207657_100470082 | 391 |
| 464 | 3300025920 | Ga0207649_10028428 | Ga0207649_100284282 | 391 |
| 465 | 3300025921 | Ga0207652_10290955 | Ga0207652_102909551 | 391 |
| 466 | 3300025922 | Ga0207646_10143728 | Ga0207646_101437282 | 391 |
| 467 | 3300025923 | Ga0207681_10016637 | Ga0207681_100166372 | 391 |
| 468 | 3300025924 | Ga0207694_10000384 | Ga0207694_100003843 | 391 |
| 469 | 3300025926 | Ga0207659_10051993 | Ga0207659_100519932 | 391 |
| 470 | 3300025926 | Ga0207659_10091349 | Ga0207659_100913492 | 391 |
| 471 | 3300025927 | Ga0207687_10011184 | Ga0207687_100111842 | 391 |
| 472 | 3300025927 | Ga0207687_10118271 | Ga0207687_101182712 | 391 |
| 473 | 3300025931 | Ga0207644_10004139 | Ga0207644_100041398 | 391 |
| 474 | 3300025931 | Ga0207644_10124009 | Ga0207644_101240092 | 391 |
| 475 | 3300025932 | Ga0207690_10202646 | Ga0207690_102026462 | 391 |
| 476 | 3300025934 | Ga0207686_10030670 | Ga0207686_100306702 | 391 |
| 477 | 3300025934 | Ga0207686_10061245 | Ga0207686_100612452 | 391 |
| 478 | 3300025935 | Ga0207709_10000917 | Ga0207709_100009177 | 391 |
| 479 | 3300025935 | Ga0207709_10114240 | Ga0207709_101142402 | 391 |
| 480 | 3300025936 | Ga0207670_10003240 | Ga0207670_100032405 | 391 |
| 481 | 3300025936 | Ga0207670_10072295 | Ga0207670_100722952 | 391 |
| 482 | 3300025937 | Ga0207669_10008554 | Ga0207669_100085542 | 391 |
| 483 | 3300025938 | Ga0207704_10000141 | Ga0207704_100001417 | 391 |
| 484 | 3300025938 | Ga0207704_10033887 | Ga0207704_100338872 | 391 |
| 485 | 3300025938 | Ga0207704_10264051 | Ga0207704_102640511 | 391 |
| 486 | 3300025940 | Ga0207691_10012268 | Ga0207691_100122687 | 391 |
| 487 | 3300025942 | Ga0207689_10001663 | Ga0207689_1000166319 | 391 |
| 488 | 3300025942 | Ga0207689_10191052 | Ga0207689_101910522 | 391 |
| 489 | 3300025945 | Ga0207679_10047371 | Ga0207679_100473713 | 391 |
| 490 | 3300025949 | Ga0207667_10000146 | Ga0207667_100001468 | 391 |
| 491 | 3300025949 | Ga0207667_10007911 | Ga0207667_100079113 | 391 |
| 492 | 3300025949 | Ga0207667_10021874 | Ga0207667_100218744 | 391 |
| 493 | 3300025949 | Ga0207667_10035181 | Ga0207667_100351813 | 391 |
| 494 | 3300025949 | Ga0207667_10061566 | Ga0207667_100615663 | 391 |
| 495 | 3300025961 | Ga0207712_10000763 | Ga0207712_1000076318 | 391 |
| 496 | 3300025961 | Ga0207712_10001549 | Ga0207712_100015494 | 391 |
| 497 | 3300025972 | Ga0207668_10029618 | Ga0207668_100296182 | 391 |
| 498 | 3300025981 | Ga0207640_10005459 | Ga0207640_100054594 | 391 |
| 499 | 3300025981 | Ga0207640_10031450 | Ga0207640_100314502 | 391 |
| 500 | 3300025986 | Ga0207658_10010157 | Ga0207658_100101577 | 391 |
| 501 | 3300025986 | Ga0207658_10036037 | Ga0207658_100360372 | 391 |
| 502 | 3300026023 | Ga0207677_10001911 | Ga0207677_100019116 | 391 |
| 503 | 3300026023 | Ga0207677_10030442 | Ga0207677_100304422 | 391 |
| 504 | 3300026035 | Ga0207703_10011030 | Ga0207703_100110302 | 391 |
| 505 | 3300026035 | Ga0207703_10022984 | Ga0207703_100229842 | 391 |
| 506 | 3300026035 | Ga0207703_10070081 | Ga0207703_100700812 | 391 |
| 507 | 3300026041 | Ga0207639_10022306 | Ga0207639_100223063 | 391 |
| 508 | 3300026041 | Ga0207639_10085764 | Ga0207639_100857642 | 391 |
| 509 | 3300026067 | Ga0207678_10044135 | Ga0207678_100441352 | 391 |
| 510 | 3300026075 | Ga0207708_10000114 | Ga0207708_1000011452 | 391 |
| 511 | 3300026075 | Ga0207708_10065819 | Ga0207708_100658192 | 391 |
| 512 | 3300026075 | Ga0207708_10140881 | Ga0207708_101408812 | 391 |
| 513 | 3300026078 | Ga0207702_10030333 | Ga0207702_100303332 | 391 |
| 514 | 3300026078 | Ga0207702_10041091 | Ga0207702_100410914 | 391 |
| 515 | 3300026078 | Ga0207702_10109756 | Ga0207702_101097562 | 391 |
| 516 | 3300026078 | Ga0207702_10317408 | Ga0207702_103174082 | 391 |
| 517 | 3300026088 | Ga0207641_10000078 | Ga0207641_1000007884 | 391 |
| 518 | 3300026088 | Ga0207641_10029235 | Ga0207641_100292353 | 391 |
| 519 | 3300026089 | Ga0207648_10000113 | Ga0207648_1000011382 | 391 |
| 520 | 3300026089 | Ga0207648_10010664 | Ga0207648_100106647 | 391 |
| 521 | 3300026089 | Ga0207648_10097267 | Ga0207648_100972671 | 391 |
| 522 | 3300026095 | Ga0207676_10292723 | Ga0207676_102927232 | 391 |
| 523 | 3300026116 | Ga0207674_10076131 | Ga0207674_100761312 | 391 |
| 524 | 3300026116 | Ga0207674_10105420 | Ga0207674_101054202 | 391 |
| 525 | 3300026118 | Ga0207675_100005429 | Ga0207675_10000542910 | 391 |
| 526 | 3300026118 | Ga0207675_100010262 | Ga0207675_1000102627 | 391 |
| 527 | 3300026121 | Ga0207683_10134453 | Ga0207683_101344532 | 391 |
| 528 | 3300026142 | Ga0207698_10091744 | Ga0207698_100917442 | 391 |
| 529 | 3300027378 | Ga0209981_1000930 | Ga0209981_10009302 | 391 |
| 530 | 3300027378 | Ga0209981_1009769 | Ga0209981_10097691 | 391 |
| 531 | 3300027395 | Ga0209996_1004501 | Ga0209996_10045012 | 391 |
| 532 | 3300027462 | Ga0210000_1002707 | Ga0210000_10027071 | 391 |
| 533 | 3300027471 | Ga0209995_1000961 | Ga0209995_10009613 | 391 |
| 534 | 3300027512 | Ga0209179_1000021 | Ga0209179_100002133 | 391 |
| 535 | 3300027526 | Ga0209968_1011722 | Ga0209968_10117221 | 391 |
| 536 | 3300027543 | Ga0209999_1009583 | Ga0209999_10095831 | 391 |
| 537 | 3300027665 | Ga0209983_1005075 | Ga0209983_10050752 | 391 |
| 538 | 3300027666 | Ga0209282_1000005 | Ga0209282_1000005335 | 391 |
| 539 | 3300027695 | Ga0209966_1001145 | Ga0209966_10011454 | 391 |
| 540 | 3300027907 | Ga0207428_10000624 | Ga0207428_1000062434 | 391 |
| 541 | 3300027907 | Ga0207428_10051818 | Ga0207428_100518182 | 391 |
| 542 | 3300028379 | Ga0268266_10129910 | Ga0268266_101299102 | 391 |
| 543 | 3300028380 | Ga0268265_10003785 | Ga0268265_100037859 | 391 |
| 544 | 3300028380 | Ga0268265_10006425 | Ga0268265_100064252 | 391 |
| 545 | 3300028381 | Ga0268264_10000380 | Ga0268264_100003804 | 391 |
| 546 | 3300028381 | Ga0268264_10002945 | Ga0268264_100029453 | 391 |
| 547 | 3300028381 | Ga0268264_10006475 | Ga0268264_100064757 | 391 |
| 548 | 3300028381 | Ga0268264_10236896 | Ga0268264_102368962 | 391 |
| 549 | 3300028381 | Ga0268264_10257045 | Ga0268264_102570452 | 391 |
| 550 | 3300028666 | Ga0265336_10000097 | Ga0265336_100000977 | 391 |
| 551 | 3300029957 | Ga0265324_10000001 | Ga0265324_10000001215 | 391 |
| 552 | 3300030745 | Ga0316182_1045184 | Ga0316182_10451841 | 391 |
| 553 | 3300031239 | Ga0265328_10000050 | Ga0265328_1000005043 | 391 |
| 554 | 3300031241 | Ga0265325_10000358 | Ga0265325_1000035816 | 391 |
| 555 | 3300031344 | Ga0265316_10171943 | Ga0265316_101719431 | 391 |
| 556 | 3300031548 | Ga0307408_100000237 | Ga0307408_10000023740 | 391 |
| 557 | 3300031548 | Ga0307408_100000238 | Ga0307408_10000023838 | 391 |
| 558 | 3300031548 | Ga0307408_100002450 | Ga0307408_1000024506 | 391 |
| 559 | 3300031548 | Ga0307408_100046907 | Ga0307408_1000469072 | 391 |
| 560 | 3300031665 | Ga0316575_10002687 | Ga0316575_100026875 | 391 |
| 561 | 3300031665 | Ga0316575_10005611 | Ga0316575_100056113 | 391 |
| 562 | 3300031691 | Ga0316579_10001345 | Ga0316579_100013453 | 391 |
| 563 | 3300031730 | Ga0307516_10002891 | Ga0307516_1000289114 | 391 |
| 564 | 3300031733 | Ga0316577_10156705 | Ga0316577_101567051 | 391 |
| 565 | 3300032002 | Ga0307416_100003997 | Ga0307416_1000039972 | 391 |
| 566 | 3300032002 | Ga0307416_100068070 | Ga0307416_1000680702 | 391 |
| 567 | 3300032002 | Ga0307416_100187738 | Ga0307416_1001877382 | 391 |
| 568 | 3300032004 | Ga0307414_10007162 | Ga0307414_100071625 | 391 |
| 569 | 3300034816 | Ga0373930_0005971 | Ga0373930_0005971_139_1314 | 391 |
| 570 | 3300034820 | Ga0373959_0011344 | Ga0373959_0011344_166_1341 | 391 |
| 571 | 3300035084 | Ga0373928_0005604 | Ga0373928_0005604_1133_2308 | 391 |
| 572 | 3300035086 | Ga0373934_0005673 | Ga0373934_0005673_3051_4226 | 391 |
| 573 | 3300035090 | Ga0373949_0025849 | Ga0373949_0025849_70_1245 | 391 |
| 574 | 3300035111 | Ga0373923_0076734 | Ga0373923_0076734_142_1317 | 391 |
| 575 | 3300035112 | Ga0373932_0000563 | Ga0373932_0000563_5947_7122 | 391 |
| 576 | 3300035113 | Ga0373936_0020490 | Ga0373936_0020490_378_1553 | 391 |
| 577 | 3300035114 | Ga0373939_0006348 | Ga0373939_0006348_1609_2784 | 391 |
| 578 | 3300035115 | Ga0373941_0019817 | Ga0373941_0019817_70_1245 | 391 |
| 579 | 3300035117 | Ga0373953_0015634 | Ga0373953_0015634_188_1366 | 391 |
| 580 | 3300035118 | Ga0373954_0000001 | Ga0373954_0000001_83410_84585 | 391 |
| 581 | 3300035120 | Ga0373957_0014165 | Ga0373957_0014165_1366_2544 | 391 |
| 582 | 3300035172 | Ga0373955_0058370 | Ga0373955_0058370_907_2091 | 391 |
| 583 | 3300035207 | Ga0373942_0004466 | Ga0373942_0004466_246_1421 | 391 |
| 584 | 3300035207 | Ga0373942_0028518 | Ga0373942_0028518_125_1300 | 391 |
| 585 | 3300035207 | Ga0373942_0037642 | Ga0373942_0037642_98_1273 | 391 |
| 586 | 3300035241 | Ga0373961_0011726 | Ga0373961_0011726_970_2145 | 391 |
| 587 | 3300035241 | Ga0373961_0013493 | Ga0373961_0013493_80_1255 | 391 |
| 588 | 3300035241 | Ga0373961_0025722 | Ga0373961_0025722_140_1315 | 391 |
| 589 | 3300035398 | Ga0316574_0001268 | Ga0316574_0001268_6872_8047 | 391 |
| 590 | 3300035410 | Ga0373924_0042206 | Ga0373924_0042206_264_1442 | 391 |
| 591 | 3300035691 | Ga0373931_0001933 | Ga0373931_0001933_2124_3299 | 391 |
