F493626

General Info

Members Datasets Scaffolds Average Seq Length
1395 576 1332 391

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025504|2501407421
Length 356
Sequence LERAGVKPEQVSDVIMGQVLTAGSGQNAARQASIKAGLPTAVPAMTINKVCGSGLKAVMLAANAIIAGDSDIVVAGGQENMSAAPHVLPGSRDGFRMGDAKLIDSMIVDGLWDVYNQYHMGVTAENVAREYGITREEQDAFAALSQNKAEAAQKAGRFDAEIVPVAIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFSKEGTVTAANASGINDGAAAVVVMSAKKAEALGLAPLARIKAYASGGVDPKVMGMGPVPASKRALERAGWSVNDLDLMEINEAFAAQALAVNKQMGWDTSKINVNGGAIAIGHPIGASGCRILVTLLHEMQRRDAKRGLASLCIGGGMGVALALERA

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
6 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
7 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
8 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
9 2643221556 Massilia sp. Root1485 Isolate Unclassified
10 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
11 2643221638 Duganella sp. Root336D2 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
16 2738541280 Massilia sp. GV090 Isolate Unclassified
17 2738541297 Duganella sp. GV083 Isolate Unclassified
18 2738541300 Massilia sp. GV016 Isolate Unclassified
19 2738541357 Duganella sp. GV053 Isolate Unclassified
20 2738543003 Duganella sp. GV066 Isolate Unclassified
21 2738543018 Massilia sp. GV045 Isolate Unclassified
22 2738543026 Duganella sp. GV089 Isolate Unclassified
23 2738543029 Duganella sp. GV039 Isolate Unclassified
24 2738543030 Massilia sp. GV097 Isolate Unclassified
25 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
26 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
27 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
28 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
29 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
30 2821131069 Duganella sp. 1224 Isolate Unclassified
31 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
32 2842682962 Bacillus sp. R-72492 Isolate Unclassified
33 2842711865 Duganella sp. R-73148 Isolate Unclassified
34 2849139964 Bacillus sp. R-71875 Isolate Unclassified
35 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
36 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
37 2857553236 Duganella sp. R-74557 Isolate Unclassified
38 2857558681 Duganella sp. R-74565 Isolate Unclassified
39 2857564685 Duganella sp. R-74599 Isolate Unclassified
40 2857581216 Bacillus sp. R-71922 Isolate Unclassified
41 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
42 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
43 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
44 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
45 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
46 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
47 2904424332 Duganella sp. 1411 Isolate Rhizosphere
48 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
49 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
50 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
51 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
52 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
53 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
54 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
55 2919476304 Duganella sp. 3397 Isolate Unclassified
56 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
57 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
58 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
59 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
60 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
61 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
62 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
63 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
76 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
77 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
78 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
79 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
81 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
82 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
83 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
84 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
85 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
86 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
87 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
88 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
89 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
90 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
91 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
92 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
93 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
94 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
95 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
96 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
101 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
102 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
103 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
106 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
118 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
119 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
122 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
123 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
124 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
125 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
128 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
129 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
132 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
133 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
134 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
135 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
136 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
142 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
143 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
144 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
145 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
146 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
147 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
148 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
149 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
150 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
151 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
152 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
153 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
154 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
158 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
159 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
160 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
161 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
162 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
164 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
165 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
166 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
167 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
168 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
169 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
170 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
171 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
172 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
174 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
175 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
176 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
177 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
178 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
179 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
180 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
181 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
182 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
183 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
184 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
185 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
186 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
187 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
188 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
189 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
190 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
191 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
192 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
193 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
194 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
195 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
196 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
197 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
198 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
199 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
200 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
201 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
202 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
203 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
204 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
205 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
206 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
207 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
208 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
210 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
212 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
213 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
219 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
221 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
222 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
223 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
226 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
227 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
233 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
235 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
238 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
295 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
301 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
302 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
303 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
304 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
305 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
306 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
307 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
308 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
309 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
310 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
311 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
312 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
313 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
314 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
315 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
316 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
317 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
318 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
319 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
320 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
321 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
322 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
323 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
324 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
325 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
326 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
327 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
328 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
329 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
330 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
331 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
332 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
333 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
334 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
335 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
336 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
337 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
338 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
339 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
340 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
341 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
343 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
344 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
345 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
346 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
347 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
348 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
349 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
350 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
351 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
352 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
353 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
354 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
355 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
356 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
357 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
358 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
359 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
360 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
361 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
362 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
363 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
364 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
365 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
366 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
367 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
368 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
369 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
370 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
371 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
372 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
373 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
374 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
375 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
376 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
377 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
380 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
381 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
382 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
383 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
384 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
385 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
386 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
387 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
388 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
389 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
390 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
391 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
392 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
393 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
394 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
398 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
399 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
400 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
401 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
404 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
405 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
406 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
407 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
408 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
409 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
410 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
411 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
412 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
413 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
414 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
415 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
416 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
417 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
420 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
421 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
422 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
423 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
424 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
425 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
426 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
427 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
428 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
429 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
432 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
433 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
434 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
435 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
436 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
437 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
438 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
439 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
440 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
441 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
442 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
443 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
444 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
445 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
446 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
447 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
448 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
449 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
450 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
451 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
452 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
453 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
454 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
455 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
456 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
457 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
458 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
459 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
460 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
461 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
462 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
463 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
464 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
465 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
466 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
467 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
468 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
469 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
470 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
471 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
472 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
473 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
474 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
475 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
476 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
477 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
478 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
479 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
480 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
481 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
482 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
483 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
484 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
485 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
486 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
487 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
488 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
489 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
490 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
491 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
492 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
497 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
498 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
511 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
512 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
513 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
514 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
515 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
516 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
517 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
518 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
519 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
520 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
521 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
522 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
523 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
524 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
525 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
526 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
527 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
530 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
531 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
532 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
533 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
534 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
535 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
536 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
537 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
538 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
539 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
540 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
541 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
542 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
543 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
544 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
545 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
546 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
547 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
548 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
549 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
550 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
551 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
575 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
576 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.04
Metatranscriptomes 4.44
Isolates 4.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.88
Nodule 0.72
Rhizoplane 3.37
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 7.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000224 3300002704 Bacteria 22214
2 JGI25156J39149_1000357 3300002705 Bacteria 29554
3 JGI25156J39149_1004830 3300002705 Bacteria 4021
4 JGI25154J39366_1000298 3300002738 Bacteria 29516
5 JGI25154J39366_1000314 3300002738 Bacteria 28089
6 JGI25154J39366_1001528 3300002738 Bacteria 8049
7 JGI25157J39369_1000262 3300002741 Bacteria 38795
8 JGI25152J39213_1001968 3300002773 Bacteria 8132
9 JGI25150J39212_1004788 3300002774 Bacteria 2965
10 JGI25159J45721_1001503 3300002987 Bacteria 9560
11 JGI25159J45721_1001567 3300002987 Bacteria 9372
12 JGI25159J45721_1001931 3300002987 Bacteria 8273
13 Ga0006759J45824_1029604 3300003163 Bacteria 2456
14 Ga0006759J45824_1036116 3300003163 Bacteria 2720
15 Ga0006759J45824_1038593 3300003163 Bacteria 2093
16 JGI25153J46596_10021355 3300003215 Bacteria 2415
17 JGI25160J50197_1002629 3300003354 Bacteria 8274
18 JGI25161J50226_1000851 3300003374 Bacteria 11351
19 Ga0007417J51691_1019026 3300003544 Bacteria 3000
20 Ga0007417J51691_1035094 3300003544 Bacteria 2190
21 Ga0007410J51695_1004766 3300003574 Bacteria 2306
22 Ga0007410J51695_1015802 3300003574 Bacteria 3127
23 Ga0007410J51695_1016077 3300003574 Bacteria 2482
24 Ga0007409J51694_1008022 3300003575 Bacteria 3060
25 Ga0007416J51690_1008222 3300003577 Bacteria 2920
26 Ga0007416J51690_1048588 3300003577 Bacteria 2167
27 Ga0007411J51799_105301 3300003611 Bacteria 2495
28 Ga0007411J51799_107039 3300003611 Bacteria 2590
29 Ga0032354_1017755 3300003693 Bacteria 3192
30 Ga0055538_1000110 3300003751 Bacteria 64583
31 Ga0055539_1000159 3300003752 Bacteria 64583
32 Ga0055533_1000161 3300003756 Bacteria 64583
33 Ga0055532_1000059 3300003758 Bacteria 152948
34 Ga0055525_1000023 3300003759 Bacteria 359920
35 Ga0055525_1000214 3300003759 Bacteria 64583
36 Ga0055535_1003465 3300003761 Bacteria 4456
37 Ga0055529_1000015 3300003763 Bacteria 366950
38 Ga0055526_1000127 3300003771 Bacteria 67487
39 Ga0055526_1000236 3300003771 Bacteria 46607
40 Ga0055526_1000251 3300003771 Bacteria 45724
41 Ga0055526_1002785 3300003771 Bacteria 11581
42 Ga0055526_1007677 3300003771 Bacteria 5549
43 Ga0055526_1013753 3300003771 Bacteria 3393
44 Ga0055537_1000121 3300003773 Bacteria 59656
45 Ga0055524_1000017 3300003775 Bacteria 235608
46 Ga0055524_1003529 3300003775 Bacteria 7560
47 Ga0055524_1005101 3300003775 Bacteria 5937
48 Ga0055524_1009191 3300003775 Bacteria 4042
49 Ga0055534_1000033 3300003784 Bacteria 116700
50 Ga0055534_1011135 3300003784 Bacteria 1844
51 Ga0055528_1000020 3300003790 Bacteria 144617
52 Ga0055528_1004648 3300003790 Bacteria 6567
53 Ga0055530_10011502 3300003791 Bacteria 3173
54 Ga0055531_10005155 3300003794 Bacteria 7705
55 Ga0055541_1000105 3300003841 Bacteria 64583
56 Ga0055543_1001887 3300004625 Bacteria 7614
57 Ga0055543_1005974 3300004625 Bacteria 3022
58 Ga0065165_1000045 3300005262 Bacteria 198887
59 Ga0065165_1000305 3300005262 Bacteria 81255
60 Ga0065165_1005109 3300005262 Bacteria 7614
61 Ga0065165_1006783 3300005262 Bacteria 5853
62 Ga0070676_10047019 3300005328 Bacteria 2518
63 Ga0070670_100016728 3300005331 Bacteria 6295
64 Ga0070670_100150404 3300005331 Bacteria 2015
65 Ga0068869_100001616 3300005334 Bacteria 13395
66 Ga0068869_100071471 3300005334 Bacteria 2569
67 Ga0070666_10006248 3300005335 Bacteria 7330
68 Ga0070680_100024156 3300005336 Bacteria 4851
69 Ga0070680_100033182 3300005336 Bacteria 4160
70 Ga0070680_100153535 3300005336 Bacteria 1934
71 Ga0070682_100064222 3300005337 Bacteria 2330
72 Ga0068868_100000209 3300005338 Bacteria 39624
73 Ga0068868_100009979 3300005338 Bacteria 6860
74 Ga0068868_100016011 3300005338 Bacteria 5560
75 Ga0070660_100004370 3300005339 Bacteria 9759
76 Ga0070660_100087616 3300005339 Bacteria 2450
77 Ga0070689_100003869 3300005340 Bacteria 10035
78 Ga0070691_10001291 3300005341 Bacteria 10621
79 Ga0070687_100000190 3300005343 Bacteria 21399
80 Ga0070661_100031382 3300005344 Bacteria 3842
81 Ga0070661_100126000 3300005344 Bacteria 1921
82 Ga0070692_10047798 3300005345 Bacteria 2215
83 Ga0070668_100039237 3300005347 Bacteria 3622
84 Ga0070669_100003300 3300005353 Bacteria 11600
85 Ga0070675_100131700 3300005354 Bacteria 2132
86 Ga0070671_100006266 3300005355 Bacteria 9480
87 Ga0070671_100025746 3300005355 Bacteria 4830
88 Ga0070674_100089309 3300005356 Bacteria 2220
89 Ga0070659_100010488 3300005366 Bacteria 6818
90 Ga0070667_100001572 3300005367 Bacteria 20458
91 Ga0070667_100003611 3300005367 Bacteria 13159
92 Ga0070667_100195824 3300005367 Bacteria 1791
93 Ga0070667_100204380 3300005367 Bacteria 1753
94 Ga0070667_100334754 3300005367 Bacteria 1368
95 Ga0070703_10010227 3300005406 Bacteria 2645
96 Ga0070713_100023776 3300005436 Bacteria 4762
97 Ga0070701_10006881 3300005438 Bacteria 4812
98 Ga0070711_100052190 3300005439 Bacteria 2813
99 Ga0070711_100294368 3300005439 Bacteria 1288
100 Ga0070705_100000320 3300005440 Bacteria 28430
101 Ga0070705_100006868 3300005440 Bacteria 5592
102 Ga0070700_100000571 3300005441 Bacteria 18444
103 Ga0070700_100000733 3300005441 Bacteria 16216
104 Ga0070694_100000802 3300005444 Bacteria 17651
105 Ga0070694_100009200 3300005444 Bacteria 6059
106 Ga0070662_100074596 3300005457 Bacteria 2510
107 Ga0070681_10000172 3300005458 Bacteria 49288
108 Ga0068867_100000417 3300005459 Bacteria 28383
109 Ga0068867_100003986 3300005459 Bacteria 10387
110 Ga0070706_100020063 3300005467 Bacteria 6159
111 Ga0070707_100150780 3300005468 Bacteria 2264
112 Ga0070698_100084098 3300005471 Bacteria 3171
113 Ga0070679_100071859 3300005530 Bacteria 3452
114 Ga0070697_100001858 3300005536 Bacteria 16143
115 Ga0070697_100003503 3300005536 Bacteria 12063
116 Ga0070697_100004877 3300005536 Bacteria 10295
117 Ga0068853_100090661 3300005539 Bacteria 2687
118 Ga0070686_100000825 3300005544 Bacteria 17899
119 Ga0070686_100062733 3300005544 Bacteria 2405