| 592 | 3300035695 | Ga0373927_0002341 | Ga0373927_0002341_10149_11324 | 391 |
| 593 | 3300035695 | Ga0373927_0016007 | Ga0373927_0016007_2762_3937 | 391 |
| 594 | 3300035724 | Ga0373933_0007378 | Ga0373933_0007378_127_1302 | 391 |
| 595 | 3300035724 | Ga0373933_0017196 | Ga0373933_0017196_2413_3591 | 391 |
| 596 | 3300035724 | Ga0373933_0089282 | Ga0373933_0089282_452_1627 | 391 |
| 597 | 3300035724 | Ga0373933_0107633 | Ga0373933_0107633_495_1673 | 391 |
| 598 | 3300035725 | Ga0373947_0170455 | Ga0373947_0170455_184_1359 | 391 |
| 599 | 3300036401 | Ga0373937_0000524 | Ga0373937_0000524_16160_17335 | 391 |
| 600 | 3300036401 | Ga0373937_0005139 | Ga0373937_0005139_7422_8606 | 391 |
| 601 | 3300037068 | Ga0373925_0040447 | Ga0373925_0040447_174_1382 | 391 |
| 602 | 3300037312 | Ga0395899_0000019 | Ga0395899_0000019_257798_258976 | 391 |
| 603 | 3300037312 | Ga0395899_0000798 | Ga0395899_0000798_624_1802 | 391 |
| 604 | 3300037312 | Ga0395899_0007820 | Ga0395899_0007820_5901_7079 | 391 |
| 605 | 3300037312 | Ga0395899_0012712 | Ga0395899_0012712_1388_2563 | 391 |
| 606 | 3300037418 | Ga0395900_0000094 | Ga0395900_0000094_162683_163858 | 391 |
| 607 | 3300037418 | Ga0395900_0011030 | Ga0395900_0011030_3691_4866 | 391 |
| 608 | 3300037418 | Ga0395900_0011936 | Ga0395900_0011936_461_1636 | 391 |
| 609 | 3300037466 | Ga0395898_0120646 | Ga0395898_0120646_686_1861 | 391 |
| 610 | 3300037471 | Ga0395905_0007080 | Ga0395905_0007080_2044_3219 | 391 |
| 611 | 3300037471 | Ga0395905_0010604 | Ga0395905_0010604_5331_6506 | 391 |
| 612 | 3300037471 | Ga0395905_0075873 | Ga0395905_0075873_775_1950 | 391 |
| 613 | 3300037471 | Ga0395905_0164472 | Ga0395905_0164472_834_2012 | 391 |
| 614 | 3300037471 | Ga0395905_0256220 | Ga0395905_0256220_295_1512 | 391 |
| 615 | 3300037588 | Ga0316581_0003799 | Ga0316581_0003799_2484_3659 | 391 |
| 616 | 3300038443 | Ga0395901_0003213 | Ga0395901_0003213_14508_15683 | 391 |
| 617 | 3300038443 | Ga0395901_0004893 | Ga0395901_0004893_9602_10783 | 391 |
| 618 | 3300038443 | Ga0395901_0039068 | Ga0395901_0039068_3047_4225 | 391 |
| 619 | 3300038443 | Ga0395901_0046737 | Ga0395901_0046737_956_2131 | 391 |
| 620 | 3300039447 | Ga0436361_0173709 | Ga0436361_0173709_6883_8058 | 391 |
| 621 | 3300039447 | Ga0436361_0568855 | Ga0436361_0568855_3067_4245 | 391 |
| 622 | 3300039447 | Ga0436361_0687629 | Ga0436361_0687629_5735_6913 | 391 |
| 623 | 3300039447 | Ga0436361_1028139 | Ga0436361_1028139_257_1435 | 391 |
| 624 | 3300039447 | Ga0436361_1082582 | Ga0436361_1082582_7244_8425 | 391 |
| 625 | 3300039447 | Ga0436361_1117918 | Ga0436361_1117918_249_1427 | 391 |
| 626 | 3300041413 | Ga0439465_0035971 | Ga0439465_0035971_401_1576 | 391 |
| 627 | 3300042007 | Ga0439449_0011991 | Ga0439449_0011991_240_1415 | 391 |
| 628 | 3300042008 | Ga0439450_013487 | Ga0439450_013487_229_1404 | 391 |
| 629 | 3300042015 | Ga0439462_0025472 | Ga0439462_0025472_304_1479 | 391 |
| 630 | 3300042156 | Ga0439446_0000980 | Ga0439446_0000980_2676_3851 | 391 |
| 631 | 3300042435 | Ga0439434_0000592 | Ga0439434_0000592_2780_3955 | 391 |
| 632 | 3300042436 | Ga0439435_0000150 | Ga0439435_0000150_6901_8076 | 391 |
| 633 | 3300042437 | Ga0439444_0000591 | Ga0439444_0000591_574_1749 | 391 |
| 634 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_437465_438640 | 391 |
| 635 | 3300042876 | Ga0451577_0017865 | Ga0451577_0017865_507_1682 | 391 |
| 636 | 3300044658 | Ga0466972_0002716 | Ga0466972_0002716_851_2026 | 391 |
| 637 | 3300044658 | Ga0466972_0021883 | Ga0466972_0021883_328_1515 | 391 |
| 638 | 3300044658 | Ga0466972_0102123 | Ga0466972_0102123_18_1196 | 391 |
| 639 | 3300044673 | Ga0453683_0000059 | Ga0453683_0000059_73934_75109 | 391 |
| 640 | 3300044683 | Ga0466965_0000165 | Ga0466965_0000165_17956_19131 | 391 |
| 641 | 3300044683 | Ga0466965_0001132 | Ga0466965_0001132_5302_6489 | 391 |
| 642 | 3300044684 | Ga0466966_0015800 | Ga0466966_0015800_212_1390 | 391 |
| 643 | 3300044684 | Ga0466966_0038508 | Ga0466966_0038508_1285_2460 | 391 |
| 644 | 3300044694 | Ga0466963_0192259 | Ga0466963_0192259_235_1413 | 391 |
| 645 | 3300044706 | Ga0466964_0001917 | Ga0466964_0001917_2705_3880 | 391 |
| 646 | 3300044706 | Ga0466964_0004838 | Ga0466964_0004838_3449_4636 | 391 |
| 647 | 3300044706 | Ga0466964_0006354 | Ga0466964_0006354_2450_3625 | 391 |
| 648 | 3300044706 | Ga0466964_0018428 | Ga0466964_0018428_1054_2229 | 391 |
| 649 | 3300044706 | Ga0466964_0041673 | Ga0466964_0041673_299_1477 | 391 |
| 650 | 3300044706 | Ga0466964_0046243 | Ga0466964_0046243_553_1728 | 391 |
| 651 | 3300044712 | Ga0453684_0000075 | Ga0453684_0000075_272731_273948 | 391 |
| 652 | 3300044712 | Ga0453684_0000585 | Ga0453684_0000585_22423_23598 | 391 |
| 653 | 3300044735 | Ga0466968_0009986 | Ga0466968_0009986_311_1498 | 391 |
| 654 | 3300044842 | Ga0466957_0000353 | Ga0466957_0000353_13208_14383 | 391 |
| 655 | 3300044842 | Ga0466957_0020442 | Ga0466957_0020442_1759_2934 | 391 |
| 656 | 3300045049 | Ga0466959_0022802 | Ga0466959_0022802_1004_2179 | 391 |
| 657 | 3300045049 | Ga0466959_0065137 | Ga0466959_0065137_71_1246 | 391 |
| 658 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_112050_113225 | 391 |
| 659 | 3300045051 | Ga0451576_0000220 | Ga0451576_0000220_23152_24327 | 391 |
| 660 | 3300045051 | Ga0451576_0006716 | Ga0451576_0006716_11598_12773 | 391 |
| 661 | 3300045051 | Ga0451576_0080077 | Ga0451576_0080077_674_1849 | 391 |
| 662 | 3300045051 | Ga0451576_0112670 | Ga0451576_0112670_107_1282 | 391 |
| 663 | 3300045051 | Ga0451576_0121077 | Ga0451576_0121077_347_1522 | 391 |
| 664 | 3300045976 | Ga0466967_0007734 | Ga0466967_0007734_2733_3911 | 391 |
| 665 | 3300045976 | Ga0466967_0083453 | Ga0466967_0083453_290_1465 | 391 |
| 666 | 3300045976 | Ga0466967_0263811 | Ga0466967_0263811_453_1628 | 391 |
| 667 | 3300046452 | Ga0495617_000017 | Ga0495617_000017_195065_196240 | 391 |
| 668 | 3300046452 | Ga0495617_000025 | Ga0495617_000025_106348_107526 | 391 |
| 669 | 3300046452 | Ga0495617_000161 | Ga0495617_000161_15400_16578 | 391 |
| 670 | 3300046452 | Ga0495617_001604 | Ga0495617_001604_5449_6627 | 391 |
| 671 | 3300046452 | Ga0495617_001680 | Ga0495617_001680_3748_4938 | 391 |
| 672 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_471680_472858 | 391 |
| 673 | 3300046453 | Ga0495627_002605 | Ga0495627_002605_2160_3335 | 391 |
| 674 | 3300046453 | Ga0495627_006780 | Ga0495627_006780_1909_3084 | 391 |
| 675 | 3300046453 | Ga0495627_017149 | Ga0495627_017149_650_1969 | 391 |
| 676 | 3300046454 | Ga0495592_0000330 | Ga0495592_0000330_14174_15349 | 391 |
| 677 | 3300046455 | Ga0495603_0034431 | Ga0495603_0034431_153_1328 | 391 |
| 678 | 3300046457 | Ga0495590_0000084 | Ga0495590_0000084_44226_45401 | 391 |
| 679 | 3300046457 | Ga0495590_0001338 | Ga0495590_0001338_6806_7981 | 391 |
| 680 | 3300046457 | Ga0495590_0002892 | Ga0495590_0002892_421_1596 | 391 |
| 681 | 3300046457 | Ga0495590_0003601 | Ga0495590_0003601_4620_5798 | 391 |
| 682 | 3300046457 | Ga0495590_0016705 | Ga0495590_0016705_304_1482 | 391 |
| 683 | 3300046458 | Ga0495591_000034 | Ga0495591_000034_54330_55505 | 391 |
| 684 | 3300046459 | Ga0495629_0004476 | Ga0495629_0004476_7853_9028 | 391 |
| 685 | 3300046459 | Ga0495629_0027130 | Ga0495629_0027130_2313_3488 | 391 |
| 686 | 3300046459 | Ga0495629_0036197 | Ga0495629_0036197_1355_2530 | 391 |
| 687 | 3300046459 | Ga0495629_0104326 | Ga0495629_0104326_328_1503 | 391 |
| 688 | 3300046459 | Ga0495629_0138423 | Ga0495629_0138423_371_1546 | 391 |
| 689 | 3300046460 | Ga0495638_0000133 | Ga0495638_0000133_55618_56796 | 391 |
| 690 | 3300046460 | Ga0495638_0008243 | Ga0495638_0008243_5014_6192 | 391 |
| 691 | 3300046460 | Ga0495638_0013742 | Ga0495638_0013742_2207_3385 | 391 |
| 692 | 3300046460 | Ga0495638_0015650 | Ga0495638_0015650_1474_2649 | 391 |
| 693 | 3300046460 | Ga0495638_0028761 | Ga0495638_0028761_281_1459 | 391 |
| 694 | 3300046463 | Ga0495653_0000016 | Ga0495653_0000016_92431_93609 | 391 |
| 695 | 3300046463 | Ga0495653_0010559 | Ga0495653_0010559_4779_5954 | 391 |
| 696 | 3300046463 | Ga0495653_0099149 | Ga0495653_0099149_293_1468 | 391 |
| 697 | 3300046471 | Ga0495650_0000062 | Ga0495650_0000062_55685_56863 | 391 |
| 698 | 3300046471 | Ga0495650_0000084 | Ga0495650_0000084_21279_22454 | 391 |
| 699 | 3300046471 | Ga0495650_0000136 | Ga0495650_0000136_46233_47411 | 391 |
| 700 | 3300046471 | Ga0495650_0000141 | Ga0495650_0000141_109867_111045 | 391 |
| 701 | 3300046471 | Ga0495650_0000201 | Ga0495650_0000201_91120_92310 | 391 |
| 702 | 3300046471 | Ga0495650_0000255 | Ga0495650_0000255_13147_14325 | 391 |
| 703 | 3300046471 | Ga0495650_0001140 | Ga0495650_0001140_7755_8933 | 391 |
| 704 | 3300046471 | Ga0495650_0016111 | Ga0495650_0016111_897_2075 | 391 |
| 705 | 3300046471 | Ga0495650_0027985 | Ga0495650_0027985_713_1891 | 391 |
| 706 | 3300046472 | Ga0495580_0000673 | Ga0495580_0000673_20007_21182 | 391 |
| 707 | 3300046472 | Ga0495580_0055254 | Ga0495580_0055254_443_1627 | 391 |
| 708 | 3300046473 | Ga0495582_0022123 | Ga0495582_0022123_1791_2966 | 391 |
| 709 | 3300046473 | Ga0495582_0034372 | Ga0495582_0034372_805_1980 | 391 |
| 710 | 3300046474 | Ga0495605_0000043 | Ga0495605_0000043_94923_96101 | 391 |