120 Ga0070686_100111726 3300005544 Bacteria 1863
121 Ga0070695_100000457 3300005545 Bacteria 21293
122 Ga0070695_100011568 3300005545 Bacteria 5279
123 Ga0070695_100069360 3300005545 Bacteria 2304
124 Ga0070695_100140999 3300005545 Bacteria 1671
125 Ga0070696_100002371 3300005546 Bacteria 12455
126 Ga0070696_100004412 3300005546 Bacteria 9390
127 Ga0070693_100001007 3300005547 Bacteria 12571
128 Ga0070665_100071194 3300005548 Bacteria 3483
129 Ga0070665_100449185 3300005548 Bacteria 1298
130 Ga0070704_100003235 3300005549 Bacteria 9308
131 Ga0070704_100007685 3300005549 Bacteria 6425
132 Ga0070704_100009798 3300005549 Bacteria 5810
133 Ga0070704_100044748 3300005549 Bacteria 3078
134 Ga0070704_100046564 3300005549 Bacteria 3025
135 Ga0070704_100133499 3300005549 Bacteria 1928
136 Ga0068855_100003929 3300005563 Bacteria 18142
137 Ga0068855_100009634 3300005563 Bacteria 11654
138 Ga0068855_100027136 3300005563 Bacteria 6852
139 Ga0068855_100045440 3300005563 Bacteria 5195
140 Ga0068855_100100599 3300005563 Bacteria 3328
141 Ga0070664_100052929 3300005564 Bacteria 3440
142 Ga0068857_100018579 3300005577 Bacteria 6099
143 Ga0068857_100047853 3300005577 Bacteria 3797
144 Ga0068854_100002076 3300005578 Bacteria 12287
145 Ga0068854_100209262 3300005578 Bacteria 1538
146 Ga0068856_100003781 3300005614 Bacteria 15160
147 Ga0068856_100031110 3300005614 Bacteria 5220
148 Ga0068856_100112324 3300005614 Bacteria 2722
149 Ga0070702_100000050 3300005615 Bacteria 32860
150 Ga0068852_100027471 3300005616 Bacteria 4639
151 Ga0068859_100000253 3300005617 Bacteria 53069
152 Ga0068859_100000332 3300005617 Bacteria 47130
153 Ga0068859_100017454 3300005617 Bacteria 7214
154 Ga0068859_100050419 3300005617 Bacteria 4181
155 Ga0068859_100087857 3300005617 Bacteria 3157
156 Ga0068864_100004666 3300005618 Bacteria 11241
157 Ga0068864_100102475 3300005618 Bacteria 2540
158 Ga0068864_100302832 3300005618 Bacteria 1497
159 Ga0068866_10000489 3300005718 Bacteria 18218
160 Ga0068861_100004686 3300005719 Bacteria 9191
161 Ga0068861_100119551 3300005719 Bacteria 2123
162 Ga0068870_10051688 3300005840 Bacteria 2177
163 Ga0068863_100000653 3300005841 Bacteria 35171
164 Ga0068863_100010939 3300005841 Bacteria 8798
165 Ga0068863_100038955 3300005841 Bacteria 4523
166 Ga0068858_100000503 3300005842 Bacteria 40960
167 Ga0068858_100025338 3300005842 Bacteria 5520
168 Ga0068858_100104904 3300005842 Bacteria 2637
169 Ga0068858_100107126 3300005842 Bacteria 2609
170 Ga0068860_100001764 3300005843 Bacteria 23090
171 Ga0068860_100011672 3300005843 Bacteria 8661
172 Ga0068860_100022107 3300005843 Bacteria 6157
173 Ga0068862_100007673 3300005844 Bacteria 8928
174 Ga0068862_100098252 3300005844 Bacteria 2557
175 Ga0081539_10003343 3300005985 Bacteria 19933
176 Ga0075365_10045830 3300006038 Bacteria 2870
177 Ga0075368_10039788 3300006042 Bacteria 1844
178 Ga0075363_100011589 3300006048 Bacteria 4227
179 Ga0070715_10041543 3300006163 Bacteria 1928
180 Ga0075367_10012620 3300006178 Bacteria 4514
181 Ga0075366_10075245 3300006195 Bacteria 2014
182 Ga0097621_100000676 3300006237 Bacteria 23878
183 Ga0097621_100065842 3300006237 Bacteria 2983
184 Ga0068871_100002899 3300006358 Bacteria 11767
185 Ga0068871_100030677 3300006358 Bacteria 4236
186 Ga0075428_100007878 3300006844 Bacteria 11812
187 Ga0075428_100020382 3300006844 Bacteria 7342
188 Ga0075430_100009032 3300006846 Bacteria 8424
189 Ga0075430_100010298 3300006846 Bacteria 7916
190 Ga0075431_100017867 3300006847 Bacteria 7212
191 Ga0075431_100029271 3300006847 Bacteria 5667
192 Ga0075431_100248848 3300006847 Bacteria 1806
193 Ga0075433_10001341 3300006852 Bacteria 18019
194 Ga0075433_10118571 3300006852 Bacteria 2349
195 Ga0075434_100000211 3300006871 Bacteria 39638
196 Ga0075434_100001149 3300006871 Bacteria 21878
197 Ga0075429_100000183 3300006880 Bacteria 40888
198 Ga0075429_100001213 3300006880 Bacteria 20918
199 Ga0068865_100005124 3300006881 Bacteria 7932
200 Ga0068865_100027969 3300006881 Bacteria 3730
201 Ga0068865_100060907 3300006881 Bacteria 2644
202 Ga0068865_100249009 3300006881 Bacteria 1402
203 Ga0075436_100002524 3300006914 Bacteria 12594
204 Ga0075436_100002652 3300006914 Bacteria 12295
205 Ga0075436_100019225 3300006914 Bacteria 4680
206 Ga0075436_100025991 3300006914 Bacteria 4031
207 Ga0075436_100067335 3300006914 Bacteria 2475
208 Ga0097620_100000253 3300006931 Bacteria 53069
209 Ga0097620_100000332 3300006931 Bacteria 47130
210 Ga0097620_100017455 3300006931 Bacteria 7214
211 Ga0097620_100050420 3300006931 Bacteria 4181
212 Ga0097620_100087858 3300006931 Bacteria 3157
213 Ga0079104_1006363 3300006946 Bacteria 4490
214 Ga0099826_10000008 3300006948 Bacteria 380974
215 Ga0075435_100000938 3300007076 Bacteria 18379
216 Ga0075435_100002363 3300007076 Bacteria 12510
217 Ga0075435_100006459 3300007076 Bacteria 8292
218 Ga0075435_100064346 3300007076 Bacteria 2980
219 Ga0075435_100094099 3300007076 Bacteria 2476
220 Ga0099795_10000045 3300007788 Bacteria 27712
221 Ga0105251_10016033 3300009011 Bacteria 4067
222 Ga0105244_10000791 3300009036 Bacteria 26909
223 Ga0105244_10003927 3300009036 Bacteria 10446
224 Ga0105244_10033860 3300009036 Bacteria 2692
225 Ga0105244_10062285 3300009036 Bacteria 1875
226 Ga0105240_10000787 3300009093 Bacteria 57466
227 Ga0105240_10013732 3300009093 Bacteria 11101
228 Ga0105240_10082386 3300009093 Bacteria 3951
229 Ga0111539_10079922 3300009094 Bacteria 3847
230 Ga0111539_10153767 3300009094 Bacteria 2692
231 Ga0105245_10000115 3300009098 Bacteria 77632
232 Ga0105245_10008434 3300009098 Bacteria 8999
233 Ga0105245_10057074 3300009098 Bacteria 3511
234 Ga0105247_10000643 3300009101 Bacteria 27978
235 Ga0105247_10009912 3300009101 Bacteria 5771
236 Ga0114129_10001051 3300009147 Bacteria 36178
237 Ga0114129_10051993 3300009147 Bacteria 5751
238 Ga0114129_10223526 3300009147 Bacteria 2539
239 Ga0114129_10339915 3300009147 Bacteria 1991
240 Ga0105243_10001566 3300009148 Bacteria 19983
241 Ga0105243_10014419 3300009148 Bacteria 5983
242 Ga0105241_10031834 3300009174 Bacteria 3950
243 Ga0105241_10055916 3300009174 Bacteria 3024
244 Ga0105242_10005505 3300009176 Bacteria 9776
245 Ga0105242_10028849 3300009176 Bacteria 4420
246 Ga0105242_10209075 3300009176 Bacteria 1738
247 Ga0105242_10312153 3300009176 Bacteria 1439
248 Ga0105248_10019135 3300009177 Bacteria 7574
249 Ga0105248_10222492 3300009177 Bacteria 2125
250 Ga0105237_10017152 3300009545 Bacteria 7511
251 Ga0105237_10048963 3300009545 Bacteria 4248
252 Ga0105238_10000537 3300009551 Bacteria 39712
253 Ga0105249_10001691 3300009553 Bacteria 19321
254 Ga0105249_10001995 3300009553 Bacteria 17726
255 Ga0105249_10083668 3300009553 Bacteria 2970
256 Ga0105249_10194629 3300009553 Bacteria 1981
257 Ga0099796_10000053 3300010159 Bacteria 20931
258 Ga0105239_10019688 3300010375 Bacteria 7449
259 Ga0105239_10103578 3300010375 Bacteria 3150
260 Ga0105239_10118690 3300010375 Bacteria 2935
261 Ga0157373_10086080 3300013100 Bacteria 2215
262 Ga0157371_10000003 3300013102 Bacteria 543317
263 Ga0157374_10000173 3300013296 Bacteria 59752
264 Ga0157374_10118484 3300013296 Bacteria 2553
265 Ga0157374_10131187 3300013296 Bacteria 2425
266 Ga0157378_10001030 3300013297 Bacteria 25495
267 Ga0157378_10013562 3300013297 Bacteria 7130
268 Ga0163162_10046451 3300013306 Bacteria 4353
269 Ga0163162_10351100 3300013306 Bacteria 1608
270 Ga0163162_10415320 3300013306 Bacteria 1478
271 Ga0157372_10508074 3300013307 Bacteria 1405
272 Ga0163163_10001456 3300014325 Bacteria 20014
273 Ga0157380_10159145 3300014326 Bacteria 1961
274 Ga0182008_10015273 3300014497 Bacteria 4009
275 Ga0157377_10057202 3300014745 Bacteria 2217
276 Ga0157379_10004821 3300014968 Bacteria 11592
277 Ga0157379_10010074 3300014968 Bacteria 8239
278 Ga0157376_10002960 3300014969 Bacteria 11654
279 Ga0157376_10013177 3300014969 Bacteria 6160
280 Ga0157376_10029396 3300014969 Bacteria 4377
281 Ga0182006_1000007 3300015261 Bacteria 452190
282 Ga0182006_1000059 3300015261 Bacteria 164868
283 Ga0182006_1034133 3300015261 Bacteria 2037
284 Ga0182007_10000068 3300015262 Bacteria 82301
285 Ga0182007_10026974 3300015262 Bacteria 1985
286 Ga0182005_1000006 3300015265 Bacteria 515188
287 Ga0182005_1000010 3300015265 Bacteria 434103
288 Ga0206351_10268376 3300020077 Bacteria 1620
289 Ga0213872_10001492 3300021361 Bacteria 15102
290 Ga0213872_10002646 3300021361 Bacteria 10393
291 Ga0213872_10003230 3300021361 Bacteria 9105
292 Ga0224712_10018126 3300022467 Bacteria 2347
293 Ga0209435_100032 3300025206 Bacteria 153068
294 Ga0209435_100146 3300025206 Bacteria 23627
295 Ga0209436_100314 3300025208 Bacteria 22212
296 Ga0209436_101267 3300025208 Bacteria 9072
297 Ga0209784_100035 3300025224 Bacteria 299760
298 Ga0209566_100040 3300025225 Bacteria 299760
299 Ga0209674_100057 3300025226 Bacteria 299760
300 Ga0209147_100109 3300025229 Bacteria 153068
301 Ga0209563_100011 3300025230 Bacteria 1187808
302 Ga0209563_100059 3300025230 Bacteria 299760
303 Ga0209437_100512 3300025233 Bacteria 27460
304 Ga0209258_100190 3300025242 Bacteria 126878
305 Ga0207425_1000009 3300025245 Bacteria 593135
306 Ga0207425_1000325 3300025245 Bacteria 34014
307 Ga0207425_1001909 3300025245 Bacteria 7908
308 Ga0209646_1000042 3300025246 Bacteria 343923
309 Ga0209646_1000113 3300025246 Bacteria 153068
310 Ga0209646_1000950 3300025246 Bacteria 9086
311 Ga0209026_1000102 3300025250 Bacteria 153068
312 Ga0209026_1001388 3300025250 Bacteria 10789
313 Ga0209026_1002229 3300025250 Bacteria 7463
314 Ga0209677_100036 3300025253 Bacteria 299760
315 Ga0209677_100944 3300025253 Bacteria 14198
316 Ga0209148_1000199 3300025254 Bacteria 108936
317 Ga0209759_1000104 3300025256 Bacteria 153068
318 Ga0209759_1000944 3300025256 Bacteria 20864
319 Ga0209129_1000061 3300025258 Bacteria 246061
320 Ga0209565_1000032 3300025263 Bacteria 316777
321 Ga0209565_1000508 3300025263 Bacteria 28236
322 Ga0209565_1002887 3300025263 Bacteria 5891
323 Ga0209455_1000031 3300025272 Bacteria 519952
324 Ga0209455_1005995 3300025272 Bacteria 3657
325 Ga0209673_1000029 3300025273 Bacteria 351978
326 Ga0209130_1000043 3300025284 Bacteria 254257
327 Ga0209130_1001889 3300025284 Bacteria 11871
328 Ga0209675_1000019 3300025291 Bacteria 351950
329 Ga0209675_1007208 3300025291 Bacteria 4306
330 Ga0209025_1000044 3300025294 Bacteria 349480
331 Ga0209564_1000010 3300025295 Bacteria 885399
332 Ga0209564_1000067 3300025295 Bacteria 311242
333 Ga0209564_1000115 3300025295 Bacteria 208988
334 Ga0209564_1000173 3300025295 Bacteria 154202
335 Ga0209564_1002315 3300025295 Bacteria 15453
336 Ga0209564_1005639 3300025295 Bacteria 7036
337 Ga0209758_1000579 3300025297 Bacteria 57238
338 Ga0209758_1001522 3300025297 Bacteria 26846
339 Ga0209050_1000040 3300025298 Bacteria 408492
340 Ga0209050_1000123 3300025298 Bacteria 195061
341 Ga0209256_1000018 3300025299 Bacteria 568467
342 Ga0209256_1000058 3300025299 Bacteria 272934
343 Ga0209256_1000142 3300025299 Bacteria 152245
344 Ga0209256_1001305 3300025299 Bacteria 26827
345 Ga0207426_1001242 3300025302 Bacteria 22421
346 Ga0209257_1000054 3300025304 Bacteria 416957
347 Ga0207655_1002048 3300025728 Bacteria 17014
348 Ga0207655_1003905 3300025728 Bacteria 10822
349 Ga0207655_1046281 3300025728 Bacteria 1808
350 Ga0207653_10017786 3300025885 Bacteria 2238
351 Ga0207710_10000961 3300025900 Bacteria 15182
352 Ga0207680_10017527 3300025903 Bacteria 3786
353 Ga0207645_10007199 3300025907 Bacteria 7885
354 Ga0207684_10029150 3300025910 Bacteria 4701
355 Ga0207654_10009008 3300025911 Bacteria 5065
356 Ga0207654_10011031 3300025911 Bacteria 4599
357 Ga0207707_10003624 3300025912 Bacteria 13691
358 Ga0207695_10001940 3300025913 Bacteria 32143
359 Ga0207695_10003997 3300025913 Bacteria 20338
360 Ga0207695_10010887 3300025913 Bacteria 11073
361 Ga0207660_10036373 3300025917 Bacteria 3422
362 Ga0207662_10000333 3300025918 Bacteria 21392
363 Ga0207657_10000785 3300025919 Bacteria 33729
364 Ga0207657_10002897 3300025919 Bacteria 18425
365 Ga0207657_10047008 3300025919 Bacteria 3777
366 Ga0207649_10014765 3300025920 Bacteria 4380
367 Ga0207649_10028428 3300025920 Bacteria 3292
368 Ga0207652_10290955 3300025921 Bacteria 1474
369 Ga0207646_10143728 3300025922 Bacteria 2149
370 Ga0207681_10016637 3300025923 Bacteria 4604
371 Ga0207694_10000384 3300025924 Bacteria 41184
372 Ga0207659_10051993 3300025926 Bacteria 2917
373 Ga0207659_10091349 3300025926 Bacteria 2274
374 Ga0207687_10011184 3300025927 Bacteria 5861
375 Ga0207687_10118271 3300025927 Bacteria 1978
376 Ga0207644_10004139 3300025931 Bacteria 9406
377 Ga0207644_10124009 3300025931 Bacteria 1970
378 Ga0207690_10008966 3300025932 Bacteria 5937
379 Ga0207690_10202646 3300025932 Bacteria 1508
380 Ga0207686_10030670 3300025934 Bacteria 3186
381 Ga0207686_10061245 3300025934 Bacteria 2385
382 Ga0207709_10000917 3300025935 Bacteria 22229
383 Ga0207709_10114240 3300025935 Bacteria 1811
384 Ga0207670_10003240 3300025936 Bacteria 8630
385 Ga0207670_10072295 3300025936 Bacteria 2387
386 Ga0207669_10008554 3300025937 Bacteria 4813
387 Ga0207704_10000141 3300025938 Bacteria 38563
388 Ga0207704_10033887 3300025938 Bacteria 2909
389 Ga0207704_10264051 3300025938 Bacteria 1299
390 Ga0207691_10012268 3300025940 Bacteria 8215
391 Ga0207689_10001663 3300025942 Bacteria 21091
392 Ga0207689_10191052 3300025942 Bacteria 1689
393 Ga0207679_10005829 3300025945 Bacteria 7736
394 Ga0207679_10047371 3300025945 Bacteria 3122
395 Ga0207667_10000146 3300025949 Bacteria 106926
396 Ga0207667_10007911 3300025949 Bacteria 12694
397 Ga0207667_10021874 3300025949 Bacteria 7077
398 Ga0207667_10035181 3300025949 Bacteria 5374
399 Ga0207667_10061566 3300025949 Bacteria 3926
400 Ga0207712_10000763 3300025961 Bacteria 24183
401 Ga0207712_10001549 3300025961 Bacteria 15507
402 Ga0207668_10029618 3300025972 Bacteria 3589
403 Ga0207640_10005459 3300025981 Bacteria 6933
404 Ga0207640_10031450 3300025981 Bacteria 3279
405 Ga0207658_10010157 3300025986 Bacteria 6398
406 Ga0207658_10036037 3300025986 Bacteria 3546
407 Ga0207677_10001911 3300026023 Bacteria 11006
408 Ga0207677_10030442 3300026023 Bacteria 3445
409 Ga0207703_10011030 3300026035 Bacteria 7041
410 Ga0207703_10022984 3300026035 Bacteria 4895
411 Ga0207703_10070081 3300026035 Bacteria 2893
412 Ga0207639_10022306 3300026041 Bacteria 4559
413 Ga0207639_10085764 3300026041 Bacteria 2505
414 Ga0207678_10044135 3300026067 Bacteria 3857
415 Ga0207708_10000114 3300026075 Bacteria 61971
416 Ga0207708_10065819 3300026075 Bacteria 2770
417 Ga0207708_10140881 3300026075 Bacteria 1891
418 Ga0207702_10030333 3300026078 Bacteria 4506
419 Ga0207702_10041091 3300026078 Bacteria 3877
420 Ga0207702_10109756 3300026078 Bacteria 2450
421 Ga0207702_10317408 3300026078 Bacteria 1483
422 Ga0207641_10000078 3300026088 Bacteria 143842
423 Ga0207641_10029235 3300026088 Bacteria 4556
424 Ga0207648_10000113 3300026089 Bacteria 78626
425 Ga0207648_10010664 3300026089 Bacteria 8687
426 Ga0207648_10097267 3300026089 Bacteria 2576
427 Ga0207676_10292723 3300026095 Bacteria 1483
428 Ga0207674_10076131 3300026116 Bacteria 3364
429 Ga0207674_10105420 3300026116 Bacteria 2797
430 Ga0207675_100005429 3300026118 Bacteria 12215
431 Ga0207675_100010262 3300026118 Bacteria 8777
432 Ga0207683_10134453 3300026121 Bacteria 2226
433 Ga0207698_10091744 3300026142 Bacteria 2488
434 Ga0209981_1000930 3300027378 Bacteria 3667
435 Ga0209981_1009769 3300027378 Bacteria 1314
436 Ga0209996_1004501 3300027395 Bacteria 1769
437 Ga0210000_1002707 3300027462 Bacteria 2526
438 Ga0209995_1000961 3300027471 Bacteria 4462
439 Ga0209179_1000021 3300027512 Bacteria 45587
440 Ga0209968_1011722 3300027526 Bacteria 1362
441 Ga0209999_1009583 3300027543 Bacteria 1749
442 Ga0209983_1005075 3300027665 Bacteria 2743
443 Ga0209282_1000005 3300027666 Bacteria 380858
444 Ga0209966_1001145 3300027695 Bacteria 4737
445 Ga0207428_10000624 3300027907 Bacteria 41590
446 Ga0207428_10051818 3300027907 Bacteria 3279
447 Ga0268266_10129910 3300028379 Bacteria 2252
448 Ga0268265_10003785 3300028380 Bacteria 10725
449 Ga0268265_10006425 3300028380 Bacteria 7967
450 Ga0268264_10000380 3300028381 Bacteria 64910
451 Ga0268264_10002945 3300028381 Bacteria 14789
452 Ga0268264_10006475 3300028381 Bacteria 9861
453 Ga0268264_10236896 3300028381 Bacteria 1688
454 Ga0268264_10257045 3300028381 Bacteria 1625
455 Ga0265336_10000097 3300028666 Bacteria 66270
456 Ga0265324_10000001 3300029957 Bacteria 562975
457 Ga0316182_1045184 3300030745 Bacteria 2669
458 Ga0265328_10000050 3300031239 Bacteria 79086
459 Ga0265325_10000358 3300031241 Bacteria 32097
460 Ga0265316_10171943 3300031344 Bacteria 1616
461 Ga0307408_100000237 3300031548 Bacteria 57856
462 Ga0307408_100000238 3300031548 Bacteria 57786
463 Ga0307408_100002450 3300031548 Bacteria 13012
464 Ga0307408_100046907 3300031548 Bacteria 3092
465 Ga0316575_10002687 3300031665 Bacteria 5999
466 Ga0316575_10005611 3300031665 Bacteria 4479
467 Ga0316579_10001345 3300031691 Bacteria 8884
468 Ga0307516_10002891 3300031730 Bacteria 22553
469 Ga0316577_10156705 3300031733 Bacteria 1284
470 Ga0307416_100003997 3300032002 Bacteria 8794
471 Ga0307416_100068070 3300032002 Bacteria 2940
472 Ga0307416_100187738 3300032002 Bacteria 1945
473 Ga0307414_10007162 3300032004 Bacteria 6257
474 Ga0373930_0005971 3300034816 Bacteria 2043
475 Ga0373959_0011344 3300034820 Bacteria 1572
476 Ga0373926_0010491 3300035083 Bacteria 3107
477 Ga0373928_0005604 3300035084 Bacteria 2402
478 Ga0373934_0005673 3300035086 Bacteria 4623
479 Ga0373944_0004560 3300035089 Bacteria 3615
480 Ga0373949_0025849 3300035090 Bacteria 1372
481 Ga0373923_0017164 3300035111 Bacteria 2764
482 Ga0373923_0076734 3300035111 Bacteria 1444
483 Ga0373932_0000563 3300035112 Bacteria 11404
484 Ga0373936_0020490 3300035113 Bacteria 2569
485 Ga0373939_0006348 3300035114 Bacteria 2847
486 Ga0373941_0019817 3300035115 Bacteria 1878
487 Ga0373945_0006048 3300035116 Bacteria 3890
488 Ga0373953_0015634 3300035117 Bacteria 2755
489 Ga0373954_0000001 3300035118 Bacteria 158201
490 Ga0373957_0014165 3300035120 Bacteria 2721
491 Ga0373946_0008207 3300035171 Bacteria 3832
492 Ga0373955_0058370 3300035172 Bacteria 2123
493 Ga0373942_0004466 3300035207 Bacteria 3244
494 Ga0373942_0028518 3300035207 Bacteria 1459
495 Ga0373942_0037642 3300035207 Bacteria 1309
496 Ga0373961_0011726 3300035241 Bacteria 2180
497 Ga0373961_0013493 3300035241 Bacteria 2061
498 Ga0373961_0025722 3300035241 Bacteria 1603
499 Ga0316574_0001268 3300035398 Bacteria 11785
500 Ga0373924_0020509 3300035410 Bacteria 2570
501 Ga0373924_0042206 3300035410 Bacteria 1870
502 Ga0373931_0001933 3300035691 Bacteria 9078
503 Ga0373931_0018621 3300035691 Bacteria 3455
504 Ga0373931_0022619 3300035691 Bacteria 3165
505 Ga0373935_0021639 3300035692 Bacteria 3939
506 Ga0373927_0002341 3300035695 Bacteria 13812
507 Ga0373927_0016007 3300035695 Bacteria 4950
508 Ga0373933_0007378 3300035724 Bacteria 5996
509 Ga0373933_0017196 3300035724 Bacteria 4054
510 Ga0373933_0089282 3300035724 Bacteria 1900
511 Ga0373933_0107633 3300035724 Bacteria 1736
512 Ga0373947_0009399 3300035725 Bacteria 5615
513 Ga0373947_0170455 3300035725 Bacteria 1412
514 Ga0373937_0000524 3300036401 Bacteria 34277
515 Ga0373937_0005139 3300036401 Bacteria 11155
516 Ga0373925_0040447 3300037068 Bacteria 3452
517 Ga0395899_0000019 3300037312 Bacteria 411777
518 Ga0395899_0000798 3300037312 Bacteria 30830
519 Ga0395899_0007820 3300037312 Bacteria 8244
520 Ga0395899_0012712 3300037312 Bacteria 6450
521 Ga0395900_0000094 3300037418 Bacteria 165903
522 Ga0395900_0011030 3300037418 Bacteria 9233
523 Ga0395900_0011936 3300037418 Bacteria 8883
524 Ga0395898_0120646 3300037466 Bacteria 2512
525 Ga0395905_0007080 3300037471 Bacteria 11212
526 Ga0395905_0010604 3300037471 Bacteria 8945
527 Ga0395905_0075873 3300037471 Bacteria 3150
528 Ga0395905_0164472 3300037471 Bacteria 2085
529 Ga0395905_0256220 3300037471 Bacteria 1634
530 Ga0316581_0003799 3300037588 Bacteria 3794
531 Ga0395901_0003213 3300038443 Bacteria 16455
532 Ga0395901_0004893 3300038443 Bacteria 13516
533 Ga0395901_0039068 3300038443 Bacteria 4910
534 Ga0395901_0046737 3300038443 Bacteria 4496
535 Ga0436361_0173709 3300039447 Bacteria 11505
536 Ga0436361_0568855 3300039447 Bacteria 14834
537 Ga0436361_0687629 3300039447 Bacteria 8660
538 Ga0436361_1015529 3300039447 Bacteria 2775
539 Ga0436361_1028139 3300039447 Bacteria 2426
540 Ga0436361_1082582 3300039447 Bacteria 32081
541 Ga0436361_1117918 3300039447 Bacteria 2632
542 Ga0436363_0742819 3300039450 Bacteria 1763
543 Ga0439465_0035971 3300041413 Bacteria 1589
544 Ga0439449_0011991 3300042007 Bacteria 3256
545 Ga0439450_013487 3300042008 Bacteria 1643
546 Ga0439451_021958 3300042009 Bacteria 1287
547 Ga0439462_0025472 3300042015 Bacteria 1557
548 Ga0439446_0000980 3300042156 Bacteria 6218
549 Ga0439434_0000592 3300042435 Bacteria 10453
550 Ga0439435_0000150 3300042436 Bacteria 9449
551 Ga0439444_0000591 3300042437 Bacteria 4162
552 Ga0451577_0000013 3300042876 Bacteria 550689
553 Ga0451577_0017865 3300042876 Bacteria 6544
554 Ga0466972_0000608 3300044658 Bacteria 17506
555 Ga0466972_0002716 3300044658 Bacteria 8756
556 Ga0466972_0021883 3300044658 Bacteria 3185
557 Ga0466972_0102123 3300044658 Bacteria 1357
558 Ga0453683_0000059 3300044673 Bacteria 187158
559 Ga0466965_0000165 3300044683 Bacteria 20020
560 Ga0466965_0001132 3300044683 Bacteria 10441
561 Ga0466966_0015800 3300044684 Bacteria 4988
562 Ga0466966_0038508 3300044684 Bacteria 3081
563 Ga0466963_0192259 3300044694 Bacteria 1426
564 Ga0466964_0001917 3300044706 Bacteria 7275
565 Ga0466964_0004838 3300044706 Bacteria 4978
566 Ga0466964_0006354 3300044706 Bacteria 4401
567 Ga0466964_0018428 3300044706 Bacteria 2679
568 Ga0466964_0041673 3300044706 Bacteria 1858
569 Ga0466964_0046243 3300044706 Bacteria 1773
570 Ga0453684_0000075 3300044712 Bacteria 437715
571 Ga0453684_0000585 3300044712 Bacteria 135647
572 Ga0466968_0009986 3300044735 Bacteria 3666
573 Ga0466957_0000353 3300044842 Bacteria 22548
574 Ga0466957_0020442 3300044842 Bacteria 3896
575 Ga0466959_0022802 3300045049 Bacteria 4628
576 Ga0466959_0065137 3300045049 Bacteria 2644
577 Ga0451576_0000018 3300045051 Bacteria 550689
578 Ga0451576_0000220 3300045051 Bacteria 141261
579 Ga0451576_0006716 3300045051 Bacteria 14020
580 Ga0451576_0080077 3300045051 Bacteria 3399
581 Ga0451576_0112670 3300045051 Bacteria 2831
582 Ga0451576_0121077 3300045051 Bacteria 2724
583 Ga0466967_0007734 3300045976 Bacteria 7792
584 Ga0466967_0083453 3300045976 Bacteria 2889
585 Ga0466967_0263811 3300045976 Bacteria 1648
586 Ga0495617_000017 3300046452 Bacteria 253066
587 Ga0495617_000025 3300046452 Bacteria 164547
588 Ga0495617_000161 3300046452 Bacteria 42643
589 Ga0495617_001604 3300046452 Bacteria 9770
590 Ga0495617_001680 3300046452 Bacteria 9512
591 Ga0495627_000004 3300046453 Bacteria 640612
592 Ga0495627_002605 3300046453 Bacteria 8500
593 Ga0495627_006780 3300046453 Bacteria 4455
594 Ga0495627_017149 3300046453 Bacteria 2466
595 Ga0495592_0000330 3300046454 Bacteria 39376
596 Ga0495603_0026086 3300046455 Bacteria 3532
597 Ga0495603_0034431 3300046455 Bacteria 3045
598 Ga0495590_0000014 3300046457 Bacteria 258314
599 Ga0495590_0000084 3300046457 Bacteria 62246
600 Ga0495590_0001338 3300046457 Bacteria 10720
601 Ga0495590_0002892 3300046457 Bacteria 7069
602 Ga0495590_0003601 3300046457 Bacteria 6304
603 Ga0495590_0016705 3300046457 Bacteria 2649
604 Ga0495591_000034 3300046458 Bacteria 170328
605 Ga0495629_0004476 3300046459 Bacteria 10471
606 Ga0495629_0027130 3300046459 Bacteria 4068
607 Ga0495629_0036197 3300046459 Bacteria 3486
608 Ga0495629_0104326 3300046459 Bacteria 1977
609 Ga0495629_0138423 3300046459 Bacteria 1694
610 Ga0495638_0000133 3300046460 Bacteria 119393
611 Ga0495638_0008243 3300046460 Bacteria 7405
612 Ga0495638_0013742 3300046460 Bacteria 5499
613 Ga0495638_0015650 3300046460 Bacteria 5089
614 Ga0495638_0028761 3300046460 Bacteria 3587
615 Ga0495653_0000016 3300046463 Bacteria 200976
616 Ga0495653_0010559 3300046463 Bacteria 7562
617 Ga0495653_0099149 3300046463 Bacteria 2114
618 Ga0495650_0000062 3300046471 Bacteria 277977
619 Ga0495650_0000084 3300046471 Bacteria 235690
620 Ga0495650_0000136 3300046471 Bacteria 171758
621 Ga0495650_0000141 3300046471 Bacteria 168676
622 Ga0495650_0000201 3300046471 Bacteria 130128
623 Ga0495650_0000255 3300046471 Bacteria 103396
624 Ga0495650_0001140 3300046471 Bacteria 28800
625 Ga0495650_0016111 3300046471 Bacteria 3802
626 Ga0495650_0027985 3300046471 Bacteria 2595
627 Ga0495580_0000673 3300046472 Bacteria 29171
628 Ga0495580_0055254 3300046472 Bacteria 2799
629 Ga0495582_0022123 3300046473 Bacteria 3478
630 Ga0495582_0034372 3300046473 Bacteria 2786
631 Ga0495605_0000043 3300046474 Bacteria 185216
632 Ga0495605_0000077 3300046474 Bacteria 127523
633 Ga0495605_0000471 3300046474 Bacteria 35776
634 Ga0495605_0003656 3300046474 Bacteria 9129
635 Ga0495605_0003838 3300046474 Bacteria 8914
636 Ga0495605_0020215 3300046474 Bacteria 3541
637 Ga0495605_0033409 3300046474 Bacteria 2610
638 Ga0495605_0046049 3300046474 Bacteria 2146
639 Ga0495639_0040528 3300046475 Bacteria 2095
640 Ga0495662_0009077 3300046476 Bacteria 4882
641 Ga0495584_0000004 3300046491 Bacteria 314714
642 Ga0495584_0000274 3300046491 Bacteria 36593
643 Ga0495584_0003655 3300046491 Bacteria 8384
644 Ga0495584_0005749 3300046491 Bacteria 6546
645 Ga0495584_0013146 3300046491 Bacteria 4223
646 Ga0495584_0023302 3300046491 Bacteria 3139
647 Ga0495584_0025806 3300046491 Bacteria 2978
648 Ga0495584_0033378 3300046491 Bacteria 2603
649 Ga0495584_0050213 3300046491 Bacteria 2100
650 Ga0495584_0056745 3300046491 Bacteria 1970
651 Ga0495584_0076091 3300046491 Bacteria 1688
652 Ga0495585_0000578 3300046492 Bacteria 34546
653 Ga0495585_0000713 3300046492 Bacteria 29877
654 Ga0495585_0001437 3300046492 Bacteria 18679
655 Ga0495585_0003217 3300046492 Bacteria 11146
656 Ga0495585_0005567 3300046492 Bacteria 7915
657 Ga0495585_0006781 3300046492 Bacteria 7069
658 Ga0495585_0007257 3300046492 Bacteria 6804
659 Ga0495585_0013513 3300046492 Bacteria 4772
660 Ga0495585_0016813 3300046492 Bacteria 4238
661 Ga0495585_0017689 3300046492 Bacteria 4116
662 Ga0495585_0028018 3300046492 Bacteria 3215
663 Ga0495585_0028728 3300046492 Bacteria 3169
664 Ga0495585_0030624 3300046492 Bacteria 3059
665 Ga0495585_0036250 3300046492 Bacteria 2783
666 Ga0495585_0040725 3300046492 Bacteria 2607
667 Ga0495585_0061019 3300046492 Bacteria 2074
668 Ga0495585_0066378 3300046492 Bacteria 1975
669 Ga0495594_0010456 3300046499 Bacteria 4814
670 Ga0495594_0010939 3300046499 Bacteria 4707
671 Ga0495594_0012276 3300046499 Bacteria 4462
672 Ga0495594_0014538 3300046499 Bacteria 4126
673 Ga0495594_0108762 3300046499 Bacteria 1562
674 Ga0495596_0000508 3300046500 Bacteria 24723
675 Ga0495596_0002024 3300046500 Bacteria 11143
676 Ga0495596_0002076 3300046500 Bacteria 11002
677 Ga0495596_0006098 3300046500 Bacteria 5606
678 Ga0495596_0009155 3300046500 Bacteria 4367
679 Ga0495596_0010488 3300046500 Bacteria 4032
680 Ga0495596_0016195 3300046500 Bacteria 3101
681 Ga0495596_0020366 3300046500 Bacteria 2716
682 Ga0495607_0000806 3300046501 Bacteria 29657
683 Ga0495607_0003187 3300046501 Bacteria 12671
684 Ga0495607_0005471 3300046501 Bacteria 9086
685 Ga0495607_0006127 3300046501 Bacteria 8506
686 Ga0495607_0009350 3300046501 Bacteria 6638
687 Ga0495607_0025650 3300046501 Bacteria 3664
688 Ga0495607_0046268 3300046501 Bacteria 2556
689 Ga0495583_0000044 3300046506 Bacteria 226264
690 Ga0495583_0000091 3300046506 Bacteria 158961
691 Ga0495583_0000099 3300046506 Bacteria 148167
692 Ga0495583_0000246 3300046506 Bacteria 89354
693 Ga0495583_0000936 3300046506 Bacteria 34112
694 Ga0495583_0002959 3300046506 Bacteria 13651
695 Ga0495583_0004328 3300046506 Bacteria 10247
696 Ga0495583_0008047 3300046506 Bacteria 6502
697 Ga0495583_0010011 3300046506 Bacteria 5585
698 Ga0495583_0024362 3300046506 Bacteria 3042
699 Ga0495583_0027526 3300046506 Bacteria 2805
700 Ga0495606_0000046 3300046507 Bacteria 210855
701 Ga0495606_0000051 3300046507 Bacteria 201659
702 Ga0495606_0000093 3300046507 Bacteria 152281
703 Ga0495606_0000476 3300046507 Bacteria 65896
704 Ga0495606_0000532 3300046507 Bacteria 61394
705 Ga0495606_0000929 3300046507 Bacteria 43166
706 Ga0495606_0000986 3300046507 Bacteria 41479
707 Ga0495606_0005680 3300046507 Bacteria 11808
708 Ga0495606_0014034 3300046507 Bacteria 6279
709 Ga0495606_0015400 3300046507 Bacteria 5893
710 Ga0495606_0016063 3300046507 Bacteria 5730
711 Ga0495606_0019821 3300046507 Bacteria 4982
712 Ga0495606_0037849 3300046507 Bacteria 3271
713 Ga0495606_0039552 3300046507 Bacteria 3176
714 Ga0495606_0062176 3300046507 Bacteria 2384
715 Ga0495608_0002611 3300046511 Bacteria 12950
716 Ga0495610_0000027 3300046512 Bacteria 275273
717 Ga0495610_0001625 3300046512 Bacteria 19763
718 Ga0495610_0002161 3300046512 Bacteria 16719
719 Ga0495610_0005034 3300046512 Bacteria 9548
720 Ga0495616_0000253 3300046513 Bacteria 43324
721 Ga0495616_0000504 3300046513 Bacteria 29591
722 Ga0495616_0000544 3300046513 Bacteria 28388
723 Ga0495616_0000591 3300046513 Bacteria 27295
724 Ga0495616_0002867 3300046513 Bacteria 11249
725 Ga0495616_0003323 3300046513 Bacteria 10335