| 711 | 3300046474 | Ga0495605_0000077 | Ga0495605_0000077_27228_28403 | 391 |
| 712 | 3300046474 | Ga0495605_0000471 | Ga0495605_0000471_16202_17377 | 391 |
| 713 | 3300046474 | Ga0495605_0003656 | Ga0495605_0003656_131_1309 | 391 |
| 714 | 3300046474 | Ga0495605_0003838 | Ga0495605_0003838_1859_3034 | 391 |
| 715 | 3300046474 | Ga0495605_0020215 | Ga0495605_0020215_893_2071 | 391 |
| 716 | 3300046474 | Ga0495605_0033409 | Ga0495605_0033409_761_1936 | 391 |
| 717 | 3300046474 | Ga0495605_0046049 | Ga0495605_0046049_709_1884 | 391 |
| 718 | 3300046475 | Ga0495639_0040528 | Ga0495639_0040528_309_1487 | 391 |
| 719 | 3300046476 | Ga0495662_0009077 | Ga0495662_0009077_2725_3900 | 391 |
| 720 | 3300046491 | Ga0495584_0000004 | Ga0495584_0000004_282147_283325 | 391 |
| 721 | 3300046491 | Ga0495584_0000274 | Ga0495584_0000274_28052_29227 | 391 |
| 722 | 3300046491 | Ga0495584_0003655 | Ga0495584_0003655_2175_3365 | 391 |
| 723 | 3300046491 | Ga0495584_0005749 | Ga0495584_0005749_2769_3944 | 391 |
| 724 | 3300046491 | Ga0495584_0013146 | Ga0495584_0013146_1630_2808 | 391 |
| 725 | 3300046491 | Ga0495584_0023302 | Ga0495584_0023302_1383_2558 | 391 |
| 726 | 3300046491 | Ga0495584_0025806 | Ga0495584_0025806_147_1322 | 391 |
| 727 | 3300046491 | Ga0495584_0033378 | Ga0495584_0033378_11_1186 | 391 |
| 728 | 3300046491 | Ga0495584_0050213 | Ga0495584_0050213_896_2071 | 391 |
| 729 | 3300046491 | Ga0495584_0056745 | Ga0495584_0056745_92_1270 | 391 |
| 730 | 3300046491 | Ga0495584_0076091 | Ga0495584_0076091_79_1257 | 391 |
| 731 | 3300046492 | Ga0495585_0000578 | Ga0495585_0000578_4428_5606 | 391 |
| 732 | 3300046492 | Ga0495585_0000713 | Ga0495585_0000713_23366_24544 | 391 |
| 733 | 3300046492 | Ga0495585_0001437 | Ga0495585_0001437_16989_18167 | 391 |
| 734 | 3300046492 | Ga0495585_0003217 | Ga0495585_0003217_3831_5009 | 391 |
| 735 | 3300046492 | Ga0495585_0005567 | Ga0495585_0005567_5768_6946 | 391 |
| 736 | 3300046492 | Ga0495585_0006781 | Ga0495585_0006781_5349_6557 | 391 |
| 737 | 3300046492 | Ga0495585_0007257 | Ga0495585_0007257_5024_6199 | 391 |
| 738 | 3300046492 | Ga0495585_0013513 | Ga0495585_0013513_2001_3320 | 391 |
| 739 | 3300046492 | Ga0495585_0016813 | Ga0495585_0016813_2261_3451 | 391 |
| 740 | 3300046492 | Ga0495585_0017689 | Ga0495585_0017689_1921_3096 | 391 |
| 741 | 3300046492 | Ga0495585_0028018 | Ga0495585_0028018_1743_2918 | 391 |
| 742 | 3300046492 | Ga0495585_0028728 | Ga0495585_0028728_1911_3086 | 391 |
| 743 | 3300046492 | Ga0495585_0030624 | Ga0495585_0030624_1212_2387 | 391 |
| 744 | 3300046492 | Ga0495585_0036250 | Ga0495585_0036250_1177_2355 | 391 |
| 745 | 3300046492 | Ga0495585_0040725 | Ga0495585_0040725_423_1598 | 391 |
| 746 | 3300046492 | Ga0495585_0061019 | Ga0495585_0061019_631_1809 | 391 |
| 747 | 3300046492 | Ga0495585_0066378 | Ga0495585_0066378_315_1490 | 391 |
| 748 | 3300046499 | Ga0495594_0010456 | Ga0495594_0010456_2097_3272 | 391 |
| 749 | 3300046499 | Ga0495594_0010939 | Ga0495594_0010939_2842_4017 | 391 |
| 750 | 3300046499 | Ga0495594_0012276 | Ga0495594_0012276_1365_2540 | 391 |
| 751 | 3300046499 | Ga0495594_0014538 | Ga0495594_0014538_1312_2487 | 391 |
| 752 | 3300046499 | Ga0495594_0108762 | Ga0495594_0108762_218_1393 | 391 |
| 753 | 3300046500 | Ga0495596_0000508 | Ga0495596_0000508_19677_20855 | 391 |
| 754 | 3300046500 | Ga0495596_0002024 | Ga0495596_0002024_2288_3463 | 391 |
| 755 | 3300046500 | Ga0495596_0002076 | Ga0495596_0002076_5775_7031 | 391 |
| 756 | 3300046500 | Ga0495596_0006098 | Ga0495596_0006098_1169_2377 | 391 |
| 757 | 3300046500 | Ga0495596_0009155 | Ga0495596_0009155_427_1602 | 391 |
| 758 | 3300046500 | Ga0495596_0010488 | Ga0495596_0010488_2238_3413 | 391 |
| 759 | 3300046500 | Ga0495596_0016195 | Ga0495596_0016195_346_1521 | 391 |
| 760 | 3300046500 | Ga0495596_0020366 | Ga0495596_0020366_1425_2600 | 391 |
| 761 | 3300046501 | Ga0495607_0000806 | Ga0495607_0000806_9917_11095 | 391 |
| 762 | 3300046501 | Ga0495607_0003187 | Ga0495607_0003187_8800_9978 | 391 |
| 763 | 3300046501 | Ga0495607_0005471 | Ga0495607_0005471_492_1667 | 391 |
| 764 | 3300046501 | Ga0495607_0006127 | Ga0495607_0006127_631_1806 | 391 |
| 765 | 3300046501 | Ga0495607_0009350 | Ga0495607_0009350_4074_5252 | 391 |
| 766 | 3300046501 | Ga0495607_0025650 | Ga0495607_0025650_997_2175 | 391 |
| 767 | 3300046501 | Ga0495607_0046268 | Ga0495607_0046268_612_1790 | 391 |
| 768 | 3300046506 | Ga0495583_0000044 | Ga0495583_0000044_126952_128130 | 391 |
| 769 | 3300046506 | Ga0495583_0000091 | Ga0495583_0000091_88239_89417 | 391 |
| 770 | 3300046506 | Ga0495583_0000099 | Ga0495583_0000099_22724_23902 | 391 |
| 771 | 3300046506 | Ga0495583_0000246 | Ga0495583_0000246_57538_58716 | 391 |
| 772 | 3300046506 | Ga0495583_0000936 | Ga0495583_0000936_7990_9165 | 391 |
| 773 | 3300046506 | Ga0495583_0002959 | Ga0495583_0002959_1046_2221 | 391 |
| 774 | 3300046506 | Ga0495583_0004328 | Ga0495583_0004328_7813_8991 | 391 |
| 775 | 3300046506 | Ga0495583_0008047 | Ga0495583_0008047_4318_5493 | 391 |
| 776 | 3300046506 | Ga0495583_0010011 | Ga0495583_0010011_3057_4232 | 391 |
| 777 | 3300046506 | Ga0495583_0024362 | Ga0495583_0024362_577_1752 | 391 |
| 778 | 3300046506 | Ga0495583_0027526 | Ga0495583_0027526_631_1806 | 391 |
| 779 | 3300046507 | Ga0495606_0000046 | Ga0495606_0000046_119159_120337 | 391 |
| 780 | 3300046507 | Ga0495606_0000051 | Ga0495606_0000051_118090_119268 | 391 |
| 781 | 3300046507 | Ga0495606_0000093 | Ga0495606_0000093_59263_60441 | 391 |
| 782 | 3300046507 | Ga0495606_0000476 | Ga0495606_0000476_60320_61498 | 391 |
| 783 | 3300046507 | Ga0495606_0000532 | Ga0495606_0000532_37827_39005 | 391 |
| 784 | 3300046507 | Ga0495606_0000929 | Ga0495606_0000929_508_1686 | 391 |
| 785 | 3300046507 | Ga0495606_0000986 | Ga0495606_0000986_93_1271 | 391 |
| 786 | 3300046507 | Ga0495606_0005680 | Ga0495606_0005680_8541_9716 | 391 |
| 787 | 3300046507 | Ga0495606_0014034 | Ga0495606_0014034_4505_5683 | 391 |
| 788 | 3300046507 | Ga0495606_0015400 | Ga0495606_0015400_3451_4626 | 391 |
| 789 | 3300046507 | Ga0495606_0016063 | Ga0495606_0016063_248_1423 | 391 |
| 790 | 3300046507 | Ga0495606_0019821 | Ga0495606_0019821_2325_3503 | 391 |
| 791 | 3300046507 | Ga0495606_0037849 | Ga0495606_0037849_1266_2441 | 391 |
| 792 | 3300046507 | Ga0495606_0039552 | Ga0495606_0039552_1606_2784 | 391 |
| 793 | 3300046507 | Ga0495606_0062176 | Ga0495606_0062176_767_1945 | 391 |
| 794 | 3300046511 | Ga0495608_0002611 | Ga0495608_0002611_3048_4223 | 391 |
| 795 | 3300046512 | Ga0495610_0000027 | Ga0495610_0000027_51453_52631 | 391 |
| 796 | 3300046512 | Ga0495610_0001625 | Ga0495610_0001625_1830_3005 | 391 |
| 797 | 3300046512 | Ga0495610_0002161 | Ga0495610_0002161_5533_6711 | 391 |
| 798 | 3300046512 | Ga0495610_0005034 | Ga0495610_0005034_6182_7360 | 391 |
| 799 | 3300046513 | Ga0495616_0000253 | Ga0495616_0000253_8182_9360 | 391 |
| 800 | 3300046513 | Ga0495616_0000504 | Ga0495616_0000504_24162_25337 | 391 |
| 801 | 3300046513 | Ga0495616_0000544 | Ga0495616_0000544_11127_12305 | 391 |
| 802 | 3300046513 | Ga0495616_0000591 | Ga0495616_0000591_25569_26744 | 391 |
| 803 | 3300046513 | Ga0495616_0002867 | Ga0495616_0002867_10036_11214 | 391 |
| 804 | 3300046513 | Ga0495616_0003323 | Ga0495616_0003323_4200_5378 | 391 |
| 805 | 3300046513 | Ga0495616_0005983 | Ga0495616_0005983_5205_6380 | 391 |
| 806 | 3300046513 | Ga0495616_0026912 | Ga0495616_0026912_477_1685 | 391 |
| 807 | 3300046513 | Ga0495616_0032132 | Ga0495616_0032132_680_1855 | 391 |
| 808 | 3300046513 | Ga0495616_0040587 | Ga0495616_0040587_898_2073 | 391 |
| 809 | 3300046513 | Ga0495616_0059352 | Ga0495616_0059352_205_1380 | 391 |
| 810 | 3300046513 | Ga0495616_0071683 | Ga0495616_0071683_229_1407 | 391 |
| 811 | 3300046513 | Ga0495616_0079182 | Ga0495616_0079182_219_1394 | 391 |
| 812 | 3300046513 | Ga0495616_0099479 | Ga0495616_0099479_36_1214 | 391 |
| 813 | 3300046514 | Ga0495618_0024257 | Ga0495618_0024257_980_2155 | 391 |
| 814 | 3300046515 | Ga0495620_0005087 | Ga0495620_0005087_2106_3284 | 391 |
| 815 | 3300046516 | Ga0495628_0169820 | Ga0495628_0169820_316_1491 | 391 |
| 816 | 3300046517 | Ga0495630_0002124 | Ga0495630_0002124_11248_12423 | 391 |
| 817 | 3300046517 | Ga0495630_0204089 | Ga0495630_0204089_35_1210 | 391 |
| 818 | 3300046518 | Ga0495631_0000278 | Ga0495631_0000278_14817_15992 | 391 |
| 819 | 3300046518 | Ga0495631_0000604 | Ga0495631_0000604_4431_5606 | 391 |
| 820 | 3300046518 | Ga0495631_0006277 | Ga0495631_0006277_1422_2597 | 391 |
| 821 | 3300046518 | Ga0495631_0009643 | Ga0495631_0009643_2509_3684 | 391 |
| 822 | 3300046518 | Ga0495631_0012275 | Ga0495631_0012275_2410_3729 | 391 |
| 823 | 3300046518 | Ga0495631_0014582 | Ga0495631_0014582_584_1759 | 391 |
| 824 | 3300046518 | Ga0495631_0020621 | Ga0495631_0020621_990_2246 | 391 |
| 825 | 3300046518 | Ga0495631_0038171 | Ga0495631_0038171_645_1820 | 391 |
| 826 | 3300046518 | Ga0495631_0049186 | Ga0495631_0049186_388_1566 | 391 |
| 827 | 3300046519 | Ga0495632_0000092 | Ga0495632_0000092_90033_91208 | 391 |
| 828 | 3300046519 | Ga0495632_0000136 | Ga0495632_0000136_58613_59788 | 391 |
| 829 | 3300046519 | Ga0495632_0001025 | Ga0495632_0001025_21532_22707 | 391 |
| 830 | 3300046519 | Ga0495632_0003825 | Ga0495632_0003825_1708_2883 | 391 |
| 831 | 3300046519 | Ga0495632_0007739 | Ga0495632_0007739_4809_5987 | 391 |
| 832 | 3300046519 | Ga0495632_0015274 | Ga0495632_0015274_313_1488 | 391 |
| 833 | 3300046519 | Ga0495632_0025563 | Ga0495632_0025563_1578_2753 | 391 |
| 834 | 3300046519 | Ga0495632_0048895 | Ga0495632_0048895_414_1589 | 391 |
| 835 | 3300046519 | Ga0495632_0070186 | Ga0495632_0070186_12_1190 | 391 |
| 836 | 3300046520 | Ga0495637_0000003 | Ga0495637_0000003_422664_423839 | 391 |
| 837 | 3300046520 | Ga0495637_0000058 | Ga0495637_0000058_83587_84765 | 391 |
| 838 | 3300046520 | Ga0495637_0000494 | Ga0495637_0000494_18665_19843 | 391 |
| 839 | 3300046520 | Ga0495637_0004779 | Ga0495637_0004779_2747_3925 | 391 |
| 840 | 3300046520 | Ga0495637_0038654 | Ga0495637_0038654_493_1668 | 391 |
| 841 | 3300046522 | Ga0495643_0000129 | Ga0495643_0000129_118480_119658 | 391 |
| 842 | 3300046522 | Ga0495643_0000139 | Ga0495643_0000139_43556_44734 | 391 |
| 843 | 3300046522 | Ga0495643_0000184 | Ga0495643_0000184_32379_33557 | 391 |
| 844 | 3300046522 | Ga0495643_0004217 | Ga0495643_0004217_4915_6090 | 391 |
| 845 | 3300046522 | Ga0495643_0014171 | Ga0495643_0014171_2658_3914 | 391 |
| 846 | 3300046522 | Ga0495643_0014568 | Ga0495643_0014568_1931_3106 | 391 |
| 847 | 3300046522 | Ga0495643_0018624 | Ga0495643_0018624_217_1392 | 391 |
| 848 | 3300046522 | Ga0495643_0037871 | Ga0495643_0037871_461_1636 | 391 |
| 849 | 3300046522 | Ga0495643_0050242 | Ga0495643_0050242_45_1223 | 391 |
| 850 | 3300046523 | Ga0495644_0001715 | Ga0495644_0001715_2366_3541 | 391 |
| 851 | 3300046523 | Ga0495644_0008067 | Ga0495644_0008067_1046_2221 | 391 |
| 852 | 3300046523 | Ga0495644_0011752 | Ga0495644_0011752_1933_3108 | 391 |
| 853 | 3300046523 | Ga0495644_0017725 | Ga0495644_0017725_536_1711 | 391 |
| 854 | 3300046523 | Ga0495644_0025292 | Ga0495644_0025292_407_1726 | 391 |
| 855 | 3300046523 | Ga0495644_0034658 | Ga0495644_0034658_178_1353 | 391 |
| 856 | 3300046524 | Ga0495648_0000006 | Ga0495648_0000006_122500_123678 | 391 |
| 857 | 3300046524 | Ga0495648_0000127 | Ga0495648_0000127_61024_62202 | 391 |
| 858 | 3300046524 | Ga0495648_0001350 | Ga0495648_0001350_4833_6008 | 391 |
| 859 | 3300046524 | Ga0495648_0001892 | Ga0495648_0001892_7829_9007 | 391 |
| 860 | 3300046524 | Ga0495648_0004786 | Ga0495648_0004786_8932_10110 | 391 |
| 861 | 3300046524 | Ga0495648_0013469 | Ga0495648_0013469_2118_3296 | 391 |
| 862 | 3300046524 | Ga0495648_0016855 | Ga0495648_0016855_2421_3596 | 391 |
| 863 | 3300046524 | Ga0495648_0040029 | Ga0495648_0040029_518_1693 | 391 |
| 864 | 3300046524 | Ga0495648_0057606 | Ga0495648_0057606_330_1505 | 391 |
| 865 | 3300046524 | Ga0495648_0066893 | Ga0495648_0066893_447_1622 | 391 |
| 866 | 3300046524 | Ga0495648_0090471 | Ga0495648_0090471_75_1250 | 391 |
| 867 | 3300046525 | Ga0495663_0006459 | Ga0495663_0006459_1429_2607 | 391 |
| 868 | 3300046526 | Ga0495666_0000358 | Ga0495666_0000358_1577_2752 | 391 |
| 869 | 3300046526 | Ga0495666_0003925 | Ga0495666_0003925_5773_6948 | 391 |
| 870 | 3300046526 | Ga0495666_0023321 | Ga0495666_0023321_224_1399 | 391 |
| 871 | 3300046526 | Ga0495666_0046082 | Ga0495666_0046082_479_1654 | 391 |
| 872 | 3300046528 | Ga0495642_0000014 | Ga0495642_0000014_79756_80931 | 391 |
| 873 | 3300046528 | Ga0495642_0000601 | Ga0495642_0000601_15545_16720 | 391 |
| 874 | 3300046528 | Ga0495642_0001447 | Ga0495642_0001447_6238_7416 | 391 |
| 875 | 3300046528 | Ga0495642_0001848 | Ga0495642_0001848_892_2070 | 391 |
| 876 | 3300046528 | Ga0495642_0002139 | Ga0495642_0002139_4347_5525 | 391 |
| 877 | 3300046528 | Ga0495642_0002176 | Ga0495642_0002176_688_1863 | 391 |
| 878 | 3300046528 | Ga0495642_0006905 | Ga0495642_0006905_1258_2577 | 391 |
| 879 | 3300046528 | Ga0495642_0015932 | Ga0495642_0015932_440_1615 | 391 |
| 880 | 3300046528 | Ga0495642_0017775 | Ga0495642_0017775_1509_2687 | 391 |
| 881 | 3300046528 | Ga0495642_0017777 | Ga0495642_0017777_577_1752 | 391 |
| 882 | 3300046528 | Ga0495642_0052798 | Ga0495642_0052798_27_1202 | 391 |
| 883 | 3300046529 | Ga0495652_0019446 | Ga0495652_0019446_3455_4630 | 391 |
| 884 | 3300046529 | Ga0495652_0060024 | Ga0495652_0060024_1569_2744 | 391 |
| 885 | 3300046529 | Ga0495652_0085345 | Ga0495652_0085345_1206_2381 | 391 |
| 886 | 3300046530 | Ga0495654_0000022 | Ga0495654_0000022_152265_153443 | 391 |
| 887 | 3300046530 | Ga0495654_0001794 | Ga0495654_0001794_11789_12964 | 391 |
| 888 | 3300046530 | Ga0495654_0006359 | Ga0495654_0006359_5470_6648 | 391 |
| 889 | 3300046531 | Ga0495665_0005000 | Ga0495665_0005000_5461_6636 | 391 |
| 890 | 3300046531 | Ga0495665_0011946 | Ga0495665_0011946_591_1766 | 391 |
| 891 | 3300046531 | Ga0495665_0029779 | Ga0495665_0029779_512_1687 | 391 |
| 892 | 3300046533 | Ga0495640_0000361 | Ga0495640_0000361_28276_29451 | 391 |
| 893 | 3300046533 | Ga0495640_0037901 | Ga0495640_0037901_1063_2238 | 391 |
| 894 | 3300046535 | Ga0495586_0002540 | Ga0495586_0002540_728_1903 | 391 |
| 895 | 3300046535 | Ga0495586_0004893 | Ga0495586_0004893_1627_2802 | 391 |
| 896 | 3300046536 | Ga0495587_0021357 | Ga0495587_0021357_541_1725 | 391 |
| 897 | 3300046536 | Ga0495587_0081796 | Ga0495587_0081796_193_1368 | 391 |
| 898 | 3300046537 | Ga0495598_0010589 | Ga0495598_0010589_941_2128 | 391 |
| 899 | 3300046538 | Ga0495609_0000068 | Ga0495609_0000068_44259_45434 | 391 |
| 900 | 3300046538 | Ga0495609_0000071 | Ga0495609_0000071_7729_8907 | 391 |
| 901 | 3300046538 | Ga0495609_0001980 | Ga0495609_0001980_2500_3678 | 391 |
| 902 | 3300046538 | Ga0495609_0003897 | Ga0495609_0003897_3264_4439 | 391 |
| 903 | 3300046538 | Ga0495609_0003956 | Ga0495609_0003956_6984_8159 | 391 |
| 904 | 3300046538 | Ga0495609_0004612 | Ga0495609_0004612_5457_6635 | 391 |
| 905 | 3300046538 | Ga0495609_0006626 | Ga0495609_0006626_133_1308 | 391 |
| 906 | 3300046538 | Ga0495609_0007470 | Ga0495609_0007470_4170_5426 | 391 |
| 907 | 3300046538 | Ga0495609_0020429 | Ga0495609_0020429_1638_2813 | 391 |
| 908 | 3300046538 | Ga0495609_0035974 | Ga0495609_0035974_818_1993 | 391 |
| 909 | 3300046542 | Ga0495597_0000051 | Ga0495597_0000051_39506_40684 | 391 |
| 910 | 3300046542 | Ga0495597_0000978 | Ga0495597_0000978_1346_2521 | 391 |
| 911 | 3300046542 | Ga0495597_0002537 | Ga0495597_0002537_7584_8762 | 391 |
| 912 | 3300046542 | Ga0495597_0003589 | Ga0495597_0003589_3503_4678 | 391 |
| 913 | 3300046542 | Ga0495597_0003947 | Ga0495597_0003947_1726_2901 | 391 |
| 914 | 3300046542 | Ga0495597_0004146 | Ga0495597_0004146_5273_6592 | 391 |
| 915 | 3300046542 | Ga0495597_0006044 | Ga0495597_0006044_4459_5634 | 391 |
| 916 | 3300046542 | Ga0495597_0007663 | Ga0495597_0007663_1315_2493 | 391 |
| 917 | 3300046542 | Ga0495597_0019435 | Ga0495597_0019435_684_1859 | 391 |
| 918 | 3300046542 | Ga0495597_0030936 | Ga0495597_0030936_586_1764 | 391 |
| 919 | 3300046542 | Ga0495597_0054653 | Ga0495597_0054653_318_1496 | 391 |
| 920 | 3300046557 | Ga0495622_0000045 | Ga0495622_0000045_38347_39525 | 391 |
| 921 | 3300046557 | Ga0495622_0000136 | Ga0495622_0000136_4928_6106 | 391 |
| 922 | 3300046557 | Ga0495622_0003680 | Ga0495622_0003680_1782_2957 | 391 |
| 923 | 3300046557 | Ga0495622_0060291 | Ga0495622_0060291_97_1287 | 391 |
| 924 | 3300046557 | Ga0495622_0072683 | Ga0495622_0072683_178_1353 | 391 |
| 925 | 3300046558 | Ga0495633_0000202 | Ga0495633_0000202_35701_36879 | 391 |
| 926 | 3300046558 | Ga0495633_0000277 | Ga0495633_0000277_17234_18412 | 391 |
| 927 | 3300046558 | Ga0495633_0001894 | Ga0495633_0001894_5026_6216 | 391 |
| 928 | 3300046558 | Ga0495633_0002629 | Ga0495633_0002629_5008_6186 | 391 |
| 929 | 3300046558 | Ga0495633_0004167 | Ga0495633_0004167_7506_8681 | 391 |
| 930 | 3300046558 | Ga0495633_0004897 | Ga0495633_0004897_4420_5595 | 391 |
| 931 | 3300046558 | Ga0495633_0005717 | Ga0495633_0005717_5472_6650 | 391 |
| 932 | 3300046558 | Ga0495633_0008856 | Ga0495633_0008856_78_1256 | 391 |
| 933 | 3300046558 | Ga0495633_0012063 | Ga0495633_0012063_42_1220 | 391 |
| 934 | 3300046558 | Ga0495633_0021002 | Ga0495633_0021002_1447_2625 | 391 |
| 935 | 3300046558 | Ga0495633_0022102 | Ga0495633_0022102_482_1660 | 391 |
| 936 | 3300046558 | Ga0495633_0024891 | Ga0495633_0024891_1329_2537 | 391 |
| 937 | 3300046558 | Ga0495633_0068939 | Ga0495633_0068939_59_1237 | 391 |
| 938 | 3300046559 | Ga0495667_0043518 | Ga0495667_0043518_463_1638 | 391 |
| 939 | 3300046615 | Ga0495656_0015428 | Ga0495656_0015428_525_1844 | 391 |
| 940 | 3300046615 | Ga0495656_0027619 | Ga0495656_0027619_863_2038 | 391 |
| 941 | 3300046616 | Ga0495668_0000029 | Ga0495668_0000029_240254_241432 | 391 |
| 942 | 3300046616 | Ga0495668_0000148 | Ga0495668_0000148_39105_40283 | 391 |
| 943 | 3300046616 | Ga0495668_0000174 | Ga0495668_0000174_41368_42543 | 391 |
| 944 | 3300046616 | Ga0495668_0000232 | Ga0495668_0000232_73396_74574 | 391 |
| 945 | 3300046616 | Ga0495668_0000993 | Ga0495668_0000993_28192_29370 | 391 |
| 946 | 3300046616 | Ga0495668_0001677 | Ga0495668_0001677_1266_2441 | 391 |
| 947 | 3300046616 | Ga0495668_0003626 | Ga0495668_0003626_7641_8819 | 391 |