726 Ga0495616_0005983 3300046513 Bacteria 7421
727 Ga0495616_0026912 3300046513 Bacteria 3055
728 Ga0495616_0032132 3300046513 Bacteria 2744
729 Ga0495616_0040587 3300046513 Bacteria 2377
730 Ga0495616_0059352 3300046513 Bacteria 1881
731 Ga0495616_0071683 3300046513 Bacteria 1674
732 Ga0495616_0079182 3300046513 Bacteria 1575
733 Ga0495616_0099479 3300046513 Bacteria 1365
734 Ga0495618_0024257 3300046514 Bacteria 3755
735 Ga0495620_0005087 3300046515 Bacteria 7363
736 Ga0495628_0169820 3300046516 Bacteria 1654
737 Ga0495630_0002124 3300046517 Bacteria 13785
738 Ga0495630_0204089 3300046517 Bacteria 1508
739 Ga0495631_0000278 3300046518 Bacteria 35695
740 Ga0495631_0000604 3300046518 Bacteria 23574
741 Ga0495631_0006277 3300046518 Bacteria 6152
742 Ga0495631_0009643 3300046518 Bacteria 4813
743 Ga0495631_0012275 3300046518 Bacteria 4191
744 Ga0495631_0014582 3300046518 Bacteria 3787
745 Ga0495631_0020621 3300046518 Bacteria 3077
746 Ga0495631_0038171 3300046518 Bacteria 2136
747 Ga0495631_0049186 3300046518 Bacteria 1846
748 Ga0495632_0000092 3300046519 Bacteria 92510
749 Ga0495632_0000136 3300046519 Bacteria 74659
750 Ga0495632_0001025 3300046519 Bacteria 24154
751 Ga0495632_0003825 3300046519 Bacteria 10464
752 Ga0495632_0007739 3300046519 Bacteria 6704
753 Ga0495632_0015274 3300046519 Bacteria 4314
754 Ga0495632_0025563 3300046519 Bacteria 3121
755 Ga0495632_0048895 3300046519 Bacteria 2092
756 Ga0495632_0070186 3300046519 Bacteria 1685
757 Ga0495637_0000003 3300046520 Bacteria 623293
758 Ga0495637_0000058 3300046520 Bacteria 96841
759 Ga0495637_0000494 3300046520 Bacteria 28654
760 Ga0495637_0004779 3300046520 Bacteria 6987
761 Ga0495637_0038654 3300046520 Bacteria 2064
762 Ga0495643_0000129 3300046522 Bacteria 122235
763 Ga0495643_0000139 3300046522 Bacteria 117261
764 Ga0495643_0000184 3300046522 Bacteria 100035
765 Ga0495643_0004217 3300046522 Bacteria 10175
766 Ga0495643_0014171 3300046522 Bacteria 4750
767 Ga0495643_0014568 3300046522 Bacteria 4674
768 Ga0495643_0018624 3300046522 Bacteria 4030
769 Ga0495643_0037871 3300046522 Bacteria 2643
770 Ga0495643_0050242 3300046522 Bacteria 2246
771 Ga0495644_0001715 3300046523 Bacteria 8869
772 Ga0495644_0008067 3300046523 Bacteria 4050
773 Ga0495644_0011752 3300046523 Bacteria 3370
774 Ga0495644_0014504 3300046523 Bacteria 3019
775 Ga0495644_0017725 3300046523 Bacteria 2720
776 Ga0495644_0025292 3300046523 Bacteria 2254
777 Ga0495644_0034658 3300046523 Bacteria 1905
778 Ga0495648_0000006 3300046524 Bacteria 361208
779 Ga0495648_0000127 3300046524 Bacteria 89962
780 Ga0495648_0001350 3300046524 Bacteria 24244
781 Ga0495648_0001892 3300046524 Bacteria 19996
782 Ga0495648_0004786 3300046524 Bacteria 11445
783 Ga0495648_0013469 3300046524 Bacteria 6043
784 Ga0495648_0016855 3300046524 Bacteria 5251
785 Ga0495648_0040029 3300046524 Bacteria 2976
786 Ga0495648_0057606 3300046524 Bacteria 2328
787 Ga0495648_0066893 3300046524 Bacteria 2104
788 Ga0495648_0090471 3300046524 Bacteria 1715
789 Ga0495648_0110518 3300046524 Bacteria 1497
790 Ga0495663_0006459 3300046525 Bacteria 3240
791 Ga0495666_0000358 3300046526 Bacteria 20068
792 Ga0495666_0003925 3300046526 Bacteria 7515
793 Ga0495666_0023321 3300046526 Bacteria 3060
794 Ga0495666_0046082 3300046526 Bacteria 2103
795 Ga0495642_0000014 3300046528 Bacteria 122339
796 Ga0495642_0000601 3300046528 Bacteria 18108
797 Ga0495642_0001447 3300046528 Bacteria 10627
798 Ga0495642_0001848 3300046528 Bacteria 9055
799 Ga0495642_0002139 3300046528 Bacteria 8151
800 Ga0495642_0002176 3300046528 Bacteria 8049
801 Ga0495642_0006905 3300046528 Bacteria 4352
802 Ga0495642_0015932 3300046528 Bacteria 2926
803 Ga0495642_0017775 3300046528 Bacteria 2778
804 Ga0495642_0017777 3300046528 Bacteria 2778
805 Ga0495642_0052798 3300046528 Bacteria 1674
806 Ga0495652_0019446 3300046529 Bacteria 6049
807 Ga0495652_0060024 3300046529 Bacteria 3215
808 Ga0495652_0085345 3300046529 Bacteria 2595
809 Ga0495654_0000022 3300046530 Bacteria 260104
810 Ga0495654_0001794 3300046530 Bacteria 14300
811 Ga0495654_0006359 3300046530 Bacteria 6718
812 Ga0495665_0005000 3300046531 Bacteria 7146
813 Ga0495665_0011946 3300046531 Bacteria 4700
814 Ga0495665_0029779 3300046531 Bacteria 2924
815 Ga0495640_0000361 3300046533 Bacteria 31989
816 Ga0495640_0037901 3300046533 Bacteria 3396
817 Ga0495586_0002047 3300046535 Bacteria 10948
818 Ga0495586_0002540 3300046535 Bacteria 9883
819 Ga0495586_0004893 3300046535 Bacteria 7164
820 Ga0495587_0021357 3300046536 Bacteria 3992
821 Ga0495587_0081796 3300046536 Bacteria 1871
822 Ga0495598_0010589 3300046537 Bacteria 2213
823 Ga0495609_0000068 3300046538 Bacteria 129809
824 Ga0495609_0000071 3300046538 Bacteria 126994
825 Ga0495609_0001980 3300046538 Bacteria 12946
826 Ga0495609_0003897 3300046538 Bacteria 8370
827 Ga0495609_0003956 3300046538 Bacteria 8297
828 Ga0495609_0004612 3300046538 Bacteria 7484
829 Ga0495609_0006626 3300046538 Bacteria 5883
830 Ga0495609_0007470 3300046538 Bacteria 5451
831 Ga0495609_0020429 3300046538 Bacteria 3060
832 Ga0495609_0035974 3300046538 Bacteria 2239
833 Ga0495597_0000051 3300046542 Bacteria 97079
834 Ga0495597_0000978 3300046542 Bacteria 22029
835 Ga0495597_0002537 3300046542 Bacteria 11454
836 Ga0495597_0003589 3300046542 Bacteria 8942
837 Ga0495597_0003947 3300046542 Bacteria 8350
838 Ga0495597_0004146 3300046542 Bacteria 8044
839 Ga0495597_0006044 3300046542 Bacteria 6304
840 Ga0495597_0007663 3300046542 Bacteria 5462
841 Ga0495597_0019435 3300046542 Bacteria 3179
842 Ga0495597_0030936 3300046542 Bacteria 2437
843 Ga0495597_0054653 3300046542 Bacteria 1753
844 Ga0495622_0000045 3300046557 Bacteria 114324
845 Ga0495622_0000136 3300046557 Bacteria 62960
846 Ga0495622_0003680 3300046557 Bacteria 7182
847 Ga0495622_0060291 3300046557 Bacteria 1757
848 Ga0495622_0072683 3300046557 Bacteria 1587
849 Ga0495633_0000202 3300046558 Bacteria 76324
850 Ga0495633_0000277 3300046558 Bacteria 59502
851 Ga0495633_0001894 3300046558 Bacteria 15254
852 Ga0495633_0002629 3300046558 Bacteria 12561
853 Ga0495633_0004167 3300046558 Bacteria 9291
854 Ga0495633_0004897 3300046558 Bacteria 8361
855 Ga0495633_0005717 3300046558 Bacteria 7517
856 Ga0495633_0008856 3300046558 Bacteria 5616
857 Ga0495633_0012063 3300046558 Bacteria 4615
858 Ga0495633_0021002 3300046558 Bacteria 3272
859 Ga0495633_0022102 3300046558 Bacteria 3170
860 Ga0495633_0024891 3300046558 Bacteria 2953
861 Ga0495633_0068939 3300046558 Bacteria 1651
862 Ga0495667_0043518 3300046559 Bacteria 2975
863 Ga0495656_0015428 3300046615 Bacteria 2883
864 Ga0495656_0027619 3300046615 Bacteria 2268
865 Ga0495668_0000029 3300046616 Bacteria 279128
866 Ga0495668_0000148 3300046616 Bacteria 105875
867 Ga0495668_0000174 3300046616 Bacteria 95737
868 Ga0495668_0000232 3300046616 Bacteria 79391
869 Ga0495668_0000993 3300046616 Bacteria 30714
870 Ga0495668_0001360 3300046616 Bacteria 23981
871 Ga0495668_0001677 3300046616 Bacteria 20554
872 Ga0495668_0003626 3300046616 Bacteria 11433
873 Ga0495668_0018136 3300046616 Bacteria 4070
874 Ga0495668_0028213 3300046616 Bacteria 3175
875 Ga0495668_0033283 3300046616 Bacteria 2896
876 Ga0495668_0037131 3300046616 Bacteria 2727
877 Ga0495668_0042026 3300046616 Bacteria 2545
878 Ga0495668_0077160 3300046616 Bacteria 1829
879 Ga0495668_0108994 3300046616 Bacteria 1514
880 Ga0495634_0004040 3300046642 Bacteria 11641
881 Ga0495634_0023044 3300046642 Bacteria 4382
882 Ga0495611_0000064 3300046648 Bacteria 74760
883 Ga0495611_0021883 3300046648 Bacteria 2763
884 Ga0495611_0022996 3300046648 Bacteria 2700
885 Ga0495611_0027825 3300046648 Bacteria 2474
886 Ga0495611_0037629 3300046648 Bacteria 2150
887 Ga0495625_0000220 3300046660 Bacteria 90406
888 Ga0495625_0001632 3300046660 Bacteria 26410
889 Ga0495625_0005340 3300046660 Bacteria 11764
890 Ga0495625_0006694 3300046660 Bacteria 10224
891 Ga0495625_0007550 3300046660 Bacteria 9441
892 Ga0495625_0022190 3300046660 Bacteria 4871
893 Ga0495625_0025488 3300046660 Bacteria 4484
894 Ga0495625_0032509 3300046660 Bacteria 3866
895 Ga0495625_0049335 3300046660 Bacteria 3026
896 Ga0495625_0051022 3300046660 Bacteria 2967
897 Ga0495625_0053232 3300046660 Bacteria 2896
898 Ga0495625_0100822 3300046660 Bacteria 1984
899 Ga0495625_0168856 3300046660 Bacteria 1462
900 Ga0495635_0002684 3300046663 Bacteria 12161
901 Ga0495635_0049501 3300046663 Bacteria 2896
902 Ga0495659_0000072 3300046664 Bacteria 42932
903 Ga0495659_0001178 3300046664 Bacteria 9074
904 Ga0495659_0001711 3300046664 Bacteria 7325
905 Ga0495661_0000214 3300046665 Bacteria 66777
906 Ga0495661_0000695 3300046665 Bacteria 33448
907 Ga0495661_0004010 3300046665 Bacteria 10733
908 Ga0495661_0008198 3300046665 Bacteria 7238
909 Ga0495661_0011114 3300046665 Bacteria 6112
910 Ga0495661_0015331 3300046665 Bacteria 5117
911 Ga0495661_0026626 3300046665 Bacteria 3723
912 Ga0495661_0028879 3300046665 Bacteria 3545
913 Ga0495661_0035609 3300046665 Bacteria 3121
914 Ga0495661_0036583 3300046665 Bacteria 3072
915 Ga0495661_0052376 3300046665 Bacteria 2459
916 Ga0495661_0056619 3300046665 Bacteria 2344
917 Ga0495661_0061482 3300046665 Bacteria 2229
918 Ga0495661_0080183 3300046665 Bacteria 1884
919 Ga0495661_0080487 3300046665 Bacteria 1879
920 Ga0495661_0134772 3300046665 Bacteria 1349
921 Ga0495588_0000141 3300046674 Bacteria 104615
922 Ga0495588_0004794 3300046674 Bacteria 5985
923 Ga0495588_0019034 3300046674 Bacteria 3358
924 Ga0495588_0023447 3300046674 Bacteria 3055
925 Ga0495588_0071398 3300046674 Bacteria 1805
926 Ga0495588_0087467 3300046674 Bacteria 1630
927 Ga0495588_0098991 3300046674 Bacteria 1531
928 Ga0495599_0108620 3300046678 Bacteria 1728
929 Ga0495623_0011773 3300046679 Bacteria 5666
930 Ga0495623_0115105 3300046679 Bacteria 1625
931 Ga0495646_0062820 3300046680 Bacteria 2207
932 Ga0495647_0000474 3300046681 Bacteria 11658
933 Ga0495658_0003242 3300046683 Bacteria 8101
934 Ga0495658_0005980 3300046683 Bacteria 5976
935 Ga0495669_0000061 3300046684 Bacteria 72014
936 Ga0495669_0000541 3300046684 Bacteria 16924
937 Ga0495669_0001956 3300046684 Bacteria 8466
938 Ga0495669_0010797 3300046684 Bacteria 3865
939 Ga0495669_0017316 3300046684 Bacteria 3091
940 Ga0495669_0021589 3300046684 Bacteria 2795
941 Ga0495669_0024322 3300046684 Bacteria 2638
942 Ga0495669_0034561 3300046684 Bacteria 2229
943 Ga0495613_0006712 3300046689 Bacteria 8592
944 Ga0495613_0043012 3300046689 Bacteria 3342
945 Ga0495624_0001779 3300046690 Bacteria 16487
946 Ga0495624_0038646 3300046690 Bacteria 3065
947 Ga0495624_0066340 3300046690 Bacteria 2253
948 Ga0495624_0086078 3300046690 Bacteria 1941
949 Ga0495670_0001678 3300046691 Bacteria 10870
950 Ga0495670_0004159 3300046691 Bacteria 7092
951 Ga0495670_0010550 3300046691 Bacteria 4541
952 Ga0495670_0020306 3300046691 Bacteria 3274
953 Ga0495670_0021699 3300046691 Bacteria 3168
954 Ga0495670_0035935 3300046691 Bacteria 2468
955 Ga0495670_0072394 3300046691 Bacteria 1745
956 Ga0495670_0074831 3300046691 Bacteria 1718
957 Ga0495670_0075274 3300046691 Bacteria 1714
958 Ga0495671_0000064 3300046692 Bacteria 106374
959 Ga0495671_0000281 3300046692 Bacteria 42628
960 Ga0495671_0001813 3300046692 Bacteria 13801
961 Ga0495671_0007401 3300046692 Bacteria 6264
962 Ga0495671_0025617 3300046692 Bacteria 3063
963 Ga0495671_0033801 3300046692 Bacteria 2603
964 Ga0495649_0000918 3300046694 Bacteria 23314
965 Ga0495649_0002189 3300046694 Bacteria 13980
966 Ga0495649_0013798 3300046694 Bacteria 4651
967 Ga0495649_0015468 3300046694 Bacteria 4343
968 Ga0495649_0028513 3300046694 Bacteria 3094
969 Ga0495589_0000084 3300046794 Bacteria 86500
970 Ga0495589_0000770 3300046794 Bacteria 20466
971 Ga0495589_0003941 3300046794 Bacteria 7966
972 Ga0495589_0004657 3300046794 Bacteria 7285
973 Ga0495589_0007237 3300046794 Bacteria 5813
974 Ga0495589_0010759 3300046794 Bacteria 4755
975 Ga0495589_0040631 3300046794 Bacteria 2321
976 Ga0495589_0066482 3300046794 Bacteria 1765
977 Ga0495600_0085173 3300046809 Bacteria 2062
978 Ga0495660_0000200 3300046810 Bacteria 62557
979 Ga0495660_0001390 3300046810 Bacteria 16607
980 Ga0495660_0001407 3300046810 Bacteria 16520
981 Ga0495660_0001424 3300046810 Bacteria 16374
982 Ga0495660_0002477 3300046810 Bacteria 11772
983 Ga0495660_0011896 3300046810 Bacteria 5048
984 Ga0495660_0012525 3300046810 Bacteria 4923
985 Ga0495660_0015786 3300046810 Bacteria 4360
986 Ga0495660_0029879 3300046810 Bacteria 3072
987 Ga0495660_0046806 3300046810 Bacteria 2371
988 Ga0495660_0051027 3300046810 Bacteria 2251
989 Ga0495660_0059913 3300046810 Bacteria 2046
990 Ga0495581_0001405 3300047315 Bacteria 13339
991 Ga0495581_0135696 3300047315 Bacteria 1434
992 Ga0495604_0004964 3300047317 Bacteria 10549
993 Ga0495604_0014498 3300047317 Bacteria 6285
994 Ga0495604_0048113 3300047317 Bacteria 3317
995 Ga0495636_0000994 3300047318 Bacteria 10594
996 Ga0495636_0002196 3300047318 Bacteria 7490
997 Ga0495636_0003868 3300047318 Bacteria 5842
998 Ga0495636_0014612 3300047318 Bacteria 3123
999 Ga0495636_0081334 3300047318 Bacteria 1395
1000 Ga0495674_0030847 3300047319 Bacteria 4871
1001 Ga0495672_0000026 3300047320 Bacteria 340319
1002 Ga0495672_0000075 3300047320 Bacteria 175957
1003 Ga0495672_0000089 3300047320 Bacteria 150897
1004 Ga0495672_0000127 3300047320 Bacteria 117475
1005 Ga0495672_0000453 3300047320 Bacteria 48724
1006 Ga0495672_0002837 3300047320 Bacteria 15410
1007 Ga0495672_0006451 3300047320 Bacteria 9079
1008 Ga0495672_0007734 3300047320 Bacteria 8042
1009 Ga0495672_0023375 3300047320 Bacteria 4001
1010 Ga0495672_0036465 3300047320 Bacteria 3019
1011 Ga0495672_0058257 3300047320 Bacteria 2240
1012 Ga0495672_0059651 3300047320 Bacteria 2206
1013 Ga0495672_0081131 3300047320 Bacteria 1807
1014 Ga0495676_0000025 3300047321 Bacteria 149350
1015 Ga0495676_0015658 3300047321 Bacteria 6744
1016 Ga0495676_0028408 3300047321 Bacteria 4776
1017 Ga0495676_0058168 3300047321 Bacteria 3043
1018 Ga0495676_0077630 3300047321 Bacteria 2532
1019 Ga0495680_0004529 3300047322 Bacteria 13277
1020 Ga0495680_0021996 3300047322 Bacteria 5328
1021 Ga0495680_0058611 3300047322 Bacteria 2975
1022 Ga0495683_0000155 3300047323 Bacteria 67620
1023 Ga0495683_0000174 3300047323 Bacteria 63168
1024 Ga0495683_0001196 3300047323 Bacteria 17704
1025 Ga0495683_0001709 3300047323 Bacteria 13920
1026 Ga0495683_0006093 3300047323 Bacteria 6612
1027 Ga0495683_0008116 3300047323 Bacteria 5637
1028 Ga0495683_0024755 3300047323 Bacteria 3079
1029 Ga0495683_0030699 3300047323 Bacteria 2741
1030 Ga0495683_0034343 3300047323 Bacteria 2579
1031 Ga0495683_0078272 3300047323 Bacteria 1616
1032 Ga0495687_000101 3300047443 Bacteria 129682
1033 Ga0495687_000117 3300047443 Bacteria 122591
1034 Ga0495687_000282 3300047443 Bacteria 66967
1035 Ga0495687_000314 3300047443 Bacteria 63156
1036 Ga0495687_000918 3300047443 Bacteria 30658
1037 Ga0495687_001051 3300047443 Bacteria 27331
1038 Ga0495687_001544 3300047443 Bacteria 20928
1039 Ga0495687_033530 3300047443 Bacteria 2327
1040 Ga0495675_0007787 3300047444 Bacteria 6611
1041 Ga0495675_0009593 3300047444 Bacteria 6028
1042 Ga0495677_0000015 3300047445 Bacteria 129962
1043 Ga0495677_0000569 3300047445 Bacteria 15189
1044 Ga0495677_0000679 3300047445 Bacteria 13773
1045 Ga0495677_0002429 3300047445 Bacteria 7315
1046 Ga0495677_0004887 3300047445 Bacteria 5110
1047 Ga0495677_0005652 3300047445 Bacteria 4739
1048 Ga0495677_0009353 3300047445 Bacteria 3621
1049 Ga0495677_0010826 3300047445 Bacteria 3341
1050 Ga0495677_0022559 3300047445 Bacteria 2283
1051 Ga0495677_0024284 3300047445 Bacteria 2198
1052 Ga0495677_0027933 3300047445 Bacteria 2047
1053 Ga0495677_0030599 3300047445 Bacteria 1959
1054 Ga0495679_005376 3300047446 Bacteria 5682
1055 Ga0495679_007325 3300047446 Bacteria 4613
1056 Ga0495679_013525 3300047446 Bacteria 3059
1057 Ga0495679_027420 3300047446 Bacteria 1879
1058 Ga0495685_000008 3300047447 Bacteria 95629
1059 Ga0495685_000199 3300047447 Bacteria 20154
1060 Ga0495685_011820 3300047447 Bacteria 2952
1061 Ga0495685_012632 3300047447 Bacteria 2861
1062 Ga0495685_014336 3300047447 Bacteria 2692
1063 Ga0495685_020018 3300047447 Bacteria 2299
1064 Ga0495673_0000008 3300047469 Bacteria 752462
1065 Ga0495673_0000009 3300047469 Bacteria 731993
1066 Ga0495673_0000012 3300047469 Bacteria 656908
1067 Ga0495673_0015767 3300047469 Bacteria 3883
1068 Ga0495681_0000700 3300047470 Bacteria 25596
1069 Ga0495681_0003376 3300047470 Bacteria 11109
1070 Ga0495681_0011812 3300047470 Bacteria 5171
1071 Ga0495681_0024264 3300047470 Bacteria 3199
1072 Ga0495681_0027563 3300047470 Bacteria 2936
1073 Ga0495681_0030815 3300047470 Bacteria 2725
1074 Ga0495681_0037283 3300047470 Bacteria 2396
1075 Ga0495681_0061210 3300047470 Bacteria 1734
1076 Ga0495681_0067778 3300047470 Bacteria 1625
1077 Ga0495686_0000163 3300047472 Bacteria 126514
1078 Ga0495686_0001540 3300047472 Bacteria 24691
1079 Ga0495686_0002255 3300047472 Bacteria 18587
1080 Ga0495686_0026085 3300047472 Bacteria 3825
1081 Ga0495686_0078606 3300047472 Bacteria 2019
1082 Ga0495593_0001956 3300047673 Bacteria 12295
1083 Ga0495593_0026634 3300047673 Bacteria 3190
1084 Ga0495602_0000323 3300048088 Bacteria 44156
1085 Ga0495602_0014971 3300048088 Bacteria 7846
1086 Ga0495614_0009833 3300048089 Bacteria 4225
1087 Ga0495614_0012614 3300048089 Bacteria 3707
1088 Ga0495614_0039758 3300048089 Bacteria 2019
1089 Ga0495614_0048154 3300048089 Bacteria 1828
1090 Ga0495626_0000182 3300048091 Bacteria 76384
1091 Ga0495626_0001143 3300048091 Bacteria 22159
1092 Ga0495626_0002715 3300048091 Bacteria 11949
1093 Ga0495626_0010792 3300048091 Bacteria 4854
1094 Ga0495626_0010964 3300048091 Bacteria 4812
1095 Ga0495626_0012497 3300048091 Bacteria 4448
1096 Ga0495626_0018137 3300048091 Bacteria 3541
1097 Ga0495626_0020785 3300048091 Bacteria 3266
1098 Ga0495626_0027079 3300048091 Bacteria 2788
1099 Ga0495626_0061724 3300048091 Bacteria 1703
1100 Ga0495626_0075258 3300048091 Bacteria 1509
1101 Ga0495626_0119831 3300048091 Bacteria 1132
1102 Ga0496100_0115312 3300048903 Bacteria 1873
1103 Ga0496100_0207315 3300048903 Bacteria 1432
1104 Ga0496101_0027763 3300048904 Bacteria 3946
1105 Ga0496101_0033957 3300048904 Bacteria 3602
1106 Ga0496101_0180814 3300048904 Bacteria 1624
1107 Ga0496102_0000024 3300048905 Bacteria 227873
1108 Ga0496102_0000154 3300048905 Bacteria 93518
1109 Ga0496102_0026028 3300048905 Bacteria 5213
1110 Ga0496102_0082748 3300048905 Bacteria 2960
1111 Ga0496102_0129461 3300048905 Bacteria 2361
1112 Ga0496102_0207244 3300048905 Bacteria 1848
1113 Ga0496103_0006301 3300048906 Bacteria 7091
1114 Ga0496103_0028900 3300048906 Bacteria 3367
1115 Ga0496103_0062928 3300048906 Bacteria 2310
1116 Ga0496104_0013736 3300048907 Bacteria 7305
1117 Ga0496104_0024049 3300048907 Bacteria 5605
1118 Ga0496104_0046944 3300048907 Bacteria 4069
1119 Ga0496105_0000967 3300048908 Bacteria 19748
1120 Ga0496105_0015981 3300048908 Bacteria 5986
1121 Ga0496105_0208179 3300048908 Bacteria 1595
1122 Ga0496105_0229440 3300048908 Bacteria 1509
1123 Ga0496106_0269751 3300048909 Bacteria 1362
1124 Ga0496106_0353616 3300048909 Bacteria 1180
1125 Ga0496107_0014903 3300048910 Bacteria 5443
1126 Ga0496107_0056252 3300048910 Bacteria 2842
1127 Ga0496108_0079390 3300048911 Bacteria 2778
1128 Ga0496108_0090016 3300048911 Bacteria 2608
1129 Ga0496109_0066229 3300048912 Bacteria 3307
1130 Ga0496109_0230265 3300048912 Bacteria 1743
1131 Ga0496110_0000229 3300048913 Bacteria 36388
1132 Ga0496110_0007614 3300048913 Bacteria 8657
1133 Ga0496110_0038075 3300048913 Bacteria 4183
1134 Ga0496110_0048976 3300048913 Bacteria 3705
1135 Ga0496110_0060061 3300048913 Bacteria 3352
1136 Ga0496111_0012670 3300048914 Bacteria 5714
1137 Ga0496111_0065800 3300048914 Bacteria 2631
1138 Ga0496112_0071785 3300048915 Bacteria 3422
1139 Ga0496113_0185920 3300048916 Bacteria 1648
1140 Ga0496114_0005092 3300048917 Bacteria 10242
1141 Ga0496114_0064750 3300048917 Bacteria 3062
1142 Ga0496114_0090766 3300048917 Bacteria 2594
1143 Ga0496114_0179600 3300048917 Bacteria 1848
1144 Ga0496115_0009194 3300048918 Bacteria 7335
1145 Ga0496115_0062018 3300048918 Bacteria 3015
1146 Ga0496115_0170188 3300048918 Bacteria 1802
1147 Ga0496115_0196201 3300048918 Bacteria 1668
1148 Ga0496116_0012782 3300048919 Bacteria 6822
1149 Ga0496116_0013047 3300048919 Bacteria 6737
1150 Ga0496116_0055260 3300048919 Bacteria 2609
1151 Ga0496116_0084320 3300048919 Bacteria 1958
1152 Ga0496117_0000005 3300048920 Bacteria 777468
1153 Ga0496117_0003151 3300048920 Bacteria 19665
1154 Ga0496118_0000022 3300048921 Bacteria 438602
1155 Ga0496118_0079447 3300048921 Bacteria 2315
1156 Ga0496119_0001121 3300048922 Bacteria 33781
1157 Ga0496120_0000014 3300048923 Bacteria 323163
1158 Ga0496120_0088968 3300048923 Bacteria 1654
1159 Ga0496121_0004138 3300048924 Bacteria 19854
1160 Ga0496121_0028870 3300048924 Bacteria 5152
1161 Ga0496121_0086796 3300048924 Bacteria 2458
1162 Ga0496122_0000648 3300048925 Bacteria 70509
1163 Ga0496122_0001132 3300048925 Bacteria 45868
1164 Ga0496122_0005577 3300048925 Bacteria 14900
1165 Ga0496122_0007186 3300048925 Bacteria 12469
1166 Ga0496122_0033482 3300048925 Bacteria 4225
1167 Ga0496123_0000473 3300048926 Bacteria 70071
1168 Ga0496123_0004457 3300048926 Bacteria 14707
1169 Ga0496123_0004484 3300048926 Bacteria 14641
1170 Ga0496123_0013688 3300048926 Bacteria 6786
1171 Ga0496123_0014227 3300048926 Bacteria 6614
1172 Ga0496123_0029164 3300048926 Bacteria 4071
1173 Ga0496124_0002033 3300048927 Bacteria 27478
1174 Ga0496124_0008922 3300048927 Bacteria 10390
1175 Ga0496124_0050628 3300048927 Bacteria 3538
1176 Ga0496124_0054048 3300048927 Bacteria 3401
1177 Ga0496124_0060877 3300048927 Bacteria 3166
1178 Ga0496124_0100000 3300048927 Bacteria 2351
1179 Ga0496124_0106386 3300048927 Bacteria 2265
1180 Ga0496124_0121737 3300048927 Bacteria 2084
1181 Ga0496125_0000545 3300048928 Bacteria 64939
1182 Ga0496125_0013723 3300048928 Bacteria 7945
1183 Ga0496125_0046260 3300048928 Bacteria 3652
1184 Ga0496125_0076545 3300048928 Bacteria 2583
1185 Ga0496125_0085738 3300048928 Bacteria 2385
1186 Ga0496125_0103848 3300048928 Bacteria 2084
1187 Ga0496126_0000657 3300048929 Bacteria 64181
1188 Ga0496126_0008484 3300048929 Bacteria 11078
1189 Ga0501306_003609 3300049127 Bacteria 1678
1190 Ga0501308_000821 3300049128 Bacteria 2238
1191 Ga0501309_001464 3300049129 Bacteria 2329
1192 Ga0501304_000296 3300049160 Bacteria 2358
1193 Ga0495678_000012 3300049459 Bacteria 333905
1194 Ga0495678_000051 3300049459 Bacteria 159383
1195 Ga0495678_000114 3300049459 Bacteria 96823
1196 Ga0495678_001536 3300049459 Bacteria 17826
1197 Ga0495678_002134 3300049459 Bacteria 13998
1198 Ga0495678_002302 3300049459 Bacteria 13180
1199 Ga0495678_008849 3300049459 Bacteria 5034
1200 Ga0495678_017479 3300049459 Bacteria 3249
1201 Ga0495682_0001124 3300049460 Bacteria 15548
1202 Ga0495682_0003033 3300049460 Bacteria 7631
1203 Ga0495682_0006100 3300049460 Bacteria 4915
1204 Ga0495682_0009071 3300049460 Bacteria 3900
1205 Ga0495682_0009960 3300049460 Bacteria 3696
1206 Ga0495682_0015910 3300049460 Bacteria 2848
1207 Ga0501316_000625 3300049532 Bacteria 2582
1208 Ga0501316_001723 3300049532 Bacteria 1918
1209 Ga0501033_0002988 3300049570 Bacteria 14117
1210 Ga0501034_0000730 3300049571 Bacteria 49754
1211 Ga0501036_0000592 3300049572 Bacteria 26278
1212 Ga0501038_0000396 3300049574 Bacteria 37861
1213 Ga0501038_0147246 3300049574 Bacteria 1922
1214 Ga0501039_0015051 3300049575 Bacteria 5918
1215 Ga0501040_0019336 3300049576 Bacteria 4529
1216 Ga0501040_0034666 3300049576 Bacteria 3419
1217 Ga0501041_0000044 3300049577 Bacteria 43476
1218 Ga0501041_0016520 3300049577 Bacteria 4389
1219 Ga0501042_0086053 3300049578 Bacteria 2254
1220 Ga0501043_0002105 3300049579 Bacteria 16990
1221 Ga0501046_0000460 3300049580 Bacteria 40737
1222 Ga0501048_0001330 3300049582 Bacteria 18732
1223 Ga0501068_0003417 3300049584 Bacteria 8543
1224 Ga0501070_0007224 3300049586 Bacteria 9431
1225 Ga0501070_0014537 3300049586 Bacteria 6623
1226 Ga0501071_0003002 3300049587 Bacteria 10441
1227 Ga0501071_0003992 3300049587 Bacteria 9311
1228 Ga0501071_0132397 3300049587 Bacteria 1853
1229 Ga0501072_0003291 3300049588 Bacteria 12152
1230 Ga0501072_0011956 3300049588 Bacteria 6630
1231 Ga0501072_0069537 3300049588 Bacteria 2780
1232 Ga0501073_0009003 3300049589 Bacteria 7372
1233 Ga0501075_0008691 3300049591 Bacteria 7083
1234 Ga0501075_0188258 3300049591 Bacteria 1574
1235 Ga0501076_0000973 3300049592 Bacteria 18756
1236 Ga0501077_0000598 3300049593 Bacteria 21812
1237 Ga0501077_0075456 3300049593 Bacteria 2135
1238 Ga0501230_000237 3300049667 Bacteria 4961
1239 Ga0501238_000615 3300049671 Bacteria 4083
1240 Ga0501225_0026361 3300049705 Bacteria 1598
1241 Ga0501079_0000184 3300049741 Bacteria 35607
1242 Ga0501079_0059984 3300049741 Bacteria 2934
1243 Ga0501080_0001609 3300049742 Bacteria 19194
1244 Ga0501080_0030734 3300049742 Bacteria 5004
1245 Ga0501080_0232767 3300049742 Bacteria 1683
1246 Ga0501081_0013380 3300049743 Bacteria 5397
1247 Ga0501083_0106966 3300049744 Bacteria 1841
1248 Ga0501269_000236 3300049766 Bacteria 16134
1249 Ga0501279_000406 3300049775 Bacteria 5723
1250 Ga0501035_0000697 3300049822 Bacteria 36586
1251 Ga0501035_0054360 3300049822 Bacteria 3578
1252 Ga0501044_0069197 3300049823 Bacteria 3594
1253 Ga0501044_0178686 3300049823 Bacteria 2090
1254 Ga0501044_0212174 3300049823 Bacteria 1890
1255 Ga0501044_0255494 3300049823 Bacteria 1692
1256 Ga0501045_0043083 3300049824 Bacteria 3286
1257 Ga0501045_0100336 3300049824 Bacteria 2143
1258 nmdc:mga03683_23551_c1 3300050489 Bacteria 2400
1259 nmdc:mga0yw44_52134_c1 3300050492 Bacteria 2480
1260 nmdc:mga0k408_113030_c1 3300050493 Bacteria 1606
1261 nmdc:mga06z11_61878_c1 3300050494 Bacteria 1954
1262 nmdc:mga05p37_2303_c1 3300050507 Bacteria 22270
1263 nmdc:mga05p37_416_c1 3300050507 Bacteria 46050
1264 nmdc:mga09592_1897_c1 3300050508 Bacteria 16816
1265 nmdc:mga09592_778_c1 3300050508 Bacteria 24622
1266 nmdc:mga0qj67_163513_c1 3300050509 Bacteria 1807
1267 nmdc:mga0qj67_3855_c1 3300050509 Bacteria 10834
1268 nmdc:mga06r32_24306_c1 3300050510 Bacteria 5621
1269 nmdc:mga06r32_8862_c1 3300050510 Bacteria 9066
1270 nmdc:mga08y16_15480_c1 3300050511 Bacteria 8021
1271 nmdc:mga08y16_6963_c1 3300050511 Bacteria 11852
1272 nmdc:mga0n895_1134_c1 3300050512 Bacteria 19498
1273 nmdc:mga0n895_1424_c1 3300050512 Bacteria 17895
1274 nmdc:mga0n895_29985_c1 3300050512 Bacteria 5194
1275 nmdc:mga0rr50_4637_c1 3300050513 Bacteria 8098
1276 nmdc:mga0rr50_7627_c1 3300050513 Bacteria 6689
1277 nmdc:mga08x19_12096_c1 3300050514 Bacteria 5193
1278 nmdc:mga08x19_21639_c1 3300050514 Bacteria 3973
1279 nmdc:mga08x19_4999_c1 3300050514 Bacteria 7839
1280 nmdc:mga0a205_672_c1 3300050515 Bacteria 27265
1281 Ga0495601_0003708 3300053077 Bacteria 8793
1282 Ga0500594_0026979 3300053118 Bacteria 1484
1283 Ga0500618_000207 3300053125 Bacteria 46848
1284 Ga0500586_000121 3300053145 Bacteria 14126
1285 Ga0501084_0003932 3300054114 Bacteria 12101
1286 Ga0501084_0064163 3300054114 Bacteria 3074
1287 Ga0501084_0154952 3300054114 Bacteria 1932
1288 Ga0590071_014234 3300059421 Bacteria 1865
1289 Ga0587084_003334 3300059477 Bacteria 1757
1290 Ga0587084_006428 3300059477 Bacteria 1427
1291 Ga0587070_007463 3300059491 Bacteria 1517
1292 Ga0587070_009644 3300059491 Bacteria 1401
1293 Ga0587073_0006579 3300059492 Bacteria 1796
1294 Ga0587077_002988 3300059493 Bacteria 2082
1295 Ga0587077_003600 3300059493 Bacteria 1963
1296 Ga0587082_003198 3300059504 Bacteria 1941
1297 Ga0587083_0005807 3300059505 Bacteria 1805
1298 Ga0587085_006964 3300059506 Bacteria 1394
1299 Ga0587088_001835 3300059508 Bacteria 2292
1300 Ga0587088_008950 3300059508 Bacteria 1429
1301 Ga0587088_011027 3300059508 Bacteria 1338
1302 Ga0587090_003028 3300059510 Bacteria 1908
1303 Ga0587091_003231 3300059511 Bacteria 2029
1304 Ga0587091_009524 3300059511 Bacteria 1465
1305 Ga0587092_001738 3300059512 Bacteria 2194
1306 Ga0587092_007058 3300059512 Bacteria 1443
1307 Ga0587101_001197 3300059623 Bacteria 2160
1308 Ga0587109_011379 3300059624 Bacteria 1437
1309 Ga0587067_008976 3300059640 Bacteria 1477
1310 Ga0587068_001597 3300059641 Bacteria 2587
1311 Ga0587068_002278 3300059641 Bacteria 2310
1312 Ga0587068_004624 3300059641 Bacteria 1830
1313 Ga0587068_007582 3300059641 Bacteria 1552
1314 Ga0587068_009042 3300059641 Bacteria 1459
1315 Ga0587069_001889 3300059642 Bacteria 2025
1316 Ga0587072_010925 3300059643 Bacteria 1475
1317 Ga0587075_002218 3300059644 Bacteria 2025
1318 Ga0587076_003127 3300059645 Bacteria 1937
1319 Ga0587076_003974 3300059645 Bacteria 1811
1320 Ga0587076_008300 3300059645 Bacteria 1446
1321 Ga0587078_003654 3300059646 Bacteria 1574
1322 Ga0587079_002034 3300059647 Bacteria 2402
1323 Ga0587079_013310 3300059647 Bacteria 1360
1324 Ga0587102_000544 3300059649 Bacteria 2209
1325 Ga0587124_002118 3300059660 Bacteria 1367
1326 Ga0587071_009860 3300060344 Bacteria 1582
1327 Ga0587071_013688 3300060344 Bacteria 1401
1328 Ga0587111_0002989 3300060346 Bacteria 2346
1329 Ga0501082_0002475 3300060353 Bacteria 16199
1330 Ga0501082_0131451 3300060353 Bacteria 2172
1331 Ga0501082_0164433 3300060353 Bacteria 1928
1332 Ga0530510_0004819 3300061734 Bacteria 9337