| 948 | 3300046616 | Ga0495668_0018136 | Ga0495668_0018136_2447_3622 | 391 |
| 949 | 3300046616 | Ga0495668_0028213 | Ga0495668_0028213_476_1684 | 391 |
| 950 | 3300046616 | Ga0495668_0033283 | Ga0495668_0033283_655_1974 | 391 |
| 951 | 3300046616 | Ga0495668_0037131 | Ga0495668_0037131_1046_2221 | 391 |
| 952 | 3300046616 | Ga0495668_0042026 | Ga0495668_0042026_1209_2384 | 391 |
| 953 | 3300046616 | Ga0495668_0077160 | Ga0495668_0077160_54_1229 | 391 |
| 954 | 3300046616 | Ga0495668_0108994 | Ga0495668_0108994_17_1195 | 391 |
| 955 | 3300046642 | Ga0495634_0004040 | Ga0495634_0004040_8339_9514 | 391 |
| 956 | 3300046642 | Ga0495634_0023044 | Ga0495634_0023044_909_2084 | 391 |
| 957 | 3300046648 | Ga0495611_0000064 | Ga0495611_0000064_46939_48114 | 391 |
| 958 | 3300046648 | Ga0495611_0021883 | Ga0495611_0021883_985_2163 | 391 |
| 959 | 3300046648 | Ga0495611_0022996 | Ga0495611_0022996_516_1691 | 391 |
| 960 | 3300046648 | Ga0495611_0027825 | Ga0495611_0027825_1042_2217 | 391 |
| 961 | 3300046648 | Ga0495611_0037629 | Ga0495611_0037629_463_1782 | 391 |
| 962 | 3300046660 | Ga0495625_0000220 | Ga0495625_0000220_14312_15490 | 391 |
| 963 | 3300046660 | Ga0495625_0001632 | Ga0495625_0001632_21989_23167 | 391 |
| 964 | 3300046660 | Ga0495625_0005340 | Ga0495625_0005340_3304_4482 | 391 |
| 965 | 3300046660 | Ga0495625_0006694 | Ga0495625_0006694_604_1782 | 391 |
| 966 | 3300046660 | Ga0495625_0007550 | Ga0495625_0007550_167_1342 | 391 |
| 967 | 3300046660 | Ga0495625_0022190 | Ga0495625_0022190_2922_4097 | 391 |
| 968 | 3300046660 | Ga0495625_0025488 | Ga0495625_0025488_2674_3852 | 391 |
| 969 | 3300046660 | Ga0495625_0032509 | Ga0495625_0032509_1001_2179 | 391 |
| 970 | 3300046660 | Ga0495625_0049335 | Ga0495625_0049335_617_1795 | 391 |
| 971 | 3300046660 | Ga0495625_0051022 | Ga0495625_0051022_1439_2614 | 391 |
| 972 | 3300046660 | Ga0495625_0053232 | Ga0495625_0053232_764_1942 | 391 |
| 973 | 3300046660 | Ga0495625_0100822 | Ga0495625_0100822_570_1745 | 391 |
| 974 | 3300046660 | Ga0495625_0168856 | Ga0495625_0168856_187_1365 | 391 |
| 975 | 3300046663 | Ga0495635_0002684 | Ga0495635_0002684_486_1661 | 391 |
| 976 | 3300046663 | Ga0495635_0049501 | Ga0495635_0049501_272_1447 | 391 |
| 977 | 3300046664 | Ga0495659_0000072 | Ga0495659_0000072_34767_35945 | 391 |
| 978 | 3300046664 | Ga0495659_0001178 | Ga0495659_0001178_1288_2466 | 391 |
| 979 | 3300046664 | Ga0495659_0001711 | Ga0495659_0001711_2263_3441 | 391 |
| 980 | 3300046665 | Ga0495661_0000214 | Ga0495661_0000214_50835_52010 | 391 |
| 981 | 3300046665 | Ga0495661_0000695 | Ga0495661_0000695_16610_17788 | 391 |
| 982 | 3300046665 | Ga0495661_0004010 | Ga0495661_0004010_8146_9321 | 391 |
| 983 | 3300046665 | Ga0495661_0008198 | Ga0495661_0008198_2300_3478 | 391 |
| 984 | 3300046665 | Ga0495661_0011114 | Ga0495661_0011114_1873_3192 | 391 |
| 985 | 3300046665 | Ga0495661_0015331 | Ga0495661_0015331_946_2124 | 391 |
| 986 | 3300046665 | Ga0495661_0026626 | Ga0495661_0026626_2086_3264 | 391 |
| 987 | 3300046665 | Ga0495661_0028879 | Ga0495661_0028879_2086_3261 | 391 |
| 988 | 3300046665 | Ga0495661_0035609 | Ga0495661_0035609_1341_2516 | 391 |
| 989 | 3300046665 | Ga0495661_0036583 | Ga0495661_0036583_1515_2693 | 391 |
| 990 | 3300046665 | Ga0495661_0052376 | Ga0495661_0052376_171_1346 | 391 |
| 991 | 3300046665 | Ga0495661_0056619 | Ga0495661_0056619_528_1703 | 391 |
| 992 | 3300046665 | Ga0495661_0061482 | Ga0495661_0061482_462_1637 | 391 |
| 993 | 3300046665 | Ga0495661_0080183 | Ga0495661_0080183_316_1491 | 391 |
| 994 | 3300046665 | Ga0495661_0080487 | Ga0495661_0080487_64_1239 | 391 |
| 995 | 3300046665 | Ga0495661_0134772 | Ga0495661_0134772_68_1243 | 391 |
| 996 | 3300046674 | Ga0495588_0000141 | Ga0495588_0000141_46470_47648 | 391 |
| 997 | 3300046674 | Ga0495588_0019034 | Ga0495588_0019034_1412_2587 | 391 |
| 998 | 3300046674 | Ga0495588_0023447 | Ga0495588_0023447_1146_2321 | 391 |
| 999 | 3300046674 | Ga0495588_0071398 | Ga0495588_0071398_484_1659 | 391 |
| 1000 | 3300046674 | Ga0495588_0087467 | Ga0495588_0087467_331_1506 | 391 |
| 1001 | 3300046674 | Ga0495588_0098991 | Ga0495588_0098991_277_1452 | 391 |
| 1002 | 3300046678 | Ga0495599_0108620 | Ga0495599_0108620_305_1480 | 391 |
| 1003 | 3300046679 | Ga0495623_0011773 | Ga0495623_0011773_2745_3920 | 391 |
| 1004 | 3300046679 | Ga0495623_0115105 | Ga0495623_0115105_23_1198 | 391 |
| 1005 | 3300046680 | Ga0495646_0062820 | Ga0495646_0062820_391_1566 | 391 |
| 1006 | 3300046683 | Ga0495658_0003242 | Ga0495658_0003242_2337_3512 | 391 |
| 1007 | 3300046684 | Ga0495669_0000061 | Ga0495669_0000061_44615_45790 | 391 |
| 1008 | 3300046684 | Ga0495669_0000541 | Ga0495669_0000541_8898_10076 | 391 |
| 1009 | 3300046684 | Ga0495669_0001956 | Ga0495669_0001956_3136_4314 | 391 |
| 1010 | 3300046684 | Ga0495669_0010797 | Ga0495669_0010797_1332_2507 | 391 |
| 1011 | 3300046684 | Ga0495669_0017316 | Ga0495669_0017316_1430_2605 | 391 |
| 1012 | 3300046684 | Ga0495669_0021589 | Ga0495669_0021589_548_1723 | 391 |
| 1013 | 3300046684 | Ga0495669_0024322 | Ga0495669_0024322_201_1376 | 391 |
| 1014 | 3300046684 | Ga0495669_0034561 | Ga0495669_0034561_840_2015 | 391 |
| 1015 | 3300046689 | Ga0495613_0006712 | Ga0495613_0006712_6691_7866 | 391 |
| 1016 | 3300046689 | Ga0495613_0043012 | Ga0495613_0043012_371_1546 | 391 |
| 1017 | 3300046690 | Ga0495624_0001779 | Ga0495624_0001779_2380_3555 | 391 |
| 1018 | 3300046690 | Ga0495624_0038646 | Ga0495624_0038646_1398_2573 | 391 |
| 1019 | 3300046690 | Ga0495624_0086078 | Ga0495624_0086078_687_1862 | 391 |
| 1020 | 3300046691 | Ga0495670_0001678 | Ga0495670_0001678_705_1883 | 391 |
| 1021 | 3300046691 | Ga0495670_0004159 | Ga0495670_0004159_1243_2418 | 391 |
| 1022 | 3300046691 | Ga0495670_0010550 | Ga0495670_0010550_3095_4273 | 391 |
| 1023 | 3300046691 | Ga0495670_0020306 | Ga0495670_0020306_496_1815 | 391 |
| 1024 | 3300046691 | Ga0495670_0021699 | Ga0495670_0021699_594_1769 | 391 |
| 1025 | 3300046691 | Ga0495670_0035935 | Ga0495670_0035935_553_1731 | 391 |
| 1026 | 3300046691 | Ga0495670_0072394 | Ga0495670_0072394_371_1546 | 391 |
| 1027 | 3300046691 | Ga0495670_0074831 | Ga0495670_0074831_67_1242 | 391 |
| 1028 | 3300046691 | Ga0495670_0075274 | Ga0495670_0075274_300_1475 | 391 |
| 1029 | 3300046692 | Ga0495671_0000064 | Ga0495671_0000064_7797_8975 | 391 |
| 1030 | 3300046692 | Ga0495671_0000281 | Ga0495671_0000281_6894_8072 | 391 |
| 1031 | 3300046692 | Ga0495671_0001813 | Ga0495671_0001813_10658_11833 | 391 |
| 1032 | 3300046692 | Ga0495671_0007401 | Ga0495671_0007401_1777_2955 | 391 |
| 1033 | 3300046692 | Ga0495671_0025617 | Ga0495671_0025617_1712_2890 | 391 |
| 1034 | 3300046692 | Ga0495671_0033801 | Ga0495671_0033801_79_1398 | 391 |
| 1035 | 3300046694 | Ga0495649_0000918 | Ga0495649_0000918_20335_21510 | 391 |
| 1036 | 3300046694 | Ga0495649_0002189 | Ga0495649_0002189_3575_4753 | 391 |
| 1037 | 3300046694 | Ga0495649_0013798 | Ga0495649_0013798_485_1663 | 391 |
| 1038 | 3300046694 | Ga0495649_0015468 | Ga0495649_0015468_1816_2994 | 391 |
| 1039 | 3300046694 | Ga0495649_0028513 | Ga0495649_0028513_1812_2990 | 391 |
| 1040 | 3300046794 | Ga0495589_0000084 | Ga0495589_0000084_34491_35666 | 391 |
| 1041 | 3300046794 | Ga0495589_0000770 | Ga0495589_0000770_18012_19187 | 391 |
| 1042 | 3300046794 | Ga0495589_0003941 | Ga0495589_0003941_5461_6636 | 391 |
| 1043 | 3300046794 | Ga0495589_0004657 | Ga0495589_0004657_3663_4838 | 391 |
| 1044 | 3300046794 | Ga0495589_0007237 | Ga0495589_0007237_549_1724 | 391 |
| 1045 | 3300046794 | Ga0495589_0010759 | Ga0495589_0010759_2608_3927 | 391 |
| 1046 | 3300046794 | Ga0495589_0040631 | Ga0495589_0040631_675_1850 | 391 |
| 1047 | 3300046794 | Ga0495589_0066482 | Ga0495589_0066482_483_1658 | 391 |
| 1048 | 3300046809 | Ga0495600_0085173 | Ga0495600_0085173_223_1398 | 391 |
| 1049 | 3300046810 | Ga0495660_0000200 | Ga0495660_0000200_11902_13077 | 391 |
| 1050 | 3300046810 | Ga0495660_0001390 | Ga0495660_0001390_4036_5247 | 391 |
| 1051 | 3300046810 | Ga0495660_0001407 | Ga0495660_0001407_6028_7206 | 391 |
| 1052 | 3300046810 | Ga0495660_0001424 | Ga0495660_0001424_3479_4657 | 391 |
| 1053 | 3300046810 | Ga0495660_0002477 | Ga0495660_0002477_9582_10757 | 391 |
| 1054 | 3300046810 | Ga0495660_0011896 | Ga0495660_0011896_2406_3581 | 391 |
| 1055 | 3300046810 | Ga0495660_0012525 | Ga0495660_0012525_3094_4272 | 391 |
| 1056 | 3300046810 | Ga0495660_0015786 | Ga0495660_0015786_2066_3241 | 391 |
| 1057 | 3300046810 | Ga0495660_0029879 | Ga0495660_0029879_686_1861 | 391 |
| 1058 | 3300046810 | Ga0495660_0046806 | Ga0495660_0046806_142_1320 | 391 |
| 1059 | 3300046810 | Ga0495660_0051027 | Ga0495660_0051027_585_1760 | 391 |
| 1060 | 3300046810 | Ga0495660_0059913 | Ga0495660_0059913_402_1577 | 391 |
| 1061 | 3300047315 | Ga0495581_0001405 | Ga0495581_0001405_11525_12700 | 391 |
| 1062 | 3300047315 | Ga0495581_0135696 | Ga0495581_0135696_158_1333 | 391 |
| 1063 | 3300047317 | Ga0495604_0004964 | Ga0495604_0004964_6718_7893 | 391 |
| 1064 | 3300047317 | Ga0495604_0014498 | Ga0495604_0014498_824_1999 | 391 |
| 1065 | 3300047317 | Ga0495604_0048113 | Ga0495604_0048113_1607_2782 | 391 |
| 1066 | 3300047318 | Ga0495636_0000994 | Ga0495636_0000994_7693_8871 | 391 |
| 1067 | 3300047318 | Ga0495636_0002196 | Ga0495636_0002196_55_1230 | 391 |
| 1068 | 3300047318 | Ga0495636_0003868 | Ga0495636_0003868_4288_5466 | 391 |
| 1069 | 3300047318 | Ga0495636_0014612 | Ga0495636_0014612_1694_2872 | 391 |
| 1070 | 3300047318 | Ga0495636_0081334 | Ga0495636_0081334_72_1247 | 391 |
| 1071 | 3300047319 | Ga0495674_0030847 | Ga0495674_0030847_3208_4383 | 391 |
| 1072 | 3300047320 | Ga0495672_0000026 | Ga0495672_0000026_338674_339852 | 391 |
| 1073 | 3300047320 | Ga0495672_0000075 | Ga0495672_0000075_87689_88867 | 391 |
| 1074 | 3300047320 | Ga0495672_0000089 | Ga0495672_0000089_26603_27778 | 391 |
| 1075 | 3300047320 | Ga0495672_0000127 | Ga0495672_0000127_18369_19547 | 391 |
| 1076 | 3300047320 | Ga0495672_0000453 | Ga0495672_0000453_27038_28213 | 391 |
| 1077 | 3300047320 | Ga0495672_0002837 | Ga0495672_0002837_1427_2602 | 391 |
| 1078 | 3300047320 | Ga0495672_0006451 | Ga0495672_0006451_2862_4052 | 391 |
| 1079 | 3300047320 | Ga0495672_0007734 | Ga0495672_0007734_6616_7794 | 391 |
| 1080 | 3300047320 | Ga0495672_0023375 | Ga0495672_0023375_2182_3357 | 391 |
| 1081 | 3300047320 | Ga0495672_0036465 | Ga0495672_0036465_1379_2554 | 391 |
| 1082 | 3300047320 | Ga0495672_0058257 | Ga0495672_0058257_864_2039 | 391 |
| 1083 | 3300047320 | Ga0495672_0059651 | Ga0495672_0059651_609_1865 | 391 |
| 1084 | 3300047320 | Ga0495672_0081131 | Ga0495672_0081131_214_1389 | 391 |
| 1085 | 3300047321 | Ga0495676_0000025 | Ga0495676_0000025_95136_96311 | 391 |
| 1086 | 3300047321 | Ga0495676_0028408 | Ga0495676_0028408_2203_3405 | 391 |
| 1087 | 3300047321 | Ga0495676_0058168 | Ga0495676_0058168_1603_2778 | 391 |
| 1088 | 3300047321 | Ga0495676_0077630 | Ga0495676_0077630_505_1680 | 391 |
| 1089 | 3300047322 | Ga0495680_0004529 | Ga0495680_0004529_1404_2579 | 391 |
| 1090 | 3300047322 | Ga0495680_0021996 | Ga0495680_0021996_1088_2266 | 391 |
| 1091 | 3300047322 | Ga0495680_0058611 | Ga0495680_0058611_634_1809 | 391 |
| 1092 | 3300047323 | Ga0495683_0000155 | Ga0495683_0000155_22168_23343 | 391 |
| 1093 | 3300047323 | Ga0495683_0000174 | Ga0495683_0000174_60153_61361 | 391 |
| 1094 | 3300047323 | Ga0495683_0001196 | Ga0495683_0001196_1449_2624 | 391 |
| 1095 | 3300047323 | Ga0495683_0001709 | Ga0495683_0001709_984_2159 | 391 |
| 1096 | 3300047323 | Ga0495683_0006093 | Ga0495683_0006093_4854_6032 | 391 |
| 1097 | 3300047323 | Ga0495683_0008116 | Ga0495683_0008116_75_1265 | 391 |
| 1098 | 3300047323 | Ga0495683_0024755 | Ga0495683_0024755_1542_2720 | 391 |
| 1099 | 3300047323 | Ga0495683_0030699 | Ga0495683_0030699_68_1243 | 391 |
| 1100 | 3300047323 | Ga0495683_0034343 | Ga0495683_0034343_535_1710 | 391 |
| 1101 | 3300047323 | Ga0495683_0078272 | Ga0495683_0078272_35_1213 | 391 |
| 1102 | 3300047443 | Ga0495687_000101 | Ga0495687_000101_44132_45307 | 391 |
| 1103 | 3300047443 | Ga0495687_000117 | Ga0495687_000117_11640_12815 | 391 |
| 1104 | 3300047443 | Ga0495687_000282 | Ga0495687_000282_27022_28197 | 391 |
| 1105 | 3300047443 | Ga0495687_000314 | Ga0495687_000314_52833_54008 | 391 |
| 1106 | 3300047443 | Ga0495687_000918 | Ga0495687_000918_24868_26046 | 391 |
| 1107 | 3300047443 | Ga0495687_001051 | Ga0495687_001051_15366_16541 | 391 |
| 1108 | 3300047443 | Ga0495687_001544 | Ga0495687_001544_1351_2526 | 391 |
| 1109 | 3300047443 | Ga0495687_033530 | Ga0495687_033530_413_1588 | 391 |
| 1110 | 3300047444 | Ga0495675_0007787 | Ga0495675_0007787_1615_2790 | 391 |
| 1111 | 3300047444 | Ga0495675_0009593 | Ga0495675_0009593_1339_2514 | 391 |
| 1112 | 3300047445 | Ga0495677_0000015 | Ga0495677_0000015_44076_45251 | 391 |
| 1113 | 3300047445 | Ga0495677_0000569 | Ga0495677_0000569_3318_4493 | 391 |
| 1114 | 3300047445 | Ga0495677_0000679 | Ga0495677_0000679_10508_11686 | 391 |
| 1115 | 3300047445 | Ga0495677_0002429 | Ga0495677_0002429_5057_6232 | 391 |
| 1116 | 3300047445 | Ga0495677_0004887 | Ga0495677_0004887_1643_2962 | 391 |
| 1117 | 3300047445 | Ga0495677_0005652 | Ga0495677_0005652_1585_2760 | 391 |
| 1118 | 3300047445 | Ga0495677_0009353 | Ga0495677_0009353_1661_2917 | 391 |
| 1119 | 3300047445 | Ga0495677_0010826 | Ga0495677_0010826_1612_2790 | 391 |
| 1120 | 3300047445 | Ga0495677_0022559 | Ga0495677_0022559_714_1889 | 391 |
| 1121 | 3300047445 | Ga0495677_0024284 | Ga0495677_0024284_675_1850 | 391 |
| 1122 | 3300047445 | Ga0495677_0027933 | Ga0495677_0027933_509_1684 | 391 |
| 1123 | 3300047445 | Ga0495677_0030599 | Ga0495677_0030599_429_1604 | 391 |
| 1124 | 3300047446 | Ga0495679_005376 | Ga0495679_005376_2837_4012 | 391 |
| 1125 | 3300047446 | Ga0495679_007325 | Ga0495679_007325_655_1833 | 391 |
| 1126 | 3300047446 | Ga0495679_013525 | Ga0495679_013525_1342_2517 | 391 |
| 1127 | 3300047446 | Ga0495679_027420 | Ga0495679_027420_405_1583 | 391 |
| 1128 | 3300047447 | Ga0495685_000008 | Ga0495685_000008_49857_51035 | 391 |
| 1129 | 3300047447 | Ga0495685_000199 | Ga0495685_000199_17373_18551 | 391 |
| 1130 | 3300047447 | Ga0495685_011820 | Ga0495685_011820_1326_2501 | 391 |
| 1131 | 3300047447 | Ga0495685_012632 | Ga0495685_012632_453_1628 | 391 |
| 1132 | 3300047447 | Ga0495685_014336 | Ga0495685_014336_445_1623 | 391 |
| 1133 | 3300047447 | Ga0495685_020018 | Ga0495685_020018_236_1414 | 391 |
| 1134 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_247852_249030 | 391 |
| 1135 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_207181_208359 | 391 |
| 1136 | 3300047469 | Ga0495673_0000012 | Ga0495673_0000012_106135_107313 | 391 |
| 1137 | 3300047469 | Ga0495673_0015767 | Ga0495673_0015767_2171_3349 | 391 |
| 1138 | 3300047470 | Ga0495681_0000700 | Ga0495681_0000700_18931_20106 | 391 |
| 1139 | 3300047470 | Ga0495681_0003376 | Ga0495681_0003376_1326_2501 | 391 |
| 1140 | 3300047470 | Ga0495681_0011812 | Ga0495681_0011812_3047_4366 | 391 |
| 1141 | 3300047470 | Ga0495681_0024264 | Ga0495681_0024264_522_1697 | 391 |
| 1142 | 3300047470 | Ga0495681_0027563 | Ga0495681_0027563_1469_2647 | 391 |
| 1143 | 3300047470 | Ga0495681_0030815 | Ga0495681_0030815_1394_2569 | 391 |
| 1144 | 3300047470 | Ga0495681_0037283 | Ga0495681_0037283_992_2167 | 391 |
| 1145 | 3300047470 | Ga0495681_0061210 | Ga0495681_0061210_539_1714 | 391 |
| 1146 | 3300047470 | Ga0495681_0067778 | Ga0495681_0067778_428_1606 | 391 |
| 1147 | 3300047472 | Ga0495686_0000163 | Ga0495686_0000163_19530_20705 | 391 |
| 1148 | 3300047472 | Ga0495686_0001540 | Ga0495686_0001540_21076_22254 | 391 |
| 1149 | 3300047472 | Ga0495686_0002255 | Ga0495686_0002255_345_1520 | 391 |
| 1150 | 3300047472 | Ga0495686_0026085 | Ga0495686_0026085_764_1942 | 391 |
| 1151 | 3300047472 | Ga0495686_0078606 | Ga0495686_0078606_406_1584 | 391 |
| 1152 | 3300047673 | Ga0495593_0001956 | Ga0495593_0001956_1487_2662 | 391 |
| 1153 | 3300047673 | Ga0495593_0026634 | Ga0495593_0026634_716_1891 | 391 |
| 1154 | 3300048088 | Ga0495602_0000323 | Ga0495602_0000323_26818_27993 | 391 |
| 1155 | 3300048088 | Ga0495602_0014971 | Ga0495602_0014971_4582_5766 | 391 |
| 1156 | 3300048089 | Ga0495614_0009833 | Ga0495614_0009833_1314_2489 | 391 |
| 1157 | 3300048089 | Ga0495614_0012614 | Ga0495614_0012614_1921_3096 | 391 |
| 1158 | 3300048089 | Ga0495614_0039758 | Ga0495614_0039758_284_1459 | 391 |
| 1159 | 3300048089 | Ga0495614_0048154 | Ga0495614_0048154_365_1540 | 391 |
| 1160 | 3300048091 | Ga0495626_0000182 | Ga0495626_0000182_38225_39400 | 391 |
| 1161 | 3300048091 | Ga0495626_0001143 | Ga0495626_0001143_14768_15943 | 391 |
| 1162 | 3300048091 | Ga0495626_0002715 | Ga0495626_0002715_2676_3851 | 391 |
| 1163 | 3300048091 | Ga0495626_0010792 | Ga0495626_0010792_2995_4173 | 391 |
| 1164 | 3300048091 | Ga0495626_0010964 | Ga0495626_0010964_3253_4428 | 391 |
| 1165 | 3300048091 | Ga0495626_0012497 | Ga0495626_0012497_657_1913 | 391 |
| 1166 | 3300048091 | Ga0495626_0018137 | Ga0495626_0018137_1357_2532 | 391 |
| 1167 | 3300048091 | Ga0495626_0020785 | Ga0495626_0020785_1355_2530 | 391 |
| 1168 | 3300048091 | Ga0495626_0027079 | Ga0495626_0027079_510_1685 | 391 |
| 1169 | 3300048091 | Ga0495626_0061724 | Ga0495626_0061724_104_1279 | 391 |
| 1170 | 3300048091 | Ga0495626_0075258 | Ga0495626_0075258_10_1185 | 391 |
| 1171 | 3300048903 | Ga0496100_0115312 | Ga0496100_0115312_644_1843 | 391 |
| 1172 | 3300048903 | Ga0496100_0207315 | Ga0496100_0207315_219_1394 | 391 |
| 1173 | 3300048904 | Ga0496101_0027763 | Ga0496101_0027763_2563_3750 | 391 |
| 1174 | 3300048904 | Ga0496101_0033957 | Ga0496101_0033957_671_1846 | 391 |
| 1175 | 3300048904 | Ga0496101_0180814 | Ga0496101_0180814_92_1270 | 391 |
| 1176 | 3300048905 | Ga0496102_0000024 | Ga0496102_0000024_99346_100524 | 391 |
| 1177 | 3300048905 | Ga0496102_0000154 | Ga0496102_0000154_1312_2487 | 391 |
| 1178 | 3300048905 | Ga0496102_0026028 | Ga0496102_0026028_875_2053 | 391 |
| 1179 | 3300048905 | Ga0496102_0082748 | Ga0496102_0082748_1303_2478 | 391 |
| 1180 | 3300048905 | Ga0496102_0129461 | Ga0496102_0129461_338_1516 | 391 |
| 1181 | 3300048905 | Ga0496102_0207244 | Ga0496102_0207244_407_1582 | 391 |
| 1182 | 3300048906 | Ga0496103_0006301 | Ga0496103_0006301_4874_6052 | 391 |
| 1183 | 3300048906 | Ga0496103_0028900 | Ga0496103_0028900_1632_2810 | 391 |