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0119831 Ga0495626_0119831_48_1112 354
2 iso_pu_bacteria 2501025504 2501407421 354
3 3300044658 Ga0466972_0000608 Ga0466972_0000608_15696_16871 356
4 3300005339 Ga0070660_100004370 Ga0070660_1000043706 357
5 3300005344 Ga0070661_100126000 Ga0070661_1001260002 357
6 3300005366 Ga0070659_100010488 Ga0070659_1000104887 357
7 3300005457 Ga0070662_100074596 Ga0070662_1000745962 357
8 3300005564 Ga0070664_100052929 Ga0070664_1000529292 357
9 3300025919 Ga0207657_10000785 Ga0207657_1000078532 357
10 3300025920 Ga0207649_10014765 Ga0207649_100147654 357
11 3300025932 Ga0207690_10008966 Ga0207690_100089664 357
12 3300025945 Ga0207679_10005829 Ga0207679_100058295 357
13 3300049578 Ga0501042_0086053 Ga0501042_0086053_178_1254 358
14 3300046524 Ga0495648_0110518 Ga0495648_0110518_388_1470 359
15 3300039447 Ga0436361_1015529 Ga0436361_1015529_27_1121 363
16 3300048909 Ga0496106_0353616 Ga0496106_0353616_64_1155 363
17 iso_pu_bacteria 2919046199 2919050667 367
18 3300042009 Ga0439451_021958 Ga0439451_021958_71_1246 373
19 3300009098 Ga0105245_10008434 Ga0105245_100084347 375
20 3300049127 Ga0501306_003609 Ga0501306_003609_80_1258 376
21 3300035083 Ga0373926_0010491 Ga0373926_0010491_1624_2799 377
22 3300035089 Ga0373944_0004560 Ga0373944_0004560_1740_2915 377
23 3300035111 Ga0373923_0017164 Ga0373923_0017164_610_1785 377
24 3300035116 Ga0373945_0006048 Ga0373945_0006048_1277_2452 377
25 3300035171 Ga0373946_0008207 Ga0373946_0008207_1229_2404 377
26 3300035410 Ga0373924_0020509 Ga0373924_0020509_982_2157 377
27 3300035692 Ga0373935_0021639 Ga0373935_0021639_410_1585 377
28 3300035725 Ga0373947_0009399 Ga0373947_0009399_828_2003 377
29 3300046455 Ga0495603_0026086 Ga0495603_0026086_1850_3025 377
30 3300046535 Ga0495586_0002047 Ga0495586_0002047_1189_2364 377
31 3300046674 Ga0495588_0004794 Ga0495588_0004794_4460_5635 377
32 3300046681 Ga0495647_0000474 Ga0495647_0000474_4198_5373 377
33 3300046683 Ga0495658_0005980 Ga0495658_0005980_1315_2490 377
34 3300046690 Ga0495624_0066340 Ga0495624_0066340_469_1644 377
35 3300047321 Ga0495676_0015658 Ga0495676_0015658_4349_5524 377
36 3300005545 Ga0070695_100140999 Ga0070695_1001409992 378
37 3300015261 Ga0182006_1000059 Ga0182006_100005974 378
38 3300035691 Ga0373931_0018621 Ga0373931_0018621_1246_2382 378
39 3300039450 Ga0436363_0742819 Ga0436363_0742819_11_1147 378
40 3300046457 Ga0495590_0000014 Ga0495590_0000014_14483_15622 378
41 3300046616 Ga0495668_0001360 Ga0495668_0001360_2168_3307 378
42 3300035691 Ga0373931_0022619 Ga0373931_0022619_1686_2861 382
43 3300048918 Ga0496115_0062018 Ga0496115_0062018_593_1768 382
44 3300046523 Ga0495644_0014504 Ga0495644_0014504_1846_3006 385
45 iso_pu_bacteria 2671180330 2672337674 386
46 iso_pu_bacteria 2816332186 2816861940 386
47 iso_pu_bacteria 2842682962 2842686785 386
48 iso_pu_bacteria 2849139964 2849141733 386
49 iso_pu_bacteria 2857581216 2857583812 386
50 iso_pu_bacteria 2921643360 2921649974 386
51 iso_pu_bacteria 2511231003 2511248696 387
52 iso_pu_bacteria 2511231026 2511387836 387
53 iso_pu_bacteria 2521172590 2521560960 387
54 iso_pu_bacteria 2548876994 2550695964 387
55 iso_pu_bacteria 2551306416 2553006157 387
56 iso_pu_bacteria 2600255292 2601671334 387
57 iso_pu_bacteria 2643221554 2643789973 387
58 iso_pu_bacteria 2643221556 2643801809 387
59 iso_pu_bacteria 2643221603 2644031392 387
60 iso_pu_bacteria 2643221638 2644212499 387
61 iso_pu_bacteria 2643221645 2644255043 387
62 iso_pu_bacteria 2643221664 2644359168 387
63 iso_pu_bacteria 2643221684 2644474397 387
64 iso_pu_bacteria 2738541280 2738738414 387
65 iso_pu_bacteria 2738541297 2738826500 387
66 iso_pu_bacteria 2738541300 2738842789 387
67 iso_pu_bacteria 2738541357 2739150297 387
68 iso_pu_bacteria 2738543003 2739192216 387
69 iso_pu_bacteria 2738543018 2739273536 387
70 iso_pu_bacteria 2738543026 2739318693 387
71 iso_pu_bacteria 2738543029 2739336934 387
72 iso_pu_bacteria 2738543030 2739342580 387
73 iso_pu_bacteria 2765235838 2765567389 387
74 iso_pu_bacteria 2808606418 2809146160 387
75 iso_pu_bacteria 2818991445 2819594905 387
76 iso_pu_bacteria 2818991449 2819617345 387
77 iso_pu_bacteria 2821131069 2821135213 387
78 iso_pu_bacteria 2839094727 2839095269 387
79 iso_pu_bacteria 2842711865 2842717090 387
80 iso_pu_bacteria 2857349434 2857357169 387
81 iso_pu_bacteria 2857547612 2857548827 387
82 iso_pu_bacteria 2857553236 2857556809 387
83 iso_pu_bacteria 2857558681 2857559043 387
84 iso_pu_bacteria 2857564685 2857567694 387
85 iso_pu_bacteria 2869162929 2869164908 387
86 iso_pu_bacteria 2884811622 2884816129 387
87 iso_pu_bacteria 2884836552 2884838245 387
88 iso_pu_bacteria 2884852848 2884854537 387
89 iso_pu_bacteria 2885080285 2885080378 387
90 iso_pu_bacteria 2896154374 2896159206 387
91 iso_pu_bacteria 2904424332 2904428061 387
92 iso_pu_bacteria 2904439833 2904442421 387
93 iso_pu_bacteria 2904530477 2904533688 387
94 iso_pu_bacteria 2904584206 2904586645 387
95 iso_pu_bacteria 2904589729 2904591541 387
96 iso_pu_bacteria 2904601388 2904602321 387
97 iso_pu_bacteria 2919079590 2919083354 387
98 iso_pu_bacteria 2919476304 2919476672 387
99 iso_pu_bacteria 2923510766 2923514799 387
100 iso_pu_bacteria 2928130867 2928133696 387
101 iso_pu_bacteria 2932410948 2932415476 387
102 iso_pu_bacteria 2932416698 2932421363 387
103 iso_pu_bacteria 2987636660 2987644559 387
104 iso_pu_bacteria 8047673197 8047676374 387
105 iso_pu_bacteria 3005445848 3005452628 388
106 3300048914 Ga0496111_0012670 Ga0496111_0012670_1568_2743 390
107 3300049705 Ga0501225_0026361 Ga0501225_0026361_378_1553 390
108 3300002704 JGI25155J39150_1000224 JGI25155J39150_10002243 391
109 3300002705 JGI25156J39149_1000357 JGI25156J39149_10003573 391
110 3300002705 JGI25156J39149_1004830 JGI25156J39149_10048303 391
111 3300002738 JGI25154J39366_1000298 JGI25154J39366_10002983 391
112 3300002738 JGI25154J39366_1000314 JGI25154J39366_10003143 391
113 3300002738 JGI25154J39366_1001528 JGI25154J39366_10015287 391
114 3300002741 JGI25157J39369_1000262 JGI25157J39369_100026218 391
115 3300002773 JGI25152J39213_1001968 JGI25152J39213_10019682 391
116 3300002774 JGI25150J39212_1004788 JGI25150J39212_10047882 391
117 3300002987 JGI25159J45721_1001503 JGI25159J45721_10015038 391
118 3300002987 JGI25159J45721_1001567 JGI25159J45721_10015679 391
119 3300002987 JGI25159J45721_1001931 JGI25159J45721_10019317 391
120 3300003163 Ga0006759J45824_1029604 Ga0006759J45824_10296042 391
121 3300003163 Ga0006759J45824_1036116 Ga0006759J45824_10361161 391
122 3300003163 Ga0006759J45824_1038593 Ga0006759J45824_10385931 391
123 3300003215 JGI25153J46596_10021355 JGI25153J46596_100213552 391
124 3300003354 JGI25160J50197_1002629 JGI25160J50197_10026297 391
125 3300003374 JGI25161J50226_1000851 JGI25161J50226_10008518 391
126 3300003544 Ga0007417J51691_1019026 Ga0007417J51691_10190262 391
127 3300003544 Ga0007417J51691_1035094 Ga0007417J51691_10350941 391
128 3300003574 Ga0007410J51695_1004766 Ga0007410J51695_10047661 391
129 3300003574 Ga0007410J51695_1015802 Ga0007410J51695_10158022 391
130 3300003574 Ga0007410J51695_1016077 Ga0007410J51695_10160772 391
131 3300003575 Ga0007409J51694_1008022 Ga0007409J51694_10080222 391
132 3300003577 Ga0007416J51690_1008222 Ga0007416J51690_10082222 391
133 3300003577 Ga0007416J51690_1048588 Ga0007416J51690_10485881 391
134 3300003611 Ga0007411J51799_105301 Ga0007411J51799_1053012 391
135 3300003611 Ga0007411J51799_107039 Ga0007411J51799_1070391 391
136 3300003693 Ga0032354_1017755 Ga0032354_10177551 391
137 3300003751 Ga0055538_1000110 Ga0055538_100011014 391
138 3300003752 Ga0055539_1000159 Ga0055539_100015914 391
139 3300003756 Ga0055533_1000161 Ga0055533_100016114 391
140 3300003758 Ga0055532_1000059 Ga0055532_100005930 391
141 3300003759 Ga0055525_1000023 Ga0055525_1000023133 391
142 3300003759 Ga0055525_1000214 Ga0055525_100021414 391
143 3300003761 Ga0055535_1003465 Ga0055535_10034653 391
144 3300003763 Ga0055529_1000015 Ga0055529_1000015339 391
145 3300003771 Ga0055526_1000127 Ga0055526_100012714 391
146 3300003771 Ga0055526_1000236 Ga0055526_100023650 391
147 3300003771 Ga0055526_1000251 Ga0055526_100025131 391
148 3300003771 Ga0055526_1002785 Ga0055526_100278514 391
149 3300003771 Ga0055526_1007677 Ga0055526_10076773 391
150 3300003771 Ga0055526_1013753 Ga0055526_10137534 391
151 3300003773 Ga0055537_1000121 Ga0055537_100012111 391
152 3300003775 Ga0055524_1000017 Ga0055524_1000017130 391
153 3300003775 Ga0055524_1003529 Ga0055524_10035294 391
154 3300003775 Ga0055524_1005101 Ga0055524_10051017 391
155 3300003775 Ga0055524_1009191 Ga0055524_10091912 391
156 3300003784 Ga0055534_1000033 Ga0055534_100003395 391
157 3300003784 Ga0055534_1011135 Ga0055534_10111351 391
158 3300003790 Ga0055528_1000020 Ga0055528_100002095 391
159 3300003790 Ga0055528_1004648 Ga0055528_10046486 391
160 3300003791 Ga0055530_10011502 Ga0055530_100115024 391
161 3300003794 Ga0055531_10005155 Ga0055531_100051557 391
162 3300003841 Ga0055541_1000105 Ga0055541_100010514 391
163 3300004625 Ga0055543_1001887 Ga0055543_10018878 391
164 3300004625 Ga0055543_1005974 Ga0055543_10059742 391
165 3300005262 Ga0065165_1000045 Ga0065165_100004596 391
166 3300005262 Ga0065165_1000305 Ga0065165_100030518 391
167 3300005262 Ga0065165_1005109 Ga0065165_10051098 391
168 3300005262 Ga0065165_1006783 Ga0065165_10067835 391
169 3300005328 Ga0070676_10047019 Ga0070676_100470192 391
170 3300005331 Ga0070670_100016728 Ga0070670_1000167282 391
171 3300005331 Ga0070670_100150404 Ga0070670_1001504042 391
172 3300005334 Ga0068869_100001616 Ga0068869_1000016169 391
173 3300005334 Ga0068869_100071471 Ga0068869_1000714712 391
174 3300005335 Ga0070666_10006248 Ga0070666_100062486 391
175 3300005336 Ga0070680_100024156 Ga0070680_1000241562 391
176 3300005336 Ga0070680_100033182 Ga0070680_1000331824 391
177 3300005336 Ga0070680_100153535 Ga0070680_1001535352 391
178 3300005337 Ga0070682_100064222 Ga0070682_1000642222 391
179 3300005338 Ga0068868_100000209 Ga0068868_10000020924 391
180 3300005338 Ga0068868_100009979 Ga0068868_1000099793 391
181 3300005338 Ga0068868_100016011 Ga0068868_1000160112 391
182 3300005339 Ga0070660_100087616 Ga0070660_1000876162 391
183 3300005340 Ga0070689_100003869 Ga0070689_1000038692 391
184 3300005341 Ga0070691_10001291 Ga0070691_100012918 391
185 3300005343 Ga0070687_100000190 Ga0070687_10000019016 391
186 3300005344 Ga0070661_100031382 Ga0070661_1000313822 391
187 3300005345 Ga0070692_10047798 Ga0070692_100477982 391
188 3300005347 Ga0070668_100039237 Ga0070668_1000392372 391
189 3300005353 Ga0070669_100003300 Ga0070669_1000033003 391
190 3300005354 Ga0070675_100131700 Ga0070675_1001317002 391
191 3300005355 Ga0070671_100006266 Ga0070671_1000062668 391
192 3300005355 Ga0070671_100025746 Ga0070671_1000257465 391
193 3300005356 Ga0070674_100089309 Ga0070674_1000893092 391
194 3300005367 Ga0070667_100001572 Ga0070667_10000157215 391
195 3300005367 Ga0070667_100003611 Ga0070667_10000361110 391
196 3300005367 Ga0070667_100195824 Ga0070667_1001958241 391
197 3300005367 Ga0070667_100204380 Ga0070667_1002043802 391
198 3300005367 Ga0070667_100334754 Ga0070667_1003347542 391
199 3300005406 Ga0070703_10010227 Ga0070703_100102272 391
200 3300005436 Ga0070713_100023776 Ga0070713_1000237762 391
201 3300005438 Ga0070701_10006881 Ga0070701_100068812 391
202 3300005439 Ga0070711_100052190 Ga0070711_1000521902 391
203 3300005439 Ga0070711_100294368 Ga0070711_1002943681 391
204 3300005440 Ga0070705_100000320 Ga0070705_1000003206 391
205 3300005440 Ga0070705_100006868 Ga0070705_1000068685 391
206 3300005441 Ga0070700_100000571 Ga0070700_1000005714 391
207 3300005441 Ga0070700_100000733 Ga0070700_10000073315 391
208 3300005444 Ga0070694_100000802 Ga0070694_10000080210 391
209 3300005444 Ga0070694_100009200 Ga0070694_1000092006 391
210 3300005458 Ga0070681_10000172 Ga0070681_1000017215 391
211 3300005459 Ga0068867_100000417 Ga0068867_10000041715 391
212 3300005459 Ga0068867_100003986 Ga0068867_1000039867 391
213 3300005467 Ga0070706_100020063 Ga0070706_1000200632 391
214 3300005468 Ga0070707_100150780 Ga0070707_1001507802 391
215 3300005471 Ga0070698_100084098 Ga0070698_1000840983 391
216 3300005530 Ga0070679_100071859 Ga0070679_1000718592 391
217 3300005536 Ga0070697_100001858 Ga0070697_1000018585 391
218 3300005536 Ga0070697_100003503 Ga0070697_1000035038 391
219 3300005536 Ga0070697_100004877 Ga0070697_1000048774 391
220 3300005539 Ga0068853_100090661 Ga0068853_1000906612 391
221 3300005544 Ga0070686_100000825 Ga0070686_10000082515 391
222 3300005544 Ga0070686_100062733 Ga0070686_1000627332 391
223 3300005544 Ga0070686_100111726 Ga0070686_1001117262 391
224 3300005545 Ga0070695_100000457 Ga0070695_10000045717 391
225 3300005545 Ga0070695_100011568 Ga0070695_1000115685 391
226 3300005545 Ga0070695_100069360 Ga0070695_1000693602 391
227 3300005546 Ga0070696_100002371 Ga0070696_1000023714 391
228 3300005546 Ga0070696_100004412 Ga0070696_1000044125 391
229 3300005547 Ga0070693_100001007 Ga0070693_1000010074 391
230 3300005548 Ga0070665_100071194 Ga0070665_1000711944 391
231 3300005548 Ga0070665_100449185 Ga0070665_1004491851 391
232 3300005549 Ga0070704_100003235 Ga0070704_1000032354 391
233 3300005549 Ga0070704_100007685 Ga0070704_1000076852 391
234 3300005549 Ga0070704_100009798 Ga0070704_1000097984 391
235 3300005549 Ga0070704_100044748 Ga0070704_1000447482 391
236 3300005549 Ga0070704_100046564 Ga0070704_1000465643 391
237 3300005549 Ga0070704_100133499 Ga0070704_1001334991 391
238 3300005563 Ga0068855_100003929 Ga0068855_10000392912 391
239 3300005563 Ga0068855_100009634 Ga0068855_1000096342 391
240 3300005563 Ga0068855_100027136 Ga0068855_1000271363 391
241 3300005563 Ga0068855_100045440 Ga0068855_1000454403 391
242 3300005563 Ga0068855_100100599 Ga0068855_1001005994 391
243 3300005577 Ga0068857_100018579 Ga0068857_1000185794 391
244 3300005577 Ga0068857_100047853 Ga0068857_1000478533 391
245 3300005578 Ga0068854_100002076 Ga0068854_1000020763 391
246 3300005578 Ga0068854_100209262 Ga0068854_1002092621 391
247 3300005614 Ga0068856_100003781 Ga0068856_10000378113 391
248 3300005614 Ga0068856_100031110 Ga0068856_1000311103 391
249 3300005614 Ga0068856_100112324 Ga0068856_1001123242 391
250 3300005615 Ga0070702_100000050 Ga0070702_1000000506 391
251 3300005616 Ga0068852_100027471 Ga0068852_1000274712 391
252 3300005617 Ga0068859_100000253 Ga0068859_10000025339 391
253 3300005617 Ga0068859_100000332 Ga0068859_10000033247 391
254 3300005617 Ga0068859_100017454 Ga0068859_1000174544 391
255 3300005617 Ga0068859_100050419 Ga0068859_1000504196 391
256 3300005617 Ga0068859_100087857 Ga0068859_1000878573 391
257 3300005618 Ga0068864_100004666 Ga0068864_1000046663 391
258 3300005618 Ga0068864_100102475 Ga0068864_1001024751 391
259 3300005618 Ga0068864_100302832 Ga0068864_1003028322 391
260 3300005718 Ga0068866_10000489 Ga0068866_1000048911 391
261 3300005719 Ga0068861_100004686 Ga0068861_1000046866 391
262 3300005719 Ga0068861_100119551 Ga0068861_1001195512 391
263 3300005840 Ga0068870_10051688 Ga0068870_100516882 391
264 3300005841 Ga0068863_100000653 Ga0068863_10000065318 391
265 3300005841 Ga0068863_100010939 Ga0068863_1000109396 391
266 3300005841 Ga0068863_100038955 Ga0068863_1000389553 391
267 3300005842 Ga0068858_100000503 Ga0068858_10000050329 391
268 3300005842 Ga0068858_100025338 Ga0068858_1000253384 391
269 3300005842 Ga0068858_100104904 Ga0068858_1001049043 391
270 3300005842 Ga0068858_100107126 Ga0068858_1001071262 391
271 3300005843 Ga0068860_100001764 Ga0068860_1000017647 391
272 3300005843 Ga0068860_100011672 Ga0068860_1000116724 391
273 3300005843 Ga0068860_100022107 Ga0068860_1000221074 391
274 3300005844 Ga0068862_100007673 Ga0068862_1000076732 391
275 3300005844 Ga0068862_100098252 Ga0068862_1000982522 391
276 3300005985 Ga0081539_10003343 Ga0081539_1000334313 391
277 3300006038 Ga0075365_10045830 Ga0075365_100458301 391
278 3300006042 Ga0075368_10039788 Ga0075368_100397882 391
279 3300006048 Ga0075363_100011589 Ga0075363_1000115892 391
280 3300006163 Ga0070715_10041543 Ga0070715_100415432 391
281 3300006178 Ga0075367_10012620 Ga0075367_100126204 391
282 3300006195 Ga0075366_10075245 Ga0075366_100752452 391
283 3300006237 Ga0097621_100000676 Ga0097621_10000067620 391
284 3300006237 Ga0097621_100065842 Ga0097621_1000658423 391
285 3300006358 Ga0068871_100002899 Ga0068871_1000028998 391
286 3300006358 Ga0068871_100030677 Ga0068871_1000306772 391
287 3300006844 Ga0075428_100007878 Ga0075428_10000787811 391
288 3300006844 Ga0075428_100020382 Ga0075428_1000203826 391
289 3300006846 Ga0075430_100009032 Ga0075430_1000090322 391
290 3300006846 Ga0075430_100010298 Ga0075430_1000102987 391
291 3300006847 Ga0075431_100017867 Ga0075431_1000178676 391
292 3300006847 Ga0075431_100029271 Ga0075431_1000292714 391
293 3300006847 Ga0075431_100248848 Ga0075431_1002488482 391
294 3300006852 Ga0075433_10001341 Ga0075433_1000134112 391
295 3300006852 Ga0075433_10118571 Ga0075433_101185712 391
296 3300006871 Ga0075434_100000211 Ga0075434_1000002116 391
297 3300006871 Ga0075434_100001149 Ga0075434_10000114911 391
298 3300006880 Ga0075429_100000183 Ga0075429_10000018321 391
299 3300006880 Ga0075429_100001213 Ga0075429_10000121316 391
300 3300006881 Ga0068865_100005124 Ga0068865_1000051247 391
301 3300006881 Ga0068865_100027969 Ga0068865_1000279692 391
302 3300006881 Ga0068865_100060907 Ga0068865_1000609072 391
303 3300006881 Ga0068865_100249009 Ga0068865_1002490091 391
304 3300006914 Ga0075436_100002524 Ga0075436_1000025246 391
305 3300006914 Ga0075436_100002652 Ga0075436_1000026526 391
306 3300006914 Ga0075436_100019225 Ga0075436_1000192252 391
307 3300006914 Ga0075436_100025991 Ga0075436_1000259914 391
308 3300006914 Ga0075436_100067335 Ga0075436_1000673352 391
309 3300006931 Ga0097620_100000253 Ga0097620_10000025339 391
310 3300006931 Ga0097620_100000332 Ga0097620_1000003326 391
311 3300006931 Ga0097620_100017455 Ga0097620_1000174554 391
312 3300006931 Ga0097620_100050420 Ga0097620_1000504206 391
313 3300006931 Ga0097620_100087858 Ga0097620_1000878583 391
314 3300006946 Ga0079104_1006363 Ga0079104_10063633 391
315 3300006948 Ga0099826_10000008 Ga0099826_10000008337 391
316 3300007076 Ga0075435_100000938 Ga0075435_10000093811 391
317 3300007076 Ga0075435_100002363 Ga0075435_1000023639 391
318 3300007076 Ga0075435_100006459 Ga0075435_1000064592 391
319 3300007076 Ga0075435_100064346 Ga0075435_1000643462 391
320 3300007076 Ga0075435_100094099 Ga0075435_1000940992 391
321 3300007788 Ga0099795_10000045 Ga0099795_1000004521 391
322 3300009011 Ga0105251_10016033 Ga0105251_100160333 391
323 3300009036 Ga0105244_10000791 Ga0105244_100007919 391
324 3300009036 Ga0105244_10003927 Ga0105244_100039279 391
325 3300009036 Ga0105244_10033860 Ga0105244_100338602 391
326 3300009036 Ga0105244_10062285 Ga0105244_100622852 391
327 3300009093 Ga0105240_10000787 Ga0105240_1000078743 391
328 3300009093 Ga0105240_10013732 Ga0105240_100137324 391
329 3300009093 Ga0105240_10082386 Ga0105240_100823862 391
330 3300009094 Ga0111539_10079922 Ga0111539_100799222 391
331 3300009094 Ga0111539_10153767 Ga0111539_101537672 391
332 3300009098 Ga0105245_10000115 Ga0105245_1000011517 391
333 3300009098 Ga0105245_10057074 Ga0105245_100570742 391
334 3300009101 Ga0105247_10000643 Ga0105247_1000064316 391
335 3300009101 Ga0105247_10009912 Ga0105247_100099125 391
336 3300009147 Ga0114129_10001051 Ga0114129_1000105115 391
337 3300009147 Ga0114129_10051993 Ga0114129_100519936 391
338 3300009147 Ga0114129_10223526 Ga0114129_102235262 391
339 3300009147 Ga0114129_10339915 Ga0114129_103399152 391
340 3300009148 Ga0105243_10001566 Ga0105243_100015669 391
341 3300009148 Ga0105243_10014419 Ga0105243_100144192 391
342 3300009174 Ga0105241_10031834 Ga0105241_100318344 391
343 3300009174 Ga0105241_10055916 Ga0105241_100559164 391
344 3300009176 Ga0105242_10005505 Ga0105242_100055052 391
345 3300009176 Ga0105242_10028849 Ga0105242_100288492 391
346 3300009176 Ga0105242_10209075 Ga0105242_102090751 391
347 3300009176 Ga0105242_10312153 Ga0105242_103121531 391
348 3300009177 Ga0105248_10019135 Ga0105248_100191354 391
349 3300009177 Ga0105248_10222492 Ga0105248_102224922 391
350 3300009545 Ga0105237_10017152 Ga0105237_100171523 391
351 3300009545 Ga0105237_10048963 Ga0105237_100489631 391
352 3300009551 Ga0105238_10000537 Ga0105238_100005372 391
353 3300009553 Ga0105249_10001691 Ga0105249_100016918 391
354 3300009553 Ga0105249_10001995 Ga0105249_1000199514 391
355 3300009553 Ga0105249_10083668 Ga0105249_100836683 391
356 3300009553 Ga0105249_10194629 Ga0105249_101946292 391
357 3300010159 Ga0099796_10000053 Ga0099796_1000005314 391
358 3300010375 Ga0105239_10019688 Ga0105239_100196882 391
359 3300010375 Ga0105239_10103578 Ga0105239_101035783 391
360 3300010375 Ga0105239_10118690 Ga0105239_101186902 391
361 3300013100 Ga0157373_10086080 Ga0157373_100860802 391
362 3300013102 Ga0157371_10000003 Ga0157371_10000003183 391
363 3300013296 Ga0157374_10000173 Ga0157374_1000017323 391
364 3300013296 Ga0157374_10118484 Ga0157374_101184842 391
365 3300013296 Ga0157374_10131187 Ga0157374_101311872 391
366 3300013297 Ga0157378_10001030 Ga0157378_1000103020 391
367 3300013297 Ga0157378_10013562 Ga0157378_100135627 391
368 3300013306 Ga0163162_10046451 Ga0163162_100464514 391
369 3300013306 Ga0163162_10351100 Ga0163162_103511002 391
370 3300013306 Ga0163162_10415320 Ga0163162_104153201 391
371 3300013307 Ga0157372_10508074 Ga0157372_105080742 391
372 3300014325 Ga0163163_10001456 Ga0163163_1000145614 391
373 3300014326 Ga0157380_10159145 Ga0157380_101591452 391
374 3300014497 Ga0182008_10015273 Ga0182008_100152732 391
375 3300014745 Ga0157377_10057202 Ga0157377_100572022 391
376 3300014968 Ga0157379_10004821 Ga0157379_1000482111 391
377 3300014968 Ga0157379_10010074 Ga0157379_100100746 391
378 3300014969 Ga0157376_10002960 Ga0157376_1000296010 391
379 3300014969 Ga0157376_10013177 Ga0157376_100131775 391
380 3300014969 Ga0157376_10029396 Ga0157376_100293962 391
381 3300015261 Ga0182006_1000007 Ga0182006_1000007184 391
382 3300015261 Ga0182006_1034133 Ga0182006_10341332 391
383 3300015262 Ga0182007_10000068 Ga0182007_1000006836 391
384 3300015262 Ga0182007_10026974 Ga0182007_100269743 391
385 3300015265 Ga0182005_1000006 Ga0182005_1000006282 391
386 3300015265 Ga0182005_1000010 Ga0182005_1000010164 391
387 3300020077 Ga0206351_10268376 Ga0206351_102683761 391
388 3300021361 Ga0213872_10001492 Ga0213872_1000149211 391
389 3300021361 Ga0213872_10002646 Ga0213872_100026462 391
390 3300021361 Ga0213872_10003230 Ga0213872_100032305 391
391 3300022467 Ga0224712_10018126 Ga0224712_100181261 391
392 3300025206 Ga0209435_100032 Ga0209435_100032110 391
393 3300025206 Ga0209435_100146 Ga0209435_10014620 391
394 3300025208 Ga0209436_100314 Ga0209436_1003148 391
395 3300025208 Ga0209436_101267 Ga0209436_1012678 391
396 3300025224 Ga0209784_100035 Ga0209784_100035236 391
397 3300025225 Ga0209566_100040 Ga0209566_100040236 391
398 3300025226 Ga0209674_100057 Ga0209674_100057236 391
399 3300025229 Ga0209147_100109 Ga0209147_100109110 391
400 3300025230 Ga0209563_100011 Ga0209563_100011447 391
401 3300025230 Ga0209563_100059 Ga0209563_100059236 391
402 3300025233 Ga0209437_100512 Ga0209437_1005125 391
403 3300025242 Ga0209258_100190 Ga0209258_10019083 391
404 3300025245 Ga0207425_1000009 Ga0207425_1000009363 391
405 3300025245 Ga0207425_1000325 Ga0207425_100032518 391
406 3300025245 Ga0207425_1001909 Ga0207425_10019099 391
407 3300025246 Ga0209646_1000042 Ga0209646_100004283 391
408 3300025246 Ga0209646_1000113 Ga0209646_1000113110 391
409 3300025246 Ga0209646_1000950 Ga0209646_10009504 391
410 3300025250 Ga0209026_1000102 Ga0209026_1000102110 391
411 3300025250 Ga0209026_1001388 Ga0209026_10013883 391
412 3300025250 Ga0209026_1002229 Ga0209026_10022294 391
413 3300025253 Ga0209677_100036 Ga0209677_100036236 391
414 3300025253 Ga0209677_100944 Ga0209677_10094410 391
415 3300025254 Ga0209148_1000199 Ga0209148_100019979 391
416 3300025256 Ga0209759_1000104 Ga0209759_1000104110 391
417 3300025256 Ga0209759_1000944 Ga0209759_10009447 391
418 3300025258 Ga0209129_1000061 Ga0209129_10000619 391
419 3300025263 Ga0209565_1000032 Ga0209565_1000032221 391
420 3300025263 Ga0209565_1000508 Ga0209565_100050823 391
421 3300025263 Ga0209565_1002887 Ga0209565_10028877 391
422 3300025272 Ga0209455_1000031 Ga0209455_1000031341 391
423 3300025272 Ga0209455_1005995 Ga0209455_10059952 391
424 3300025273 Ga0209673_1000029 Ga0209673_1000029246 391
425 3300025284 Ga0209130_1000043 Ga0209130_1000043135 391
426 3300025284 Ga0209130_1001889 Ga0209130_10018898 391
427 3300025291 Ga0209675_1000019 Ga0209675_100001997 391
428 3300025291 Ga0209675_1007208 Ga0209675_10072084 391
429 3300025294 Ga0209025_1000044 Ga0209025_1000044281 391
430 3300025295 Ga0209564_1000010 Ga0209564_1000010237 391
431 3300025295 Ga0209564_1000067 Ga0209564_1000067108 391
432 3300025295 Ga0209564_1000115 Ga0209564_1000115111 391
433 3300025295 Ga0209564_1000173 Ga0209564_1000173100 391
434 3300025295 Ga0209564_1002315 Ga0209564_100231515 391
435 3300025295 Ga0209564_1005639 Ga0209564_10056393 391
436 3300025297 Ga0209758_1000579 Ga0209758_100057915 391
437 3300025297 Ga0209758_1001522 Ga0209758_100152217 391
438 3300025298 Ga0209050_1000040 Ga0209050_1000040219 391
439 3300025298 Ga0209050_1000123 Ga0209050_100012311 391
440 3300025299 Ga0209256_1000018 Ga0209256_1000018348 391
441 3300025299 Ga0209256_1000058 Ga0209256_1000058194 391
442 3300025299 Ga0209256_1000142 Ga0209256_1000142133 391
443 3300025299 Ga0209256_1001305 Ga0209256_100130522 391
444 3300025302 Ga0207426_1001242 Ga0207426_100124215 391
445 3300025304 Ga0209257_1000054 Ga0209257_1000054180 391
446 3300025728 Ga0207655_1002048 Ga0207655_10020489 391
447 3300025728 Ga0207655_1003905 Ga0207655_10039055 391
448 3300025728 Ga0207655_1046281 Ga0207655_10462812 391
449 3300025885 Ga0207653_10017786 Ga0207653_100177862 391
450 3300025900 Ga0207710_10000961 Ga0207710_100009615 391
451 3300025903 Ga0207680_10017527 Ga0207680_100175273 391
452 3300025907 Ga0207645_10007199 Ga0207645_100071995 391
453 3300025910 Ga0207684_10029150 Ga0207684_100291503 391
454 3300025911 Ga0207654_10009008 Ga0207654_100090082 391
455 3300025911 Ga0207654_10011031 Ga0207654_100110313 391
456 3300025912 Ga0207707_10003624 Ga0207707_100036247 391
457 3300025913 Ga0207695_10001940 Ga0207695_1000194027 391
458 3300025913 Ga0207695_10003997 Ga0207695_100039973 391
459 3300025913 Ga0207695_10010887 Ga0207695_100108877 391
460 3300025917 Ga0207660_10036373 Ga0207660_100363732 391
461 3300025918 Ga0207662_10000333 Ga0207662_1000033316 391
462 3300025919 Ga0207657_10002897 Ga0207657_1000289718 391
463 3300025919 Ga0207657_10047008 Ga0207657_100470082 391
464 3300025920 Ga0207649_10028428 Ga0207649_100284282 391
465 3300025921 Ga0207652_10290955 Ga0207652_102909551 391
466 3300025922 Ga0207646_10143728 Ga0207646_101437282 391
467 3300025923 Ga0207681_10016637 Ga0207681_100166372 391
468 3300025924 Ga0207694_10000384 Ga0207694_100003843 391
469 3300025926 Ga0207659_10051993 Ga0207659_100519932 391
470 3300025926 Ga0207659_10091349 Ga0207659_100913492 391
471 3300025927 Ga0207687_10011184 Ga0207687_100111842 391
472 3300025927 Ga0207687_10118271 Ga0207687_101182712 391
473 3300025931 Ga0207644_10004139 Ga0207644_100041398 391
474 3300025931 Ga0207644_10124009 Ga0207644_101240092 391
475 3300025932 Ga0207690_10202646 Ga0207690_102026462 391
476 3300025934 Ga0207686_10030670 Ga0207686_100306702 391
477 3300025934 Ga0207686_10061245 Ga0207686_100612452 391
478 3300025935 Ga0207709_10000917 Ga0207709_100009177 391
479 3300025935 Ga0207709_10114240 Ga0207709_101142402 391
480 3300025936 Ga0207670_10003240 Ga0207670_100032405 391
481 3300025936 Ga0207670_10072295 Ga0207670_100722952 391
482 3300025937 Ga0207669_10008554 Ga0207669_100085542 391
483 3300025938 Ga0207704_10000141 Ga0207704_100001417 391
484 3300025938 Ga0207704_10033887 Ga0207704_100338872 391
485 3300025938 Ga0207704_10264051 Ga0207704_102640511 391
486 3300025940 Ga0207691_10012268 Ga0207691_100122687 391
487 3300025942 Ga0207689_10001663 Ga0207689_1000166319 391
488 3300025942 Ga0207689_10191052 Ga0207689_101910522 391
489 3300025945 Ga0207679_10047371 Ga0207679_100473713 391
490 3300025949 Ga0207667_10000146 Ga0207667_100001468 391
491 3300025949 Ga0207667_10007911 Ga0207667_100079113 391
492 3300025949 Ga0207667_10021874 Ga0207667_100218744 391
493 3300025949 Ga0207667_10035181 Ga0207667_100351813 391
494 3300025949 Ga0207667_10061566 Ga0207667_100615663 391
495 3300025961 Ga0207712_10000763 Ga0207712_1000076318 391
496 3300025961 Ga0207712_10001549 Ga0207712_100015494 391
497 3300025972 Ga0207668_10029618 Ga0207668_100296182 391
498 3300025981 Ga0207640_10005459 Ga0207640_100054594 391
499 3300025981 Ga0207640_10031450 Ga0207640_100314502 391
500 3300025986 Ga0207658_10010157 Ga0207658_100101577 391
501 3300025986 Ga0207658_10036037 Ga0207658_100360372 391
502 3300026023 Ga0207677_10001911 Ga0207677_100019116 391
503 3300026023 Ga0207677_10030442 Ga0207677_100304422 391
504 3300026035 Ga0207703_10011030 Ga0207703_100110302 391
505 3300026035 Ga0207703_10022984 Ga0207703_100229842 391
506 3300026035 Ga0207703_10070081 Ga0207703_100700812 391
507 3300026041 Ga0207639_10022306 Ga0207639_100223063 391
508 3300026041 Ga0207639_10085764 Ga0207639_100857642 391
509 3300026067 Ga0207678_10044135 Ga0207678_100441352 391
510 3300026075 Ga0207708_10000114 Ga0207708_1000011452 391
511 3300026075 Ga0207708_10065819 Ga0207708_100658192 391
512 3300026075 Ga0207708_10140881 Ga0207708_101408812 391
513 3300026078 Ga0207702_10030333 Ga0207702_100303332 391
514 3300026078 Ga0207702_10041091 Ga0207702_100410914 391
515 3300026078 Ga0207702_10109756 Ga0207702_101097562 391
516 3300026078 Ga0207702_10317408 Ga0207702_103174082 391
517 3300026088 Ga0207641_10000078 Ga0207641_1000007884 391
518 3300026088 Ga0207641_10029235 Ga0207641_100292353 391
519 3300026089 Ga0207648_10000113 Ga0207648_1000011382 391
520 3300026089 Ga0207648_10010664 Ga0207648_100106647 391
521 3300026089 Ga0207648_10097267 Ga0207648_100972671 391
522 3300026095 Ga0207676_10292723 Ga0207676_102927232 391
523 3300026116 Ga0207674_10076131 Ga0207674_100761312 391
524 3300026116 Ga0207674_10105420 Ga0207674_101054202 391
525 3300026118 Ga0207675_100005429 Ga0207675_10000542910 391
526 3300026118 Ga0207675_100010262 Ga0207675_1000102627 391
527 3300026121 Ga0207683_10134453 Ga0207683_101344532 391
528 3300026142 Ga0207698_10091744 Ga0207698_100917442 391
529 3300027378 Ga0209981_1000930 Ga0209981_10009302 391
530 3300027378 Ga0209981_1009769 Ga0209981_10097691 391
531 3300027395 Ga0209996_1004501 Ga0209996_10045012 391
532 3300027462 Ga0210000_1002707 Ga0210000_10027071 391
533 3300027471 Ga0209995_1000961 Ga0209995_10009613 391
534 3300027512 Ga0209179_1000021 Ga0209179_100002133 391
535 3300027526 Ga0209968_1011722 Ga0209968_10117221 391
536 3300027543 Ga0209999_1009583 Ga0209999_10095831 391
537 3300027665 Ga0209983_1005075 Ga0209983_10050752 391
538 3300027666 Ga0209282_1000005 Ga0209282_1000005335 391
539 3300027695 Ga0209966_1001145 Ga0209966_10011454 391
540 3300027907 Ga0207428_10000624 Ga0207428_1000062434 391
541 3300027907 Ga0207428_10051818 Ga0207428_100518182 391
542 3300028379 Ga0268266_10129910 Ga0268266_101299102 391
543 3300028380 Ga0268265_10003785 Ga0268265_100037859 391
544 3300028380 Ga0268265_10006425 Ga0268265_100064252 391
545 3300028381 Ga0268264_10000380 Ga0268264_100003804 391
546 3300028381 Ga0268264_10002945 Ga0268264_100029453 391
547 3300028381 Ga0268264_10006475 Ga0268264_100064757 391
548 3300028381 Ga0268264_10236896 Ga0268264_102368962 391
549 3300028381 Ga0268264_10257045 Ga0268264_102570452 391
550 3300028666 Ga0265336_10000097 Ga0265336_100000977 391
551 3300029957 Ga0265324_10000001 Ga0265324_10000001215 391
552 3300030745 Ga0316182_1045184 Ga0316182_10451841 391
553 3300031239 Ga0265328_10000050 Ga0265328_1000005043 391
554 3300031241 Ga0265325_10000358 Ga0265325_1000035816 391
555 3300031344 Ga0265316_10171943 Ga0265316_101719431 391
556 3300031548 Ga0307408_100000237 Ga0307408_10000023740 391
557 3300031548 Ga0307408_100000238 Ga0307408_10000023838 391
558 3300031548 Ga0307408_100002450 Ga0307408_1000024506 391
559 3300031548 Ga0307408_100046907 Ga0307408_1000469072 391
560 3300031665 Ga0316575_10002687 Ga0316575_100026875 391
561 3300031665 Ga0316575_10005611 Ga0316575_100056113 391
562 3300031691 Ga0316579_10001345 Ga0316579_100013453 391
563 3300031730 Ga0307516_10002891 Ga0307516_1000289114 391
564 3300031733 Ga0316577_10156705 Ga0316577_101567051 391
565 3300032002 Ga0307416_100003997 Ga0307416_1000039972 391
566 3300032002 Ga0307416_100068070 Ga0307416_1000680702 391
567 3300032002 Ga0307416_100187738 Ga0307416_1001877382 391
568 3300032004 Ga0307414_10007162 Ga0307414_100071625 391
569 3300034816 Ga0373930_0005971 Ga0373930_0005971_139_1314 391
570 3300034820 Ga0373959_0011344 Ga0373959_0011344_166_1341 391
571 3300035084 Ga0373928_0005604 Ga0373928_0005604_1133_2308 391
572 3300035086 Ga0373934_0005673 Ga0373934_0005673_3051_4226 391
573 3300035090 Ga0373949_0025849 Ga0373949_0025849_70_1245 391
574 3300035111 Ga0373923_0076734 Ga0373923_0076734_142_1317 391
575 3300035112 Ga0373932_0000563 Ga0373932_0000563_5947_7122 391
576 3300035113 Ga0373936_0020490 Ga0373936_0020490_378_1553 391
577 3300035114 Ga0373939_0006348 Ga0373939_0006348_1609_2784 391
578 3300035115 Ga0373941_0019817 Ga0373941_0019817_70_1245 391
579 3300035117 Ga0373953_0015634 Ga0373953_0015634_188_1366 391
580 3300035118 Ga0373954_0000001 Ga0373954_0000001_83410_84585 391
581 3300035120 Ga0373957_0014165 Ga0373957_0014165_1366_2544 391
582 3300035172 Ga0373955_0058370 Ga0373955_0058370_907_2091 391
583 3300035207 Ga0373942_0004466 Ga0373942_0004466_246_1421 391
584 3300035207 Ga0373942_0028518 Ga0373942_0028518_125_1300 391
585 3300035207 Ga0373942_0037642 Ga0373942_0037642_98_1273 391
586 3300035241 Ga0373961_0011726 Ga0373961_0011726_970_2145 391
587 3300035241 Ga0373961_0013493 Ga0373961_0013493_80_1255 391
588 3300035241 Ga0373961_0025722 Ga0373961_0025722_140_1315 391
589 3300035398 Ga0316574_0001268 Ga0316574_0001268_6872_8047 391
590 3300035410 Ga0373924_0042206 Ga0373924_0042206_264_1442 391
591 3300035691 Ga0373931_0001933 Ga0373931_0001933_2124_3299 391
592 3300035695 Ga0373927_0002341 Ga0373927_0002341_10149_11324 391
593 3300035695 Ga0373927_0016007 Ga0373927_0016007_2762_3937 391
594 3300035724 Ga0373933_0007378 Ga0373933_0007378_127_1302 391
595 3300035724 Ga0373933_0017196 Ga0373933_0017196_2413_3591 391
596 3300035724 Ga0373933_0089282 Ga0373933_0089282_452_1627 391
597 3300035724 Ga0373933_0107633 Ga0373933_0107633_495_1673 391
598 3300035725 Ga0373947_0170455 Ga0373947_0170455_184_1359 391
599 3300036401 Ga0373937_0000524 Ga0373937_0000524_16160_17335 391
600 3300036401 Ga0373937_0005139 Ga0373937_0005139_7422_8606 391
601 3300037068 Ga0373925_0040447 Ga0373925_0040447_174_1382 391
602 3300037312 Ga0395899_0000019 Ga0395899_0000019_257798_258976 391
603 3300037312 Ga0395899_0000798 Ga0395899_0000798_624_1802 391
604 3300037312 Ga0395899_0007820 Ga0395899_0007820_5901_7079 391
605 3300037312 Ga0395899_0012712 Ga0395899_0012712_1388_2563 391
606 3300037418 Ga0395900_0000094 Ga0395900_0000094_162683_163858 391
607 3300037418 Ga0395900_0011030 Ga0395900_0011030_3691_4866 391
608 3300037418 Ga0395900_0011936 Ga0395900_0011936_461_1636 391
609 3300037466 Ga0395898_0120646 Ga0395898_0120646_686_1861 391
610 3300037471 Ga0395905_0007080 Ga0395905_0007080_2044_3219 391
611 3300037471 Ga0395905_0010604 Ga0395905_0010604_5331_6506 391
612 3300037471 Ga0395905_0075873 Ga0395905_0075873_775_1950 391
613 3300037471 Ga0395905_0164472 Ga0395905_0164472_834_2012 391
614 3300037471 Ga0395905_0256220 Ga0395905_0256220_295_1512 391
615 3300037588 Ga0316581_0003799 Ga0316581_0003799_2484_3659 391
616 3300038443 Ga0395901_0003213 Ga0395901_0003213_14508_15683 391
617 3300038443 Ga0395901_0004893 Ga0395901_0004893_9602_10783 391
618 3300038443 Ga0395901_0039068 Ga0395901_0039068_3047_4225 391
619 3300038443 Ga0395901_0046737 Ga0395901_0046737_956_2131 391
620 3300039447 Ga0436361_0173709 Ga0436361_0173709_6883_8058 391
621 3300039447 Ga0436361_0568855 Ga0436361_0568855_3067_4245 391
622 3300039447 Ga0436361_0687629 Ga0436361_0687629_5735_6913 391
623 3300039447 Ga0436361_1028139 Ga0436361_1028139_257_1435 391
624 3300039447 Ga0436361_1082582 Ga0436361_1082582_7244_8425 391
625 3300039447 Ga0436361_1117918 Ga0436361_1117918_249_1427 391
626 3300041413 Ga0439465_0035971 Ga0439465_0035971_401_1576 391
627 3300042007 Ga0439449_0011991 Ga0439449_0011991_240_1415 391
628 3300042008 Ga0439450_013487 Ga0439450_013487_229_1404 391
629 3300042015 Ga0439462_0025472 Ga0439462_0025472_304_1479 391
630 3300042156 Ga0439446_0000980 Ga0439446_0000980_2676_3851 391
631 3300042435 Ga0439434_0000592 Ga0439434_0000592_2780_3955 391
632 3300042436 Ga0439435_0000150 Ga0439435_0000150_6901_8076 391
633 3300042437 Ga0439444_0000591 Ga0439444_0000591_574_1749 391
634 3300042876 Ga0451577_0000013 Ga0451577_0000013_437465_438640 391
635 3300042876 Ga0451577_0017865 Ga0451577_0017865_507_1682 391
636 3300044658 Ga0466972_0002716 Ga0466972_0002716_851_2026 391
637 3300044658 Ga0466972_0021883 Ga0466972_0021883_328_1515 391
638 3300044658 Ga0466972_0102123 Ga0466972_0102123_18_1196 391
639 3300044673 Ga0453683_0000059 Ga0453683_0000059_73934_75109 391
640 3300044683 Ga0466965_0000165 Ga0466965_0000165_17956_19131 391
641 3300044683 Ga0466965_0001132 Ga0466965_0001132_5302_6489 391
642 3300044684 Ga0466966_0015800 Ga0466966_0015800_212_1390 391
643 3300044684 Ga0466966_0038508 Ga0466966_0038508_1285_2460 391
644 3300044694 Ga0466963_0192259 Ga0466963_0192259_235_1413 391
645 3300044706 Ga0466964_0001917 Ga0466964_0001917_2705_3880 391
646 3300044706 Ga0466964_0004838 Ga0466964_0004838_3449_4636 391
647 3300044706 Ga0466964_0006354 Ga0466964_0006354_2450_3625 391
648 3300044706 Ga0466964_0018428 Ga0466964_0018428_1054_2229 391
649 3300044706 Ga0466964_0041673 Ga0466964_0041673_299_1477 391
650 3300044706 Ga0466964_0046243 Ga0466964_0046243_553_1728 391
651 3300044712 Ga0453684_0000075 Ga0453684_0000075_272731_273948 391
652 3300044712 Ga0453684_0000585 Ga0453684_0000585_22423_23598 391
653 3300044735 Ga0466968_0009986 Ga0466968_0009986_311_1498 391
654 3300044842 Ga0466957_0000353 Ga0466957_0000353_13208_14383 391
655 3300044842 Ga0466957_0020442 Ga0466957_0020442_1759_2934 391
656 3300045049 Ga0466959_0022802 Ga0466959_0022802_1004_2179 391
657 3300045049 Ga0466959_0065137 Ga0466959_0065137_71_1246 391
658 3300045051 Ga0451576_0000018 Ga0451576_0000018_112050_113225 391
659 3300045051 Ga0451576_0000220 Ga0451576_0000220_23152_24327 391
660 3300045051 Ga0451576_0006716 Ga0451576_0006716_11598_12773 391
661 3300045051 Ga0451576_0080077 Ga0451576_0080077_674_1849 391
662 3300045051 Ga0451576_0112670 Ga0451576_0112670_107_1282 391
663 3300045051 Ga0451576_0121077 Ga0451576_0121077_347_1522 391
664 3300045976 Ga0466967_0007734 Ga0466967_0007734_2733_3911 391
665 3300045976 Ga0466967_0083453 Ga0466967_0083453_290_1465 391
666 3300045976 Ga0466967_0263811 Ga0466967_0263811_453_1628 391
667 3300046452 Ga0495617_000017 Ga0495617_000017_195065_196240 391
668 3300046452 Ga0495617_000025 Ga0495617_000025_106348_107526 391
669 3300046452 Ga0495617_000161 Ga0495617_000161_15400_16578 391
670 3300046452 Ga0495617_001604 Ga0495617_001604_5449_6627 391
671 3300046452 Ga0495617_001680 Ga0495617_001680_3748_4938 391
672 3300046453 Ga0495627_000004 Ga0495627_000004_471680_472858 391
673 3300046453 Ga0495627_002605 Ga0495627_002605_2160_3335 391
674 3300046453 Ga0495627_006780 Ga0495627_006780_1909_3084 391
675 3300046453 Ga0495627_017149 Ga0495627_017149_650_1969 391
676 3300046454 Ga0495592_0000330 Ga0495592_0000330_14174_15349 391
677 3300046455 Ga0495603_0034431 Ga0495603_0034431_153_1328 391
678 3300046457 Ga0495590_0000084 Ga0495590_0000084_44226_45401 391
679 3300046457 Ga0495590_0001338 Ga0495590_0001338_6806_7981 391
680 3300046457 Ga0495590_0002892 Ga0495590_0002892_421_1596 391
681 3300046457 Ga0495590_0003601 Ga0495590_0003601_4620_5798 391
682 3300046457 Ga0495590_0016705 Ga0495590_0016705_304_1482 391
683 3300046458 Ga0495591_000034 Ga0495591_000034_54330_55505 391
684 3300046459 Ga0495629_0004476 Ga0495629_0004476_7853_9028 391
685 3300046459 Ga0495629_0027130 Ga0495629_0027130_2313_3488 391
686 3300046459 Ga0495629_0036197 Ga0495629_0036197_1355_2530 391
687 3300046459 Ga0495629_0104326 Ga0495629_0104326_328_1503 391
688 3300046459 Ga0495629_0138423 Ga0495629_0138423_371_1546 391
689 3300046460 Ga0495638_0000133 Ga0495638_0000133_55618_56796 391
690 3300046460 Ga0495638_0008243 Ga0495638_0008243_5014_6192 391
691 3300046460 Ga0495638_0013742 Ga0495638_0013742_2207_3385 391
692 3300046460 Ga0495638_0015650 Ga0495638_0015650_1474_2649 391
693 3300046460 Ga0495638_0028761 Ga0495638_0028761_281_1459 391
694 3300046463 Ga0495653_0000016 Ga0495653_0000016_92431_93609 391
695 3300046463 Ga0495653_0010559 Ga0495653_0010559_4779_5954 391
696 3300046463 Ga0495653_0099149 Ga0495653_0099149_293_1468 391
697 3300046471 Ga0495650_0000062 Ga0495650_0000062_55685_56863 391
698 3300046471 Ga0495650_0000084 Ga0495650_0000084_21279_22454 391
699 3300046471 Ga0495650_0000136 Ga0495650_0000136_46233_47411 391
700 3300046471 Ga0495650_0000141 Ga0495650_0000141_109867_111045 391
701 3300046471 Ga0495650_0000201 Ga0495650_0000201_91120_92310 391
702 3300046471 Ga0495650_0000255 Ga0495650_0000255_13147_14325 391
703 3300046471 Ga0495650_0001140 Ga0495650_0001140_7755_8933 391
704 3300046471 Ga0495650_0016111 Ga0495650_0016111_897_2075 391
705 3300046471 Ga0495650_0027985 Ga0495650_0027985_713_1891 391
706 3300046472 Ga0495580_0000673 Ga0495580_0000673_20007_21182 391
707 3300046472 Ga0495580_0055254 Ga0495580_0055254_443_1627 391
708 3300046473 Ga0495582_0022123 Ga0495582_0022123_1791_2966 391
709 3300046473 Ga0495582_0034372 Ga0495582_0034372_805_1980 391
710 3300046474 Ga0495605_0000043 Ga0495605_0000043_94923_96101 391
711 3300046474 Ga0495605_0000077 Ga0495605_0000077_27228_28403 391
712 3300046474 Ga0495605_0000471 Ga0495605_0000471_16202_17377 391
713 3300046474 Ga0495605_0003656 Ga0495605_0003656_131_1309 391
714 3300046474 Ga0495605_0003838 Ga0495605_0003838_1859_3034 391
715 3300046474 Ga0495605_0020215 Ga0495605_0020215_893_2071 391
716 3300046474 Ga0495605_0033409 Ga0495605_0033409_761_1936 391
717 3300046474 Ga0495605_0046049 Ga0495605_0046049_709_1884 391
718 3300046475 Ga0495639_0040528 Ga0495639_0040528_309_1487 391
719 3300046476 Ga0495662_0009077 Ga0495662_0009077_2725_3900 391
720 3300046491 Ga0495584_0000004 Ga0495584_0000004_282147_283325 391
721 3300046491 Ga0495584_0000274 Ga0495584_0000274_28052_29227 391
722 3300046491 Ga0495584_0003655 Ga0495584_0003655_2175_3365 391
723 3300046491 Ga0495584_0005749 Ga0495584_0005749_2769_3944 391
724 3300046491 Ga0495584_0013146 Ga0495584_0013146_1630_2808 391
725 3300046491 Ga0495584_0023302 Ga0495584_0023302_1383_2558 391
726 3300046491 Ga0495584_0025806 Ga0495584_0025806_147_1322 391
727 3300046491 Ga0495584_0033378 Ga0495584_0033378_11_1186 391
728 3300046491 Ga0495584_0050213 Ga0495584_0050213_896_2071 391
729 3300046491 Ga0495584_0056745 Ga0495584_0056745_92_1270 391
730 3300046491 Ga0495584_0076091 Ga0495584_0076091_79_1257 391
731 3300046492 Ga0495585_0000578 Ga0495585_0000578_4428_5606 391
732 3300046492 Ga0495585_0000713 Ga0495585_0000713_23366_24544 391
733 3300046492 Ga0495585_0001437 Ga0495585_0001437_16989_18167 391
734 3300046492 Ga0495585_0003217 Ga0495585_0003217_3831_5009 391
735 3300046492 Ga0495585_0005567 Ga0495585_0005567_5768_6946 391
736 3300046492 Ga0495585_0006781 Ga0495585_0006781_5349_6557 391
737 3300046492 Ga0495585_0007257 Ga0495585_0007257_5024_6199 391
738 3300046492 Ga0495585_0013513 Ga0495585_0013513_2001_3320 391
739 3300046492 Ga0495585_0016813 Ga0495585_0016813_2261_3451 391
740 3300046492 Ga0495585_0017689 Ga0495585_0017689_1921_3096 391
741 3300046492 Ga0495585_0028018 Ga0495585_0028018_1743_2918 391
742 3300046492 Ga0495585_0028728 Ga0495585_0028728_1911_3086 391
743 3300046492 Ga0495585_0030624 Ga0495585_0030624_1212_2387 391
744 3300046492 Ga0495585_0036250 Ga0495585_0036250_1177_2355 391
745 3300046492 Ga0495585_0040725 Ga0495585_0040725_423_1598 391
746 3300046492 Ga0495585_0061019 Ga0495585_0061019_631_1809 391
747 3300046492 Ga0495585_0066378 Ga0495585_0066378_315_1490 391
748 3300046499 Ga0495594_0010456 Ga0495594_0010456_2097_3272 391
749 3300046499 Ga0495594_0010939 Ga0495594_0010939_2842_4017 391
750 3300046499 Ga0495594_0012276 Ga0495594_0012276_1365_2540 391
751 3300046499 Ga0495594_0014538 Ga0495594_0014538_1312_2487 391
752 3300046499 Ga0495594_0108762 Ga0495594_0108762_218_1393 391
753 3300046500 Ga0495596_0000508 Ga0495596_0000508_19677_20855 391
754 3300046500 Ga0495596_0002024 Ga0495596_0002024_2288_3463 391
755 3300046500 Ga0495596_0002076 Ga0495596_0002076_5775_7031 391
756 3300046500 Ga0495596_0006098 Ga0495596_0006098_1169_2377 391
757 3300046500 Ga0495596_0009155 Ga0495596_0009155_427_1602 391
758 3300046500 Ga0495596_0010488 Ga0495596_0010488_2238_3413 391
759 3300046500 Ga0495596_0016195 Ga0495596_0016195_346_1521 391
760 3300046500 Ga0495596_0020366 Ga0495596_0020366_1425_2600 391
761 3300046501 Ga0495607_0000806 Ga0495607_0000806_9917_11095 391
762 3300046501 Ga0495607_0003187 Ga0495607_0003187_8800_9978 391
763 3300046501 Ga0495607_0005471 Ga0495607_0005471_492_1667 391
764 3300046501 Ga0495607_0006127 Ga0495607_0006127_631_1806 391
765 3300046501 Ga0495607_0009350 Ga0495607_0009350_4074_5252 391
766 3300046501 Ga0495607_0025650 Ga0495607_0025650_997_2175 391
767 3300046501 Ga0495607_0046268 Ga0495607_0046268_612_1790 391
768 3300046506 Ga0495583_0000044 Ga0495583_0000044_126952_128130 391
769 3300046506 Ga0495583_0000091 Ga0495583_0000091_88239_89417 391
770 3300046506 Ga0495583_0000099 Ga0495583_0000099_22724_23902 391
771 3300046506 Ga0495583_0000246 Ga0495583_0000246_57538_58716 391
772 3300046506 Ga0495583_0000936 Ga0495583_0000936_7990_9165 391
773 3300046506 Ga0495583_0002959 Ga0495583_0002959_1046_2221 391
774 3300046506 Ga0495583_0004328 Ga0495583_0004328_7813_8991 391
775 3300046506 Ga0495583_0008047 Ga0495583_0008047_4318_5493 391
776 3300046506 Ga0495583_0010011 Ga0495583_0010011_3057_4232 391
777 3300046506 Ga0495583_0024362 Ga0495583_0024362_577_1752 391
778 3300046506 Ga0495583_0027526 Ga0495583_0027526_631_1806 391
779 3300046507 Ga0495606_0000046 Ga0495606_0000046_119159_120337 391
780 3300046507 Ga0495606_0000051 Ga0495606_0000051_118090_119268 391
781 3300046507 Ga0495606_0000093 Ga0495606_0000093_59263_60441 391
782 3300046507 Ga0495606_0000476 Ga0495606_0000476_60320_61498 391
783 3300046507 Ga0495606_0000532 Ga0495606_0000532_37827_39005 391
784 3300046507 Ga0495606_0000929 Ga0495606_0000929_508_1686 391
785 3300046507 Ga0495606_0000986 Ga0495606_0000986_93_1271 391
786 3300046507 Ga0495606_0005680 Ga0495606_0005680_8541_9716 391
787 3300046507 Ga0495606_0014034 Ga0495606_0014034_4505_5683 391
788 3300046507 Ga0495606_0015400 Ga0495606_0015400_3451_4626 391
789 3300046507 Ga0495606_0016063 Ga0495606_0016063_248_1423 391
790 3300046507 Ga0495606_0019821 Ga0495606_0019821_2325_3503 391
791 3300046507 Ga0495606_0037849 Ga0495606_0037849_1266_2441 391
792 3300046507 Ga0495606_0039552 Ga0495606_0039552_1606_2784 391
793 3300046507 Ga0495606_0062176 Ga0495606_0062176_767_1945 391
794 3300046511 Ga0495608_0002611 Ga0495608_0002611_3048_4223 391
795 3300046512 Ga0495610_0000027 Ga0495610_0000027_51453_52631 391
796 3300046512 Ga0495610_0001625 Ga0495610_0001625_1830_3005 391
797 3300046512 Ga0495610_0002161 Ga0495610_0002161_5533_6711 391
798 3300046512 Ga0495610_0005034 Ga0495610_0005034_6182_7360 391
799 3300046513 Ga0495616_0000253 Ga0495616_0000253_8182_9360 391
800 3300046513 Ga0495616_0000504 Ga0495616_0000504_24162_25337 391
801 3300046513 Ga0495616_0000544 Ga0495616_0000544_11127_12305 391
802 3300046513 Ga0495616_0000591 Ga0495616_0000591_25569_26744 391
803 3300046513 Ga0495616_0002867 Ga0495616_0002867_10036_11214 391
804 3300046513 Ga0495616_0003323 Ga0495616_0003323_4200_5378 391
805 3300046513 Ga0495616_0005983 Ga0495616_0005983_5205_6380 391
806 3300046513 Ga0495616_0026912 Ga0495616_0026912_477_1685 391
807 3300046513 Ga0495616_0032132 Ga0495616_0032132_680_1855 391
808 3300046513 Ga0495616_0040587 Ga0495616_0040587_898_2073 391
809 3300046513 Ga0495616_0059352 Ga0495616_0059352_205_1380 391
810 3300046513 Ga0495616_0071683 Ga0495616_0071683_229_1407 391
811 3300046513 Ga0495616_0079182 Ga0495616_0079182_219_1394 391
812 3300046513 Ga0495616_0099479 Ga0495616_0099479_36_1214 391
813 3300046514 Ga0495618_0024257 Ga0495618_0024257_980_2155 391
814 3300046515 Ga0495620_0005087 Ga0495620_0005087_2106_3284 391
815 3300046516 Ga0495628_0169820 Ga0495628_0169820_316_1491 391
816 3300046517 Ga0495630_0002124 Ga0495630_0002124_11248_12423 391
817 3300046517 Ga0495630_0204089 Ga0495630_0204089_35_1210 391
818 3300046518 Ga0495631_0000278 Ga0495631_0000278_14817_15992 391
819 3300046518 Ga0495631_0000604 Ga0495631_0000604_4431_5606 391
820 3300046518 Ga0495631_0006277 Ga0495631_0006277_1422_2597 391
821 3300046518 Ga0495631_0009643 Ga0495631_0009643_2509_3684 391
822 3300046518 Ga0495631_0012275 Ga0495631_0012275_2410_3729 391
823 3300046518 Ga0495631_0014582 Ga0495631_0014582_584_1759 391
824 3300046518 Ga0495631_0020621 Ga0495631_0020621_990_2246 391
825 3300046518 Ga0495631_0038171 Ga0495631_0038171_645_1820 391
826 3300046518 Ga0495631_0049186 Ga0495631_0049186_388_1566 391
827 3300046519 Ga0495632_0000092 Ga0495632_0000092_90033_91208 391
828 3300046519 Ga0495632_0000136 Ga0495632_0000136_58613_59788 391
829 3300046519 Ga0495632_0001025 Ga0495632_0001025_21532_22707 391
830 3300046519 Ga0495632_0003825 Ga0495632_0003825_1708_2883 391
831 3300046519 Ga0495632_0007739 Ga0495632_0007739_4809_5987 391
832 3300046519 Ga0495632_0015274 Ga0495632_0015274_313_1488 391
833 3300046519 Ga0495632_0025563 Ga0495632_0025563_1578_2753 391
834 3300046519 Ga0495632_0048895 Ga0495632_0048895_414_1589 391
835 3300046519 Ga0495632_0070186 Ga0495632_0070186_12_1190 391
836 3300046520 Ga0495637_0000003 Ga0495637_0000003_422664_423839 391
837 3300046520 Ga0495637_0000058 Ga0495637_0000058_83587_84765 391
838 3300046520 Ga0495637_0000494 Ga0495637_0000494_18665_19843 391
839 3300046520 Ga0495637_0004779 Ga0495637_0004779_2747_3925 391
840 3300046520 Ga0495637_0038654 Ga0495637_0038654_493_1668 391
841 3300046522 Ga0495643_0000129 Ga0495643_0000129_118480_119658 391
842 3300046522 Ga0495643_0000139 Ga0495643_0000139_43556_44734 391
843 3300046522 Ga0495643_0000184 Ga0495643_0000184_32379_33557 391
844 3300046522 Ga0495643_0004217 Ga0495643_0004217_4915_6090 391
845 3300046522 Ga0495643_0014171 Ga0495643_0014171_2658_3914 391
846 3300046522 Ga0495643_0014568 Ga0495643_0014568_1931_3106 391
847 3300046522 Ga0495643_0018624 Ga0495643_0018624_217_1392 391
848 3300046522 Ga0495643_0037871 Ga0495643_0037871_461_1636 391
849 3300046522 Ga0495643_0050242 Ga0495643_0050242_45_1223 391
850 3300046523 Ga0495644_0001715 Ga0495644_0001715_2366_3541 391
851 3300046523 Ga0495644_0008067 Ga0495644_0008067_1046_2221 391
852 3300046523 Ga0495644_0011752 Ga0495644_0011752_1933_3108 391
853 3300046523 Ga0495644_0017725 Ga0495644_0017725_536_1711 391
854 3300046523 Ga0495644_0025292 Ga0495644_0025292_407_1726 391
855 3300046523 Ga0495644_0034658 Ga0495644_0034658_178_1353 391
856 3300046524 Ga0495648_0000006 Ga0495648_0000006_122500_123678 391
857 3300046524 Ga0495648_0000127 Ga0495648_0000127_61024_62202 391
858 3300046524 Ga0495648_0001350 Ga0495648_0001350_4833_6008 391
859 3300046524 Ga0495648_0001892 Ga0495648_0001892_7829_9007 391
860 3300046524 Ga0495648_0004786 Ga0495648_0004786_8932_10110 391
861 3300046524 Ga0495648_0013469 Ga0495648_0013469_2118_3296 391
862 3300046524 Ga0495648_0016855 Ga0495648_0016855_2421_3596 391
863 3300046524 Ga0495648_0040029 Ga0495648_0040029_518_1693 391
864 3300046524 Ga0495648_0057606 Ga0495648_0057606_330_1505 391
865 3300046524 Ga0495648_0066893 Ga0495648_0066893_447_1622 391
866 3300046524 Ga0495648_0090471 Ga0495648_0090471_75_1250 391
867 3300046525 Ga0495663_0006459 Ga0495663_0006459_1429_2607 391
868 3300046526 Ga0495666_0000358 Ga0495666_0000358_1577_2752 391
869 3300046526 Ga0495666_0003925 Ga0495666_0003925_5773_6948 391
870 3300046526 Ga0495666_0023321 Ga0495666_0023321_224_1399 391
871 3300046526 Ga0495666_0046082 Ga0495666_0046082_479_1654 391
872 3300046528 Ga0495642_0000014 Ga0495642_0000014_79756_80931 391
873 3300046528 Ga0495642_0000601 Ga0495642_0000601_15545_16720 391
874 3300046528 Ga0495642_0001447 Ga0495642_0001447_6238_7416 391
875 3300046528 Ga0495642_0001848 Ga0495642_0001848_892_2070 391
876 3300046528 Ga0495642_0002139 Ga0495642_0002139_4347_5525 391
877 3300046528 Ga0495642_0002176 Ga0495642_0002176_688_1863 391
878 3300046528 Ga0495642_0006905 Ga0495642_0006905_1258_2577 391
879 3300046528 Ga0495642_0015932 Ga0495642_0015932_440_1615 391
880 3300046528 Ga0495642_0017775 Ga0495642_0017775_1509_2687 391
881 3300046528 Ga0495642_0017777 Ga0495642_0017777_577_1752 391
882 3300046528 Ga0495642_0052798 Ga0495642_0052798_27_1202 391
883 3300046529 Ga0495652_0019446 Ga0495652_0019446_3455_4630 391
884 3300046529 Ga0495652_0060024 Ga0495652_0060024_1569_2744 391
885 3300046529 Ga0495652_0085345 Ga0495652_0085345_1206_2381 391
886 3300046530 Ga0495654_0000022 Ga0495654_0000022_152265_153443 391
887 3300046530 Ga0495654_0001794 Ga0495654_0001794_11789_12964 391
888 3300046530 Ga0495654_0006359 Ga0495654_0006359_5470_6648 391
889 3300046531 Ga0495665_0005000 Ga0495665_0005000_5461_6636 391
890 3300046531 Ga0495665_0011946 Ga0495665_0011946_591_1766 391
891 3300046531 Ga0495665_0029779 Ga0495665_0029779_512_1687 391
892 3300046533 Ga0495640_0000361 Ga0495640_0000361_28276_29451 391
893 3300046533 Ga0495640_0037901 Ga0495640_0037901_1063_2238 391
894 3300046535 Ga0495586_0002540 Ga0495586_0002540_728_1903 391
895 3300046535 Ga0495586_0004893 Ga0495586_0004893_1627_2802 391
896 3300046536 Ga0495587_0021357 Ga0495587_0021357_541_1725 391
897 3300046536 Ga0495587_0081796 Ga0495587_0081796_193_1368 391
898 3300046537 Ga0495598_0010589 Ga0495598_0010589_941_2128 391
899 3300046538 Ga0495609_0000068 Ga0495609_0000068_44259_45434 391
900 3300046538 Ga0495609_0000071 Ga0495609_0000071_7729_8907 391
901 3300046538 Ga0495609_0001980 Ga0495609_0001980_2500_3678 391
902 3300046538 Ga0495609_0003897 Ga0495609_0003897_3264_4439 391
903 3300046538 Ga0495609_0003956 Ga0495609_0003956_6984_8159 391
904 3300046538 Ga0495609_0004612 Ga0495609_0004612_5457_6635 391
905 3300046538 Ga0495609_0006626 Ga0495609_0006626_133_1308 391
906 3300046538 Ga0495609_0007470 Ga0495609_0007470_4170_5426 391
907 3300046538 Ga0495609_0020429 Ga0495609_0020429_1638_2813 391
908 3300046538 Ga0495609_0035974 Ga0495609_0035974_818_1993 391
909 3300046542 Ga0495597_0000051 Ga0495597_0000051_39506_40684 391
910 3300046542 Ga0495597_0000978 Ga0495597_0000978_1346_2521 391
911 3300046542 Ga0495597_0002537 Ga0495597_0002537_7584_8762 391
912 3300046542 Ga0495597_0003589 Ga0495597_0003589_3503_4678 391
913 3300046542 Ga0495597_0003947 Ga0495597_0003947_1726_2901 391
914 3300046542 Ga0495597_0004146 Ga0495597_0004146_5273_6592 391
915 3300046542 Ga0495597_0006044 Ga0495597_0006044_4459_5634 391
916 3300046542 Ga0495597_0007663 Ga0495597_0007663_1315_2493 391
917 3300046542 Ga0495597_0019435 Ga0495597_0019435_684_1859 391
918 3300046542 Ga0495597_0030936 Ga0495597_0030936_586_1764 391
919 3300046542 Ga0495597_0054653 Ga0495597_0054653_318_1496 391
920 3300046557 Ga0495622_0000045 Ga0495622_0000045_38347_39525 391
921 3300046557 Ga0495622_0000136 Ga0495622_0000136_4928_6106 391
922 3300046557 Ga0495622_0003680 Ga0495622_0003680_1782_2957 391
923 3300046557 Ga0495622_0060291 Ga0495622_0060291_97_1287 391
924 3300046557 Ga0495622_0072683 Ga0495622_0072683_178_1353 391
925 3300046558 Ga0495633_0000202 Ga0495633_0000202_35701_36879 391
926 3300046558 Ga0495633_0000277 Ga0495633_0000277_17234_18412 391
927 3300046558 Ga0495633_0001894 Ga0495633_0001894_5026_6216 391
928 3300046558 Ga0495633_0002629 Ga0495633_0002629_5008_6186 391
929 3300046558 Ga0495633_0004167 Ga0495633_0004167_7506_8681 391
930 3300046558 Ga0495633_0004897 Ga0495633_0004897_4420_5595 391
931 3300046558 Ga0495633_0005717 Ga0495633_0005717_5472_6650 391
932 3300046558 Ga0495633_0008856 Ga0495633_0008856_78_1256 391
933 3300046558 Ga0495633_0012063 Ga0495633_0012063_42_1220 391
934 3300046558 Ga0495633_0021002 Ga0495633_0021002_1447_2625 391
935 3300046558 Ga0495633_0022102 Ga0495633_0022102_482_1660 391
936 3300046558 Ga0495633_0024891 Ga0495633_0024891_1329_2537 391
937 3300046558 Ga0495633_0068939 Ga0495633_0068939_59_1237 391
938 3300046559 Ga0495667_0043518 Ga0495667_0043518_463_1638 391
939 3300046615 Ga0495656_0015428 Ga0495656_0015428_525_1844 391
940 3300046615 Ga0495656_0027619 Ga0495656_0027619_863_2038 391
941 3300046616 Ga0495668_0000029 Ga0495668_0000029_240254_241432 391
942 3300046616 Ga0495668_0000148 Ga0495668_0000148_39105_40283 391
943 3300046616 Ga0495668_0000174 Ga0495668_0000174_41368_42543 391
944 3300046616 Ga0495668_0000232 Ga0495668_0000232_73396_74574 391
945 3300046616 Ga0495668_0000993 Ga0495668_0000993_28192_29370 391
946 3300046616 Ga0495668_0001677 Ga0495668_0001677_1266_2441 391
947 3300046616 Ga0495668_0003626 Ga0495668_0003626_7641_8819 391
948 3300046616 Ga0495668_0018136 Ga0495668_0018136_2447_3622 391
949 3300046616 Ga0495668_0028213 Ga0495668_0028213_476_1684 391
950 3300046616 Ga0495668_0033283 Ga0495668_0033283_655_1974 391
951 3300046616 Ga0495668_0037131 Ga0495668_0037131_1046_2221 391
952 3300046616 Ga0495668_0042026 Ga0495668_0042026_1209_2384 391
953 3300046616 Ga0495668_0077160 Ga0495668_0077160_54_1229 391
954 3300046616 Ga0495668_0108994 Ga0495668_0108994_17_1195 391
955 3300046642 Ga0495634_0004040 Ga0495634_0004040_8339_9514 391
956 3300046642 Ga0495634_0023044 Ga0495634_0023044_909_2084 391
957 3300046648 Ga0495611_0000064 Ga0495611_0000064_46939_48114 391
958 3300046648 Ga0495611_0021883 Ga0495611_0021883_985_2163 391
959 3300046648 Ga0495611_0022996 Ga0495611_0022996_516_1691 391
960 3300046648 Ga0495611_0027825 Ga0495611_0027825_1042_2217 391
961 3300046648 Ga0495611_0037629 Ga0495611_0037629_463_1782 391
962 3300046660 Ga0495625_0000220 Ga0495625_0000220_14312_15490 391
963 3300046660 Ga0495625_0001632 Ga0495625_0001632_21989_23167 391
964 3300046660 Ga0495625_0005340 Ga0495625_0005340_3304_4482 391
965 3300046660 Ga0495625_0006694 Ga0495625_0006694_604_1782 391
966 3300046660 Ga0495625_0007550 Ga0495625_0007550_167_1342 391
967 3300046660 Ga0495625_0022190 Ga0495625_0022190_2922_4097 391
968 3300046660 Ga0495625_0025488 Ga0495625_0025488_2674_3852 391
969 3300046660 Ga0495625_0032509 Ga0495625_0032509_1001_2179 391
970 3300046660 Ga0495625_0049335 Ga0495625_0049335_617_1795 391
971 3300046660 Ga0495625_0051022 Ga0495625_0051022_1439_2614 391
972 3300046660 Ga0495625_0053232 Ga0495625_0053232_764_1942 391
973 3300046660 Ga0495625_0100822 Ga0495625_0100822_570_1745 391
974 3300046660 Ga0495625_0168856 Ga0495625_0168856_187_1365 391
975 3300046663 Ga0495635_0002684 Ga0495635_0002684_486_1661 391
976 3300046663 Ga0495635_0049501 Ga0495635_0049501_272_1447 391
977 3300046664 Ga0495659_0000072 Ga0495659_0000072_34767_35945 391
978 3300046664 Ga0495659_0001178 Ga0495659_0001178_1288_2466 391
979 3300046664 Ga0495659_0001711 Ga0495659_0001711_2263_3441 391
980 3300046665 Ga0495661_0000214 Ga0495661_0000214_50835_52010 391
981 3300046665 Ga0495661_0000695 Ga0495661_0000695_16610_17788 391
982 3300046665 Ga0495661_0004010 Ga0495661_0004010_8146_9321 391
983 3300046665 Ga0495661_0008198 Ga0495661_0008198_2300_3478 391
984 3300046665 Ga0495661_0011114 Ga0495661_0011114_1873_3192 391
985 3300046665 Ga0495661_0015331 Ga0495661_0015331_946_2124 391
986 3300046665 Ga0495661_0026626 Ga0495661_0026626_2086_3264 391
987 3300046665 Ga0495661_0028879 Ga0495661_0028879_2086_3261 391
988 3300046665 Ga0495661_0035609 Ga0495661_0035609_1341_2516 391
989 3300046665 Ga0495661_0036583 Ga0495661_0036583_1515_2693 391
990 3300046665 Ga0495661_0052376 Ga0495661_0052376_171_1346 391
991 3300046665 Ga0495661_0056619 Ga0495661_0056619_528_1703 391
992 3300046665 Ga0495661_0061482 Ga0495661_0061482_462_1637 391
993 3300046665 Ga0495661_0080183 Ga0495661_0080183_316_1491 391
994 3300046665 Ga0495661_0080487 Ga0495661_0080487_64_1239 391
995 3300046665 Ga0495661_0134772 Ga0495661_0134772_68_1243 391
996 3300046674 Ga0495588_0000141 Ga0495588_0000141_46470_47648 391
997 3300046674 Ga0495588_0019034 Ga0495588_0019034_1412_2587 391
998 3300046674 Ga0495588_0023447 Ga0495588_0023447_1146_2321 391
999 3300046674 Ga0495588_0071398 Ga0495588_0071398_484_1659 391
1000 3300046674 Ga0495588_0087467 Ga0495588_0087467_331_1506 391
1001 3300046674 Ga0495588_0098991 Ga0495588_0098991_277_1452 391
1002 3300046678 Ga0495599_0108620 Ga0495599_0108620_305_1480 391
1003 3300046679 Ga0495623_0011773 Ga0495623_0011773_2745_3920 391
1004 3300046679 Ga0495623_0115105 Ga0495623_0115105_23_1198 391
1005 3300046680 Ga0495646_0062820 Ga0495646_0062820_391_1566 391
1006 3300046683 Ga0495658_0003242 Ga0495658_0003242_2337_3512 391
1007 3300046684 Ga0495669_0000061 Ga0495669_0000061_44615_45790 391
1008 3300046684 Ga0495669_0000541 Ga0495669_0000541_8898_10076 391
1009 3300046684 Ga0495669_0001956 Ga0495669_0001956_3136_4314 391
1010 3300046684 Ga0495669_0010797 Ga0495669_0010797_1332_2507 391
1011 3300046684 Ga0495669_0017316 Ga0495669_0017316_1430_2605 391
1012 3300046684 Ga0495669_0021589 Ga0495669_0021589_548_1723 391
1013 3300046684 Ga0495669_0024322 Ga0495669_0024322_201_1376 391
1014 3300046684 Ga0495669_0034561 Ga0495669_0034561_840_2015 391
1015 3300046689 Ga0495613_0006712 Ga0495613_0006712_6691_7866 391
1016 3300046689 Ga0495613_0043012 Ga0495613_0043012_371_1546 391
1017 3300046690 Ga0495624_0001779 Ga0495624_0001779_2380_3555 391
1018 3300046690 Ga0495624_0038646 Ga0495624_0038646_1398_2573 391
1019 3300046690 Ga0495624_0086078 Ga0495624_0086078_687_1862 391
1020 3300046691 Ga0495670_0001678 Ga0495670_0001678_705_1883 391
1021 3300046691 Ga0495670_0004159 Ga0495670_0004159_1243_2418 391
1022 3300046691 Ga0495670_0010550 Ga0495670_0010550_3095_4273 391
1023 3300046691 Ga0495670_0020306 Ga0495670_0020306_496_1815 391
1024 3300046691 Ga0495670_0021699 Ga0495670_0021699_594_1769 391
1025 3300046691 Ga0495670_0035935 Ga0495670_0035935_553_1731 391
1026 3300046691 Ga0495670_0072394 Ga0495670_0072394_371_1546 391
1027 3300046691 Ga0495670_0074831 Ga0495670_0074831_67_1242 391
1028 3300046691 Ga0495670_0075274 Ga0495670_0075274_300_1475 391
1029 3300046692 Ga0495671_0000064 Ga0495671_0000064_7797_8975 391
1030 3300046692 Ga0495671_0000281 Ga0495671_0000281_6894_8072 391
1031 3300046692 Ga0495671_0001813 Ga0495671_0001813_10658_11833 391
1032 3300046692 Ga0495671_0007401 Ga0495671_0007401_1777_2955 391
1033 3300046692 Ga0495671_0025617 Ga0495671_0025617_1712_2890 391
1034 3300046692 Ga0495671_0033801 Ga0495671_0033801_79_1398 391
1035 3300046694 Ga0495649_0000918 Ga0495649_0000918_20335_21510 391
1036 3300046694 Ga0495649_0002189 Ga0495649_0002189_3575_4753 391
1037 3300046694 Ga0495649_0013798 Ga0495649_0013798_485_1663 391
1038 3300046694 Ga0495649_0015468 Ga0495649_0015468_1816_2994 391
1039 3300046694 Ga0495649_0028513 Ga0495649_0028513_1812_2990 391
1040 3300046794 Ga0495589_0000084 Ga0495589_0000084_34491_35666 391
1041 3300046794 Ga0495589_0000770 Ga0495589_0000770_18012_19187 391
1042 3300046794 Ga0495589_0003941 Ga0495589_0003941_5461_6636 391
1043 3300046794 Ga0495589_0004657 Ga0495589_0004657_3663_4838 391
1044 3300046794 Ga0495589_0007237 Ga0495589_0007237_549_1724 391
1045 3300046794 Ga0495589_0010759 Ga0495589_0010759_2608_3927 391
1046 3300046794 Ga0495589_0040631 Ga0495589_0040631_675_1850 391
1047 3300046794 Ga0495589_0066482 Ga0495589_0066482_483_1658 391
1048 3300046809 Ga0495600_0085173 Ga0495600_0085173_223_1398 391
1049 3300046810 Ga0495660_0000200 Ga0495660_0000200_11902_13077 391
1050 3300046810 Ga0495660_0001390 Ga0495660_0001390_4036_5247 391
1051 3300046810 Ga0495660_0001407 Ga0495660_0001407_6028_7206 391
1052 3300046810 Ga0495660_0001424 Ga0495660_0001424_3479_4657 391
1053 3300046810 Ga0495660_0002477 Ga0495660_0002477_9582_10757 391
1054 3300046810 Ga0495660_0011896 Ga0495660_0011896_2406_3581 391
1055 3300046810 Ga0495660_0012525 Ga0495660_0012525_3094_4272 391
1056 3300046810 Ga0495660_0015786 Ga0495660_0015786_2066_3241 391
1057 3300046810 Ga0495660_0029879 Ga0495660_0029879_686_1861 391
1058 3300046810 Ga0495660_0046806 Ga0495660_0046806_142_1320 391
1059 3300046810 Ga0495660_0051027 Ga0495660_0051027_585_1760 391
1060 3300046810 Ga0495660_0059913 Ga0495660_0059913_402_1577 391
1061 3300047315 Ga0495581_0001405 Ga0495581_0001405_11525_12700 391
1062 3300047315 Ga0495581_0135696 Ga0495581_0135696_158_1333 391
1063 3300047317 Ga0495604_0004964 Ga0495604_0004964_6718_7893 391
1064 3300047317 Ga0495604_0014498 Ga0495604_0014498_824_1999 391
1065 3300047317 Ga0495604_0048113 Ga0495604_0048113_1607_2782 391
1066 3300047318 Ga0495636_0000994 Ga0495636_0000994_7693_8871 391
1067 3300047318 Ga0495636_0002196 Ga0495636_0002196_55_1230 391
1068 3300047318 Ga0495636_0003868 Ga0495636_0003868_4288_5466 391
1069 3300047318 Ga0495636_0014612 Ga0495636_0014612_1694_2872 391
1070 3300047318 Ga0495636_0081334 Ga0495636_0081334_72_1247 391
1071 3300047319 Ga0495674_0030847 Ga0495674_0030847_3208_4383 391
1072 3300047320 Ga0495672_0000026 Ga0495672_0000026_338674_339852 391
1073 3300047320 Ga0495672_0000075 Ga0495672_0000075_87689_88867 391
1074 3300047320 Ga0495672_0000089 Ga0495672_0000089_26603_27778 391
1075 3300047320 Ga0495672_0000127 Ga0495672_0000127_18369_19547 391
1076 3300047320 Ga0495672_0000453 Ga0495672_0000453_27038_28213 391
1077 3300047320 Ga0495672_0002837 Ga0495672_0002837_1427_2602 391
1078 3300047320 Ga0495672_0006451 Ga0495672_0006451_2862_4052 391
1079 3300047320 Ga0495672_0007734 Ga0495672_0007734_6616_7794 391
1080 3300047320 Ga0495672_0023375 Ga0495672_0023375_2182_3357 391
1081 3300047320 Ga0495672_0036465 Ga0495672_0036465_1379_2554 391
1082 3300047320 Ga0495672_0058257 Ga0495672_0058257_864_2039 391
1083 3300047320 Ga0495672_0059651 Ga0495672_0059651_609_1865 391
1084 3300047320 Ga0495672_0081131 Ga0495672_0081131_214_1389 391
1085 3300047321 Ga0495676_0000025 Ga0495676_0000025_95136_96311 391
1086 3300047321 Ga0495676_0028408 Ga0495676_0028408_2203_3405 391
1087 3300047321 Ga0495676_0058168 Ga0495676_0058168_1603_2778 391
1088 3300047321 Ga0495676_0077630 Ga0495676_0077630_505_1680 391
1089 3300047322 Ga0495680_0004529 Ga0495680_0004529_1404_2579 391
1090 3300047322 Ga0495680_0021996 Ga0495680_0021996_1088_2266 391
1091 3300047322 Ga0495680_0058611 Ga0495680_0058611_634_1809 391
1092 3300047323 Ga0495683_0000155 Ga0495683_0000155_22168_23343 391
1093 3300047323 Ga0495683_0000174 Ga0495683_0000174_60153_61361 391
1094 3300047323 Ga0495683_0001196 Ga0495683_0001196_1449_2624 391
1095 3300047323 Ga0495683_0001709 Ga0495683_0001709_984_2159 391
1096 3300047323 Ga0495683_0006093 Ga0495683_0006093_4854_6032 391
1097 3300047323 Ga0495683_0008116 Ga0495683_0008116_75_1265 391
1098 3300047323 Ga0495683_0024755 Ga0495683_0024755_1542_2720 391
1099 3300047323 Ga0495683_0030699 Ga0495683_0030699_68_1243 391
1100 3300047323 Ga0495683_0034343 Ga0495683_0034343_535_1710 391
1101 3300047323 Ga0495683_0078272 Ga0495683_0078272_35_1213 391
1102 3300047443 Ga0495687_000101 Ga0495687_000101_44132_45307 391
1103 3300047443 Ga0495687_000117 Ga0495687_000117_11640_12815 391
1104 3300047443 Ga0495687_000282 Ga0495687_000282_27022_28197 391
1105 3300047443 Ga0495687_000314 Ga0495687_000314_52833_54008 391
1106 3300047443 Ga0495687_000918 Ga0495687_000918_24868_26046 391
1107 3300047443 Ga0495687_001051 Ga0495687_001051_15366_16541 391
1108 3300047443 Ga0495687_001544 Ga0495687_001544_1351_2526 391
1109 3300047443 Ga0495687_033530 Ga0495687_033530_413_1588 391
1110 3300047444 Ga0495675_0007787 Ga0495675_0007787_1615_2790 391
1111 3300047444 Ga0495675_0009593 Ga0495675_0009593_1339_2514 391
1112 3300047445 Ga0495677_0000015 Ga0495677_0000015_44076_45251 391
1113 3300047445 Ga0495677_0000569 Ga0495677_0000569_3318_4493 391
1114 3300047445 Ga0495677_0000679 Ga0495677_0000679_10508_11686 391
1115 3300047445 Ga0495677_0002429 Ga0495677_0002429_5057_6232 391
1116 3300047445 Ga0495677_0004887 Ga0495677_0004887_1643_2962 391
1117 3300047445 Ga0495677_0005652 Ga0495677_0005652_1585_2760 391
1118 3300047445 Ga0495677_0009353 Ga0495677_0009353_1661_2917 391
1119 3300047445 Ga0495677_0010826 Ga0495677_0010826_1612_2790 391
1120 3300047445 Ga0495677_0022559 Ga0495677_0022559_714_1889 391
1121 3300047445 Ga0495677_0024284 Ga0495677_0024284_675_1850 391
1122 3300047445 Ga0495677_0027933 Ga0495677_0027933_509_1684 391
1123 3300047445 Ga0495677_0030599 Ga0495677_0030599_429_1604 391
1124 3300047446 Ga0495679_005376 Ga0495679_005376_2837_4012 391
1125 3300047446 Ga0495679_007325 Ga0495679_007325_655_1833 391
1126 3300047446 Ga0495679_013525 Ga0495679_013525_1342_2517 391
1127 3300047446 Ga0495679_027420 Ga0495679_027420_405_1583 391
1128 3300047447 Ga0495685_000008 Ga0495685_000008_49857_51035 391
1129 3300047447 Ga0495685_000199 Ga0495685_000199_17373_18551 391
1130 3300047447 Ga0495685_011820 Ga0495685_011820_1326_2501 391
1131 3300047447 Ga0495685_012632 Ga0495685_012632_453_1628 391
1132 3300047447 Ga0495685_014336 Ga0495685_014336_445_1623 391
1133 3300047447 Ga0495685_020018 Ga0495685_020018_236_1414 391
1134 3300047469 Ga0495673_0000008 Ga0495673_0000008_247852_249030 391
1135 3300047469 Ga0495673_0000009 Ga0495673_0000009_207181_208359 391
1136 3300047469 Ga0495673_0000012 Ga0495673_0000012_106135_107313 391
1137 3300047469 Ga0495673_0015767 Ga0495673_0015767_2171_3349 391
1138 3300047470 Ga0495681_0000700 Ga0495681_0000700_18931_20106 391
1139 3300047470 Ga0495681_0003376 Ga0495681_0003376_1326_2501 391
1140 3300047470 Ga0495681_0011812 Ga0495681_0011812_3047_4366 391
1141 3300047470 Ga0495681_0024264 Ga0495681_0024264_522_1697 391
1142 3300047470 Ga0495681_0027563 Ga0495681_0027563_1469_2647 391
1143 3300047470 Ga0495681_0030815 Ga0495681_0030815_1394_2569 391
1144 3300047470 Ga0495681_0037283 Ga0495681_0037283_992_2167 391
1145 3300047470 Ga0495681_0061210 Ga0495681_0061210_539_1714 391
1146 3300047470 Ga0495681_0067778 Ga0495681_0067778_428_1606 391
1147 3300047472 Ga0495686_0000163 Ga0495686_0000163_19530_20705 391
1148 3300047472 Ga0495686_0001540 Ga0495686_0001540_21076_22254 391
1149 3300047472 Ga0495686_0002255 Ga0495686_0002255_345_1520 391
1150 3300047472 Ga0495686_0026085 Ga0495686_0026085_764_1942 391
1151 3300047472 Ga0495686_0078606 Ga0495686_0078606_406_1584 391
1152 3300047673 Ga0495593_0001956 Ga0495593_0001956_1487_2662 391
1153 3300047673 Ga0495593_0026634 Ga0495593_0026634_716_1891 391
1154 3300048088 Ga0495602_0000323 Ga0495602_0000323_26818_27993 391
1155 3300048088 Ga0495602_0014971 Ga0495602_0014971_4582_5766 391
1156 3300048089 Ga0495614_0009833 Ga0495614_0009833_1314_2489 391
1157 3300048089 Ga0495614_0012614 Ga0495614_0012614_1921_3096 391
1158 3300048089 Ga0495614_0039758 Ga0495614_0039758_284_1459 391
1159 3300048089 Ga0495614_0048154 Ga0495614_0048154_365_1540 391
1160 3300048091 Ga0495626_0000182 Ga0495626_0000182_38225_39400 391
1161 3300048091 Ga0495626_0001143 Ga0495626_0001143_14768_15943 391
1162 3300048091 Ga0495626_0002715 Ga0495626_0002715_2676_3851 391
1163 3300048091 Ga0495626_0010792 Ga0495626_0010792_2995_4173 391
1164 3300048091 Ga0495626_0010964 Ga0495626_0010964_3253_4428 391
1165 3300048091 Ga0495626_0012497 Ga0495626_0012497_657_1913 391
1166 3300048091 Ga0495626_0018137 Ga0495626_0018137_1357_2532 391
1167 3300048091 Ga0495626_0020785 Ga0495626_0020785_1355_2530 391
1168 3300048091 Ga0495626_0027079 Ga0495626_0027079_510_1685 391
1169 3300048091 Ga0495626_0061724 Ga0495626_0061724_104_1279 391
1170 3300048091 Ga0495626_0075258 Ga0495626_0075258_10_1185 391
1171 3300048903 Ga0496100_0115312 Ga0496100_0115312_644_1843 391
1172 3300048903 Ga0496100_0207315 Ga0496100_0207315_219_1394 391
1173 3300048904 Ga0496101_0027763 Ga0496101_0027763_2563_3750 391
1174 3300048904 Ga0496101_0033957 Ga0496101_0033957_671_1846 391
1175 3300048904 Ga0496101_0180814 Ga0496101_0180814_92_1270 391
1176 3300048905 Ga0496102_0000024 Ga0496102_0000024_99346_100524 391
1177 3300048905 Ga0496102_0000154 Ga0496102_0000154_1312_2487 391
1178 3300048905 Ga0496102_0026028 Ga0496102_0026028_875_2053 391
1179 3300048905 Ga0496102_0082748 Ga0496102_0082748_1303_2478 391
1180 3300048905 Ga0496102_0129461 Ga0496102_0129461_338_1516 391
1181 3300048905 Ga0496102_0207244 Ga0496102_0207244_407_1582 391
1182 3300048906 Ga0496103_0006301 Ga0496103_0006301_4874_6052 391
1183 3300048906 Ga0496103_0028900 Ga0496103_0028900_1632_2810 391
1184 3300048906 Ga0496103_0062928 Ga0496103_0062928_608_1786 391
1185 3300048907 Ga0496104_0013736 Ga0496104_0013736_4210_5397 391
1186 3300048907 Ga0496104_0024049 Ga0496104_0024049_1259_2434 391
1187 3300048907 Ga0496104_0046944 Ga0496104_0046944_933_2132 391
1188 3300048908 Ga0496105_0000967 Ga0496105_0000967_8633_9832 391
1189 3300048908 Ga0496105_0015981 Ga0496105_0015981_3624_4799 391
1190 3300048908 Ga0496105_0208179 Ga0496105_0208179_202_1389 391
1191 3300048908 Ga0496105_0229440 Ga0496105_0229440_282_1457 391
1192 3300048909 Ga0496106_0269751 Ga0496106_0269751_58_1233 391
1193 3300048910 Ga0496107_0014903 Ga0496107_0014903_3089_4264 391
1194 3300048910 Ga0496107_0056252 Ga0496107_0056252_1334_2509 391
1195 3300048911 Ga0496108_0079390 Ga0496108_0079390_490_1677 391
1196 3300048911 Ga0496108_0090016 Ga0496108_0090016_283_1461 391
1197 3300048912 Ga0496109_0066229 Ga0496109_0066229_1558_2745 391
1198 3300048912 Ga0496109_0230265 Ga0496109_0230265_416_1591 391
1199 3300048913 Ga0496110_0000229 Ga0496110_0000229_30174_31352 391
1200 3300048913 Ga0496110_0007614 Ga0496110_0007614_6177_7364 391
1201 3300048913 Ga0496110_0038075 Ga0496110_0038075_2402_3577 391
1202 3300048913 Ga0496110_0048976 Ga0496110_0048976_215_1393 391
1203 3300048913 Ga0496110_0060061 Ga0496110_0060061_676_1851 391
1204 3300048914 Ga0496111_0065800 Ga0496111_0065800_532_1719 391
1205 3300048915 Ga0496112_0071785 Ga0496112_0071785_1345_2520 391
1206 3300048916 Ga0496113_0185920 Ga0496113_0185920_444_1622 391
1207 3300048917 Ga0496114_0005092 Ga0496114_0005092_6132_7331 391
1208 3300048917 Ga0496114_0064750 Ga0496114_0064750_1607_2794 391
1209 3300048917 Ga0496114_0090766 Ga0496114_0090766_1043_2218 391
1210 3300048917 Ga0496114_0179600 Ga0496114_0179600_399_1577 391
1211 3300048918 Ga0496115_0009194 Ga0496115_0009194_5587_6762 391
1212 3300048918 Ga0496115_0170188 Ga0496115_0170188_396_1571 391
1213 3300048918 Ga0496115_0196201 Ga0496115_0196201_291_1466 391
1214 3300048919 Ga0496116_0012782 Ga0496116_0012782_3375_4550 391
1215 3300048919 Ga0496116_0013047 Ga0496116_0013047_2138_3316 391
1216 3300048919 Ga0496116_0055260 Ga0496116_0055260_912_2090 391
1217 3300048919 Ga0496116_0084320 Ga0496116_0084320_459_1637 391
1218 3300048920 Ga0496117_0000005 Ga0496117_0000005_254115_255293 391
1219 3300048920 Ga0496117_0003151 Ga0496117_0003151_18101_19279 391
1220 3300048921 Ga0496118_0000022 Ga0496118_0000022_183310_184488 391
1221 3300048921 Ga0496118_0079447 Ga0496118_0079447_128_1306 391
1222 3300048922 Ga0496119_0001121 Ga0496119_0001121_9005_10183 391
1223 3300048923 Ga0496120_0000014 Ga0496120_0000014_199341_200519 391
1224 3300048923 Ga0496120_0088968 Ga0496120_0088968_64_1242 391
1225 3300048924 Ga0496121_0004138 Ga0496121_0004138_3292_4467 391
1226 3300048924 Ga0496121_0028870 Ga0496121_0028870_3306_4481 391
1227 3300048924 Ga0496121_0086796 Ga0496121_0086796_687_1862 391
1228 3300048925 Ga0496122_0000648 Ga0496122_0000648_28670_29845 391
1229 3300048925 Ga0496122_0001132 Ga0496122_0001132_42966_44144 391
1230 3300048925 Ga0496122_0005577 Ga0496122_0005577_13181_14356 391
1231 3300048925 Ga0496122_0007186 Ga0496122_0007186_9015_10190 391
1232 3300048925 Ga0496122_0033482 Ga0496122_0033482_1224_2402 391
1233 3300048926 Ga0496123_0000473 Ga0496123_0000473_40520_41695 391
1234 3300048926 Ga0496123_0004457 Ga0496123_0004457_4370_5545 391
1235 3300048926 Ga0496123_0004484 Ga0496123_0004484_9816_10994 391
1236 3300048926 Ga0496123_0013688 Ga0496123_0013688_1844_3022 391
1237 3300048926 Ga0496123_0014227 Ga0496123_0014227_167_1345 391
1238 3300048926 Ga0496123_0029164 Ga0496123_0029164_2512_3687 391
1239 3300048927 Ga0496124_0002033 Ga0496124_0002033_12988_14166 391
1240 3300048927 Ga0496124_0008922 Ga0496124_0008922_8635_9813 391
1241 3300048927 Ga0496124_0050628 Ga0496124_0050628_1967_3142 391
1242 3300048927 Ga0496124_0054048 Ga0496124_0054048_1024_2199 391
1243 3300048927 Ga0496124_0060877 Ga0496124_0060877_706_1881 391
1244 3300048927 Ga0496124_0100000 Ga0496124_0100000_1041_2219 391
1245 3300048927 Ga0496124_0106386 Ga0496124_0106386_140_1351 391
1246 3300048927 Ga0496124_0121737 Ga0496124_0121737_705_1880 391
1247 3300048928 Ga0496125_0000545 Ga0496125_0000545_656_1831 391
1248 3300048928 Ga0496125_0013723 Ga0496125_0013723_4153_5331 391
1249 3300048928 Ga0496125_0046260 Ga0496125_0046260_1200_2375 391
1250 3300048928 Ga0496125_0076545 Ga0496125_0076545_817_2007 391
1251 3300048928 Ga0496125_0085738 Ga0496125_0085738_109_1287 391
1252 3300048928 Ga0496125_0103848 Ga0496125_0103848_809_1984 391
1253 3300048929 Ga0496126_0000657 Ga0496126_0000657_50716_51894 391
1254 3300048929 Ga0496126_0008484 Ga0496126_0008484_935_2113 391
1255 3300049128 Ga0501308_000821 Ga0501308_000821_794_1972 391
1256 3300049129 Ga0501309_001464 Ga0501309_001464_434_1612 391
1257 3300049160 Ga0501304_000296 Ga0501304_000296_262_1440 391
1258 3300049459 Ga0495678_000012 Ga0495678_000012_102367_103578 391
1259 3300049459 Ga0495678_000051 Ga0495678_000051_44034_45209 391
1260 3300049459 Ga0495678_000114 Ga0495678_000114_87648_88826 391
1261 3300049459 Ga0495678_001536 Ga0495678_001536_6611_7789 391
1262 3300049459 Ga0495678_002134 Ga0495678_002134_11533_12708 391
1263 3300049459 Ga0495678_002302 Ga0495678_002302_10445_11623 391
1264 3300049459 Ga0495678_008849 Ga0495678_008849_2497_3675 391
1265 3300049459 Ga0495678_017479 Ga0495678_017479_1375_2550 391
1266 3300049460 Ga0495682_0001124 Ga0495682_0001124_1261_2436 391
1267 3300049460 Ga0495682_0003033 Ga0495682_0003033_3935_5125 391
1268 3300049460 Ga0495682_0006100 Ga0495682_0006100_3208_4386 391
1269 3300049460 Ga0495682_0009071 Ga0495682_0009071_575_1750 391
1270 3300049460 Ga0495682_0009960 Ga0495682_0009960_1512_2690 391
1271 3300049460 Ga0495682_0015910 Ga0495682_0015910_1448_2626 391
1272 3300049532 Ga0501316_000625 Ga0501316_000625_914_2092 391
1273 3300049532 Ga0501316_001723 Ga0501316_001723_399_1580 391
1274 3300049570 Ga0501033_0002988 Ga0501033_0002988_6028_7203 391
1275 3300049571 Ga0501034_0000730 Ga0501034_0000730_28222_29397 391
1276 3300049572 Ga0501036_0000592 Ga0501036_0000592_10587_11762 391
1277 3300049574 Ga0501038_0000396 Ga0501038_0000396_4503_5678 391
1278 3300049574 Ga0501038_0147246 Ga0501038_0147246_232_1407 391
1279 3300049575 Ga0501039_0015051 Ga0501039_0015051_3230_4405 391
1280 3300049576 Ga0501040_0019336 Ga0501040_0019336_3256_4431 391
1281 3300049576 Ga0501040_0034666 Ga0501040_0034666_1288_2463 391
1282 3300049577 Ga0501041_0000044 Ga0501041_0000044_24262_25437 391
1283 3300049577 Ga0501041_0016520 Ga0501041_0016520_1055_2230 391
1284 3300049579 Ga0501043_0002105 Ga0501043_0002105_2790_3965 391
1285 3300049580 Ga0501046_0000460 Ga0501046_0000460_27988_29163 391
1286 3300049582 Ga0501048_0001330 Ga0501048_0001330_14327_15502 391
1287 3300049584 Ga0501068_0003417 Ga0501068_0003417_4263_5438 391
1288 3300049586 Ga0501070_0007224 Ga0501070_0007224_5571_6746 391
1289 3300049586 Ga0501070_0014537 Ga0501070_0014537_4263_5438 391
1290 3300049587 Ga0501071_0003002 Ga0501071_0003002_1477_2652 391
1291 3300049587 Ga0501071_0003992 Ga0501071_0003992_7503_8678 391
1292 3300049587 Ga0501071_0132397 Ga0501071_0132397_279_1454 391
1293 3300049588 Ga0501072_0003291 Ga0501072_0003291_3621_4796 391
1294 3300049588 Ga0501072_0011956 Ga0501072_0011956_2968_4143 391
1295 3300049588 Ga0501072_0069537 Ga0501072_0069537_1336_2511 391
1296 3300049589 Ga0501073_0009003 Ga0501073_0009003_1924_3099 391
1297 3300049591 Ga0501075_0008691 Ga0501075_0008691_1406_2581 391
1298 3300049591 Ga0501075_0188258 Ga0501075_0188258_386_1561 391
1299 3300049592 Ga0501076_0000973 Ga0501076_0000973_14005_15180 391
1300 3300049593 Ga0501077_0000598 Ga0501077_0000598_18078_19253 391
1301 3300049593 Ga0501077_0075456 Ga0501077_0075456_56_1231 391
1302 3300049667 Ga0501230_000237 Ga0501230_000237_897_2075 391
1303 3300049671 Ga0501238_000615 Ga0501238_000615_479_1657 391
1304 3300049741 Ga0501079_0000184 Ga0501079_0000184_32986_34161 391
1305 3300049741 Ga0501079_0059984 Ga0501079_0059984_1657_2832 391
1306 3300049742 Ga0501080_0001609 Ga0501080_0001609_4727_5902 391
1307 3300049742 Ga0501080_0030734 Ga0501080_0030734_2546_3721 391
1308 3300049742 Ga0501080_0232767 Ga0501080_0232767_296_1471 391
1309 3300049743 Ga0501081_0013380 Ga0501081_0013380_368_1543 391
1310 3300049744 Ga0501083_0106966 Ga0501083_0106966_186_1406 391
1311 3300049766 Ga0501269_000236 Ga0501269_000236_5212_6390 391
1312 3300049775 Ga0501279_000406 Ga0501279_000406_602_1780 391
1313 3300049822 Ga0501035_0000697 Ga0501035_0000697_2092_3267 391
1314 3300049822 Ga0501035_0054360 Ga0501035_0054360_2085_3260 391
1315 3300049823 Ga0501044_0069197 Ga0501044_0069197_1262_2440 391
1316 3300049823 Ga0501044_0178686 Ga0501044_0178686_361_1536 391
1317 3300049823 Ga0501044_0212174 Ga0501044_0212174_482_1657 391
1318 3300049823 Ga0501044_0255494 Ga0501044_0255494_496_1671 391
1319 3300049824 Ga0501045_0043083 Ga0501045_0043083_1644_2819 391
1320 3300049824 Ga0501045_0100336 Ga0501045_0100336_439_1614 391
1321 3300050489 nmdc:mga03683_23551_c1 nmdc:mga03683_23551_c1_276_1451 391
1322 3300050492 nmdc:mga0yw44_52134_c1 nmdc:mga0yw44_52134_c1_1192_2367 391
1323 3300050493 nmdc:mga0k408_113030_c1 nmdc:mga0k408_113030_c1_299_1474 391
1324 3300050494 nmdc:mga06z11_61878_c1 nmdc:mga06z11_61878_c1_666_1841 391
1325 3300050507 nmdc:mga05p37_2303_c1 nmdc:mga05p37_2303_c1_15412_16587 391
1326 3300050507 nmdc:mga05p37_416_c1 nmdc:mga05p37_416_c1_6657_7832 391
1327 3300050508 nmdc:mga09592_1897_c1 nmdc:mga09592_1897_c1_10792_11967 391
1328 3300050508 nmdc:mga09592_778_c1 nmdc:mga09592_778_c1_16950_18125 391
1329 3300050509 nmdc:mga0qj67_163513_c1 nmdc:mga0qj67_163513_c1_452_1627 391
1330 3300050509 nmdc:mga0qj67_3855_c1 nmdc:mga0qj67_3855_c1_5316_6491 391
1331 3300050510 nmdc:mga06r32_24306_c1 nmdc:mga06r32_24306_c1_3654_4829 391
1332 3300050510 nmdc:mga06r32_8862_c1 nmdc:mga06r32_8862_c1_2762_3937 391
1333 3300050511 nmdc:mga08y16_15480_c1 nmdc:mga08y16_15480_c1_6654_7829 391
1334 3300050511 nmdc:mga08y16_6963_c1 nmdc:mga08y16_6963_c1_9213_10388 391
1335 3300050512 nmdc:mga0n895_1134_c1 nmdc:mga0n895_1134_c1_3571_4746 391
1336 3300050512 nmdc:mga0n895_1424_c1 nmdc:mga0n895_1424_c1_3079_4254 391
1337 3300050512 nmdc:mga0n895_29985_c1 nmdc:mga0n895_29985_c1_1987_3162 391
1338 3300050513 nmdc:mga0rr50_4637_c1 nmdc:mga0rr50_4637_c1_503_1678 391
1339 3300050513 nmdc:mga0rr50_7627_c1 nmdc:mga0rr50_7627_c1_1481_2656 391
1340 3300050514 nmdc:mga08x19_12096_c1 nmdc:mga08x19_12096_c1_2081_3256 391
1341 3300050514 nmdc:mga08x19_21639_c1 nmdc:mga08x19_21639_c1_2470_3645 391
1342 3300050514 nmdc:mga08x19_4999_c1 nmdc:mga08x19_4999_c1_4161_5336 391
1343 3300050515 nmdc:mga0a205_672_c1 nmdc:mga0a205_672_c1_16995_18170 391
1344 3300053077 Ga0495601_0003708 Ga0495601_0003708_7018_8193 391
1345 3300053118 Ga0500594_0026979 Ga0500594_0026979_106_1284 391
1346 3300053125 Ga0500618_000207 Ga0500618_000207_42769_43947 391
1347 3300053145 Ga0500586_000121 Ga0500586_000121_1605_2783 391
1348 3300054114 Ga0501084_0003932 Ga0501084_0003932_3558_4733 391
1349 3300054114 Ga0501084_0064163 Ga0501084_0064163_768_1943 391
1350 3300054114 Ga0501084_0154952 Ga0501084_0154952_113_1288 391
1351 3300059421 Ga0590071_014234 Ga0590071_014234_159_1334 391
1352 3300059477 Ga0587084_003334 Ga0587084_003334_181_1356 391
1353 3300059477 Ga0587084_006428 Ga0587084_006428_32_1207 391
1354 3300059491 Ga0587070_007463 Ga0587070_007463_80_1255 391
1355 3300059491 Ga0587070_009644 Ga0587070_009644_38_1216 391
1356 3300059492 Ga0587073_0006579 Ga0587073_0006579_411_1589 391
1357 3300059493 Ga0587077_002988 Ga0587077_002988_718_1893 391
1358 3300059493 Ga0587077_003600 Ga0587077_003600_743_1933 391
1359 3300059504 Ga0587082_003198 Ga0587082_003198_46_1233 391
1360 3300059505 Ga0587083_0005807 Ga0587083_0005807_186_1361 391
1361 3300059506 Ga0587085_006964 Ga0587085_006964_186_1364 391
1362 3300059508 Ga0587088_001835 Ga0587088_001835_861_2036 391
1363 3300059508 Ga0587088_008950 Ga0587088_008950_83_1258 391
1364 3300059508 Ga0587088_011027 Ga0587088_011027_80_1255 391
1365 3300059510 Ga0587090_003028 Ga0587090_003028_347_1525 391
1366 3300059511 Ga0587091_003231 Ga0587091_003231_771_1946 391
1367 3300059511 Ga0587091_009524 Ga0587091_009524_82_1257 391
1368 3300059512 Ga0587092_001738 Ga0587092_001738_905_2080 391
1369 3300059512 Ga0587092_007058 Ga0587092_007058_185_1360 391
1370 3300059623 Ga0587101_001197 Ga0587101_001197_173_1348 391
1371 3300059624 Ga0587109_011379 Ga0587109_011379_181_1356 391
1372 3300059640 Ga0587067_008976 Ga0587067_008976_257_1447 391
1373 3300059641 Ga0587068_001597 Ga0587068_001597_526_1704 391
1374 3300059641 Ga0587068_002278 Ga0587068_002278_344_1519 391
1375 3300059641 Ga0587068_004624 Ga0587068_004624_190_1365 391
1376 3300059641 Ga0587068_007582 Ga0587068_007582_286_1473 391
1377 3300059641 Ga0587068_009042 Ga0587068_009042_97_1275 391
1378 3300059642 Ga0587069_001889 Ga0587069_001889_181_1356 391
1379 3300059643 Ga0587072_010925 Ga0587072_010925_80_1255 391
1380 3300059644 Ga0587075_002218 Ga0587075_002218_799_1974 391
1381 3300059645 Ga0587076_003127 Ga0587076_003127_39_1229 391
1382 3300059645 Ga0587076_003974 Ga0587076_003974_184_1359 391
1383 3300059645 Ga0587076_008300 Ga0587076_008300_190_1365 391
1384 3300059646 Ga0587078_003654 Ga0587078_003654_186_1361 391
1385 3300059647 Ga0587079_002034 Ga0587079_002034_992_2167 391
1386 3300059647 Ga0587079_013310 Ga0587079_013310_82_1257 391
1387 3300059649 Ga0587102_000544 Ga0587102_000544_174_1349 391
1388 3300059660 Ga0587124_002118 Ga0587124_002118_100_1287 391
1389 3300060344 Ga0587071_009860 Ga0587071_009860_84_1259 391
1390 3300060344 Ga0587071_013688 Ga0587071_013688_189_1367 391
1391 3300060346 Ga0587111_0002989 Ga0587111_0002989_922_2097 391
1392 3300060353 Ga0501082_0002475 Ga0501082_0002475_3354_4529 391
1393 3300060353 Ga0501082_0131451 Ga0501082_0131451_208_1383 391
1394 3300060353 Ga0501082_0164433 Ga0501082_0164433_679_1854 391
1395 3300061734 Ga0530510_0004819 Ga0530510_0004819_3827_5002 391

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00108

Thiolase_N

Thiolase, N-terminal domain

1

226

0.99

PF02803

Thiolase_C

Thiolase, C-terminal domain

233

355

0.98

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

3

95

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o9a-assembly1.cif.gz_B crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 0.9886 3 391
4o99-assembly1.cif.gz_B crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 0.9881 3 391
1m3k-assembly1.cif.gz_A biosynthetic thiolase, inactive c89a mutant 0.9877 2 390
1dlu-assembly1.cif.gz_A unliganded biosynthetic thiolase from zoogloea ramigera 0.9875 4 390
7lcl-assembly1.cif.gz_D zoogloea ramigera biosynthetic thiolase q183y mutant 0.9873 3 390
ID Description Score Start End Superfamily
af_Q8CAY6_6_396_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9858 2 391 3.40.47.10
af_P76461_1_264_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9816 1 262 3.40.47.10
af_P9WG69_2_389_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 6 390 3.40.50.720
af_A0A0G2KML7_1_235_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9784 157 391 3.40.47.10
1dluC01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9761 4 272 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A536EAF4-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 0.9919 1 125 GO:0003985
AF-A0A2G1ZV94-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.9) 0.9914 2 118 GO:0003985
AF-A0A6I1HIL2-F1-model_v4 Acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9913 1 391 GO:0003988
AF-A0A6P9B1E3-F1-model_v4 Acetyl-CoA acetyltransferase, cytosolic-like 0.9906 16 120 GO:0016747
AF-M5BJ77-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9905 5 122 GO:0003985
GO:0005739
GO:0006635

Feature Viewer

pLDDT pTM Quality
95.21 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map