| 1184 | 3300048906 | Ga0496103_0062928 | Ga0496103_0062928_608_1786 | 391 |
| 1185 | 3300048907 | Ga0496104_0013736 | Ga0496104_0013736_4210_5397 | 391 |
| 1186 | 3300048907 | Ga0496104_0024049 | Ga0496104_0024049_1259_2434 | 391 |
| 1187 | 3300048907 | Ga0496104_0046944 | Ga0496104_0046944_933_2132 | 391 |
| 1188 | 3300048908 | Ga0496105_0000967 | Ga0496105_0000967_8633_9832 | 391 |
| 1189 | 3300048908 | Ga0496105_0015981 | Ga0496105_0015981_3624_4799 | 391 |
| 1190 | 3300048908 | Ga0496105_0208179 | Ga0496105_0208179_202_1389 | 391 |
| 1191 | 3300048908 | Ga0496105_0229440 | Ga0496105_0229440_282_1457 | 391 |
| 1192 | 3300048909 | Ga0496106_0269751 | Ga0496106_0269751_58_1233 | 391 |
| 1193 | 3300048910 | Ga0496107_0014903 | Ga0496107_0014903_3089_4264 | 391 |
| 1194 | 3300048910 | Ga0496107_0056252 | Ga0496107_0056252_1334_2509 | 391 |
| 1195 | 3300048911 | Ga0496108_0079390 | Ga0496108_0079390_490_1677 | 391 |
| 1196 | 3300048911 | Ga0496108_0090016 | Ga0496108_0090016_283_1461 | 391 |
| 1197 | 3300048912 | Ga0496109_0066229 | Ga0496109_0066229_1558_2745 | 391 |
| 1198 | 3300048912 | Ga0496109_0230265 | Ga0496109_0230265_416_1591 | 391 |
| 1199 | 3300048913 | Ga0496110_0000229 | Ga0496110_0000229_30174_31352 | 391 |
| 1200 | 3300048913 | Ga0496110_0007614 | Ga0496110_0007614_6177_7364 | 391 |
| 1201 | 3300048913 | Ga0496110_0038075 | Ga0496110_0038075_2402_3577 | 391 |
| 1202 | 3300048913 | Ga0496110_0048976 | Ga0496110_0048976_215_1393 | 391 |
| 1203 | 3300048913 | Ga0496110_0060061 | Ga0496110_0060061_676_1851 | 391 |
| 1204 | 3300048914 | Ga0496111_0065800 | Ga0496111_0065800_532_1719 | 391 |
| 1205 | 3300048915 | Ga0496112_0071785 | Ga0496112_0071785_1345_2520 | 391 |
| 1206 | 3300048916 | Ga0496113_0185920 | Ga0496113_0185920_444_1622 | 391 |
| 1207 | 3300048917 | Ga0496114_0005092 | Ga0496114_0005092_6132_7331 | 391 |
| 1208 | 3300048917 | Ga0496114_0064750 | Ga0496114_0064750_1607_2794 | 391 |
| 1209 | 3300048917 | Ga0496114_0090766 | Ga0496114_0090766_1043_2218 | 391 |
| 1210 | 3300048917 | Ga0496114_0179600 | Ga0496114_0179600_399_1577 | 391 |
| 1211 | 3300048918 | Ga0496115_0009194 | Ga0496115_0009194_5587_6762 | 391 |
| 1212 | 3300048918 | Ga0496115_0170188 | Ga0496115_0170188_396_1571 | 391 |
| 1213 | 3300048918 | Ga0496115_0196201 | Ga0496115_0196201_291_1466 | 391 |
| 1214 | 3300048919 | Ga0496116_0012782 | Ga0496116_0012782_3375_4550 | 391 |
| 1215 | 3300048919 | Ga0496116_0013047 | Ga0496116_0013047_2138_3316 | 391 |
| 1216 | 3300048919 | Ga0496116_0055260 | Ga0496116_0055260_912_2090 | 391 |
| 1217 | 3300048919 | Ga0496116_0084320 | Ga0496116_0084320_459_1637 | 391 |
| 1218 | 3300048920 | Ga0496117_0000005 | Ga0496117_0000005_254115_255293 | 391 |
| 1219 | 3300048920 | Ga0496117_0003151 | Ga0496117_0003151_18101_19279 | 391 |
| 1220 | 3300048921 | Ga0496118_0000022 | Ga0496118_0000022_183310_184488 | 391 |
| 1221 | 3300048921 | Ga0496118_0079447 | Ga0496118_0079447_128_1306 | 391 |
| 1222 | 3300048922 | Ga0496119_0001121 | Ga0496119_0001121_9005_10183 | 391 |
| 1223 | 3300048923 | Ga0496120_0000014 | Ga0496120_0000014_199341_200519 | 391 |
| 1224 | 3300048923 | Ga0496120_0088968 | Ga0496120_0088968_64_1242 | 391 |
| 1225 | 3300048924 | Ga0496121_0004138 | Ga0496121_0004138_3292_4467 | 391 |
| 1226 | 3300048924 | Ga0496121_0028870 | Ga0496121_0028870_3306_4481 | 391 |
| 1227 | 3300048924 | Ga0496121_0086796 | Ga0496121_0086796_687_1862 | 391 |
| 1228 | 3300048925 | Ga0496122_0000648 | Ga0496122_0000648_28670_29845 | 391 |
| 1229 | 3300048925 | Ga0496122_0001132 | Ga0496122_0001132_42966_44144 | 391 |
| 1230 | 3300048925 | Ga0496122_0005577 | Ga0496122_0005577_13181_14356 | 391 |
| 1231 | 3300048925 | Ga0496122_0007186 | Ga0496122_0007186_9015_10190 | 391 |
| 1232 | 3300048925 | Ga0496122_0033482 | Ga0496122_0033482_1224_2402 | 391 |
| 1233 | 3300048926 | Ga0496123_0000473 | Ga0496123_0000473_40520_41695 | 391 |
| 1234 | 3300048926 | Ga0496123_0004457 | Ga0496123_0004457_4370_5545 | 391 |
| 1235 | 3300048926 | Ga0496123_0004484 | Ga0496123_0004484_9816_10994 | 391 |
| 1236 | 3300048926 | Ga0496123_0013688 | Ga0496123_0013688_1844_3022 | 391 |
| 1237 | 3300048926 | Ga0496123_0014227 | Ga0496123_0014227_167_1345 | 391 |
| 1238 | 3300048926 | Ga0496123_0029164 | Ga0496123_0029164_2512_3687 | 391 |
| 1239 | 3300048927 | Ga0496124_0002033 | Ga0496124_0002033_12988_14166 | 391 |
| 1240 | 3300048927 | Ga0496124_0008922 | Ga0496124_0008922_8635_9813 | 391 |
| 1241 | 3300048927 | Ga0496124_0050628 | Ga0496124_0050628_1967_3142 | 391 |
| 1242 | 3300048927 | Ga0496124_0054048 | Ga0496124_0054048_1024_2199 | 391 |
| 1243 | 3300048927 | Ga0496124_0060877 | Ga0496124_0060877_706_1881 | 391 |
| 1244 | 3300048927 | Ga0496124_0100000 | Ga0496124_0100000_1041_2219 | 391 |
| 1245 | 3300048927 | Ga0496124_0106386 | Ga0496124_0106386_140_1351 | 391 |
| 1246 | 3300048927 | Ga0496124_0121737 | Ga0496124_0121737_705_1880 | 391 |
| 1247 | 3300048928 | Ga0496125_0000545 | Ga0496125_0000545_656_1831 | 391 |
| 1248 | 3300048928 | Ga0496125_0013723 | Ga0496125_0013723_4153_5331 | 391 |
| 1249 | 3300048928 | Ga0496125_0046260 | Ga0496125_0046260_1200_2375 | 391 |
| 1250 | 3300048928 | Ga0496125_0076545 | Ga0496125_0076545_817_2007 | 391 |
| 1251 | 3300048928 | Ga0496125_0085738 | Ga0496125_0085738_109_1287 | 391 |
| 1252 | 3300048928 | Ga0496125_0103848 | Ga0496125_0103848_809_1984 | 391 |
| 1253 | 3300048929 | Ga0496126_0000657 | Ga0496126_0000657_50716_51894 | 391 |
| 1254 | 3300048929 | Ga0496126_0008484 | Ga0496126_0008484_935_2113 | 391 |
| 1255 | 3300049128 | Ga0501308_000821 | Ga0501308_000821_794_1972 | 391 |
| 1256 | 3300049129 | Ga0501309_001464 | Ga0501309_001464_434_1612 | 391 |
| 1257 | 3300049160 | Ga0501304_000296 | Ga0501304_000296_262_1440 | 391 |
| 1258 | 3300049459 | Ga0495678_000012 | Ga0495678_000012_102367_103578 | 391 |
| 1259 | 3300049459 | Ga0495678_000051 | Ga0495678_000051_44034_45209 | 391 |
| 1260 | 3300049459 | Ga0495678_000114 | Ga0495678_000114_87648_88826 | 391 |
| 1261 | 3300049459 | Ga0495678_001536 | Ga0495678_001536_6611_7789 | 391 |
| 1262 | 3300049459 | Ga0495678_002134 | Ga0495678_002134_11533_12708 | 391 |
| 1263 | 3300049459 | Ga0495678_002302 | Ga0495678_002302_10445_11623 | 391 |
| 1264 | 3300049459 | Ga0495678_008849 | Ga0495678_008849_2497_3675 | 391 |
| 1265 | 3300049459 | Ga0495678_017479 | Ga0495678_017479_1375_2550 | 391 |
| 1266 | 3300049460 | Ga0495682_0001124 | Ga0495682_0001124_1261_2436 | 391 |
| 1267 | 3300049460 | Ga0495682_0003033 | Ga0495682_0003033_3935_5125 | 391 |
| 1268 | 3300049460 | Ga0495682_0006100 | Ga0495682_0006100_3208_4386 | 391 |
| 1269 | 3300049460 | Ga0495682_0009071 | Ga0495682_0009071_575_1750 | 391 |
| 1270 | 3300049460 | Ga0495682_0009960 | Ga0495682_0009960_1512_2690 | 391 |
| 1271 | 3300049460 | Ga0495682_0015910 | Ga0495682_0015910_1448_2626 | 391 |
| 1272 | 3300049532 | Ga0501316_000625 | Ga0501316_000625_914_2092 | 391 |
| 1273 | 3300049532 | Ga0501316_001723 | Ga0501316_001723_399_1580 | 391 |
| 1274 | 3300049570 | Ga0501033_0002988 | Ga0501033_0002988_6028_7203 | 391 |
| 1275 | 3300049571 | Ga0501034_0000730 | Ga0501034_0000730_28222_29397 | 391 |
| 1276 | 3300049572 | Ga0501036_0000592 | Ga0501036_0000592_10587_11762 | 391 |
| 1277 | 3300049574 | Ga0501038_0000396 | Ga0501038_0000396_4503_5678 | 391 |
| 1278 | 3300049574 | Ga0501038_0147246 | Ga0501038_0147246_232_1407 | 391 |
| 1279 | 3300049575 | Ga0501039_0015051 | Ga0501039_0015051_3230_4405 | 391 |
| 1280 | 3300049576 | Ga0501040_0019336 | Ga0501040_0019336_3256_4431 | 391 |
| 1281 | 3300049576 | Ga0501040_0034666 | Ga0501040_0034666_1288_2463 | 391 |
| 1282 | 3300049577 | Ga0501041_0000044 | Ga0501041_0000044_24262_25437 | 391 |
| 1283 | 3300049577 | Ga0501041_0016520 | Ga0501041_0016520_1055_2230 | 391 |
| 1284 | 3300049579 | Ga0501043_0002105 | Ga0501043_0002105_2790_3965 | 391 |
| 1285 | 3300049580 | Ga0501046_0000460 | Ga0501046_0000460_27988_29163 | 391 |
| 1286 | 3300049582 | Ga0501048_0001330 | Ga0501048_0001330_14327_15502 | 391 |
| 1287 | 3300049584 | Ga0501068_0003417 | Ga0501068_0003417_4263_5438 | 391 |
| 1288 | 3300049586 | Ga0501070_0007224 | Ga0501070_0007224_5571_6746 | 391 |
| 1289 | 3300049586 | Ga0501070_0014537 | Ga0501070_0014537_4263_5438 | 391 |
| 1290 | 3300049587 | Ga0501071_0003002 | Ga0501071_0003002_1477_2652 | 391 |
| 1291 | 3300049587 | Ga0501071_0003992 | Ga0501071_0003992_7503_8678 | 391 |
| 1292 | 3300049587 | Ga0501071_0132397 | Ga0501071_0132397_279_1454 | 391 |
| 1293 | 3300049588 | Ga0501072_0003291 | Ga0501072_0003291_3621_4796 | 391 |
| 1294 | 3300049588 | Ga0501072_0011956 | Ga0501072_0011956_2968_4143 | 391 |
| 1295 | 3300049588 | Ga0501072_0069537 | Ga0501072_0069537_1336_2511 | 391 |
| 1296 | 3300049589 | Ga0501073_0009003 | Ga0501073_0009003_1924_3099 | 391 |
| 1297 | 3300049591 | Ga0501075_0008691 | Ga0501075_0008691_1406_2581 | 391 |
| 1298 | 3300049591 | Ga0501075_0188258 | Ga0501075_0188258_386_1561 | 391 |
| 1299 | 3300049592 | Ga0501076_0000973 | Ga0501076_0000973_14005_15180 | 391 |
| 1300 | 3300049593 | Ga0501077_0000598 | Ga0501077_0000598_18078_19253 | 391 |
| 1301 | 3300049593 | Ga0501077_0075456 | Ga0501077_0075456_56_1231 | 391 |
| 1302 | 3300049667 | Ga0501230_000237 | Ga0501230_000237_897_2075 | 391 |
| 1303 | 3300049671 | Ga0501238_000615 | Ga0501238_000615_479_1657 | 391 |
| 1304 | 3300049741 | Ga0501079_0000184 | Ga0501079_0000184_32986_34161 | 391 |
| 1305 | 3300049741 | Ga0501079_0059984 | Ga0501079_0059984_1657_2832 | 391 |
| 1306 | 3300049742 | Ga0501080_0001609 | Ga0501080_0001609_4727_5902 | 391 |
| 1307 | 3300049742 | Ga0501080_0030734 | Ga0501080_0030734_2546_3721 | 391 |
| 1308 | 3300049742 | Ga0501080_0232767 | Ga0501080_0232767_296_1471 | 391 |
| 1309 | 3300049743 | Ga0501081_0013380 | Ga0501081_0013380_368_1543 | 391 |
| 1310 | 3300049744 | Ga0501083_0106966 | Ga0501083_0106966_186_1406 | 391 |
| 1311 | 3300049766 | Ga0501269_000236 | Ga0501269_000236_5212_6390 | 391 |
| 1312 | 3300049775 | Ga0501279_000406 | Ga0501279_000406_602_1780 | 391 |
| 1313 | 3300049822 | Ga0501035_0000697 | Ga0501035_0000697_2092_3267 | 391 |
| 1314 | 3300049822 | Ga0501035_0054360 | Ga0501035_0054360_2085_3260 | 391 |
| 1315 | 3300049823 | Ga0501044_0069197 | Ga0501044_0069197_1262_2440 | 391 |
| 1316 | 3300049823 | Ga0501044_0178686 | Ga0501044_0178686_361_1536 | 391 |
| 1317 | 3300049823 | Ga0501044_0212174 | Ga0501044_0212174_482_1657 | 391 |
| 1318 | 3300049823 | Ga0501044_0255494 | Ga0501044_0255494_496_1671 | 391 |
| 1319 | 3300049824 | Ga0501045_0043083 | Ga0501045_0043083_1644_2819 | 391 |
| 1320 | 3300049824 | Ga0501045_0100336 | Ga0501045_0100336_439_1614 | 391 |
| 1321 | 3300050489 | nmdc:mga03683_23551_c1 | nmdc:mga03683_23551_c1_276_1451 | 391 |
| 1322 | 3300050492 | nmdc:mga0yw44_52134_c1 | nmdc:mga0yw44_52134_c1_1192_2367 | 391 |
| 1323 | 3300050493 | nmdc:mga0k408_113030_c1 | nmdc:mga0k408_113030_c1_299_1474 | 391 |
| 1324 | 3300050494 | nmdc:mga06z11_61878_c1 | nmdc:mga06z11_61878_c1_666_1841 | 391 |
| 1325 | 3300050507 | nmdc:mga05p37_2303_c1 | nmdc:mga05p37_2303_c1_15412_16587 | 391 |
| 1326 | 3300050507 | nmdc:mga05p37_416_c1 | nmdc:mga05p37_416_c1_6657_7832 | 391 |
| 1327 | 3300050508 | nmdc:mga09592_1897_c1 | nmdc:mga09592_1897_c1_10792_11967 | 391 |
| 1328 | 3300050508 | nmdc:mga09592_778_c1 | nmdc:mga09592_778_c1_16950_18125 | 391 |
| 1329 | 3300050509 | nmdc:mga0qj67_163513_c1 | nmdc:mga0qj67_163513_c1_452_1627 | 391 |
| 1330 | 3300050509 | nmdc:mga0qj67_3855_c1 | nmdc:mga0qj67_3855_c1_5316_6491 | 391 |
| 1331 | 3300050510 | nmdc:mga06r32_24306_c1 | nmdc:mga06r32_24306_c1_3654_4829 | 391 |
| 1332 | 3300050510 | nmdc:mga06r32_8862_c1 | nmdc:mga06r32_8862_c1_2762_3937 | 391 |
| 1333 | 3300050511 | nmdc:mga08y16_15480_c1 | nmdc:mga08y16_15480_c1_6654_7829 | 391 |
| 1334 | 3300050511 | nmdc:mga08y16_6963_c1 | nmdc:mga08y16_6963_c1_9213_10388 | 391 |
| 1335 | 3300050512 | nmdc:mga0n895_1134_c1 | nmdc:mga0n895_1134_c1_3571_4746 | 391 |
| 1336 | 3300050512 | nmdc:mga0n895_1424_c1 | nmdc:mga0n895_1424_c1_3079_4254 | 391 |
| 1337 | 3300050512 | nmdc:mga0n895_29985_c1 | nmdc:mga0n895_29985_c1_1987_3162 | 391 |
| 1338 | 3300050513 | nmdc:mga0rr50_4637_c1 | nmdc:mga0rr50_4637_c1_503_1678 | 391 |
| 1339 | 3300050513 | nmdc:mga0rr50_7627_c1 | nmdc:mga0rr50_7627_c1_1481_2656 | 391 |
| 1340 | 3300050514 | nmdc:mga08x19_12096_c1 | nmdc:mga08x19_12096_c1_2081_3256 | 391 |
| 1341 | 3300050514 | nmdc:mga08x19_21639_c1 | nmdc:mga08x19_21639_c1_2470_3645 | 391 |
| 1342 | 3300050514 | nmdc:mga08x19_4999_c1 | nmdc:mga08x19_4999_c1_4161_5336 | 391 |
| 1343 | 3300050515 | nmdc:mga0a205_672_c1 | nmdc:mga0a205_672_c1_16995_18170 | 391 |
| 1344 | 3300053077 | Ga0495601_0003708 | Ga0495601_0003708_7018_8193 | 391 |
| 1345 | 3300053118 | Ga0500594_0026979 | Ga0500594_0026979_106_1284 | 391 |
| 1346 | 3300053125 | Ga0500618_000207 | Ga0500618_000207_42769_43947 | 391 |
| 1347 | 3300053145 | Ga0500586_000121 | Ga0500586_000121_1605_2783 | 391 |
| 1348 | 3300054114 | Ga0501084_0003932 | Ga0501084_0003932_3558_4733 | 391 |
| 1349 | 3300054114 | Ga0501084_0064163 | Ga0501084_0064163_768_1943 | 391 |
| 1350 | 3300054114 | Ga0501084_0154952 | Ga0501084_0154952_113_1288 | 391 |
| 1351 | 3300059421 | Ga0590071_014234 | Ga0590071_014234_159_1334 | 391 |
| 1352 | 3300059477 | Ga0587084_003334 | Ga0587084_003334_181_1356 | 391 |
| 1353 | 3300059477 | Ga0587084_006428 | Ga0587084_006428_32_1207 | 391 |
| 1354 | 3300059491 | Ga0587070_007463 | Ga0587070_007463_80_1255 | 391 |
| 1355 | 3300059491 | Ga0587070_009644 | Ga0587070_009644_38_1216 | 391 |
| 1356 | 3300059492 | Ga0587073_0006579 | Ga0587073_0006579_411_1589 | 391 |
| 1357 | 3300059493 | Ga0587077_002988 | Ga0587077_002988_718_1893 | 391 |
| 1358 | 3300059493 | Ga0587077_003600 | Ga0587077_003600_743_1933 | 391 |
| 1359 | 3300059504 | Ga0587082_003198 | Ga0587082_003198_46_1233 | 391 |
| 1360 | 3300059505 | Ga0587083_0005807 | Ga0587083_0005807_186_1361 | 391 |
| 1361 | 3300059506 | Ga0587085_006964 | Ga0587085_006964_186_1364 | 391 |
| 1362 | 3300059508 | Ga0587088_001835 | Ga0587088_001835_861_2036 | 391 |
| 1363 | 3300059508 | Ga0587088_008950 | Ga0587088_008950_83_1258 | 391 |
| 1364 | 3300059508 | Ga0587088_011027 | Ga0587088_011027_80_1255 | 391 |
| 1365 | 3300059510 | Ga0587090_003028 | Ga0587090_003028_347_1525 | 391 |
| 1366 | 3300059511 | Ga0587091_003231 | Ga0587091_003231_771_1946 | 391 |
| 1367 | 3300059511 | Ga0587091_009524 | Ga0587091_009524_82_1257 | 391 |
| 1368 | 3300059512 | Ga0587092_001738 | Ga0587092_001738_905_2080 | 391 |
| 1369 | 3300059512 | Ga0587092_007058 | Ga0587092_007058_185_1360 | 391 |
| 1370 | 3300059623 | Ga0587101_001197 | Ga0587101_001197_173_1348 | 391 |
| 1371 | 3300059624 | Ga0587109_011379 | Ga0587109_011379_181_1356 | 391 |
| 1372 | 3300059640 | Ga0587067_008976 | Ga0587067_008976_257_1447 | 391 |
| 1373 | 3300059641 | Ga0587068_001597 | Ga0587068_001597_526_1704 | 391 |
| 1374 | 3300059641 | Ga0587068_002278 | Ga0587068_002278_344_1519 | 391 |
| 1375 | 3300059641 | Ga0587068_004624 | Ga0587068_004624_190_1365 | 391 |
| 1376 | 3300059641 | Ga0587068_007582 | Ga0587068_007582_286_1473 | 391 |
| 1377 | 3300059641 | Ga0587068_009042 | Ga0587068_009042_97_1275 | 391 |
| 1378 | 3300059642 | Ga0587069_001889 | Ga0587069_001889_181_1356 | 391 |
| 1379 | 3300059643 | Ga0587072_010925 | Ga0587072_010925_80_1255 | 391 |
| 1380 | 3300059644 | Ga0587075_002218 | Ga0587075_002218_799_1974 | 391 |
| 1381 | 3300059645 | Ga0587076_003127 | Ga0587076_003127_39_1229 | 391 |
| 1382 | 3300059645 | Ga0587076_003974 | Ga0587076_003974_184_1359 | 391 |
| 1383 | 3300059645 | Ga0587076_008300 | Ga0587076_008300_190_1365 | 391 |
| 1384 | 3300059646 | Ga0587078_003654 | Ga0587078_003654_186_1361 | 391 |
| 1385 | 3300059647 | Ga0587079_002034 | Ga0587079_002034_992_2167 | 391 |
| 1386 | 3300059647 | Ga0587079_013310 | Ga0587079_013310_82_1257 | 391 |
| 1387 | 3300059649 | Ga0587102_000544 | Ga0587102_000544_174_1349 | 391 |
| 1388 | 3300059660 | Ga0587124_002118 | Ga0587124_002118_100_1287 | 391 |
| 1389 | 3300060344 | Ga0587071_009860 | Ga0587071_009860_84_1259 | 391 |
| 1390 | 3300060344 | Ga0587071_013688 | Ga0587071_013688_189_1367 | 391 |
| 1391 | 3300060346 | Ga0587111_0002989 | Ga0587111_0002989_922_2097 | 391 |
| 1392 | 3300060353 | Ga0501082_0002475 | Ga0501082_0002475_3354_4529 | 391 |
| 1393 | 3300060353 | Ga0501082_0131451 | Ga0501082_0131451_208_1383 | 391 |
| 1394 | 3300060353 | Ga0501082_0164433 | Ga0501082_0164433_679_1854 | 391 |
| 1395 | 3300061734 | Ga0530510_0004819 | Ga0530510_0004819_3827_5002 | 391 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4o9a-assembly1.cif.gz_B | crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 | 0.9886 | 3 | 391 |
| 4o99-assembly1.cif.gz_B | crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 | 0.9881 | 3 | 391 |
| 1m3k-assembly1.cif.gz_A | biosynthetic thiolase, inactive c89a mutant | 0.9877 | 2 | 390 |
| 1dlu-assembly1.cif.gz_A | unliganded biosynthetic thiolase from zoogloea ramigera | 0.9875 | 4 | 390 |
| 7lcl-assembly1.cif.gz_D | zoogloea ramigera biosynthetic thiolase q183y mutant | 0.9873 | 3 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8CAY6_6_396_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9858 | 2 | 391 | 3.40.47.10 |
| af_P76461_1_264_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9816 | 1 | 262 | 3.40.47.10 |
| af_P9WG69_2_389_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9795 | 6 | 390 | 3.40.50.720 |
| af_A0A0G2KML7_1_235_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9784 | 157 | 391 | 3.40.47.10 |
| 1dluC01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9761 | 4 | 272 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536EAF4-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.9) | 0.9919 | 1 | 125 |
GO:0003985
|
| AF-A0A2G1ZV94-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.9) | 0.9914 | 2 | 118 |
GO:0003985
|
| AF-A0A6I1HIL2-F1-model_v4 | Acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9913 | 1 | 391 |
GO:0003988
|
| AF-A0A6P9B1E3-F1-model_v4 | Acetyl-CoA acetyltransferase, cytosolic-like | 0.9906 | 16 | 120 |
GO:0016747
|
| AF-M5BJ77-F1-model_v4 | Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) | 0.9905 | 5 | 122 |
GO:0003985
GO:0005739 GO:0006635 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar