F493507
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1380 | 458 | 1380 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10007017|Ga0081455_1000701713 |
| Length | 348 |
| Sequence | VDWIWLSTATAEENREEATMTRGQRITRRHTLGLCGASALSLSFKAHPAIAQAAVLRQGYQTNLWGMPTYYLLRSGALEKHGLKIEEFGVPSGNLTMQQMVARQVDLGTYAGPSFILGHDKGGLVGIAVIAHVGRTTRVMARKDLGLSKIEQLKGLKVANQTGSSVGNIFVDQIAPAAGLKKGDYQEVRMDVNNMVAAMAAKTVDAMVNVEPYNTIAEADGLATTIMDYREVDKMPVFMAATPEFVAKSAEALVAYLKAWLEVAGDFKTQPNKVADTIYSFYAGKGYSMSQDTFRKALATVDVEPGFPSDLQPYLQRHAEVLLKEKKISALPDWSKALRPEFMDKARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 23 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 122 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 123 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 124 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 130 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 253 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 256 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 260 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 262 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 263 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 275 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 281 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 283 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 288 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 297 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 303 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 304 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 305 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 306 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 307 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 382 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 383 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 384 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 385 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 386 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 432 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 449 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 450 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 452 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 457 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.03 |
| Nodule | 0 |
| Rhizoplane | 6.23 |
| Rhizosphere | 91.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_149540 | 2162886006 | Bacteria | 1409 |
| 2 | 2214772980 | 2209111006 | Bacteria | 12584 |
| 3 | ARcpr5oldR_c000026 | 3300000041 | Bacteria | 30226 |
| 4 | ARSoilYngRDRAFT_c00029 | 3300000042 | Bacteria | 22121 |
| 5 | ARcpr5yngRDRAFT_c000044 | 3300000043 | Bacteria | 19945 |
| 6 | ARSoilOldRDRAFT_c000037 | 3300000044 | Bacteria | 30277 |
| 7 | ARCol0yngRDRAFT_1000020 | 3300000652 | Bacteria | 30273 |
| 8 | JGI24747J21853_1003341 | 3300001978 | Bacteria | 1382 |
| 9 | JGI24739J22299_10004550 | 3300001989 | Bacteria | 5302 |
| 10 | JGI24739J22299_10008850 | 3300001989 | Bacteria | 3753 |
| 11 | JGI24737J22298_10001930 | 3300001990 | Bacteria | 7416 |
| 12 | JGI24737J22298_10004430 | 3300001990 | Bacteria | 4894 |
| 13 | JGI24750J21931_1000586 | 3300002070 | Bacteria | 5547 |
| 14 | JGI24750J21931_1004848 | 3300002070 | Bacteria | 1640 |
| 15 | JGI24745J21846_1000864 | 3300002073 | Bacteria | 2808 |
| 16 | JGI24748J21848_1002686 | 3300002074 | Bacteria | 2021 |
| 17 | JGI24738J21930_10002565 | 3300002075 | Bacteria | 4714 |
| 18 | JGI24749J21850_1001223 | 3300002076 | Bacteria | 3648 |
| 19 | JGI24744J21845_10000745 | 3300002077 | Bacteria | 6048 |
| 20 | JGI24033J26618_1004836 | 3300002155 | Bacteria | 1465 |
| 21 | JGI24034J26672_10009358 | 3300002239 | Bacteria | 1443 |
| 22 | JGI24742J22300_10000139 | 3300002244 | Bacteria | 10736 |
| 23 | JGI24742J22300_10013412 | 3300002244 | Bacteria | 1371 |
| 24 | JGI25406J46586_10009736 | 3300003203 | Bacteria | 4295 |
| 25 | JGI25405J52794_10004445 | 3300003911 | Bacteria | 2504 |
| 26 | JGI25405J52794_10030165 | 3300003911 | Bacteria | 1123 |
| 27 | Ga0065717_1002108 | 3300005276 | Bacteria | 2893 |
| 28 | Ga0065716_1001673 | 3300005277 | Bacteria | 4322 |
| 29 | Ga0065704_10089952 | 3300005289 | Bacteria | 2821 |
| 30 | Ga0065704_10118765 | 3300005289 | Bacteria | 1811 |
| 31 | Ga0065712_10026023 | 3300005290 | Bacteria | 1564 |
| 32 | Ga0065712_10071735 | 3300005290 | Bacteria | 5090 |
| 33 | Ga0065712_10077193 | 3300005290 | Bacteria | 3510 |
| 34 | Ga0065712_10079021 | 3300005290 | Bacteria | 3255 |
| 35 | Ga0065712_10109644 | 3300005290 | Bacteria | 1851 |
| 36 | Ga0065715_10092917 | 3300005293 | Bacteria | 4880 |
| 37 | Ga0065715_10094907 | 3300005293 | Bacteria | 4208 |
| 38 | Ga0065715_10113387 | 3300005293 | Bacteria | 2491 |
| 39 | Ga0065707_10015385 | 3300005295 | Bacteria | 1480 |
| 40 | Ga0065707_10113495 | 3300005295 | Bacteria | 2319 |
| 41 | Ga0065707_10126631 | 3300005295 | Bacteria | 1999 |
| 42 | Ga0070658_10087550 | 3300005327 | Bacteria | 2563 |
| 43 | Ga0070676_10001078 | 3300005328 | Bacteria | 13598 |
| 44 | Ga0070676_10054636 | 3300005328 | Bacteria | 2355 |
| 45 | Ga0070676_10122285 | 3300005328 | Bacteria | 1635 |
| 46 | Ga0070683_100007390 | 3300005329 | Bacteria | 9282 |
| 47 | Ga0070683_100131327 | 3300005329 | Bacteria | 2370 |
| 48 | Ga0070683_100290541 | 3300005329 | Bacteria | 1555 |
| 49 | Ga0070690_100020059 | 3300005330 | Bacteria | 4068 |
| 50 | Ga0070690_100023267 | 3300005330 | Bacteria | 3798 |
| 51 | Ga0070690_100052599 | 3300005330 | Bacteria | 2604 |
| 52 | Ga0070690_100080239 | 3300005330 | Bacteria | 2134 |
| 53 | Ga0070690_100115033 | 3300005330 | Bacteria | 1799 |
| 54 | Ga0070670_100037546 | 3300005331 | Bacteria | 4168 |
| 55 | Ga0070670_100211992 | 3300005331 | Unclassified | 1684 |
| 56 | Ga0070670_100249424 | 3300005331 | Bacteria | 1546 |
| 57 | Ga0070677_10000009 | 3300005333 | Bacteria | 65648 |
| 58 | Ga0068869_100023901 | 3300005334 | Bacteria | 4228 |
| 59 | Ga0068869_100062092 | 3300005334 | Bacteria | 2742 |
| 60 | Ga0068869_100181230 | 3300005334 | Unclassified | 1651 |
| 61 | Ga0070666_10087321 | 3300005335 | Bacteria | 2137 |
| 62 | Ga0070666_10257883 | 3300005335 | Bacteria | 1235 |
| 63 | Ga0070680_100004715 | 3300005336 | Bacteria | 10260 |
| 64 | Ga0070680_100069756 | 3300005336 | Bacteria | 2886 |
| 65 | Ga0070680_100081718 | 3300005336 | Bacteria | 2666 |
| 66 | Ga0070680_100412129 | 3300005336 | Bacteria | 1152 |
| 67 | Ga0070682_100001091 | 3300005337 | Bacteria | 15614 |
| 68 | Ga0070682_100049089 | 3300005337 | Bacteria | 2630 |
| 69 | Ga0070682_100127156 | 3300005337 | Bacteria | 1719 |
| 70 | Ga0068868_100037790 | 3300005338 | Bacteria | 3744 |
| 71 | Ga0068868_100239938 | 3300005338 | Bacteria | 1522 |
| 72 | Ga0068868_100261789 | 3300005338 | Bacteria | 1459 |
| 73 | Ga0070660_100001398 | 3300005339 | Bacteria | 16443 |
| 74 | Ga0070660_100144322 | 3300005339 | Bacteria | 1911 |
| 75 | Ga0070660_100196169 | 3300005339 | Bacteria | 1637 |
| 76 | Ga0070660_100231278 | 3300005339 | Bacteria | 1504 |
| 77 | Ga0070689_100008504 | 3300005340 | Bacteria | 7234 |
| 78 | Ga0070689_100044808 | 3300005340 | Bacteria | 3404 |
| 79 | Ga0070689_100063151 | 3300005340 | Bacteria | 2882 |
| 80 | Ga0070689_100086925 | 3300005340 | Bacteria | 2459 |
| 81 | Ga0070691_10000769 | 3300005341 | Bacteria | 12720 |
| 82 | Ga0070691_10002420 | 3300005341 | Bacteria | 8280 |
| 83 | Ga0070687_100000649 | 3300005343 | Bacteria | 11529 |
| 84 | Ga0070687_100071219 | 3300005343 | Bacteria | 1867 |
| 85 | Ga0070687_100094904 | 3300005343 | Bacteria | 1657 |
| 86 | Ga0070687_100119767 | 3300005343 | Bacteria | 1503 |
| 87 | Ga0070661_100001076 | 3300005344 | Bacteria | 19335 |
| 88 | Ga0070661_100289923 | 3300005344 | Bacteria | 1271 |
| 89 | Ga0070692_10015532 | 3300005345 | Bacteria | 3603 |
| 90 | Ga0070668_100012317 | 3300005347 | Bacteria | 6370 |
| 91 | Ga0070669_100005888 | 3300005353 | Bacteria | 8845 |
| 92 | Ga0070669_100042372 | 3300005353 | Bacteria | 3312 |
| 93 | Ga0070669_100271323 | 3300005353 | Bacteria | 1357 |
| 94 | Ga0070675_100000727 | 3300005354 | Bacteria | 22927 |
| 95 | Ga0070675_100102688 | 3300005354 | Bacteria | 2409 |
| 96 | Ga0070671_100000438 | 3300005355 | Bacteria | 28920 |
| 97 | Ga0070674_100001976 | 3300005356 | Bacteria | 11215 |
| 98 | Ga0070673_100001186 | 3300005364 | Bacteria | 14992 |
| 99 | Ga0070673_100291181 | 3300005364 | Bacteria | 1435 |
| 100 | Ga0070688_100022325 | 3300005365 | Bacteria | 3706 |
| 101 | Ga0070688_100060450 | 3300005365 | Bacteria | 2392 |
| 102 | Ga0070688_100075351 | 3300005365 | Bacteria | 2168 |
| 103 | Ga0070688_100203341 | 3300005365 | Bacteria | 1387 |
| 104 | Ga0070688_100320875 | 3300005365 | Bacteria | 1125 |
| 105 | Ga0070659_100005874 | 3300005366 | Bacteria | 8843 |
| 106 | Ga0070659_100019477 | 3300005366 | Bacteria | 5143 |
| 107 | Ga0070659_100058285 | 3300005366 | Bacteria | 3048 |
| 108 | Ga0070667_100005963 | 3300005367 | Bacteria | 10128 |
| 109 | Ga0070667_100128914 | 3300005367 | Bacteria | 2206 |
| 110 | Ga0070667_100199136 | 3300005367 | Bacteria | 1777 |
| 111 | Ga0070703_10002528 | 3300005406 | Bacteria | 5263 |
| 112 | Ga0070709_10107117 | 3300005434 | Bacteria | 1872 |
| 113 | Ga0070709_10112306 | 3300005434 | Bacteria | 1833 |
| 114 | Ga0070714_100036372 | 3300005435 | Bacteria | 4129 |
| 115 | Ga0070714_100055527 | 3300005435 | Bacteria | 3385 |
| 116 | Ga0070714_100137127 | 3300005435 | Bacteria | 2192 |
| 117 | Ga0070714_100502951 | 3300005435 | Bacteria | 1156 |
| 118 | Ga0070713_100005553 | 3300005436 | Bacteria | 8640 |
| 119 | Ga0070713_100015791 | 3300005436 | Bacteria | 5658 |
| 120 | Ga0070713_100028859 | 3300005436 | Bacteria | 4385 |
| 121 | Ga0070713_100064124 | 3300005436 | Bacteria | 3082 |
| 122 | Ga0070713_100174721 | 3300005436 | Bacteria | 1927 |
| 123 | Ga0070710_10010566 | 3300005437 | Bacteria | 4538 |
| 124 | Ga0070710_10204869 | 3300005437 | Bacteria | 1247 |
| 125 | Ga0070701_10000339 | 3300005438 | Bacteria | 15527 |
| 126 | Ga0070701_10037392 | 3300005438 | Bacteria | 2450 |
| 127 | Ga0070701_10054327 | 3300005438 | Bacteria | 2088 |
| 128 | Ga0070701_10095736 | 3300005438 | Bacteria | 1635 |
| 129 | Ga0070701_10146773 | 3300005438 | Bacteria | 1354 |
| 130 | Ga0070701_10203237 | 3300005438 | Bacteria | 1172 |
| 131 | Ga0070711_100027442 | 3300005439 | Bacteria | 3738 |
| 132 | Ga0070711_100073831 | 3300005439 | Bacteria | 2411 |
| 133 | Ga0070711_100199809 | 3300005439 | Bacteria | 1542 |
| 134 | Ga0070711_100253768 | 3300005439 | Bacteria | 1381 |
| 135 | Ga0070705_100000010 | 3300005440 | Bacteria | 102079 |
| 136 | Ga0070705_100005352 | 3300005440 | Bacteria | 6249 |
| 137 | Ga0070700_100000783 | 3300005441 | Bacteria | 15666 |
| 138 | Ga0070700_100022570 | 3300005441 | Bacteria | 3672 |
| 139 | Ga0070700_100036344 | 3300005441 | Bacteria | 2987 |
| 140 | Ga0070694_100006633 | 3300005444 | Bacteria | 7034 |
| 141 | Ga0070694_100120006 | 3300005444 | Bacteria | 1885 |
| 142 | Ga0070694_100268004 | 3300005444 | Bacteria | 1298 |
| 143 | Ga0070708_100466820 | 3300005445 | Bacteria | 1191 |
| 144 | Ga0070708_100544493 | 3300005445 | Bacteria | 1095 |
| 145 | Ga0070663_100006904 | 3300005455 | Bacteria | 6875 |
| 146 | Ga0070663_100017471 | 3300005455 | Bacteria | 4682 |
| 147 | Ga0070663_100025858 | 3300005455 | Bacteria | 3968 |
| 148 | Ga0070663_100028384 | 3300005455 | Bacteria | 3810 |
| 149 | Ga0070663_100033005 | 3300005455 | Bacteria | 3573 |
| 150 | Ga0070663_100039036 | 3300005455 | Bacteria | 3316 |
| 151 | Ga0070663_100284134 | 3300005455 | Bacteria | 1319 |
| 152 | Ga0070678_100011564 | 3300005456 | Bacteria | 5451 |
| 153 | Ga0070678_100092572 | 3300005456 | Bacteria | 2323 |
| 154 | Ga0070678_100237424 | 3300005456 | Bacteria | 1522 |
| 155 | Ga0070678_100248890 | 3300005456 | Bacteria | 1489 |
| 156 | Ga0070662_100017941 | 3300005457 | Bacteria | 4778 |
| 157 | Ga0070662_100103866 | 3300005457 | Bacteria | 2155 |
| 158 | Ga0070681_10070525 | 3300005458 | Bacteria | 3460 |
| 159 | Ga0070681_10081473 | 3300005458 | Bacteria | 3192 |
| 160 | Ga0070681_10222552 | 3300005458 | Bacteria | 1802 |
| 161 | Ga0070681_10245025 | 3300005458 | Bacteria | 1705 |
| 162 | Ga0068867_100021953 | 3300005459 | Bacteria | 4559 |
| 163 | Ga0068867_100363538 | 3300005459 | Bacteria | 1211 |
| 164 | Ga0068867_100434058 | 3300005459 | Bacteria | 1115 |
| 165 | Ga0070685_10005962 | 3300005466 | Bacteria | 6203 |
| 166 | Ga0070685_10022940 | 3300005466 | Bacteria | 3410 |
| 167 | Ga0070685_10023443 | 3300005466 | Bacteria | 3380 |
| 168 | Ga0070685_10097760 | 3300005466 | Bacteria | 1788 |
| 169 | Ga0070707_100160119 | 3300005468 | Bacteria | 2193 |
| 170 | Ga0070698_100079534 | 3300005471 | Bacteria | 3275 |
| 171 | Ga0070699_100001314 | 3300005518 | Bacteria | 22902 |
| 172 | Ga0070679_100009564 | 3300005530 | Bacteria | 9168 |
| 173 | Ga0070679_100021002 | 3300005530 | Bacteria | 6371 |
| 174 | Ga0070679_100050983 | 3300005530 | Bacteria | 4122 |
| 175 | Ga0070679_100127315 | 3300005530 | Bacteria | 2528 |
| 176 | Ga0070679_100134755 | 3300005530 | Bacteria | 2451 |
| 177 | Ga0070684_100031662 | 3300005535 | Bacteria | 4505 |
| 178 | Ga0070684_100034741 | 3300005535 | Bacteria | 4312 |
| 179 | Ga0070684_100161110 | 3300005535 | Bacteria | 2035 |
| 180 | Ga0070697_100039300 | 3300005536 | Bacteria | 3825 |
| 181 | Ga0070697_100201176 | 3300005536 | Bacteria | 1693 |
| 182 | Ga0068853_100004375 | 3300005539 | Bacteria | 10933 |
| 183 | Ga0068853_100594483 | 3300005539 | Bacteria | 1051 |
| 184 | Ga0070672_100011149 | 3300005543 | Bacteria | 6259 |
| 185 | Ga0070672_100022463 | 3300005543 | Bacteria | 4635 |
| 186 | Ga0070686_100006762 | 3300005544 | Bacteria | 6383 |
| 187 | Ga0070686_100028126 | 3300005544 | Bacteria | 3407 |
| 188 | Ga0070695_100001719 | 3300005545 | Bacteria | 12317 |
| 189 | Ga0070695_100012898 | 3300005545 | Bacteria | 5017 |
| 190 | Ga0070695_100110603 | 3300005545 | Bacteria | 1863 |
| 191 | Ga0070695_100152637 | 3300005545 | Bacteria | 1613 |
| 192 | Ga0070696_100002812 | 3300005546 | Bacteria | 11557 |
| 193 | Ga0070696_100029222 | 3300005546 | Bacteria | 3766 |
| 194 | Ga0070696_100045814 | 3300005546 | Bacteria | 3031 |
| 195 | Ga0070696_100127308 | 3300005546 | Bacteria | 1849 |
| 196 | Ga0070693_100000577 | 3300005547 | Bacteria | 16215 |
| 197 | Ga0070693_100010134 | 3300005547 | Bacteria | 4709 |
| 198 | Ga0070693_100023786 | 3300005547 | Bacteria | 3279 |
| 199 | Ga0070693_100122989 | 3300005547 | Bacteria | 1612 |
| 200 | Ga0070693_100236167 | 3300005547 | Bacteria | 1205 |
| 201 | Ga0070665_100072419 | 3300005548 | Bacteria | 3454 |
| 202 | Ga0070665_100240155 | 3300005548 | Bacteria | 1812 |
| 203 | Ga0070704_100008088 | 3300005549 | Bacteria | 6283 |
| 204 | Ga0070704_100013846 | 3300005549 | Bacteria | 5022 |
| 205 | Ga0070704_100028556 | 3300005549 | Bacteria | 3713 |
| 206 | Ga0070704_100126371 | 3300005549 | Bacteria | 1974 |
| 207 | Ga0070704_100303866 | 3300005549 | Bacteria | 1330 |
| 208 | Ga0070704_100314933 | 3300005549 | Bacteria | 1309 |
| 209 | Ga0068855_100014148 | 3300005563 | Bacteria | 9611 |
| 210 | Ga0068855_100021980 | 3300005563 | Bacteria | 7648 |
| 211 | Ga0068855_100031300 | 3300005563 | Bacteria | 6354 |
| 212 | Ga0068855_100185531 | 3300005563 | Bacteria | 2349 |
| 213 | Ga0068855_100437051 | 3300005563 | Bacteria | 1430 |
| 214 | Ga0070664_100002073 | 3300005564 | Bacteria | 16008 |
| 215 | Ga0070664_100070153 | 3300005564 | Bacteria | 3000 |
| 216 | Ga0070664_100145517 | 3300005564 | Bacteria | 2089 |
| 217 | Ga0070664_100284498 | 3300005564 | Bacteria | 1492 |
| 218 | Ga0070664_100424861 | 3300005564 | Bacteria | 1218 |
| 219 | Ga0068857_100008536 | 3300005577 | Bacteria | 8859 |
| 220 | Ga0068857_100011549 | 3300005577 | Bacteria | 7685 |
| 221 | Ga0068857_100101644 | 3300005577 | Bacteria | 2580 |
| 222 | Ga0068857_100313354 | 3300005577 | Bacteria | 1448 |
| 223 | Ga0068854_100153463 | 3300005578 | Bacteria | 1778 |
| 224 | Ga0068856_100271248 | 3300005614 | Bacteria | 1713 |
| 225 | Ga0068856_100506165 | 3300005614 | Bacteria | 1229 |
| 226 | Ga0068856_100578229 | 3300005614 | Bacteria | 1144 |
| 227 | Ga0070702_100005245 | 3300005615 | Bacteria | 6011 |
| 228 | Ga0070702_100023173 | 3300005615 | Bacteria | 3295 |
| 229 | Ga0068852_100001086 | 3300005616 | Bacteria | 17979 |
| 230 | Ga0068852_100054483 | 3300005616 | Bacteria | 3447 |
| 231 | Ga0068852_100089360 | 3300005616 | Bacteria | 2753 |
| 232 | Ga0068859_100023234 | 3300005617 | Bacteria | 6221 |
| 233 | Ga0068859_100047095 | 3300005617 | Bacteria | 4331 |
| 234 | Ga0068859_100087792 | 3300005617 | Bacteria | 3159 |
| 235 | Ga0068859_100104533 | 3300005617 | Bacteria | 2891 |
| 236 | Ga0068859_100231880 | 3300005617 | Bacteria | 1935 |
| 237 | Ga0068859_100259579 | 3300005617 | Bacteria | 1828 |
| 238 | Ga0068859_100307236 | 3300005617 | Bacteria | 1679 |
| 239 | Ga0068864_100017473 | 3300005618 | Bacteria | 5980 |
| 240 | Ga0068864_100021486 | 3300005618 | Bacteria | 5408 |
| 241 | Ga0068864_100025772 | 3300005618 | Bacteria | 4956 |
| 242 | Ga0068864_100053465 | 3300005618 | Bacteria | 3484 |
| 243 | Ga0068864_100138872 | 3300005618 | Bacteria | 2190 |
| 244 | Ga0068864_100444139 | 3300005618 | Bacteria | 1239 |
| 245 | Ga0068866_10000403 | 3300005718 | Bacteria | 20138 |
| 246 | Ga0068866_10020659 | 3300005718 | Bacteria | 3020 |
| 247 | Ga0068861_100001047 | 3300005719 | Bacteria | 16998 |
| 248 | Ga0068861_100201519 | 3300005719 | Bacteria | 1671 |
| 249 | Ga0068870_10000860 | 3300005840 | Bacteria | 11868 |
| 250 | Ga0068870_10018357 | 3300005840 | Bacteria | 3376 |
| 251 | Ga0068863_100003728 | 3300005841 | Bacteria | 15069 |
| 252 | Ga0068863_100046330 | 3300005841 | Bacteria | 4126 |
| 253 | Ga0068863_100107195 | 3300005841 | Bacteria | 2658 |
| 254 | Ga0068858_100032605 | 3300005842 | Bacteria | 4837 |
| 255 | Ga0068858_100051742 | 3300005842 | Bacteria | 3800 |
| 256 | Ga0068858_100098651 | 3300005842 | Bacteria | 2723 |
| 257 | Ga0068858_100173525 | 3300005842 | Bacteria | 2034 |
| 258 | Ga0068858_100283910 | 3300005842 | Bacteria | 1576 |
| 259 | Ga0068860_100013440 | 3300005843 | Bacteria | 8028 |
| 260 | Ga0068860_100023327 | 3300005843 | Bacteria | 5980 |
| 261 | Ga0068860_100036747 | 3300005843 | Bacteria | 4690 |
| 262 | Ga0068860_100038963 | 3300005843 | Bacteria | 4546 |
| 263 | Ga0068862_100003043 | 3300005844 | Bacteria | 14604 |
| 264 | Ga0068862_100024080 | 3300005844 | Bacteria | 5105 |
| 265 | Ga0068862_100041039 | 3300005844 | Bacteria | 3936 |
| 266 | Ga0068862_100068170 | 3300005844 | Bacteria | 3068 |
| 267 | Ga0068862_100256818 | 3300005844 | Bacteria | 1594 |
| 268 | Ga0081455_10000012 | 3300005937 | Bacteria | 201668 |
| 269 | Ga0081455_10003284 | 3300005937 | Bacteria | 18715 |
| 270 | Ga0081455_10007017 | 3300005937 | Bacteria | 11967 |
| 271 | Ga0081455_10016936 | 3300005937 | Bacteria | 7006 |
| 272 | Ga0081455_10018308 | 3300005937 | Bacteria | 6677 |
| 273 | Ga0081455_10048782 | 3300005937 | Bacteria | 3655 |
| 274 | Ga0081538_10018338 | 3300005981 | Bacteria | 5260 |
| 275 | Ga0081538_10059042 | 3300005981 | Bacteria | 2219 |
| 276 | Ga0081540_1000185 | 3300005983 | Bacteria | 64858 |
| 277 | Ga0081540_1002413 | 3300005983 | Bacteria | 15223 |
| 278 | Ga0081540_1011112 | 3300005983 | Bacteria | 6044 |
| 279 | Ga0081540_1048822 | 3300005983 | Bacteria | 2116 |
| 280 | Ga0081539_10008542 | 3300005985 | Bacteria | 8868 |
| 281 | Ga0081539_10023001 | 3300005985 | Bacteria | 4097 |
| 282 | Ga0070717_10007114 | 3300006028 | Bacteria | 8292 |
| 283 | Ga0070717_10010759 | 3300006028 | Bacteria | 6925 |
| 284 | Ga0070717_10279432 | 3300006028 | Bacteria | 1481 |
| 285 | Ga0075365_10041913 | 3300006038 | Bacteria | 2991 |
| 286 | Ga0075363_100064023 | 3300006048 | Bacteria | 1986 |
| 287 | Ga0075364_10289916 | 3300006051 | Bacteria | 1114 |
| 288 | Ga0075432_10001490 | 3300006058 | Bacteria | 7644 |
| 289 | Ga0070715_10015144 | 3300006163 | Bacteria | 2870 |
| 290 | Ga0070715_10043536 | 3300006163 | Bacteria | 1893 |
| 291 | Ga0070715_10051397 | 3300006163 | Bacteria | 1773 |
| 292 | Ga0070715_10100637 | 3300006163 | Bacteria | 1347 |
| 293 | Ga0070716_100012292 | 3300006173 | Bacteria | 4336 |
| 294 | Ga0070716_100048777 | 3300006173 | Bacteria | 2396 |
| 295 | Ga0070716_100107036 | 3300006173 | Bacteria | 1726 |
| 296 | Ga0070712_100172611 | 3300006175 | Bacteria | 1679 |
| 297 | Ga0070712_100279375 | 3300006175 | Bacteria | 1344 |
| 298 | Ga0075362_10000839 | 3300006177 | Bacteria | 9234 |
| 299 | Ga0075362_10042644 | 3300006177 | Bacteria | 2006 |
| 300 | Ga0075367_10103410 | 3300006178 | Bacteria | 1743 |
| 301 | Ga0075427_10001112 | 3300006194 | Bacteria | 3382 |
| 302 | Ga0075366_10001687 | 3300006195 | Bacteria | 11092 |
| 303 | Ga0075366_10210171 | 3300006195 | Bacteria | 1184 |
| 304 | Ga0097621_100000421 | 3300006237 | Bacteria | 29460 |
| 305 | Ga0097621_100008029 | 3300006237 | Bacteria | 7577 |
| 306 | Ga0097621_100043497 | 3300006237 | Bacteria | 3621 |
| 307 | Ga0097621_100081579 | 3300006237 | Bacteria | 2692 |
| 308 | Ga0068871_100000515 | 3300006358 | Bacteria | 26586 |
| 309 | Ga0068871_100012948 | 3300006358 | Bacteria | 6177 |
| 310 | Ga0068871_100109481 | 3300006358 | Bacteria | 2322 |
| 311 | Ga0075428_100007282 | 3300006844 | Bacteria | 12256 |
| 312 | Ga0075428_100013216 | 3300006844 | Bacteria | 9185 |
| 313 | Ga0075428_100124513 | 3300006844 | Bacteria | 2805 |
| 314 | Ga0075428_100124758 | 3300006844 | Bacteria | 2803 |
| 315 | Ga0075428_100138610 | 3300006844 | Bacteria | 2645 |
| 316 | Ga0075428_100280433 | 3300006844 | Bacteria | 1793 |
| 317 | Ga0075428_100377007 | 3300006844 | Bacteria | 1521 |
| 318 | Ga0075430_100021979 | 3300006846 | Bacteria | 5422 |
| 319 | Ga0075430_100026411 | 3300006846 | Bacteria | 4941 |
| 320 | Ga0075430_100028858 | 3300006846 | Bacteria | 4711 |
| 321 | Ga0075430_100085576 | 3300006846 | Bacteria | 2639 |
| 322 | Ga0075431_100001810 | 3300006847 | Bacteria | 20184 |
| 323 | Ga0075431_100002413 | 3300006847 | Bacteria | 17988 |
| 324 | Ga0075431_100003540 | 3300006847 | Bacteria | 15121 |
| 325 | Ga0075431_100072177 | 3300006847 | Bacteria | 3562 |
| 326 | Ga0075431_100082800 | 3300006847 | Bacteria | 3312 |
| 327 | Ga0075431_100109344 | 3300006847 | Unclassified | 2853 |
| 328 | Ga0075431_100143787 | 3300006847 | Bacteria | 2458 |
| 329 | Ga0075433_10002034 | 3300006852 | Bacteria | 15272 |
| 330 | Ga0075433_10006137 | 3300006852 | Bacteria | 9468 |
| 331 | Ga0075433_10008633 | 3300006852 | Bacteria | 8131 |
| 332 | Ga0075433_10036232 | 3300006852 | Bacteria | 4248 |
| 333 | Ga0075433_10097947 | 3300006852 | Bacteria | 2596 |
| 334 | Ga0075433_10149589 | 3300006852 | Bacteria | 2077 |
| 335 | Ga0075433_10203189 | 3300006852 | Bacteria | 1761 |
| 336 | Ga0075433_10218749 | 3300006852 | Bacteria | 1692 |
| 337 | Ga0075434_100000007 | 3300006871 | Bacteria | 95975 |
| 338 | Ga0075434_100000693 | 3300006871 | Bacteria | 26314 |
| 339 | Ga0075434_100001159 | 3300006871 | Bacteria | 21806 |
| 340 | Ga0075434_100005025 | 3300006871 | Bacteria | 12006 |
| 341 | Ga0075434_100038594 | 3300006871 | Bacteria | 4730 |
| 342 | Ga0075434_100082088 | 3300006871 | Bacteria | 3221 |
| 343 | Ga0075434_100096480 | 3300006871 | Bacteria | 2961 |
| 344 | Ga0075434_100171810 | 3300006871 | Bacteria | 2187 |
| 345 | Ga0075434_100215803 | 3300006871 | Bacteria | 1939 |
| 346 | Ga0075434_100260622 | 3300006871 | Bacteria | 1753 |
| 347 | Ga0075434_100313884 | 3300006871 | Bacteria | 1588 |
| 348 | Ga0075429_100004783 | 3300006880 | Bacteria | 11659 |
| 349 | Ga0075429_100006663 | 3300006880 | Bacteria | 10011 |
| 350 | Ga0075429_100026387 | 3300006880 | Bacteria | 5044 |
| 351 | Ga0075429_100119201 | 3300006880 | Bacteria | 2306 |
| 352 | Ga0075429_100128342 | 3300006880 | Bacteria | 2218 |
| 353 | Ga0075429_100430059 | 3300006880 | Unclassified | 1156 |
| 354 | Ga0068865_100002115 | 3300006881 | Bacteria | 11728 |
| 355 | Ga0068865_100156928 | 3300006881 | Bacteria | 1732 |
| 356 | Ga0075436_100002192 | 3300006914 | Bacteria | 13473 |
| 357 | Ga0075436_100037473 | 3300006914 | Bacteria | 3348 |
| 358 | Ga0075436_100167778 | 3300006914 | Bacteria | 1549 |
| 359 | Ga0075436_100226373 | 3300006914 | Bacteria | 1328 |
| 360 | Ga0097620_100023234 | 3300006931 | Bacteria | 6221 |
| 361 | Ga0097620_100047094 | 3300006931 | Bacteria | 4331 |
| 362 | Ga0097620_100087787 | 3300006931 | Bacteria | 3159 |
| 363 | Ga0097620_100104537 | 3300006931 | Bacteria | 2891 |
| 364 | Ga0097620_100231869 | 3300006931 | Bacteria | 1935 |
| 365 | Ga0097620_100259577 | 3300006931 | Bacteria | 1828 |
| 366 | Ga0097620_100307236 | 3300006931 | Bacteria | 1679 |
| 367 | Ga0075435_100000432 | 3300007076 | Bacteria | 25629 |
| 368 | Ga0075435_100025823 | 3300007076 | Bacteria | 4577 |
| 369 | Ga0075435_100026492 | 3300007076 | Bacteria | 4524 |
| 370 | Ga0075435_100049630 | 3300007076 | Bacteria | 3375 |
| 371 | Ga0075435_100150894 | 3300007076 | Bacteria | 1954 |
| 372 | Ga0075435_100172380 | 3300007076 | Bacteria | 1826 |
| 373 | Ga0099794_10058103 | 3300007265 | Bacteria | 1875 |
| 374 | Ga0099795_10011526 | 3300007788 | Bacteria | 2646 |
| 375 | Ga0099795_10018796 | 3300007788 | Bacteria | 2227 |
| 376 | Ga0105251_10040087 | 3300009011 | Bacteria | 2284 |
| 377 | Ga0105251_10053918 | 3300009011 | Bacteria | 1911 |
| 378 | Ga0105244_10161476 | 3300009036 | Bacteria | 1070 |
| 379 | Ga0105240_10037315 | 3300009093 | Bacteria | 6246 |
| 380 | Ga0105240_10154042 | 3300009093 | Bacteria | 2735 |
| 381 | Ga0111539_10004448 | 3300009094 | Bacteria | 18316 |
| 382 | Ga0111539_10005607 | 3300009094 | Bacteria | 16233 |
| 383 | Ga0111539_10013539 | 3300009094 | Bacteria | 10195 |
| 384 | Ga0111539_10017591 | 3300009094 | Bacteria | 8846 |
| 385 | Ga0111539_10019998 | 3300009094 | Bacteria | 8247 |
| 386 | Ga0111539_10022696 | 3300009094 | Bacteria | 7708 |
| 387 | Ga0111539_10029537 | 3300009094 | Bacteria | 6675 |
| 388 | Ga0111539_10146086 | 3300009094 | Bacteria | 2769 |
| 389 | Ga0111539_10279279 | 3300009094 | Unclassified | 1943 |
| 390 | Ga0111539_10420466 | 3300009094 | Bacteria | 1557 |
| 391 | Ga0111539_10512699 | 3300009094 | Bacteria | 1397 |
| 392 | Ga0111539_10572289 | 3300009094 | Bacteria | 1316 |
| 393 | Ga0111539_10722476 | 3300009094 | Unclassified | 1159 |
| 394 | Ga0105245_10029148 | 3300009098 | Bacteria | 4874 |
| 395 | Ga0105245_10131013 | 3300009098 | Bacteria | 2352 |
| 396 | Ga0105245_10145527 | 3300009098 | Bacteria | 2236 |
| 397 | Ga0105245_10265153 | 3300009098 | Bacteria | 1673 |
| 398 | Ga0105247_10012837 | 3300009101 | Bacteria | 5028 |
| 399 | Ga0105247_10013130 | 3300009101 | Bacteria | 4968 |
| 400 | Ga0114129_10000742 | 3300009147 | Bacteria | 41451 |
| 401 | Ga0114129_10059035 | 3300009147 | Bacteria | 5364 |
| 402 | Ga0114129_10065278 | 3300009147 | Bacteria | 5080 |
| 403 | Ga0114129_10105879 | 3300009147 | Bacteria | 3886 |
| 404 | Ga0114129_10179865 | 3300009147 | Bacteria | 2878 |
| 405 | Ga0114129_10212542 | 3300009147 | Bacteria | 2614 |
| 406 | Ga0114129_10293458 | 3300009147 | Bacteria | 2169 |
| 407 | Ga0114129_10643719 | 3300009147 | Bacteria | 1369 |
| 408 | Ga0105243_10002574 | 3300009148 | Bacteria | 15152 |
| 409 | Ga0105243_10011951 | 3300009148 | Bacteria | 6563 |
| 410 | Ga0105241_10111008 | 3300009174 | Bacteria | 2194 |
| 411 | Ga0105241_10244434 | 3300009174 | Bacteria | 1518 |
| 412 | Ga0105241_10299267 | 3300009174 | Bacteria | 1380 |
| 413 | Ga0105242_10004599 | 3300009176 | Bacteria | 10698 |
| 414 | Ga0105242_10110869 | 3300009176 | Bacteria | 2339 |
| 415 | Ga0105248_10000821 | 3300009177 | Bacteria | 34849 |
| 416 | Ga0105248_10076409 | 3300009177 | Bacteria | 3764 |
| 417 | Ga0105248_10084997 | 3300009177 | Bacteria | 3561 |
| 418 | Ga0105248_10121013 | 3300009177 | Bacteria | 2953 |
| 419 | Ga0105237_10042956 | 3300009545 | Bacteria | 4556 |
| 420 | Ga0105237_10128596 | 3300009545 | Bacteria | 2527 |
| 421 | Ga0105237_10298174 | 3300009545 | Bacteria | 1615 |
| 422 | Ga0105237_10364152 | 3300009545 | Bacteria | 1450 |
| 423 | Ga0105238_10009936 | 3300009551 | Bacteria | 9542 |
| 424 | Ga0105238_10011216 | 3300009551 | Bacteria | 9016 |
| 425 | Ga0105238_10226060 | 3300009551 | Bacteria | 1848 |
| 426 | Ga0105238_10272723 | 3300009551 | Bacteria | 1672 |
| 427 | Ga0105249_10015879 | 3300009553 | Bacteria | 6674 |
| 428 | Ga0105249_10017602 | 3300009553 | Bacteria | 6345 |
| 429 | Ga0105249_10084737 | 3300009553 | Bacteria | 2952 |
| 430 | Ga0105249_10197852 | 3300009553 | Bacteria | 1965 |
| 431 | Ga0105249_10510758 | 3300009553 | Bacteria | 1248 |
| 432 | Ga0105239_10004537 | 3300010375 | Bacteria | 16545 |
| 433 | Ga0105239_10196874 | 3300010375 | Bacteria | 2257 |
| 434 | Ga0105239_10286295 | 3300010375 | Bacteria | 1855 |
| 435 | Ga0105239_10446827 | 3300010375 | Bacteria | 1466 |
| 436 | Ga0105246_10001092 | 3300011119 | Bacteria | 15711 |
| 437 | Ga0105246_10097849 | 3300011119 | Bacteria | 2130 |
| 438 | Ga0157335_1001950 | 3300012492 | Unclassified | 1192 |
| 439 | Ga0157371_10007315 | 3300013102 | Bacteria | 8965 |
| 440 | Ga0157370_10056317 | 3300013104 | Bacteria | 3742 |
| 441 | Ga0157370_10241917 | 3300013104 | Bacteria | 1669 |
| 442 | Ga0157374_10002049 | 3300013296 | Bacteria | 16945 |
| 443 | Ga0157374_10032857 | 3300013296 | Bacteria | 4729 |
| 444 | Ga0157374_10427440 | 3300013296 | Bacteria | 1324 |
| 445 | Ga0157378_10007541 | 3300013297 | Bacteria | 9498 |
| 446 | Ga0163162_10005029 | 3300013306 | Bacteria | 12738 |
| 447 | Ga0163162_10046419 | 3300013306 | Bacteria | 4354 |
| 448 | Ga0163162_10343621 | 3300013306 | Bacteria | 1625 |
| 449 | Ga0163162_10517261 | 3300013306 | Bacteria | 1323 |
| 450 | Ga0157372_10012748 | 3300013307 | Bacteria | 8955 |
| 451 | Ga0157372_10362354 | 3300013307 | Bacteria | 1689 |
| 452 | Ga0157375_10005227 | 3300013308 | Bacteria | 11266 |
| 453 | Ga0157375_10019784 | 3300013308 | Bacteria | 6134 |
| 454 | Ga0163163_10005574 | 3300014325 | Bacteria | 10905 |
| 455 | Ga0163163_10049189 | 3300014325 | Bacteria | 4148 |
| 456 | Ga0163163_10057095 | 3300014325 | Bacteria | 3859 |
| 457 | Ga0163163_10065275 | 3300014325 | Bacteria | 3613 |
| 458 | Ga0163163_10178827 | 3300014325 | Bacteria | 2168 |
| 459 | Ga0163163_10384246 | 3300014325 | Bacteria | 1461 |
| 460 | Ga0157380_10001279 | 3300014326 | Bacteria | 16357 |
| 461 | Ga0157380_10057392 | 3300014326 | Bacteria | 3100 |
| 462 | Ga0157377_10000312 | 3300014745 | Bacteria | 22340 |
| 463 | Ga0157379_10001989 | 3300014968 | Bacteria | 16918 |
| 464 | Ga0157379_10063884 | 3300014968 | Bacteria | 3291 |
| 465 | Ga0157379_10237266 | 3300014968 | Bacteria | 1654 |
| 466 | Ga0157376_10001372 | 3300014969 | Bacteria | 16037 |
| 467 | Ga0157376_10019925 | 3300014969 | Bacteria | 5179 |
| 468 | Ga0157376_10106846 | 3300014969 | Bacteria | 2456 |
| 469 | Ga0157376_10278940 | 3300014969 | Bacteria | 1573 |
| 470 | Ga0157376_10503392 | 3300014969 | Bacteria | 1191 |
| 471 | Ga0163161_10003480 | 3300017792 | Bacteria | 11037 |
| 472 | Ga0163161_10103438 | 3300017792 | Bacteria | 2122 |
| 473 | Ga0206356_10050520 | 3300020070 | Bacteria | 1940 |
| 474 | Ga0207666_1000038 | 3300025271 | Bacteria | 26508 |
| 475 | Ga0207666_1000670 | 3300025271 | Bacteria | 4106 |
| 476 | Ga0207673_1006959 | 3300025290 | Bacteria | 1410 |
| 477 | Ga0209758_1000079 | 3300025297 | Bacteria | 262874 |
| 478 | Ga0207697_10000373 | 3300025315 | Bacteria | 25127 |
| 479 | Ga0207697_10017294 | 3300025315 | Bacteria | 2964 |
| 480 | Ga0207697_10025362 | 3300025315 | Bacteria | 2422 |
| 481 | Ga0207697_10084636 | 3300025315 | Bacteria | 1339 |
| 482 | Ga0207713_1072809 | 3300025735 | Unclassified | 1263 |
| 483 | Ga0207653_10000559 | 3300025885 | Bacteria | 13532 |
| 484 | Ga0207682_10000071 | 3300025893 | Bacteria | 44843 |
| 485 | Ga0207692_10010499 | 3300025898 | Bacteria | 3906 |
| 486 | Ga0207692_10050472 | 3300025898 | Bacteria | 2104 |
| 487 | Ga0207642_10004072 | 3300025899 | Bacteria | 4683 |
| 488 | Ga0207642_10010782 | 3300025899 | Bacteria | 3237 |
| 489 | Ga0207642_10070749 | 3300025899 | Bacteria | 1659 |
| 490 | Ga0207710_10007020 | 3300025900 | Bacteria | 4785 |
| 491 | Ga0207710_10007122 | 3300025900 | Bacteria | 4745 |
| 492 | Ga0207710_10093911 | 3300025900 | Bacteria | 1408 |
| 493 | Ga0207688_10000237 | 3300025901 | Bacteria | 25119 |
| 494 | Ga0207688_10023508 | 3300025901 | Bacteria | 3376 |
| 495 | Ga0207680_10037949 | 3300025903 | Bacteria | 2785 |
| 496 | Ga0207647_10009005 | 3300025904 | Bacteria | 7113 |
| 497 | Ga0207647_10064700 | 3300025904 | Bacteria | 2222 |
| 498 | Ga0207647_10099247 | 3300025904 | Bacteria | 1729 |
| 499 | Ga0207647_10110025 | 3300025904 | Bacteria | 1629 |
| 500 | Ga0207647_10144254 | 3300025904 | Bacteria | 1394 |
| 501 | Ga0207647_10145926 | 3300025904 | Bacteria | 1385 |
| 502 | Ga0207699_10079821 | 3300025906 | Bacteria | 2025 |
| 503 | Ga0207699_10127180 | 3300025906 | Bacteria | 1656 |
| 504 | Ga0207699_10186277 | 3300025906 | Bacteria | 1398 |
| 505 | Ga0207645_10000779 | 3300025907 | Bacteria | 26604 |
| 506 | Ga0207645_10028585 | 3300025907 | Bacteria | 3598 |
| 507 | Ga0207645_10038461 | 3300025907 | Bacteria | 3068 |
| 508 | Ga0207645_10063209 | 3300025907 | Bacteria | 2365 |
| 509 | Ga0207645_10079328 | 3300025907 | Bacteria | 2104 |
| 510 | Ga0207643_10000276 | 3300025908 | Bacteria | 35671 |
| 511 | Ga0207643_10022449 | 3300025908 | Bacteria | 3474 |
| 512 | Ga0207705_10077767 | 3300025909 | Bacteria | 2414 |
| 513 | Ga0207684_10097682 | 3300025910 | Bacteria | 2507 |
| 514 | Ga0207654_10014702 | 3300025911 | Bacteria | 4048 |
| 515 | Ga0207654_10093334 | 3300025911 | Bacteria | 1840 |
| 516 | Ga0207654_10196411 | 3300025911 | Bacteria | 1326 |
| 517 | Ga0207654_10244704 | 3300025911 | Bacteria | 1200 |
| 518 | Ga0207707_10000454 | 3300025912 | Bacteria | 42654 |
| 519 | Ga0207707_10069691 | 3300025912 | Bacteria | 3065 |
| 520 | Ga0207707_10083619 | 3300025912 | Bacteria | 2787 |
| 521 | Ga0207707_10131233 | 3300025912 | Bacteria | 2191 |
| 522 | Ga0207695_10364338 | 3300025913 | Bacteria | 1332 |
| 523 | Ga0207671_10016484 | 3300025914 | Bacteria | 5741 |
| 524 | Ga0207671_10037376 | 3300025914 | Bacteria | 3601 |
| 525 | Ga0207671_10188217 | 3300025914 | Bacteria | 1608 |
| 526 | Ga0207693_10005073 | 3300025915 | Bacteria | 11046 |
| 527 | Ga0207693_10007312 | 3300025915 | Bacteria | 9084 |
| 528 | Ga0207693_10010113 | 3300025915 | Bacteria | 7663 |
| 529 | Ga0207693_10051746 | 3300025915 | Bacteria | 3222 |
| 530 | Ga0207693_10073450 | 3300025915 | Bacteria | 2677 |
| 531 | Ga0207693_10078058 | 3300025915 | Bacteria | 2592 |
| 532 | Ga0207693_10085039 | 3300025915 | Bacteria | 2478 |
| 533 | Ga0207693_10097721 | 3300025915 | Bacteria | 2302 |
| 534 | Ga0207663_10061077 | 3300025916 | Bacteria | 2390 |
| 535 | Ga0207663_10072881 | 3300025916 | Bacteria | 2221 |
| 536 | Ga0207663_10119841 | 3300025916 | Bacteria | 1800 |
| 537 | Ga0207660_10000087 | 3300025917 | Bacteria | 49552 |
| 538 | Ga0207660_10078775 | 3300025917 | Bacteria | 2416 |
| 539 | Ga0207660_10107168 | 3300025917 | Bacteria | 2096 |
| 540 | Ga0207660_10225179 | 3300025917 | Bacteria | 1473 |
| 541 | Ga0207662_10000659 | 3300025918 | Bacteria | 15653 |
| 542 | Ga0207662_10009020 | 3300025918 | Bacteria | 5479 |
| 543 | Ga0207662_10022432 | 3300025918 | Bacteria | 3620 |
| 544 | Ga0207662_10109719 | 3300025918 | Bacteria | 1719 |
| 545 | Ga0207662_10180772 | 3300025918 | Bacteria | 1357 |
| 546 | Ga0207657_10003101 | 3300025919 | Bacteria | 17768 |
| 547 | Ga0207657_10005173 | 3300025919 | Bacteria | 13682 |
| 548 | Ga0207657_10035321 | 3300025919 | Bacteria | 4483 |
| 549 | Ga0207657_10051853 | 3300025919 | Bacteria | 3564 |
| 550 | Ga0207657_10158047 | 3300025919 | Bacteria | 1842 |
| 551 | Ga0207657_10167303 | 3300025919 | Bacteria | 1783 |
| 552 | Ga0207649_10000662 | 3300025920 | Bacteria | 22982 |
| 553 | Ga0207649_10095650 | 3300025920 | Bacteria | 1955 |
| 554 | Ga0207649_10127807 | 3300025920 | Bacteria | 1722 |
| 555 | Ga0207652_10001908 | 3300025921 | Bacteria | 18069 |
| 556 | Ga0207652_10023549 | 3300025921 | Bacteria | 5101 |
| 557 | Ga0207681_10001262 | 3300025923 | Bacteria | 16334 |
| 558 | Ga0207681_10211519 | 3300025923 | Bacteria | 1495 |
| 559 | Ga0207694_10017984 | 3300025924 | Bacteria | 5342 |
| 560 | Ga0207694_10044775 | 3300025924 | Bacteria | 3417 |
| 561 | Ga0207650_10005107 | 3300025925 | Bacteria | 8956 |
| 562 | Ga0207650_10377855 | 3300025925 | Bacteria | 1170 |
| 563 | Ga0207659_10000143 | 3300025926 | Bacteria | 42200 |
| 564 | Ga0207659_10139648 | 3300025926 | Bacteria | 1880 |
| 565 | Ga0207687_10000865 | 3300025927 | Bacteria | 20461 |
| 566 | Ga0207687_10030379 | 3300025927 | Bacteria | 3643 |
| 567 | Ga0207687_10290565 | 3300025927 | Bacteria | 1313 |
| 568 | Ga0207687_10315623 | 3300025927 | Bacteria | 1263 |
| 569 | Ga0207700_10000323 | 3300025928 | Bacteria | 28133 |
| 570 | Ga0207700_10072896 | 3300025928 | Bacteria | 2650 |
| 571 | Ga0207700_10083953 | 3300025928 | Bacteria | 2495 |
| 572 | Ga0207700_10145360 | 3300025928 | Bacteria | 1953 |
| 573 | Ga0207664_10049417 | 3300025929 | Bacteria | 3311 |
| 574 | Ga0207664_10104335 | 3300025929 | Bacteria | 2347 |
| 575 | Ga0207664_10205112 | 3300025929 | Bacteria | 1703 |
| 576 | Ga0207664_10370743 | 3300025929 | Bacteria | 1270 |
| 577 | Ga0207644_10000532 | 3300025931 | Bacteria | 24677 |
| 578 | Ga0207644_10042290 | 3300025931 | Bacteria | 3228 |
| 579 | Ga0207644_10120249 | 3300025931 | Bacteria | 1999 |
| 580 | Ga0207644_10225091 | 3300025931 | Bacteria | 1488 |
| 581 | Ga0207690_10000409 | 3300025932 | Bacteria | 28156 |
| 582 | Ga0207706_10001338 | 3300025933 | Bacteria | 24639 |
| 583 | Ga0207706_10006493 | 3300025933 | Bacteria | 10857 |
| 584 | Ga0207706_10006705 | 3300025933 | Bacteria | 10645 |
| 585 | Ga0207706_10046748 | 3300025933 | Bacteria | 3831 |
| 586 | Ga0207706_10058641 | 3300025933 | Bacteria | 3390 |
| 587 | Ga0207706_10064354 | 3300025933 | Bacteria | 3229 |
| 588 | Ga0207686_10000500 | 3300025934 | Bacteria | 25713 |
| 589 | Ga0207686_10042200 | 3300025934 | Bacteria | 2786 |
| 590 | Ga0207686_10075339 | 3300025934 | Bacteria | 2184 |
| 591 | Ga0207709_10001266 | 3300025935 | Bacteria | 18089 |
| 592 | Ga0207709_10050874 | 3300025935 | Bacteria | 2536 |
| 593 | Ga0207709_10141359 | 3300025935 | Bacteria | 1655 |
| 594 | Ga0207670_10007354 | 3300025936 | Bacteria | 6140 |
| 595 | Ga0207670_10016040 | 3300025936 | Bacteria | 4493 |
| 596 | Ga0207670_10027140 | 3300025936 | Bacteria | 3617 |
| 597 | Ga0207670_10083746 | 3300025936 | Bacteria | 2238 |
| 598 | Ga0207670_10198058 | 3300025936 | Bacteria | 1524 |
| 599 | Ga0207669_10001125 | 3300025937 | Bacteria | 11423 |
| 600 | Ga0207704_10000613 | 3300025938 | Bacteria | 15794 |
| 601 | Ga0207665_10001192 | 3300025939 | Bacteria | 17511 |
| 602 | Ga0207665_10003934 | 3300025939 | Bacteria | 9947 |
| 603 | Ga0207665_10073486 | 3300025939 | Bacteria | 2338 |
| 604 | Ga0207665_10319638 | 3300025939 | Bacteria | 1164 |
| 605 | Ga0207691_10002493 | 3300025940 | Bacteria | 18001 |
| 606 | Ga0207691_10003339 | 3300025940 | Bacteria | 15624 |
| 607 | Ga0207691_10130622 | 3300025940 | Bacteria | 2219 |
| 608 | Ga0207711_10003987 | 3300025941 | Bacteria | 12681 |
| 609 | Ga0207711_10029326 | 3300025941 | Bacteria | 4640 |
| 610 | Ga0207711_10050370 | 3300025941 | Bacteria | 3565 |
| 611 | Ga0207711_10238615 | 3300025941 | Bacteria | 1667 |
| 612 | Ga0207711_10286694 | 3300025941 | Bacteria | 1517 |
| 613 | Ga0207689_10000440 | 3300025942 | Bacteria | 38932 |
| 614 | Ga0207689_10021598 | 3300025942 | Bacteria | 5412 |
| 615 | Ga0207689_10273806 | 3300025942 | Bacteria | 1398 |
| 616 | Ga0207661_10059018 | 3300025944 | Bacteria | 3090 |
| 617 | Ga0207661_10061762 | 3300025944 | Bacteria | 3028 |
| 618 | Ga0207661_10125939 | 3300025944 | Bacteria | 2188 |
| 619 | Ga0207661_10150552 | 3300025944 | Bacteria | 2011 |
| 620 | Ga0207679_10005990 | 3300025945 | Bacteria | 7648 |
| 621 | Ga0207679_10016049 | 3300025945 | Bacteria | 4965 |
| 622 | Ga0207679_10110913 | 3300025945 | Bacteria | 2165 |
| 623 | Ga0207667_10018606 | 3300025949 | Bacteria | 7784 |
| 624 | Ga0207667_10040968 | 3300025949 | Bacteria | 4929 |
| 625 | Ga0207651_10000335 | 3300025960 | Bacteria | 19911 |
| 626 | Ga0207712_10002448 | 3300025961 | Bacteria | 11985 |
| 627 | Ga0207712_10004065 | 3300025961 | Bacteria | 9233 |
| 628 | Ga0207712_10194903 | 3300025961 | Bacteria | 1602 |
| 629 | Ga0207668_10000065 | 3300025972 | Bacteria | 86273 |
| 630 | Ga0207668_10100099 | 3300025972 | Bacteria | 2152 |
| 631 | Ga0207668_10176418 | 3300025972 | Bacteria | 1681 |
| 632 | Ga0207640_10000339 | 3300025981 | Bacteria | 31004 |
| 633 | Ga0207658_10004428 | 3300025986 | Bacteria | 9771 |
| 634 | Ga0207658_10034444 | 3300025986 | Bacteria | 3620 |
| 635 | Ga0207658_10185666 | 3300025986 | Bacteria | 1724 |
| 636 | Ga0207658_10291234 | 3300025986 | Bacteria | 1403 |
| 637 | Ga0207677_10003580 | 3300026023 | Bacteria | 8226 |
| 638 | Ga0207677_10229464 | 3300026023 | Bacteria | 1494 |
| 639 | Ga0207703_10001885 | 3300026035 | Bacteria | 18620 |
| 640 | Ga0207703_10124556 | 3300026035 | Bacteria | 2217 |
| 641 | Ga0207703_10195052 | 3300026035 | Bacteria | 1796 |
| 642 | Ga0207639_10041384 | 3300026041 | Bacteria | 3447 |
| 643 | Ga0207678_10000944 | 3300026067 | Bacteria | 26538 |
| 644 | Ga0207678_10006342 | 3300026067 | Bacteria | 10500 |
| 645 | Ga0207678_10019284 | 3300026067 | Bacteria | 5990 |
| 646 | Ga0207678_10036592 | 3300026067 | Bacteria | 4273 |
| 647 | Ga0207678_10062862 | 3300026067 | Bacteria | 3190 |
| 648 | Ga0207708_10002019 | 3300026075 | Bacteria | 14954 |
| 649 | Ga0207708_10002166 | 3300026075 | Bacteria | 14494 |
| 650 | Ga0207708_10033326 | 3300026075 | Bacteria | 3913 |
| 651 | Ga0207708_10039810 | 3300026075 | Bacteria | 3583 |
| 652 | Ga0207708_10115624 | 3300026075 | Bacteria | 2086 |
| 653 | Ga0207708_10126975 | 3300026075 | Bacteria | 1991 |
| 654 | Ga0207702_10056555 | 3300026078 | Bacteria | 3331 |
| 655 | Ga0207641_10005810 | 3300026088 | Bacteria | 10470 |
| 656 | Ga0207641_10085777 | 3300026088 | Bacteria | 2744 |
| 657 | Ga0207648_10004730 | 3300026089 | Bacteria | 13904 |
| 658 | Ga0207648_10049631 | 3300026089 | Bacteria | 3672 |
| 659 | Ga0207648_10087607 | 3300026089 | Bacteria | 2717 |
| 660 | Ga0207648_10167995 | 3300026089 | Bacteria | 1939 |
| 661 | Ga0207676_10008134 | 3300026095 | Bacteria | 7455 |
| 662 | Ga0207676_10046203 | 3300026095 | Bacteria | 3368 |
| 663 | Ga0207676_10100203 | 3300026095 | Bacteria | 2399 |
| 664 | Ga0207676_10127208 | 3300026095 | Bacteria | 2160 |
| 665 | Ga0207674_10003323 | 3300026116 | Bacteria | 19775 |
| 666 | Ga0207674_10005364 | 3300026116 | Bacteria | 15249 |
| 667 | Ga0207674_10082603 | 3300026116 | Bacteria | 3213 |
| 668 | Ga0207674_10091204 | 3300026116 | Bacteria | 3038 |
| 669 | Ga0207675_100000815 | 3300026118 | Bacteria | 31016 |
| 670 | Ga0207675_100011636 | 3300026118 | Bacteria | 8227 |
| 671 | Ga0207675_100081484 | 3300026118 | Bacteria | 3034 |
| 672 | Ga0207675_100175686 | 3300026118 | Bacteria | 2049 |
| 673 | Ga0207675_100191507 | 3300026118 | Bacteria | 1962 |
| 674 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 675 | Ga0207683_10074307 | 3300026121 | Bacteria | 3007 |
| 676 | Ga0207683_10096807 | 3300026121 | Bacteria | 2631 |
| 677 | Ga0207683_10124322 | 3300026121 | Bacteria | 2318 |
| 678 | Ga0207683_10327574 | 3300026121 | Bacteria | 1404 |
| 679 | Ga0207698_10024447 | 3300026142 | Bacteria | 4240 |
| 680 | Ga0209967_1000489 | 3300027364 | Bacteria | 5203 |
| 681 | Ga0209981_1000830 | 3300027378 | Bacteria | 3900 |
| 682 | Ga0209996_1008254 | 3300027395 | Bacteria | 1363 |
| 683 | Ga0210000_1001264 | 3300027462 | Bacteria | 3559 |
| 684 | Ga0209968_1006091 | 3300027526 | Bacteria | 1816 |
| 685 | Ga0209999_1003822 | 3300027543 | Bacteria | 2705 |
| 686 | Ga0209971_1014174 | 3300027682 | Bacteria | 1889 |
| 687 | Ga0209971_1017209 | 3300027682 | Bacteria | 1714 |
| 688 | Ga0209966_1000743 | 3300027695 | Bacteria | 6783 |
| 689 | Ga0209966_1001998 | 3300027695 | Bacteria | 3413 |
| 690 | Ga0209998_10001042 | 3300027717 | Bacteria | 6950 |
| 691 | Ga0209998_10011704 | 3300027717 | Bacteria | 1818 |
| 692 | Ga0209974_10050686 | 3300027876 | Bacteria | 1395 |
| 693 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 694 | Ga0207428_10000255 | 3300027907 | Bacteria | 72962 |
| 695 | Ga0207428_10003313 | 3300027907 | Bacteria | 15665 |
| 696 | Ga0207428_10013736 | 3300027907 | Bacteria | 7059 |
| 697 | Ga0207428_10016308 | 3300027907 | Bacteria | 6392 |
| 698 | Ga0207428_10058144 | 3300027907 | Bacteria | 3069 |
| 699 | Ga0207428_10142280 | 3300027907 | Unclassified | 1830 |
| 700 | Ga0268266_10020037 | 3300028379 | Bacteria | 5701 |
| 701 | Ga0268266_10128823 | 3300028379 | Bacteria | 2262 |
| 702 | Ga0268266_10247664 | 3300028379 | Bacteria | 1647 |
| 703 | Ga0268265_10009461 | 3300028380 | Bacteria | 6580 |
| 704 | Ga0268265_10029653 | 3300028380 | Bacteria | 3930 |
| 705 | Ga0268264_10001153 | 3300028381 | Bacteria | 25764 |
| 706 | Ga0268264_10006938 | 3300028381 | Bacteria | 9501 |
| 707 | Ga0265337_1001632 | 3300028556 | Bacteria | 10908 |
| 708 | Ga0265337_1029353 | 3300028556 | Bacteria | 1645 |
| 709 | Ga0265338_10020616 | 3300028800 | Bacteria | 6924 |
| 710 | Ga0265338_10038131 | 3300028800 | Bacteria | 4558 |
| 711 | Ga0265338_10076159 | 3300028800 | Bacteria | 2843 |
| 712 | Ga0265763_1000066 | 3300030763 | Bacteria | 4406 |
| 713 | Ga0265760_10071838 | 3300031090 | Bacteria | 1062 |
| 714 | Ga0265330_10009242 | 3300031235 | Bacteria | 4693 |
| 715 | Ga0265330_10014275 | 3300031235 | Bacteria | 3687 |
| 716 | Ga0265325_10000320 | 3300031241 | Bacteria | 33866 |
| 717 | Ga0265325_10000901 | 3300031241 | Bacteria | 21471 |
| 718 | Ga0265325_10001624 | 3300031241 | Bacteria | 15665 |
| 719 | Ga0265339_10000107 | 3300031249 | Bacteria | 68261 |
| 720 | Ga0265339_10000387 | 3300031249 | Bacteria | 34871 |
| 721 | Ga0265339_10119541 | 3300031249 | Bacteria | 1356 |
| 722 | Ga0265331_10024832 | 3300031250 | Bacteria | 3028 |
| 723 | Ga0265313_10000850 | 3300031595 | Bacteria | 30762 |
| 724 | Ga0265313_10004004 | 3300031595 | Bacteria | 11532 |
| 725 | Ga0265314_10007897 | 3300031711 | Bacteria | 9182 |
| 726 | Ga0265342_10000196 | 3300031712 | Bacteria | 67364 |
| 727 | Ga0373930_0000014 | 3300034816 | Bacteria | 17170 |
| 728 | Ga0373948_0000493 | 3300034817 | Bacteria | 4922 |
| 729 | Ga0373948_0034839 | 3300034817 | Bacteria | 1031 |
| 730 | Ga0373950_0000145 | 3300034818 | Bacteria | 11351 |
| 731 | Ga0373958_0000064 | 3300034819 | Bacteria | 10619 |
| 732 | Ga0373959_0013423 | 3300034820 | Bacteria | 1477 |
| 733 | Ga0373938_0001531 | 3300034957 | Bacteria | 3712 |
| 734 | Ga0373926_0017053 | 3300035083 | Bacteria | 2489 |
| 735 | Ga0373926_0026074 | 3300035083 | Bacteria | 2043 |
| 736 | Ga0373928_0001389 | 3300035084 | Bacteria | 4719 |
| 737 | Ga0373928_0028267 | 3300035084 | Bacteria | 1226 |
| 738 | Ga0373929_0000101 | 3300035085 | Bacteria | 14304 |
| 739 | Ga0373929_0002654 | 3300035085 | Bacteria | 3273 |
| 740 | Ga0373929_0016173 | 3300035085 | Bacteria | 1459 |
| 741 | Ga0373934_0055179 | 3300035086 | Bacteria | 1578 |
| 742 | Ga0373940_0022780 | 3300035088 | Bacteria | 1611 |
| 743 | Ga0373944_0013599 | 3300035089 | Bacteria | 2261 |
| 744 | Ga0373949_0000293 | 3300035090 | Bacteria | 18099 |
| 745 | Ga0373949_0000952 | 3300035090 | Bacteria | 8980 |
| 746 | Ga0373949_0015900 | 3300035090 | Bacteria | 1684 |
| 747 | Ga0373949_0027664 | 3300035090 | Bacteria | 1334 |
| 748 | Ga0373951_0001275 | 3300035091 | Bacteria | 6672 |
| 749 | Ga0373952_0000030 | 3300035092 | Bacteria | 16323 |
| 750 | Ga0373952_0010083 | 3300035092 | Bacteria | 1821 |
| 751 | Ga0373952_0013911 | 3300035092 | Bacteria | 1603 |
| 752 | Ga0373952_0034855 | 3300035092 | Bacteria | 1137 |
| 753 | Ga0373923_0053917 | 3300035111 | Bacteria | 1692 |
| 754 | Ga0373923_0077086 | 3300035111 | Bacteria | 1440 |
| 755 | Ga0373932_0024430 | 3300035112 | Bacteria | 1626 |
| 756 | Ga0373932_0055616 | 3300035112 | Bacteria | 1187 |
| 757 | Ga0373932_0077125 | 3300035112 | Bacteria | 1045 |
| 758 | Ga0373936_0009974 | 3300035113 | Bacteria | 3585 |
| 759 | Ga0373936_0019684 | 3300035113 | Bacteria | 2616 |
| 760 | Ga0373939_0000791 | 3300035114 | Bacteria | 7801 |
| 761 | Ga0373941_0000050 | 3300035115 | Bacteria | 17747 |
| 762 | Ga0373941_0002899 | 3300035115 | Bacteria | 3823 |
| 763 | Ga0373941_0004506 | 3300035115 | Bacteria | 3224 |
| 764 | Ga0373941_0046160 | 3300035115 | Bacteria | 1367 |
| 765 | Ga0373945_0001214 | 3300035116 | Bacteria | 7848 |
| 766 | Ga0373945_0005087 | 3300035116 | Bacteria | 4193 |
| 767 | Ga0373945_0114844 | 3300035116 | Bacteria | 1065 |
| 768 | Ga0373953_0001444 | 3300035117 | Bacteria | 6890 |
| 769 | Ga0373953_0051017 | 3300035117 | Bacteria | 1672 |
| 770 | Ga0373954_0001943 | 3300035118 | Bacteria | 8567 |
| 771 | Ga0373954_0006970 | 3300035118 | Bacteria | 4934 |
| 772 | Ga0373954_0008746 | 3300035118 | Bacteria | 4451 |
| 773 | Ga0373954_0021614 | 3300035118 | Bacteria | 2914 |
| 774 | Ga0373954_0041945 | 3300035118 | Bacteria | 2134 |
| 775 | Ga0373956_0024531 | 3300035119 | Bacteria | 2599 |
| 776 | Ga0373957_0003309 | 3300035120 | Bacteria | 4749 |
| 777 | Ga0373957_0005066 | 3300035120 | Bacteria | 4066 |
| 778 | Ga0373957_0024044 | 3300035120 | Bacteria | 2184 |
| 779 | Ga0373960_0004388 | 3300035121 | Bacteria | 3230 |
| 780 | Ga0373960_0007174 | 3300035121 | Bacteria | 2633 |
| 781 | Ga0373960_0016939 | 3300035121 | Bacteria | 1881 |
| 782 | Ga0373960_0045372 | 3300035121 | Bacteria | 1286 |
| 783 | Ga0373943_0001792 | 3300035170 | Bacteria | 9710 |
| 784 | Ga0373943_0006259 | 3300035170 | Bacteria | 5347 |
| 785 | Ga0373943_0011476 | 3300035170 | Bacteria | 3986 |
| 786 | Ga0373946_0000496 | 3300035171 | Bacteria | 13068 |
| 787 | Ga0373946_0007440 | 3300035171 | Bacteria | 4005 |
| 788 | Ga0373946_0044280 | 3300035171 | Bacteria | 1837 |
| 789 | Ga0373946_0088151 | 3300035171 | Bacteria | 1371 |
| 790 | Ga0373955_0000779 | 3300035172 | Bacteria | 13651 |
| 791 | Ga0373955_0005131 | 3300035172 | Bacteria | 5853 |
| 792 | Ga0373955_0017746 | 3300035172 | Bacteria | 3526 |
| 793 | Ga0373955_0136417 | 3300035172 | Bacteria | 1435 |
| 794 | Ga0373942_0000073 | 3300035207 | Bacteria | 21344 |
| 795 | Ga0373942_0056815 | 3300035207 | Bacteria | 1112 |
| 796 | Ga0373961_0000480 | 3300035241 | Bacteria | 15603 |
| 797 | Ga0373961_0009096 | 3300035241 | Bacteria | 2425 |
| 798 | Ga0373962_0001214 | 3300035242 | Bacteria | 6025 |
| 799 | Ga0373962_0008813 | 3300035242 | Bacteria | 2490 |
| 800 | Ga0373962_0011212 | 3300035242 | Bacteria | 2244 |
| 801 | Ga0373962_0036676 | 3300035242 | Bacteria | 1366 |
| 802 | Ga0373924_0036219 | 3300035410 | Bacteria | 2004 |
| 803 | Ga0373924_0053087 | 3300035410 | Bacteria | 1683 |
| 804 | Ga0373931_0000537 | 3300035691 | Bacteria | 15543 |
| 805 | Ga0373931_0004302 | 3300035691 | Bacteria | 6489 |
| 806 | Ga0373931_0006018 | 3300035691 | Bacteria | 5644 |
| 807 | Ga0373931_0023545 | 3300035691 | Bacteria | 3111 |
| 808 | Ga0373931_0025443 | 3300035691 | Bacteria | 3006 |
| 809 | Ga0373931_0027531 | 3300035691 | Bacteria | 2902 |
| 810 | Ga0373931_0346212 | 3300035691 | Bacteria | 929 |
| 811 | Ga0373935_0000053 | 3300035692 | Bacteria | 46838 |
| 812 | Ga0373935_0001261 | 3300035692 | Bacteria | 13962 |
| 813 | Ga0373935_0016092 | 3300035692 | Bacteria | 4526 |
| 814 | Ga0373935_0030809 | 3300035692 | Bacteria | 3325 |
| 815 | Ga0373935_0111894 | 3300035692 | Bacteria | 1813 |
| 816 | Ga0373935_0187353 | 3300035692 | Bacteria | 1423 |
| 817 | Ga0373927_0014200 | 3300035695 | Bacteria | 5280 |
| 818 | Ga0373927_0035423 | 3300035695 | Bacteria | 3245 |
| 819 | Ga0373933_0001426 | 3300035724 | Bacteria | 14019 |
| 820 | Ga0373933_0002786 | 3300035724 | Bacteria | 9757 |
| 821 | Ga0373933_0021557 | 3300035724 | Bacteria | 3661 |
| 822 | Ga0373933_0022272 | 3300035724 | Bacteria | 3606 |
| 823 | Ga0373933_0051395 | 3300035724 | Bacteria | 2463 |
| 824 | Ga0373947_0000259 | 3300035725 | Bacteria | 29909 |
| 825 | Ga0373947_0054577 | 3300035725 | Bacteria | 2411 |
| 826 | Ga0373937_0000030 | 3300036401 | Bacteria | 122176 |
| 827 | Ga0373937_0000907 | 3300036401 | Bacteria | 25212 |
| 828 | Ga0373937_0003255 | 3300036401 | Bacteria | 13620 |
| 829 | Ga0373937_0036814 | 3300036401 | Bacteria | 4458 |
| 830 | Ga0373937_0046962 | 3300036401 | Bacteria | 3949 |
| 831 | Ga0373937_0160827 | 3300036401 | Bacteria | 2105 |
| 832 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 833 | Ga0373925_0010040 | 3300037068 | Bacteria | 6877 |
| 834 | Ga0373925_0019842 | 3300037068 | Bacteria | 4890 |
| 835 | Ga0373925_0120679 | 3300037068 | Bacteria | 2034 |
| 836 | Ga0395900_0009186 | 3300037418 | Bacteria | 10132 |
| 837 | Ga0395900_0022366 | 3300037418 | Bacteria | 6466 |
| 838 | Ga0395898_0001841 | 3300037466 | Bacteria | 27267 |
| 839 | Ga0395898_0003941 | 3300037466 | Bacteria | 16375 |
| 840 | Ga0436364_0478575 | 3300037853 | Bacteria | 1314 |
| 841 | Ga0395901_0014006 | 3300038443 | Bacteria | 8161 |
| 842 | Ga0395901_0125602 | 3300038443 | Bacteria | 2696 |
| 843 | Ga0395901_0194074 | 3300038443 | Bacteria | 2129 |
| 844 | Ga0395901_0310785 | 3300038443 | Bacteria | 1632 |
| 845 | Ga0436365_0556834 | 3300039437 | Bacteria | 1651 |
| 846 | Ga0439453_0002489 | 3300041408 | Bacteria | 2549 |
| 847 | Ga0439443_000477 | 3300042003 | Bacteria | 3560 |
| 848 | Ga0439450_002377 | 3300042008 | Bacteria | 2951 |
| 849 | Ga0439446_0001019 | 3300042156 | Bacteria | 6142 |
| 850 | Ga0439435_0000002 | 3300042436 | Bacteria | 34816 |
| 851 | Ga0439435_0000646 | 3300042436 | Bacteria | 5729 |
| 852 | Ga0451577_0147580 | 3300042876 | Bacteria | 2115 |
| 853 | Ga0451577_0206376 | 3300042876 | Bacteria | 1774 |
| 854 | Ga0453683_0000968 | 3300044673 | Bacteria | 27176 |
| 855 | Ga0466963_0013664 | 3300044694 | Bacteria | 4992 |
| 856 | Ga0466963_0046783 | 3300044694 | Bacteria | 2854 |
| 857 | Ga0453684_0283538 | 3300044712 | Bacteria | 1888 |
| 858 | Ga0466968_0091790 | 3300044735 | Bacteria | 1347 |
| 859 | Ga0466959_0065728 | 3300045049 | Bacteria | 2632 |
| 860 | Ga0451576_0017130 | 3300045051 | Bacteria | 7970 |
| 861 | Ga0451576_0559512 | 3300045051 | Bacteria | 1201 |
| 862 | Ga0466958_0076835 | 3300045836 | Bacteria | 2050 |
| 863 | Ga0466967_0000135 | 3300045976 | Bacteria | 28276 |
| 864 | Ga0495592_0000046 | 3300046454 | Bacteria | 117345 |
| 865 | Ga0495592_0001393 | 3300046454 | Bacteria | 16741 |
| 866 | Ga0495592_0002484 | 3300046454 | Bacteria | 13030 |
| 867 | Ga0495592_0075149 | 3300046454 | Bacteria | 2454 |
| 868 | Ga0495592_0257395 | 3300046454 | Bacteria | 1151 |
| 869 | Ga0495603_0001804 | 3300046455 | Bacteria | 12638 |
| 870 | Ga0495603_0002249 | 3300046455 | Bacteria | 11338 |
| 871 | Ga0495603_0014184 | 3300046455 | Bacteria | 4821 |
| 872 | Ga0495629_0000594 | 3300046459 | Bacteria | 29414 |
| 873 | Ga0495629_0001140 | 3300046459 | Bacteria | 20980 |
| 874 | Ga0495629_0002311 | 3300046459 | Bacteria | 14684 |
| 875 | Ga0495629_0032319 | 3300046459 | Bacteria | 3705 |
| 876 | Ga0495629_0088951 | 3300046459 | Bacteria | 2154 |
| 877 | Ga0495638_0003988 | 3300046460 | Bacteria | 11355 |
| 878 | Ga0495638_0077367 | 3300046460 | Bacteria | 2026 |
| 879 | Ga0495641_0011331 | 3300046461 | Bacteria | 5090 |
| 880 | Ga0495641_0017820 | 3300046461 | Bacteria | 3686 |
| 881 | Ga0495651_0000822 | 3300046462 | Bacteria | 24113 |
| 882 | Ga0495651_0004816 | 3300046462 | Bacteria | 10326 |
| 883 | Ga0495651_0006482 | 3300046462 | Bacteria | 8945 |
| 884 | Ga0495651_0047233 | 3300046462 | Bacteria | 3330 |
| 885 | Ga0495651_0062848 | 3300046462 | Bacteria | 2840 |
| 886 | Ga0495651_0086884 | 3300046462 | Bacteria | 2352 |
| 887 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 888 | Ga0495653_0004798 | 3300046463 | Bacteria | 10964 |
| 889 | Ga0495653_0181253 | 3300046463 | Bacteria | 1445 |
| 890 | Ga0495580_0012844 | 3300046472 | Bacteria | 6417 |
| 891 | Ga0495580_0057444 | 3300046472 | Bacteria | 2738 |
| 892 | Ga0495580_0070869 | 3300046472 | Bacteria | 2435 |
| 893 | Ga0495582_0000379 | 3300046473 | Bacteria | 24152 |
| 894 | Ga0495582_0009407 | 3300046473 | Bacteria | 5384 |
| 895 | Ga0495582_0010594 | 3300046473 | Bacteria | 5072 |
| 896 | Ga0495582_0052800 | 3300046473 | Bacteria | 2241 |
| 897 | Ga0495605_0136938 | 3300046474 | Bacteria | 1101 |
| 898 | Ga0495639_0046773 | 3300046475 | Bacteria | 1959 |
| 899 | Ga0495662_0000084 | 3300046476 | Bacteria | 33781 |
| 900 | Ga0495662_0027194 | 3300046476 | Bacteria | 2763 |
| 901 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 902 | Ga0495664_0007745 | 3300046477 | Bacteria | 5977 |
| 903 | Ga0495664_0043029 | 3300046477 | Bacteria | 2676 |
| 904 | Ga0495664_0048292 | 3300046477 | Bacteria | 2526 |
| 905 | Ga0495664_0050575 | 3300046477 | Bacteria | 2467 |
| 906 | Ga0495584_0048021 | 3300046491 | Bacteria | 2153 |
| 907 | Ga0495585_0001932 | 3300046492 | Bacteria | 15492 |
| 908 | Ga0495594_0009110 | 3300046499 | Bacteria | 5124 |
| 909 | Ga0495594_0011284 | 3300046499 | Bacteria | 4642 |
| 910 | Ga0495594_0055076 | 3300046499 | Bacteria | 2192 |
| 911 | Ga0495583_0074035 | 3300046506 | Bacteria | 1492 |
| 912 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 913 | Ga0495608_0017846 | 3300046511 | Bacteria | 4905 |
| 914 | Ga0495608_0215979 | 3300046511 | Bacteria | 1204 |
| 915 | Ga0495616_0048796 | 3300046513 | Bacteria | 2125 |
| 916 | Ga0495616_0154975 | 3300046513 | Bacteria | 1034 |
| 917 | Ga0495618_0000034 | 3300046514 | Bacteria | 104335 |
| 918 | Ga0495618_0001547 | 3300046514 | Bacteria | 15443 |
| 919 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 920 | Ga0495628_0003624 | 3300046516 | Bacteria | 13800 |
| 921 | Ga0495628_0027943 | 3300046516 | Bacteria | 4586 |
| 922 | Ga0495630_0000662 | 3300046517 | Bacteria | 24856 |
| 923 | Ga0495630_0005622 | 3300046517 | Bacteria | 8855 |
| 924 | Ga0495630_0042264 | 3300046517 | Bacteria | 3404 |
| 925 | Ga0495630_0178293 | 3300046517 | Bacteria | 1620 |
| 926 | Ga0495644_0003085 | 3300046523 | Bacteria | 6594 |
| 927 | Ga0495666_0001508 | 3300046526 | Bacteria | 11395 |
| 928 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 929 | Ga0495652_0013904 | 3300046529 | Bacteria | 7238 |
| 930 | Ga0495652_0014845 | 3300046529 | Bacteria | 6981 |
| 931 | Ga0495652_0019057 | 3300046529 | Bacteria | 6112 |
| 932 | Ga0495652_0078363 | 3300046529 | Bacteria | 2736 |
| 933 | Ga0495652_0154159 | 3300046529 | Bacteria | 1791 |
| 934 | Ga0495652_0154943 | 3300046529 | Bacteria | 1785 |
| 935 | Ga0495665_0003909 | 3300046531 | Bacteria | 8063 |
| 936 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 937 | Ga0495640_0006199 | 3300046533 | Bacteria | 9472 |
| 938 | Ga0495640_0010455 | 3300046533 | Bacteria | 7168 |
| 939 | Ga0495640_0050524 | 3300046533 | Bacteria | 2864 |
| 940 | Ga0495640_0075109 | 3300046533 | Bacteria | 2257 |
| 941 | Ga0495640_0211013 | 3300046533 | Bacteria | 1227 |
| 942 | Ga0495587_0000031 | 3300046536 | Bacteria | 126721 |
| 943 | Ga0495587_0002979 | 3300046536 | Bacteria | 11321 |
| 944 | Ga0495587_0016339 | 3300046536 | Bacteria | 4618 |
| 945 | Ga0495587_0114061 | 3300046536 | Bacteria | 1550 |
| 946 | Ga0495587_0118380 | 3300046536 | Bacteria | 1517 |
| 947 | Ga0495598_0004396 | 3300046537 | Bacteria | 3048 |
| 948 | Ga0495598_0019744 | 3300046537 | Bacteria | 1771 |
| 949 | Ga0495598_0021953 | 3300046537 | Bacteria | 1703 |
| 950 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 951 | Ga0495645_0010875 | 3300046543 | Bacteria | 6391 |
| 952 | Ga0495622_0013050 | 3300046557 | Bacteria | 3855 |
| 953 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 954 | Ga0495667_0000202 | 3300046559 | Bacteria | 40046 |
| 955 | Ga0495667_0000365 | 3300046559 | Bacteria | 28797 |
| 956 | Ga0495667_0250301 | 3300046559 | Bacteria | 1128 |
| 957 | Ga0495667_0302345 | 3300046559 | Bacteria | 1013 |
| 958 | Ga0495656_0026229 | 3300046615 | Bacteria | 2318 |
| 959 | Ga0495634_0000533 | 3300046642 | Bacteria | 37336 |
| 960 | Ga0495634_0007719 | 3300046642 | Bacteria | 8052 |
| 961 | Ga0495634_0008544 | 3300046642 | Bacteria | 7612 |
| 962 | Ga0495634_0050245 | 3300046642 | Bacteria | 2801 |
| 963 | Ga0495634_0098239 | 3300046642 | Bacteria | 1894 |
| 964 | Ga0495634_0186293 | 3300046642 | Bacteria | 1297 |
| 965 | Ga0495611_0053259 | 3300046648 | Bacteria | 1826 |
| 966 | Ga0495635_0000022 | 3300046663 | Bacteria | 160907 |
| 967 | Ga0495635_0000981 | 3300046663 | Bacteria | 18808 |
| 968 | Ga0495635_0013894 | 3300046663 | Bacteria | 5633 |
| 969 | Ga0495635_0087593 | 3300046663 | Bacteria | 2131 |
| 970 | Ga0495635_0116019 | 3300046663 | Bacteria | 1828 |
| 971 | Ga0495659_0004216 | 3300046664 | Bacteria | 4538 |
| 972 | Ga0495659_0034053 | 3300046664 | Bacteria | 1790 |
| 973 | Ga0495661_0010683 | 3300046665 | Bacteria | 6254 |
| 974 | Ga0495588_0108007 | 3300046674 | Bacteria | 1465 |
| 975 | Ga0495657_0000276 | 3300046675 | Bacteria | 46295 |
| 976 | Ga0495657_0090215 | 3300046675 | Bacteria | 1968 |
| 977 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 978 | Ga0495599_0002835 | 3300046678 | Bacteria | 10095 |
| 979 | Ga0495599_0046540 | 3300046678 | Bacteria | 2720 |
| 980 | Ga0495623_0000094 | 3300046679 | Bacteria | 53328 |
| 981 | Ga0495623_0001448 | 3300046679 | Bacteria | 16089 |
| 982 | Ga0495623_0093803 | 3300046679 | Bacteria | 1837 |
| 983 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 984 | Ga0495646_0002316 | 3300046680 | Bacteria | 11659 |
| 985 | Ga0495646_0038495 | 3300046680 | Bacteria | 2952 |
| 986 | Ga0495646_0080686 | 3300046680 | Bacteria | 1897 |
| 987 | Ga0495647_0000122 | 3300046681 | Bacteria | 19930 |
| 988 | Ga0495647_0000393 | 3300046681 | Bacteria | 12484 |
| 989 | Ga0495647_0001922 | 3300046681 | Bacteria | 6479 |
| 990 | Ga0495658_0000210 | 3300046683 | Bacteria | 33648 |
| 991 | Ga0495658_0005298 | 3300046683 | Bacteria | 6345 |
| 992 | Ga0495658_0009937 | 3300046683 | Bacteria | 4747 |
| 993 | Ga0495658_0026729 | 3300046683 | Bacteria | 3096 |
| 994 | Ga0495658_0198856 | 3300046683 | Bacteria | 1249 |
| 995 | Ga0495669_0040626 | 3300046684 | Bacteria | 2064 |
| 996 | Ga0495669_0058211 | 3300046684 | Bacteria | 1744 |
| 997 | Ga0495613_0014661 | 3300046689 | Bacteria | 5816 |
| 998 | Ga0495613_0018397 | 3300046689 | Bacteria | 5211 |
| 999 | Ga0495613_0083862 | 3300046689 | Bacteria | 2314 |
| 1000 | Ga0495624_0000222 | 3300046690 | Bacteria | 44293 |
| 1001 | Ga0495624_0020416 | 3300046690 | Bacteria | 4410 |
| 1002 | Ga0495624_0024713 | 3300046690 | Bacteria | 3951 |
| 1003 | Ga0495624_0034304 | 3300046690 | Bacteria | 3283 |
| 1004 | Ga0495670_0001624 | 3300046691 | Bacteria | 11000 |
| 1005 | Ga0495670_0045447 | 3300046691 | Bacteria | 2193 |
| 1006 | Ga0495670_0072999 | 3300046691 | Bacteria | 1739 |
| 1007 | Ga0495671_0128272 | 3300046692 | Bacteria | 1237 |
| 1008 | Ga0495600_0000033 | 3300046809 | Bacteria | 83590 |
| 1009 | Ga0495600_0000506 | 3300046809 | Bacteria | 20198 |
| 1010 | Ga0495600_0002658 | 3300046809 | Bacteria | 10329 |
| 1011 | Ga0495600_0030323 | 3300046809 | Bacteria | 3503 |
| 1012 | Ga0495600_0124399 | 3300046809 | Bacteria | 1677 |
| 1013 | Ga0495581_0005193 | 3300047315 | Bacteria | 7534 |
| 1014 | Ga0495581_0014416 | 3300047315 | Bacteria | 4584 |
| 1015 | Ga0495581_0020808 | 3300047315 | Bacteria | 3806 |
| 1016 | Ga0495581_0046003 | 3300047315 | Bacteria | 2522 |
| 1017 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 1018 | Ga0495604_0001089 | 3300047317 | Bacteria | 22540 |
| 1019 | Ga0495604_0002751 | 3300047317 | Bacteria | 14105 |
| 1020 | Ga0495604_0007025 | 3300047317 | Bacteria | 8925 |
| 1021 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 1022 | Ga0495674_0001490 | 3300047319 | Bacteria | 22945 |
| 1023 | Ga0495674_0014630 | 3300047319 | Bacteria | 7343 |
| 1024 | Ga0495674_0071080 | 3300047319 | Bacteria | 3006 |
| 1025 | Ga0495674_0144775 | 3300047319 | Bacteria | 1995 |
| 1026 | Ga0495674_0214125 | 3300047319 | Bacteria | 1595 |
| 1027 | Ga0495672_0144545 | 3300047320 | Bacteria | 1239 |
| 1028 | Ga0495676_0000289 | 3300047321 | Bacteria | 40718 |
| 1029 | Ga0495676_0021676 | 3300047321 | Bacteria | 5605 |
| 1030 | Ga0495676_0059814 | 3300047321 | Bacteria | 2989 |
| 1031 | Ga0495676_0079695 | 3300047321 | Bacteria | 2489 |
| 1032 | Ga0495680_0000091 | 3300047322 | Bacteria | 81622 |
| 1033 | Ga0495680_0001414 | 3300047322 | Bacteria | 25878 |
| 1034 | Ga0495680_0012301 | 3300047322 | Bacteria | 7541 |
| 1035 | Ga0495680_0018026 | 3300047322 | Bacteria | 6007 |
| 1036 | Ga0495680_0037109 | 3300047322 | Bacteria | 3906 |
| 1037 | Ga0495680_0072323 | 3300047322 | Bacteria | 2623 |
| 1038 | Ga0495680_0273037 | 3300047322 | Bacteria | 1193 |
| 1039 | Ga0495680_0408977 | 3300047322 | Bacteria | 935 |
| 1040 | Ga0495675_0000064 | 3300047444 | Bacteria | 74132 |
| 1041 | Ga0495675_0006504 | 3300047444 | Bacteria | 7152 |
| 1042 | Ga0495685_021278 | 3300047447 | Bacteria | 2232 |
| 1043 | Ga0495684_0000035 | 3300047471 | Bacteria | 107768 |
| 1044 | Ga0495684_0000075 | 3300047471 | Bacteria | 67922 |
| 1045 | Ga0495684_0073421 | 3300047471 | Bacteria | 2599 |
| 1046 | Ga0495684_0202056 | 3300047471 | Bacteria | 1465 |
| 1047 | Ga0495686_0194647 | 3300047472 | Bacteria | 1167 |
| 1048 | Ga0495593_0001106 | 3300047673 | Bacteria | 15737 |
| 1049 | Ga0495593_0033459 | 3300047673 | Bacteria | 2799 |
| 1050 | Ga0495602_0000029 | 3300048088 | Bacteria | 142344 |
| 1051 | Ga0495602_0002033 | 3300048088 | Bacteria | 20344 |
| 1052 | Ga0495602_0018847 | 3300048088 | Bacteria | 6872 |
| 1053 | Ga0495602_0139834 | 3300048088 | Bacteria | 1918 |
| 1054 | Ga0495615_0025543 | 3300048090 | Bacteria | 1372 |
| 1055 | Ga0496100_0000404 | 3300048903 | Bacteria | 20908 |
| 1056 | Ga0496100_0000823 | 3300048903 | Bacteria | 14892 |
| 1057 | Ga0496100_0013536 | 3300048903 | Bacteria | 4709 |
| 1058 | Ga0496100_0200173 | 3300048903 | Bacteria | 1455 |
| 1059 | Ga0496101_0000423 | 3300048904 | Bacteria | 27228 |
| 1060 | Ga0496101_0042230 | 3300048904 | Bacteria | 3254 |
| 1061 | Ga0496101_0074352 | 3300048904 | Bacteria | 2499 |
| 1062 | Ga0496102_0003323 | 3300048905 | Bacteria | 13636 |
| 1063 | Ga0496102_0004385 | 3300048905 | Bacteria | 11921 |
| 1064 | Ga0496102_0017907 | 3300048905 | Bacteria | 6213 |
| 1065 | Ga0496102_0050819 | 3300048905 | Bacteria | 3775 |
| 1066 | Ga0496102_0185693 | 3300048905 | Bacteria | 1959 |
| 1067 | Ga0496102_0199970 | 3300048905 | Bacteria | 1883 |
| 1068 | Ga0496103_0000967 | 3300048906 | Bacteria | 20341 |
| 1069 | Ga0496103_0161660 | 3300048906 | Bacteria | 1436 |
| 1070 | Ga0496104_0000711 | 3300048907 | Bacteria | 28620 |
| 1071 | Ga0496104_0000925 | 3300048907 | Bacteria | 25187 |
| 1072 | Ga0496104_0005217 | 3300048907 | Bacteria | 11362 |
| 1073 | Ga0496104_0005466 | 3300048907 | Bacteria | 11129 |
| 1074 | Ga0496104_0014835 | 3300048907 | Bacteria | 7042 |
| 1075 | Ga0496104_0018532 | 3300048907 | Bacteria | 6351 |
| 1076 | Ga0496104_0026724 | 3300048907 | Bacteria | 5333 |
| 1077 | Ga0496104_0037384 | 3300048907 | Bacteria | 4540 |
| 1078 | Ga0496104_0462323 | 3300048907 | Bacteria | 1180 |
| 1079 | Ga0496105_0007195 | 3300048908 | Bacteria | 8589 |
| 1080 | Ga0496105_0010049 | 3300048908 | Bacteria | 7427 |
| 1081 | Ga0496105_0017905 | 3300048908 | Bacteria | 5685 |
| 1082 | Ga0496105_0020189 | 3300048908 | Bacteria | 5380 |
| 1083 | Ga0496105_0025218 | 3300048908 | Bacteria | 4837 |
| 1084 | Ga0496105_0096900 | 3300048908 | Bacteria | 2436 |
| 1085 | Ga0496105_0124462 | 3300048908 | Bacteria | 2125 |
| 1086 | Ga0496105_0245365 | 3300048908 | Bacteria | 1452 |
| 1087 | Ga0496105_0339947 | 3300048908 | Bacteria | 1200 |
| 1088 | Ga0496106_0002446 | 3300048909 | Bacteria | 13839 |
| 1089 | Ga0496106_0003669 | 3300048909 | Bacteria | 11448 |
| 1090 | Ga0496106_0005520 | 3300048909 | Bacteria | 9359 |
| 1091 | Ga0496106_0015174 | 3300048909 | Bacteria | 5701 |
| 1092 | Ga0496106_0269363 | 3300048909 | Bacteria | 1363 |
| 1093 | Ga0496107_0000500 | 3300048910 | Bacteria | 21655 |
| 1094 | Ga0496107_0021517 | 3300048910 | Bacteria | 4558 |
| 1095 | Ga0496107_0130304 | 3300048910 | Bacteria | 1856 |
| 1096 | Ga0496108_0018949 | 3300048911 | Bacteria | 5643 |
| 1097 | Ga0496108_0040996 | 3300048911 | Bacteria | 3862 |
| 1098 | Ga0496108_0053124 | 3300048911 | Bacteria | 3396 |
| 1099 | Ga0496108_0068004 | 3300048911 | Bacteria | 3005 |
| 1100 | Ga0496108_0115535 | 3300048911 | Bacteria | 2298 |
| 1101 | Ga0496109_0000340 | 3300048912 | Bacteria | 43565 |
| 1102 | Ga0496109_0000359 | 3300048912 | Bacteria | 42297 |
| 1103 | Ga0496109_0000976 | 3300048912 | Bacteria | 23658 |
| 1104 | Ga0496109_0005940 | 3300048912 | Bacteria | 10246 |
| 1105 | Ga0496109_0015600 | 3300048912 | Bacteria | 6625 |
| 1106 | Ga0496109_0056951 | 3300048912 | Bacteria | 3567 |
| 1107 | Ga0496109_0082278 | 3300048912 | Bacteria | 2967 |
| 1108 | Ga0496110_0002357 | 3300048913 | Bacteria | 14148 |
| 1109 | Ga0496110_0003362 | 3300048913 | Bacteria | 12213 |
| 1110 | Ga0496110_0020674 | 3300048913 | Bacteria | 5559 |
| 1111 | Ga0496110_0027384 | 3300048913 | Bacteria | 4886 |
| 1112 | Ga0496110_0229269 | 3300048913 | Bacteria | 1689 |
| 1113 | Ga0496111_0023917 | 3300048914 | Bacteria | 4294 |
| 1114 | Ga0496111_0030852 | 3300048914 | Bacteria | 3814 |
| 1115 | Ga0496111_0040590 | 3300048914 | Bacteria | 3338 |
| 1116 | Ga0496111_0083227 | 3300048914 | Bacteria | 2338 |
| 1117 | Ga0496111_0090226 | 3300048914 | Bacteria | 2245 |
| 1118 | Ga0496111_0276562 | 3300048914 | Bacteria | 1245 |
| 1119 | Ga0496112_0021049 | 3300048915 | Bacteria | 6194 |
| 1120 | Ga0496112_0032947 | 3300048915 | Bacteria | 5032 |
| 1121 | Ga0496112_0038798 | 3300048915 | Bacteria | 4652 |
| 1122 | Ga0496112_0044120 | 3300048915 | Bacteria | 4367 |
| 1123 | Ga0496112_0051703 | 3300048915 | Bacteria | 4030 |
| 1124 | Ga0496112_0078758 | 3300048915 | Bacteria | 3259 |
| 1125 | Ga0496112_0122219 | 3300048915 | Bacteria | 2574 |
| 1126 | Ga0496112_0216613 | 3300048915 | Bacteria | 1871 |
| 1127 | Ga0496112_0338368 | 3300048915 | Bacteria | 1448 |
| 1128 | Ga0496113_0001950 | 3300048916 | Bacteria | 11812 |
| 1129 | Ga0496113_0008785 | 3300048916 | Bacteria | 6598 |
| 1130 | Ga0496113_0087302 | 3300048916 | Bacteria | 2398 |
| 1131 | Ga0496113_0189124 | 3300048916 | Bacteria | 1634 |
| 1132 | Ga0496114_0122875 | 3300048917 | Bacteria | 2234 |
| 1133 | Ga0496114_0253543 | 3300048917 | Bacteria | 1548 |
| 1134 | Ga0496115_0009549 | 3300048918 | Bacteria | 7206 |
| 1135 | Ga0496115_0019987 | 3300048918 | Bacteria | 5160 |
| 1136 | Ga0496115_0073699 | 3300048918 | Bacteria | 2771 |
| 1137 | Ga0496115_0127875 | 3300048918 | Bacteria | 2093 |
| 1138 | Ga0496115_0139123 | 3300048918 | Bacteria | 2002 |
| 1139 | Ga0496115_0152345 | 3300048918 | Bacteria | 1909 |
| 1140 | Ga0496115_0189422 | 3300048918 | Bacteria | 1699 |
| 1141 | Ga0501031_0016693 | 3300049568 | Bacteria | 4769 |
| 1142 | Ga0501031_0055503 | 3300049568 | Bacteria | 2581 |
| 1143 | Ga0501031_0062823 | 3300049568 | Bacteria | 2420 |
| 1144 | Ga0501031_0111803 | 3300049568 | Bacteria | 1784 |
| 1145 | Ga0501031_0128683 | 3300049568 | Bacteria | 1654 |
| 1146 | Ga0501032_0062347 | 3300049569 | Bacteria | 2498 |
| 1147 | Ga0501033_0008227 | 3300049570 | Bacteria | 8079 |
| 1148 | Ga0501033_0017629 | 3300049570 | Bacteria | 5394 |
| 1149 | Ga0501033_0044445 | 3300049570 | Bacteria | 3307 |
| 1150 | Ga0501034_0006692 | 3300049571 | Bacteria | 12361 |
| 1151 | Ga0501034_0029366 | 3300049571 | Bacteria | 5588 |
| 1152 | Ga0501034_0039017 | 3300049571 | Bacteria | 4810 |
| 1153 | Ga0501034_0080158 | 3300049571 | Bacteria | 3268 |
| 1154 | Ga0501034_0311184 | 3300049571 | Bacteria | 1509 |
| 1155 | Ga0501036_0018021 | 3300049572 | Bacteria | 5912 |
| 1156 | Ga0501036_0054799 | 3300049572 | Bacteria | 3378 |
| 1157 | Ga0501036_0090209 | 3300049572 | Bacteria | 2589 |
| 1158 | Ga0501036_0166604 | 3300049572 | Bacteria | 1857 |
| 1159 | Ga0501036_0246470 | 3300049572 | Bacteria | 1498 |
| 1160 | Ga0501037_0116612 | 3300049573 | Bacteria | 1922 |
| 1161 | Ga0501038_0000775 | 3300049574 | Bacteria | 28264 |
| 1162 | Ga0501038_0134268 | 3300049574 | Bacteria | 2029 |
| 1163 | Ga0501038_0153148 | 3300049574 | Bacteria | 1879 |
| 1164 | Ga0501039_0044530 | 3300049575 | Bacteria | 3428 |
| 1165 | Ga0501039_0057887 | 3300049575 | Bacteria | 3001 |
| 1166 | Ga0501039_0163702 | 3300049575 | Bacteria | 1749 |
| 1167 | Ga0501039_0201796 | 3300049575 | Bacteria | 1563 |
| 1168 | Ga0501039_0297066 | 3300049575 | Bacteria | 1270 |
| 1169 | Ga0501040_0009567 | 3300049576 | Bacteria | 6324 |
| 1170 | Ga0501040_0012594 | 3300049576 | Bacteria | 5545 |
| 1171 | Ga0501040_0138114 | 3300049576 | Unclassified | 1716 |
| 1172 | Ga0501040_0301252 | 3300049576 | Bacteria | 1146 |
| 1173 | Ga0501041_0017024 | 3300049577 | Bacteria | 4325 |
| 1174 | Ga0501041_0027793 | 3300049577 | Bacteria | 3410 |
| 1175 | Ga0501041_0095703 | 3300049577 | Bacteria | 1835 |
| 1176 | Ga0501041_0288703 | 3300049577 | Bacteria | 1033 |
| 1177 | Ga0501042_0044547 | 3300049578 | Bacteria | 3162 |
| 1178 | Ga0501042_0056371 | 3300049578 | Bacteria | 2804 |
| 1179 | Ga0501042_0082155 | 3300049578 | Bacteria | 2310 |
| 1180 | Ga0501042_0121352 | 3300049578 | Bacteria | 1882 |
| 1181 | Ga0501043_0050356 | 3300049579 | Bacteria | 3274 |
| 1182 | Ga0501043_0103007 | 3300049579 | Bacteria | 2243 |
| 1183 | Ga0501043_0138409 | 3300049579 | Bacteria | 1907 |
| 1184 | Ga0501046_0032814 | 3300049580 | Bacteria | 4201 |
| 1185 | Ga0501046_0039215 | 3300049580 | Bacteria | 3795 |
| 1186 | Ga0501046_0062896 | 3300049580 | Bacteria | 2899 |
| 1187 | Ga0501046_0120856 | 3300049580 | Bacteria | 1993 |
| 1188 | Ga0501046_0344041 | 3300049580 | Bacteria | 1083 |
| 1189 | Ga0501047_0006347 | 3300049581 | Bacteria | 11116 |
| 1190 | Ga0501047_0009067 | 3300049581 | Bacteria | 9395 |
| 1191 | Ga0501047_0018859 | 3300049581 | Bacteria | 6617 |
| 1192 | Ga0501047_0039533 | 3300049581 | Bacteria | 4562 |
| 1193 | Ga0501048_0107955 | 3300049582 | Bacteria | 1965 |
| 1194 | Ga0501068_0098761 | 3300049584 | Bacteria | 1808 |
| 1195 | Ga0501068_0139895 | 3300049584 | Bacteria | 1517 |
| 1196 | Ga0501069_0038797 | 3300049585 | Bacteria | 2630 |
| 1197 | Ga0501070_0027193 | 3300049586 | Bacteria | 4799 |
| 1198 | Ga0501070_0056684 | 3300049586 | Bacteria | 3248 |
| 1199 | Ga0501070_0097024 | 3300049586 | Bacteria | 2438 |
| 1200 | Ga0501071_0095714 | 3300049587 | Bacteria | 2185 |
| 1201 | Ga0501071_0156383 | 3300049587 | Bacteria | 1702 |
| 1202 | Ga0501072_0009124 | 3300049588 | Bacteria | 7532 |
| 1203 | Ga0501072_0020826 | 3300049588 | Bacteria | 5082 |
| 1204 | Ga0501072_0222407 | 3300049588 | Bacteria | 1504 |
| 1205 | Ga0501073_0123601 | 3300049589 | Bacteria | 1794 |
| 1206 | Ga0501074_0073296 | 3300049590 | Bacteria | 2460 |
| 1207 | Ga0501075_0004734 | 3300049591 | Bacteria | 9250 |
| 1208 | Ga0501075_0005155 | 3300049591 | Bacteria | 8937 |
| 1209 | Ga0501076_0001405 | 3300049592 | Bacteria | 16125 |
| 1210 | Ga0501076_0016440 | 3300049592 | Bacteria | 5610 |
| 1211 | Ga0501076_0064247 | 3300049592 | Bacteria | 2925 |
| 1212 | Ga0501076_0155999 | 3300049592 | Bacteria | 1858 |
| 1213 | Ga0501076_0212696 | 3300049592 | Bacteria | 1580 |
| 1214 | Ga0501076_0361151 | 3300049592 | Bacteria | 1193 |
| 1215 | Ga0501076_0579486 | 3300049592 | Unclassified | 925 |
| 1216 | Ga0501077_0007341 | 3300049593 | Bacteria | 6798 |
| 1217 | Ga0501077_0103962 | 3300049593 | Bacteria | 1800 |
| 1218 | Ga0501077_0150602 | 3300049593 | Unclassified | 1476 |
| 1219 | Ga0501077_0233313 | 3300049593 | Bacteria | 1170 |
| 1220 | Ga0501077_0248646 | 3300049593 | Bacteria | 1130 |
| 1221 | Ga0501079_0003233 | 3300049741 | Bacteria | 11932 |
| 1222 | Ga0501079_0040616 | 3300049741 | Bacteria | 3589 |
| 1223 | Ga0501079_0062842 | 3300049741 | Bacteria | 2864 |
| 1224 | Ga0501079_0118220 | 3300049741 | Bacteria | 2060 |
| 1225 | Ga0501079_0139506 | 3300049741 | Bacteria | 1888 |
| 1226 | Ga0501080_0021206 | 3300049742 | Bacteria | 6013 |
| 1227 | Ga0501080_0028713 | 3300049742 | Bacteria | 5178 |
| 1228 | Ga0501080_0096741 | 3300049742 | Bacteria | 2741 |
| 1229 | Ga0501081_0001767 | 3300049743 | Bacteria | 13415 |
| 1230 | Ga0501081_0010499 | 3300049743 | Bacteria | 6045 |
| 1231 | Ga0501081_0010888 | 3300049743 | Bacteria | 5945 |
| 1232 | Ga0501081_0024939 | 3300049743 | Bacteria | 4020 |
| 1233 | Ga0501081_0054812 | 3300049743 | Bacteria | 2755 |
| 1234 | Ga0501081_0055859 | 3300049743 | Bacteria | 2728 |
| 1235 | Ga0501083_0029184 | 3300049744 | Bacteria | 3796 |
| 1236 | Ga0501083_0063014 | 3300049744 | Bacteria | 2473 |
| 1237 | Ga0501083_0106169 | 3300049744 | Bacteria | 1849 |
| 1238 | Ga0501083_0141130 | 3300049744 | Bacteria | 1578 |
| 1239 | Ga0501035_0000127 | 3300049822 | Bacteria | 92397 |
| 1240 | Ga0501035_0022579 | 3300049822 | Bacteria | 5779 |
| 1241 | Ga0501044_0008177 | 3300049823 | Bacteria | 11483 |
| 1242 | Ga0501044_0023098 | 3300049823 | Bacteria | 6621 |
| 1243 | Ga0501044_0088157 | 3300049823 | Bacteria | 3133 |
| 1244 | Ga0501045_0018155 | 3300049824 | Bacteria | 4999 |
| 1245 | Ga0501045_0057834 | 3300049824 | Bacteria | 2838 |
| 1246 | Ga0501045_0133245 | 3300049824 | Bacteria | 1847 |
| 1247 | Ga0501045_0153487 | 3300049824 | Bacteria | 1713 |
| 1248 | Ga0501045_0162931 | 3300049824 | Bacteria | 1660 |
| 1249 | Ga0501045_0173509 | 3300049824 | Unclassified | 1606 |
| 1250 | nmdc:mga03683_4783_c1 | 3300050489 | Bacteria | 4521 |
| 1251 | nmdc:mga03683_56333_c1 | 3300050489 | Bacteria | 1652 |
| 1252 | nmdc:mga03n38_22752_c1 | 3300050490 | Bacteria | 2541 |
| 1253 | nmdc:mga00v17_126627_c1 | 3300050491 | Bacteria | 1630 |
| 1254 | nmdc:mga00v17_4490_c1 | 3300050491 | Bacteria | 7264 |
| 1255 | nmdc:mga0yw44_65200_c1 | 3300050492 | Bacteria | 2244 |
| 1256 | nmdc:mga0k408_2408_c1 | 3300050493 | Bacteria | 9952 |
| 1257 | nmdc:mga06z11_200577_c1 | 3300050494 | Unclassified | 1159 |
| 1258 | nmdc:mga07m45_84329_c2 | 3300050496 | Bacteria | 1514 |
| 1259 | nmdc:mga05p37_114724_c1 | 3300050507 | Bacteria | 3312 |
| 1260 | nmdc:mga05p37_148901_c1 | 3300050507 | Bacteria | 2865 |
| 1261 | nmdc:mga05p37_1808_c2 | 3300050507 | Bacteria | 13333 |
| 1262 | nmdc:mga05p37_227255_c1 | 3300050507 | Bacteria | 2250 |
| 1263 | nmdc:mga05p37_295597_c1 | 3300050507 | Bacteria | 1926 |
| 1264 | nmdc:mga05p37_356208_c1 | 3300050507 | Bacteria | 1722 |
| 1265 | nmdc:mga05p37_45950_c1 | 3300050507 | Bacteria | 5370 |
| 1266 | nmdc:mga05p37_508_c2 | 3300050507 | Bacteria | 7955 |
| 1267 | nmdc:mga05p37_711641_c1 | 3300050507 | Bacteria | 1114 |
| 1268 | nmdc:mga05p37_75031_c1 | 3300050507 | Bacteria | 4163 |
| 1269 | nmdc:mga05p37_888971_c1 | 3300050507 | Bacteria | 962 |
| 1270 | nmdc:mga09592_152046_c1 | 3300050508 | Bacteria | 1997 |
| 1271 | nmdc:mga09592_239014_c1 | 3300050508 | Bacteria | 1574 |
| 1272 | nmdc:mga09592_30039_c1 | 3300050508 | Bacteria | 4523 |
| 1273 | nmdc:mga09592_49791_c1 | 3300050508 | Bacteria | 3532 |
| 1274 | nmdc:mga09592_5057_c1 | 3300050508 | Bacteria | 10702 |
| 1275 | nmdc:mga0qj67_15510_c1 | 3300050509 | Bacteria | 5769 |
| 1276 | nmdc:mga0qj67_5333_c1 | 3300050509 | Bacteria | 9380 |
| 1277 | nmdc:mga06r32_124972_c1 | 3300050510 | Bacteria | 2540 |
| 1278 | nmdc:mga06r32_146979_c1 | 3300050510 | Bacteria | 2334 |
| 1279 | nmdc:mga06r32_1960_c1 | 3300050510 | Bacteria | 18367 |
| 1280 | nmdc:mga06r32_236663_c1 | 3300050510 | Bacteria | 1813 |
| 1281 | nmdc:mga06r32_33897_c1 | 3300050510 | Bacteria | 4812 |
| 1282 | nmdc:mga06r32_3441_c1 | 3300050510 | Bacteria | 14162 |
| 1283 | nmdc:mga06r32_4445_c1 | 3300050510 | Bacteria | 12549 |
| 1284 | nmdc:mga06r32_479484_c1 | 3300050510 | Bacteria | 1222 |
| 1285 | nmdc:mga06r32_53801_c1 | 3300050510 | Bacteria | 3858 |
| 1286 | nmdc:mga08y16_14675_c1 | 3300050511 | Bacteria | 8238 |
| 1287 | nmdc:mga08y16_2332_c1 | 3300050511 | Bacteria | 19466 |
| 1288 | nmdc:mga08y16_3146_c1 | 3300050511 | Bacteria | 17090 |
| 1289 | nmdc:mga08y16_378174_c1 | 3300050511 | Unclassified | 1452 |
| 1290 | nmdc:mga08y16_3939_c1 | 3300050511 | Bacteria | 15466 |
| 1291 | nmdc:mga08y16_566179_c1 | 3300050511 | Bacteria | 1149 |
| 1292 | nmdc:mga08y16_63381_c1 | 3300050511 | Bacteria | 3860 |
| 1293 | nmdc:mga08y16_640818_c1 | 3300050511 | Bacteria | 1068 |
| 1294 | nmdc:mga08y16_75718_c1 | 3300050511 | Bacteria | 3508 |
| 1295 | nmdc:mga08y16_9215_c1 | 3300050511 | Bacteria | 10357 |
| 1296 | nmdc:mga0n895_142493_c1 | 3300050512 | Bacteria | 2426 |
| 1297 | nmdc:mga0n895_145_c1 | 3300050512 | Bacteria | 43408 |
| 1298 | nmdc:mga0n895_149686_c1 | 3300050512 | Bacteria | 2364 |
| 1299 | nmdc:mga0n895_159698_c1 | 3300050512 | Bacteria | 2285 |
| 1300 | nmdc:mga0n895_204112_c1 | 3300050512 | Bacteria | 2007 |
| 1301 | nmdc:mga0n895_37534_c1 | 3300050512 | Bacteria | 4688 |
| 1302 | nmdc:mga0n895_429381_c1 | 3300050512 | Bacteria | 1335 |
| 1303 | nmdc:mga0n895_450487_c1 | 3300050512 | Bacteria | 1300 |
| 1304 | nmdc:mga0n895_4696_c1 | 3300050512 | Bacteria | 11271 |
| 1305 | nmdc:mga0n895_494323_c1 | 3300050512 | Bacteria | 1233 |
| 1306 | nmdc:mga0n895_4964_c1 | 3300050512 | Bacteria | 11037 |
| 1307 | nmdc:mga0n895_545530_c1 | 3300050512 | Bacteria | 1165 |
| 1308 | nmdc:mga0n895_56995_c1 | 3300050512 | Bacteria | 3851 |
| 1309 | nmdc:mga0n895_662439_c1 | 3300050512 | Bacteria | 1042 |
| 1310 | nmdc:mga0n895_697_c1 | 3300050512 | Bacteria | 23592 |
| 1311 | nmdc:mga0n895_79449_c1 | 3300050512 | Bacteria | 3267 |
| 1312 | nmdc:mga0rr50_1966_c1 | 3300050513 | Bacteria | 11411 |
| 1313 | nmdc:mga0rr50_2684_c1 | 3300050513 | Bacteria | 10078 |
| 1314 | nmdc:mga0rr50_26927_c1 | 3300050513 | Bacteria | 4020 |
| 1315 | nmdc:mga0rr50_354727_c1 | 3300050513 | Bacteria | 1234 |
| 1316 | nmdc:mga0rr50_42859_c1 | 3300050513 | Bacteria | 3308 |
| 1317 | nmdc:mga0rr50_48815_c1 | 3300050513 | Bacteria | 3131 |
| 1318 | nmdc:mga0rr50_59705_c1 | 3300050513 | Bacteria | 2865 |
| 1319 | nmdc:mga08x19_113019_c1 | 3300050514 | Bacteria | 1813 |
| 1320 | nmdc:mga08x19_1133_c1 | 3300050514 | Bacteria | 16621 |
| 1321 | nmdc:mga08x19_33203_c1 | 3300050514 | Bacteria | 3256 |
| 1322 | nmdc:mga08x19_73938_c1 | 3300050514 | Bacteria | 1451 |
| 1323 | nmdc:mga0a205_17058_c2 | 3300050515 | Bacteria | 3488 |
| 1324 | nmdc:mga0a205_17080_c2 | 3300050515 | Bacteria | 3784 |
| 1325 | nmdc:mga0a205_18201_c1 | 3300050515 | Bacteria | 6599 |
| 1326 | nmdc:mga0a205_1921_c1 | 3300050515 | Bacteria | 18059 |
| 1327 | nmdc:mga0a205_19981_c1 | 3300050515 | Bacteria | 6319 |
| 1328 | nmdc:mga0a205_212511_c1 | 3300050515 | Bacteria | 1822 |
| 1329 | nmdc:mga0a205_2724_c1 | 3300050515 | Bacteria | 15622 |
| 1330 | nmdc:mga0a205_44400_c1 | 3300050515 | Bacteria | 4284 |
| 1331 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1332 | Ga0495601_0001042 | 3300053077 | Bacteria | 15154 |
| 1333 | Ga0495601_0001925 | 3300053077 | Bacteria | 11619 |
| 1334 | Ga0495601_0044685 | 3300053077 | Bacteria | 2784 |
| 1335 | Ga0495601_0153402 | 3300053077 | Bacteria | 1504 |
| 1336 | Ga0495601_0224351 | 3300053077 | Bacteria | 1227 |
| 1337 | Ga0495601_0230234 | 3300053077 | Bacteria | 1210 |
| 1338 | Ga0495612_0000026 | 3300053078 | Bacteria | 111627 |
| 1339 | Ga0495612_0000858 | 3300053078 | Bacteria | 12361 |
| 1340 | Ga0495612_0012643 | 3300053078 | Bacteria | 3403 |
| 1341 | Ga0495612_0021006 | 3300053078 | Bacteria | 2618 |
| 1342 | Ga0495595_0000024 | 3300053084 | Bacteria | 108008 |
| 1343 | Ga0495595_0000879 | 3300053084 | Bacteria | 11535 |
| 1344 | Ga0495595_0006336 | 3300053084 | Bacteria | 4819 |
| 1345 | Ga0495595_0010002 | 3300053084 | Bacteria | 3933 |
| 1346 | Ga0495595_0026796 | 3300053084 | Bacteria | 2563 |
| 1347 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1348 | Ga0495619_0000229 | 3300053085 | Bacteria | 40785 |
| 1349 | Ga0495619_0002881 | 3300053085 | Bacteria | 11182 |
| 1350 | Ga0495619_0005795 | 3300053085 | Bacteria | 7828 |
| 1351 | Ga0495619_0013992 | 3300053085 | Bacteria | 5062 |
| 1352 | Ga0495619_0018217 | 3300053085 | Bacteria | 4453 |
| 1353 | Ga0495619_0022907 | 3300053085 | Bacteria | 3998 |
| 1354 | Ga0495619_0177839 | 3300053085 | Bacteria | 1472 |
| 1355 | Ga0500643_009516 | 3300053087 | Bacteria | 3706 |
| 1356 | Ga0500593_023541 | 3300053117 | Bacteria | 2727 |
| 1357 | Ga0500594_0047434 | 3300053118 | Bacteria | 1198 |
| 1358 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1359 | Ga0500589_072464 | 3300053147 | Bacteria | 1556 |
| 1360 | Ga0500604_0030341 | 3300053151 | Bacteria | 1581 |
| 1361 | Ga0500604_0069737 | 3300053151 | Bacteria | 1119 |
| 1362 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1363 | Ga0500616_0042710 | 3300053153 | Bacteria | 2426 |
| 1364 | Ga0500645_000015 | 3300053730 | Bacteria | 150140 |
| 1365 | Ga0501084_0046785 | 3300054114 | Bacteria | 3624 |
| 1366 | Ga0501084_0068704 | 3300054114 | Bacteria | 2966 |
| 1367 | Ga0501084_0077346 | 3300054114 | Bacteria | 2790 |
| 1368 | Ga0501084_0137519 | 3300054114 | Bacteria | 2056 |
| 1369 | Ga0501084_0170353 | 3300054114 | Bacteria | 1838 |
| 1370 | Ga0590077_005770 | 3300059426 | Bacteria | 2536 |
| 1371 | Ga0501082_0000013 | 3300060353 | Bacteria | 119623 |
| 1372 | Ga0501082_0011948 | 3300060353 | Bacteria | 7466 |
| 1373 | Ga0501082_0013431 | 3300060353 | Bacteria | 7039 |
| 1374 | Ga0501082_0015413 | 3300060353 | Bacteria | 6579 |
| 1375 | Ga0501082_0152268 | 3300060353 | Bacteria | 2009 |
| 1376 | Ga0501082_0271122 | 3300060353 | Bacteria | 1477 |
| 1377 | Ga0530510_0000596 | 3300061734 | Bacteria | 23255 |
| 1378 | Ga0530510_0030147 | 3300061734 | Bacteria | 3895 |
| 1379 | Ga0530510_0111429 | 3300061734 | Bacteria | 2004 |
| 1380 | Ga0530510_0224288 | 3300061734 | Bacteria | 1397 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0016693 | Ga0501031_0016693_362_1372 | 231 |
| 2 | 3300049569 | Ga0501032_0062347 | Ga0501032_0062347_881_1891 | 231 |
| 3 | 3300049570 | Ga0501033_0017629 | Ga0501033_0017629_3881_4891 | 231 |
| 4 | 3300049571 | Ga0501034_0039017 | Ga0501034_0039017_229_1239 | 231 |
| 5 | 3300049572 | Ga0501036_0054799 | Ga0501036_0054799_1841_2851 | 231 |
| 6 | 3300049575 | Ga0501039_0057887 | Ga0501039_0057887_268_1278 | 231 |
| 7 | 3300049822 | Ga0501035_0022579 | Ga0501035_0022579_1612_2622 | 231 |
| 8 | 3300049571 | Ga0501034_0311184 | Ga0501034_0311184_248_1258 | 233 |
| 9 | 3300049572 | Ga0501036_0166604 | Ga0501036_0166604_490_1500 | 233 |
| 10 | 3300049573 | Ga0501037_0116612 | Ga0501037_0116612_550_1560 | 233 |
| 11 | 3300049574 | Ga0501038_0134268 | Ga0501038_0134268_266_1276 | 233 |
| 12 | 3300049579 | Ga0501043_0138409 | Ga0501043_0138409_604_1614 | 233 |
| 13 | 3300049580 | Ga0501046_0120856 | Ga0501046_0120856_400_1410 | 233 |
| 14 | 3300049586 | Ga0501070_0097024 | Ga0501070_0097024_961_1971 | 233 |
| 15 | 3300028800 | Ga0265338_10076159 | Ga0265338_100761593 | 250 |
| 16 | 3300049568 | Ga0501031_0128683 | Ga0501031_0128683_464_1429 | 251 |
| 17 | 3300049570 | Ga0501033_0008227 | Ga0501033_0008227_653_1618 | 251 |
| 18 | 3300049572 | Ga0501036_0090209 | Ga0501036_0090209_407_1372 | 251 |
| 19 | 3300049574 | Ga0501038_0000775 | Ga0501038_0000775_1428_2393 | 251 |
| 20 | 3300049575 | Ga0501039_0201796 | Ga0501039_0201796_266_1231 | 251 |
| 21 | 3300049576 | Ga0501040_0009567 | Ga0501040_0009567_1052_2017 | 251 |
| 22 | 3300049577 | Ga0501041_0027793 | Ga0501041_0027793_762_1727 | 251 |
| 23 | 3300049578 | Ga0501042_0056371 | Ga0501042_0056371_1365_2330 | 251 |
| 24 | 3300049579 | Ga0501043_0050356 | Ga0501043_0050356_391_1356 | 251 |
| 25 | 3300049580 | Ga0501046_0344041 | Ga0501046_0344041_63_1028 | 251 |
| 26 | 3300049584 | Ga0501068_0098761 | Ga0501068_0098761_718_1683 | 251 |
| 27 | 3300049587 | Ga0501071_0095714 | Ga0501071_0095714_1006_1971 | 251 |
| 28 | 3300049591 | Ga0501075_0005155 | Ga0501075_0005155_1215_2180 | 251 |
| 29 | 3300049592 | Ga0501076_0155999 | Ga0501076_0155999_527_1492 | 251 |
| 30 | 3300049593 | Ga0501077_0248646 | Ga0501077_0248646_102_1067 | 251 |
| 31 | 3300049741 | Ga0501079_0040616 | Ga0501079_0040616_1527_2492 | 251 |
| 32 | 3300049742 | Ga0501080_0028713 | Ga0501080_0028713_1036_2001 | 251 |
| 33 | 3300049743 | Ga0501081_0010499 | Ga0501081_0010499_4205_5170 | 251 |
| 34 | 3300049824 | Ga0501045_0153487 | Ga0501045_0153487_146_1111 | 251 |
| 35 | 3300054114 | Ga0501084_0137519 | Ga0501084_0137519_521_1486 | 251 |
| 36 | 3300060353 | Ga0501082_0011948 | Ga0501082_0011948_6435_7400 | 251 |
| 37 | 3300061734 | Ga0530510_0111429 | Ga0530510_0111429_898_1863 | 251 |
| 38 | 3300003911 | JGI25405J52794_10004445 | JGI25405J52794_100044452 | 252 |
| 39 | 3300005459 | Ga0068867_100434058 | Ga0068867_1004340581 | 252 |
| 40 | 3300005937 | Ga0081455_10003284 | Ga0081455_100032846 | 252 |
| 41 | 3300005985 | Ga0081539_10023001 | Ga0081539_100230012 | 252 |
| 42 | 3300006177 | Ga0075362_10000839 | Ga0075362_100008398 | 252 |
| 43 | 3300006178 | Ga0075367_10103410 | Ga0075367_101034102 | 252 |
| 44 | 3300006195 | Ga0075366_10001687 | Ga0075366_100016876 | 252 |
| 45 | 3300006852 | Ga0075433_10149589 | Ga0075433_101495892 | 252 |
| 46 | 3300006871 | Ga0075434_100038594 | Ga0075434_1000385943 | 252 |
| 47 | 3300009147 | Ga0114129_10065278 | Ga0114129_100652785 | 252 |
| 48 | 3300046460 | Ga0495638_0003988 | Ga0495638_0003988_5934_6914 | 252 |
| 49 | 3300046460 | Ga0495638_0077367 | Ga0495638_0077367_850_1824 | 252 |
| 50 | 3300047447 | Ga0495685_021278 | Ga0495685_021278_523_1506 | 252 |
| 51 | 3300050489 | nmdc:mga03683_4783_c1 | nmdc:mga03683_4783_c1_3504_4481 | 252 |
| 52 | 3300050490 | nmdc:mga03n38_22752_c1 | nmdc:mga03n38_22752_c1_54_1031 | 252 |
| 53 | 3300050491 | nmdc:mga00v17_4490_c1 | nmdc:mga00v17_4490_c1_1812_2789 | 252 |
| 54 | 3300050493 | nmdc:mga0k408_2408_c1 | nmdc:mga0k408_2408_c1_1142_2119 | 252 |
| 55 | 3300050507 | nmdc:mga05p37_148901_c1 | nmdc:mga05p37_148901_c1_922_1929 | 252 |
| 56 | 3300050510 | nmdc:mga06r32_479484_c1 | nmdc:mga06r32_479484_c1_175_1161 | 252 |
| 57 | 3300050512 | nmdc:mga0n895_79449_c1 | nmdc:mga0n895_79449_c1_1133_2140 | 252 |
| 58 | 3300053147 | Ga0500589_072464 | Ga0500589_072464_346_1326 | 252 |
| 59 | 3300053151 | Ga0500604_0030341 | Ga0500604_0030341_586_1566 | 252 |
| 60 | 3300060353 | Ga0501082_0000013 | Ga0501082_0000013_80136_81116 | 252 |
| 61 | 3300003203 | JGI25406J46586_10009736 | JGI25406J46586_100097363 | 253 |
| 62 | 3300005985 | Ga0081539_10008542 | Ga0081539_100085424 | 253 |
| 63 | 3300006871 | Ga0075434_100171810 | Ga0075434_1001718102 | 253 |
| 64 | 3300050512 | nmdc:mga0n895_56995_c1 | nmdc:mga0n895_56995_c1_521_1519 | 253 |
| 65 | 3300005340 | Ga0070689_100063151 | Ga0070689_1000631513 | 254 |
| 66 | 3300005343 | Ga0070687_100094904 | Ga0070687_1000949042 | 254 |
| 67 | 3300005466 | Ga0070685_10023443 | Ga0070685_100234434 | 254 |
| 68 | 3300006880 | Ga0075429_100128342 | Ga0075429_1001283422 | 254 |
| 69 | 3300009098 | Ga0105245_10131013 | Ga0105245_101310132 | 254 |
| 70 | 3300025927 | Ga0207687_10030379 | Ga0207687_100303792 | 254 |
| 71 | 3300025936 | Ga0207670_10027140 | Ga0207670_100271402 | 254 |
| 72 | 3300026023 | Ga0207677_10229464 | Ga0207677_102294642 | 254 |
| 73 | 3300026118 | Ga0207675_100191507 | Ga0207675_1001915072 | 254 |
| 74 | 3300050508 | nmdc:mga09592_49791_c1 | nmdc:mga09592_49791_c1_2067_3053 | 254 |
| 75 | 3300005329 | Ga0070683_100131327 | Ga0070683_1001313271 | 255 |
| 76 | 3300005338 | Ga0068868_100239938 | Ga0068868_1002399382 | 255 |
| 77 | 3300005340 | Ga0070689_100086925 | Ga0070689_1000869253 | 255 |
| 78 | 3300005438 | Ga0070701_10203237 | Ga0070701_102032371 | 255 |
| 79 | 3300005535 | Ga0070684_100031662 | Ga0070684_1000316622 | 255 |
| 80 | 3300005549 | Ga0070704_100314933 | Ga0070704_1003149331 | 255 |
| 81 | 3300005617 | Ga0068859_100259579 | Ga0068859_1002595792 | 255 |
| 82 | 3300005618 | Ga0068864_100444139 | Ga0068864_1004441392 | 255 |
| 83 | 3300005841 | Ga0068863_100107195 | Ga0068863_1001071952 | 255 |
| 84 | 3300006931 | Ga0097620_100259577 | Ga0097620_1002595772 | 255 |
| 85 | 3300009551 | Ga0105238_10011216 | Ga0105238_100112168 | 255 |
| 86 | 3300025907 | Ga0207645_10063209 | Ga0207645_100632092 | 255 |
| 87 | 3300025911 | Ga0207654_10196411 | Ga0207654_101964111 | 255 |
| 88 | 3300025924 | Ga0207694_10044775 | Ga0207694_100447752 | 255 |
| 89 | 3300025931 | Ga0207644_10120249 | Ga0207644_101202492 | 255 |
| 90 | 3300026075 | Ga0207708_10115624 | Ga0207708_101156242 | 255 |
| 91 | 3300026095 | Ga0207676_10100203 | Ga0207676_101002031 | 255 |
| 92 | 3300026116 | Ga0207674_10082603 | Ga0207674_100826033 | 255 |
| 93 | 3300035691 | Ga0373931_0346212 | Ga0373931_0346212_11_898 | 255 |
| 94 | 3300005290 | Ga0065712_10026023 | Ga0065712_100260231 | 256 |
| 95 | 3300005367 | Ga0070667_100128914 | Ga0070667_1001289143 | 256 |
| 96 | 3300025926 | Ga0207659_10139648 | Ga0207659_101396482 | 256 |
| 97 | 3300025933 | Ga0207706_10064354 | Ga0207706_100643543 | 256 |
| 98 | 3300025986 | Ga0207658_10034444 | Ga0207658_100344443 | 256 |
| 99 | 3300026089 | Ga0207648_10167995 | Ga0207648_101679952 | 256 |
| 100 | 3300026121 | Ga0207683_10327574 | Ga0207683_103275742 | 256 |
| 101 | 3300046537 | Ga0495598_0021953 | Ga0495598_0021953_618_1595 | 256 |
| 102 | 3300048090 | Ga0495615_0025543 | Ga0495615_0025543_153_1130 | 256 |
| 103 | 3300005334 | Ga0068869_100181230 | Ga0068869_1001812302 | 257 |
| 104 | 3300005617 | Ga0068859_100104533 | Ga0068859_1001045333 | 257 |
| 105 | 3300005618 | Ga0068864_100053465 | Ga0068864_1000534652 | 257 |
| 106 | 3300005842 | Ga0068858_100173525 | Ga0068858_1001735252 | 257 |
| 107 | 3300005844 | Ga0068862_100256818 | Ga0068862_1002568182 | 257 |
| 108 | 3300006852 | Ga0075433_10006137 | Ga0075433_100061375 | 257 |
| 109 | 3300006871 | Ga0075434_100001159 | Ga0075434_10000115915 | 257 |
| 110 | 3300006914 | Ga0075436_100002192 | Ga0075436_1000021925 | 257 |
| 111 | 3300006931 | Ga0097620_100104537 | Ga0097620_1001045372 | 257 |
| 112 | 3300007076 | Ga0075435_100000432 | Ga0075435_10000043225 | 257 |
| 113 | 3300009094 | Ga0111539_10019998 | Ga0111539_100199982 | 257 |
| 114 | 3300026035 | Ga0207703_10195052 | Ga0207703_101950522 | 257 |
| 115 | 3300026095 | Ga0207676_10127208 | Ga0207676_101272082 | 257 |
| 116 | 3300050511 | nmdc:mga08y16_9215_c1 | nmdc:mga08y16_9215_c1_6155_7123 | 257 |
| 117 | 3300050512 | nmdc:mga0n895_4696_c1 | nmdc:mga0n895_4696_c1_8343_9311 | 257 |
| 118 | 3300050513 | nmdc:mga0rr50_1966_c1 | nmdc:mga0rr50_1966_c1_8483_9451 | 257 |
| 119 | 3300050514 | nmdc:mga08x19_1133_c1 | nmdc:mga08x19_1133_c1_6710_7678 | 257 |
| 120 | 3300050515 | nmdc:mga0a205_1921_c1 | nmdc:mga0a205_1921_c1_9307_10275 | 257 |
| 121 | 3300006852 | Ga0075433_10218749 | Ga0075433_102187492 | 258 |
| 122 | 3300005545 | Ga0070695_100110603 | Ga0070695_1001106032 | 259 |
| 123 | 3300042876 | Ga0451577_0147580 | Ga0451577_0147580_857_1825 | 259 |
| 124 | 3300045051 | Ga0451576_0017130 | Ga0451576_0017130_5951_6919 | 259 |
| 125 | 3300005293 | Ga0065715_10094907 | Ga0065715_100949074 | 260 |
| 126 | 3300005546 | Ga0070696_100029222 | Ga0070696_1000292221 | 260 |
| 127 | 3300035207 | Ga0373942_0056815 | Ga0373942_0056815_37_885 | 260 |
| 128 | 3300050515 | nmdc:mga0a205_212511_c1 | nmdc:mga0a205_212511_c1_483_1331 | 260 |
| 129 | 3300005436 | Ga0070713_100064124 | Ga0070713_1000641242 | 262 |
| 130 | 3300006871 | Ga0075434_100096480 | Ga0075434_1000964803 | 262 |
| 131 | 3300025916 | Ga0207663_10119841 | Ga0207663_101198411 | 262 |
| 132 | 3300025928 | Ga0207700_10083953 | Ga0207700_100839533 | 262 |
| 133 | 3300025929 | Ga0207664_10205112 | Ga0207664_102051122 | 262 |
| 134 | 3300028800 | Ga0265338_10020616 | Ga0265338_100206162 | 262 |
| 135 | 3300031090 | Ga0265760_10071838 | Ga0265760_100718381 | 262 |
| 136 | 3300031249 | Ga0265339_10000107 | Ga0265339_1000010764 | 262 |
| 137 | 3300035111 | Ga0373923_0053917 | Ga0373923_0053917_292_1296 | 262 |
| 138 | 3300036401 | Ga0373937_0160827 | Ga0373937_0160827_1044_2036 | 262 |
| 139 | 3300044694 | Ga0466963_0046783 | Ga0466963_0046783_758_1744 | 262 |
| 140 | 3300044735 | Ga0466968_0091790 | Ga0466968_0091790_309_1301 | 262 |
| 141 | 3300045049 | Ga0466959_0065728 | Ga0466959_0065728_1030_2016 | 262 |
| 142 | 3300045836 | Ga0466958_0076835 | Ga0466958_0076835_58_1044 | 262 |
| 143 | 3300046529 | Ga0495652_0154159 | Ga0495652_0154159_695_1687 | 262 |
| 144 | 3300046680 | Ga0495646_0002316 | Ga0495646_0002316_9392_10375 | 262 |
| 145 | 3300047319 | Ga0495674_0214125 | Ga0495674_0214125_93_1085 | 262 |
| 146 | 3300047322 | Ga0495680_0273037 | Ga0495680_0273037_103_1095 | 262 |
| 147 | 3300049575 | Ga0501039_0163702 | Ga0501039_0163702_167_1156 | 262 |
| 148 | 3300049577 | Ga0501041_0288703 | Ga0501041_0288703_56_1021 | 262 |
| 149 | 3300049585 | Ga0501069_0038797 | Ga0501069_0038797_676_1665 | 262 |
| 150 | 3300049592 | Ga0501076_0064247 | Ga0501076_0064247_481_1470 | 262 |
| 151 | 3300049744 | Ga0501083_0063014 | Ga0501083_0063014_503_1492 | 262 |
| 152 | 2162886006 | SwRhRL3b_contig_149540 | SwRhRL3b_0814.00002160 | 263 |
| 153 | 2209111006 | 2214772980 | 2213792851 | 263 |
| 154 | 3300000041 | ARcpr5oldR_c000026 | ARcpr5oldR_00002613 | 263 |
| 155 | 3300000042 | ARSoilYngRDRAFT_c00029 | ARSoilYngRDRAFT_0002913 | 263 |
| 156 | 3300000043 | ARcpr5yngRDRAFT_c000044 | ARcpr5yngRDRAFT_00004413 | 263 |
| 157 | 3300000044 | ARSoilOldRDRAFT_c000037 | ARSoilOldRDRAFT_00003721 | 263 |
| 158 | 3300000652 | ARCol0yngRDRAFT_1000020 | ARCol0yngRDRAFT_100002013 | 263 |
| 159 | 3300001978 | JGI24747J21853_1003341 | JGI24747J21853_10033412 | 263 |
| 160 | 3300001989 | JGI24739J22299_10004550 | JGI24739J22299_100045507 | 263 |
| 161 | 3300001989 | JGI24739J22299_10008850 | JGI24739J22299_100088504 | 263 |
| 162 | 3300001990 | JGI24737J22298_10001930 | JGI24737J22298_100019302 | 263 |
| 163 | 3300001990 | JGI24737J22298_10004430 | JGI24737J22298_100044305 | 263 |
| 164 | 3300002070 | JGI24750J21931_1000586 | JGI24750J21931_10005867 | 263 |
| 165 | 3300002070 | JGI24750J21931_1004848 | JGI24750J21931_10048482 | 263 |
| 166 | 3300002073 | JGI24745J21846_1000864 | JGI24745J21846_10008641 | 263 |
| 167 | 3300002074 | JGI24748J21848_1002686 | JGI24748J21848_10026862 | 263 |
| 168 | 3300002075 | JGI24738J21930_10002565 | JGI24738J21930_100025652 | 263 |
| 169 | 3300002076 | JGI24749J21850_1001223 | JGI24749J21850_10012233 | 263 |
| 170 | 3300002077 | JGI24744J21845_10000745 | JGI24744J21845_100007457 | 263 |
| 171 | 3300002155 | JGI24033J26618_1004836 | JGI24033J26618_10048362 | 263 |
| 172 | 3300002239 | JGI24034J26672_10009358 | JGI24034J26672_100093582 | 263 |
| 173 | 3300002244 | JGI24742J22300_10000139 | JGI24742J22300_1000013913 | 263 |
| 174 | 3300002244 | JGI24742J22300_10013412 | JGI24742J22300_100134121 | 263 |
| 175 | 3300003911 | JGI25405J52794_10030165 | JGI25405J52794_100301651 | 263 |
| 176 | 3300005276 | Ga0065717_1002108 | Ga0065717_10021082 | 263 |
| 177 | 3300005277 | Ga0065716_1001673 | Ga0065716_10016732 | 263 |
| 178 | 3300005289 | Ga0065704_10089952 | Ga0065704_100899522 | 263 |
| 179 | 3300005289 | Ga0065704_10118765 | Ga0065704_101187652 | 263 |
| 180 | 3300005290 | Ga0065712_10071735 | Ga0065712_100717354 | 263 |
| 181 | 3300005290 | Ga0065712_10077193 | Ga0065712_100771931 | 263 |
| 182 | 3300005290 | Ga0065712_10079021 | Ga0065712_100790212 | 263 |
| 183 | 3300005290 | Ga0065712_10109644 | Ga0065712_101096442 | 263 |
| 184 | 3300005293 | Ga0065715_10092917 | Ga0065715_100929171 | 263 |
| 185 | 3300005293 | Ga0065715_10113387 | Ga0065715_101133873 | 263 |
| 186 | 3300005295 | Ga0065707_10015385 | Ga0065707_100153852 | 263 |
| 187 | 3300005295 | Ga0065707_10113495 | Ga0065707_101134952 | 263 |
| 188 | 3300005295 | Ga0065707_10126631 | Ga0065707_101266312 | 263 |
| 189 | 3300005327 | Ga0070658_10087550 | Ga0070658_100875502 | 263 |
| 190 | 3300005328 | Ga0070676_10001078 | Ga0070676_100010785 | 263 |
| 191 | 3300005328 | Ga0070676_10054636 | Ga0070676_100546362 | 263 |
| 192 | 3300005328 | Ga0070676_10122285 | Ga0070676_101222852 | 263 |
| 193 | 3300005329 | Ga0070683_100007390 | Ga0070683_1000073904 | 263 |
| 194 | 3300005329 | Ga0070683_100290541 | Ga0070683_1002905412 | 263 |
| 195 | 3300005330 | Ga0070690_100020059 | Ga0070690_1000200593 | 263 |
| 196 | 3300005330 | Ga0070690_100023267 | Ga0070690_1000232673 | 263 |
| 197 | 3300005330 | Ga0070690_100052599 | Ga0070690_1000525992 | 263 |
| 198 | 3300005330 | Ga0070690_100080239 | Ga0070690_1000802392 | 263 |
| 199 | 3300005330 | Ga0070690_100115033 | Ga0070690_1001150332 | 263 |
| 200 | 3300005331 | Ga0070670_100037546 | Ga0070670_1000375464 | 263 |
| 201 | 3300005331 | Ga0070670_100211992 | Ga0070670_1002119922 | 263 |
| 202 | 3300005331 | Ga0070670_100249424 | Ga0070670_1002494241 | 263 |
| 203 | 3300005333 | Ga0070677_10000009 | Ga0070677_100000092 | 263 |
| 204 | 3300005334 | Ga0068869_100023901 | Ga0068869_1000239012 | 263 |
| 205 | 3300005334 | Ga0068869_100062092 | Ga0068869_1000620922 | 263 |
| 206 | 3300005335 | Ga0070666_10087321 | Ga0070666_100873212 | 263 |
| 207 | 3300005335 | Ga0070666_10257883 | Ga0070666_102578832 | 263 |
| 208 | 3300005336 | Ga0070680_100004715 | Ga0070680_1000047155 | 263 |
| 209 | 3300005336 | Ga0070680_100069756 | Ga0070680_1000697563 | 263 |
| 210 | 3300005336 | Ga0070680_100081718 | Ga0070680_1000817182 | 263 |
| 211 | 3300005336 | Ga0070680_100412129 | Ga0070680_1004121291 | 263 |
| 212 | 3300005337 | Ga0070682_100001091 | Ga0070682_10000109119 | 263 |
| 213 | 3300005337 | Ga0070682_100049089 | Ga0070682_1000490892 | 263 |
| 214 | 3300005337 | Ga0070682_100127156 | Ga0070682_1001271562 | 263 |
| 215 | 3300005338 | Ga0068868_100037790 | Ga0068868_1000377904 | 263 |
| 216 | 3300005338 | Ga0068868_100261789 | Ga0068868_1002617892 | 263 |
| 217 | 3300005339 | Ga0070660_100001398 | Ga0070660_1000013989 | 263 |
| 218 | 3300005339 | Ga0070660_100144322 | Ga0070660_1001443222 | 263 |
| 219 | 3300005339 | Ga0070660_100196169 | Ga0070660_1001961691 | 263 |
| 220 | 3300005339 | Ga0070660_100231278 | Ga0070660_1002312781 | 263 |
| 221 | 3300005340 | Ga0070689_100008504 | Ga0070689_1000085044 | 263 |
| 222 | 3300005340 | Ga0070689_100044808 | Ga0070689_1000448083 | 263 |
| 223 | 3300005341 | Ga0070691_10000769 | Ga0070691_100007698 | 263 |
| 224 | 3300005341 | Ga0070691_10002420 | Ga0070691_100024208 | 263 |
| 225 | 3300005343 | Ga0070687_100000649 | Ga0070687_1000006492 | 263 |
| 226 | 3300005343 | Ga0070687_100071219 | Ga0070687_1000712192 | 263 |
| 227 | 3300005343 | Ga0070687_100119767 | Ga0070687_1001197671 | 263 |
| 228 | 3300005344 | Ga0070661_100001076 | Ga0070661_10000107620 | 263 |
| 229 | 3300005344 | Ga0070661_100289923 | Ga0070661_1002899231 | 263 |
| 230 | 3300005345 | Ga0070692_10015532 | Ga0070692_100155323 | 263 |
| 231 | 3300005347 | Ga0070668_100012317 | Ga0070668_1000123171 | 263 |
| 232 | 3300005353 | Ga0070669_100005888 | Ga0070669_1000058884 | 263 |
| 233 | 3300005353 | Ga0070669_100042372 | Ga0070669_1000423721 | 263 |
| 234 | 3300005353 | Ga0070669_100271323 | Ga0070669_1002713231 | 263 |
| 235 | 3300005354 | Ga0070675_100000727 | Ga0070675_10000072723 | 263 |
| 236 | 3300005354 | Ga0070675_100102688 | Ga0070675_1001026882 | 263 |
| 237 | 3300005355 | Ga0070671_100000438 | Ga0070671_10000043815 | 263 |
| 238 | 3300005356 | Ga0070674_100001976 | Ga0070674_1000019768 | 263 |
| 239 | 3300005364 | Ga0070673_100001186 | Ga0070673_1000011868 | 263 |
| 240 | 3300005364 | Ga0070673_100291181 | Ga0070673_1002911811 | 263 |
| 241 | 3300005365 | Ga0070688_100022325 | Ga0070688_1000223251 | 263 |
| 242 | 3300005365 | Ga0070688_100060450 | Ga0070688_1000604502 | 263 |
| 243 | 3300005365 | Ga0070688_100075351 | Ga0070688_1000753512 | 263 |
| 244 | 3300005365 | Ga0070688_100203341 | Ga0070688_1002033411 | 263 |
| 245 | 3300005365 | Ga0070688_100320875 | Ga0070688_1003208751 | 263 |
| 246 | 3300005366 | Ga0070659_100005874 | Ga0070659_1000058744 | 263 |
| 247 | 3300005366 | Ga0070659_100019477 | Ga0070659_1000194775 | 263 |
| 248 | 3300005366 | Ga0070659_100058285 | Ga0070659_1000582854 | 263 |
| 249 | 3300005367 | Ga0070667_100005963 | Ga0070667_1000059634 | 263 |
| 250 | 3300005367 | Ga0070667_100199136 | Ga0070667_1001991361 | 263 |
| 251 | 3300005406 | Ga0070703_10002528 | Ga0070703_100025285 | 263 |
| 252 | 3300005434 | Ga0070709_10107117 | Ga0070709_101071172 | 263 |
| 253 | 3300005434 | Ga0070709_10112306 | Ga0070709_101123062 | 263 |
| 254 | 3300005435 | Ga0070714_100036372 | Ga0070714_1000363722 | 263 |
| 255 | 3300005435 | Ga0070714_100055527 | Ga0070714_1000555271 | 263 |
| 256 | 3300005435 | Ga0070714_100137127 | Ga0070714_1001371272 | 263 |
| 257 | 3300005435 | Ga0070714_100502951 | Ga0070714_1005029511 | 263 |
| 258 | 3300005436 | Ga0070713_100005553 | Ga0070713_1000055532 | 263 |
| 259 | 3300005436 | Ga0070713_100015791 | Ga0070713_1000157911 | 263 |
| 260 | 3300005436 | Ga0070713_100028859 | Ga0070713_1000288594 | 263 |
| 261 | 3300005436 | Ga0070713_100174721 | Ga0070713_1001747212 | 263 |
| 262 | 3300005437 | Ga0070710_10010566 | Ga0070710_100105663 | 263 |
| 263 | 3300005437 | Ga0070710_10204869 | Ga0070710_102048691 | 263 |
| 264 | 3300005438 | Ga0070701_10000339 | Ga0070701_100003398 | 263 |
| 265 | 3300005438 | Ga0070701_10037392 | Ga0070701_100373922 | 263 |
| 266 | 3300005438 | Ga0070701_10054327 | Ga0070701_100543272 | 263 |
| 267 | 3300005438 | Ga0070701_10095736 | Ga0070701_100957361 | 263 |
| 268 | 3300005438 | Ga0070701_10146773 | Ga0070701_101467731 | 263 |
| 269 | 3300005439 | Ga0070711_100027442 | Ga0070711_1000274422 | 263 |
| 270 | 3300005439 | Ga0070711_100073831 | Ga0070711_1000738311 | 263 |
| 271 | 3300005439 | Ga0070711_100199809 | Ga0070711_1001998092 | 263 |
| 272 | 3300005439 | Ga0070711_100253768 | Ga0070711_1002537682 | 263 |
| 273 | 3300005440 | Ga0070705_100000010 | Ga0070705_10000001045 | 263 |
| 274 | 3300005440 | Ga0070705_100005352 | Ga0070705_1000053528 | 263 |
| 275 | 3300005441 | Ga0070700_100000783 | Ga0070700_10000078311 | 263 |
| 276 | 3300005441 | Ga0070700_100022570 | Ga0070700_1000225703 | 263 |
| 277 | 3300005441 | Ga0070700_100036344 | Ga0070700_1000363442 | 263 |
| 278 | 3300005444 | Ga0070694_100006633 | Ga0070694_1000066335 | 263 |
| 279 | 3300005444 | Ga0070694_100120006 | Ga0070694_1001200062 | 263 |
| 280 | 3300005444 | Ga0070694_100268004 | Ga0070694_1002680041 | 263 |
| 281 | 3300005445 | Ga0070708_100466820 | Ga0070708_1004668201 | 263 |
| 282 | 3300005445 | Ga0070708_100544493 | Ga0070708_1005444931 | 263 |
| 283 | 3300005455 | Ga0070663_100006904 | Ga0070663_1000069046 | 263 |
| 284 | 3300005455 | Ga0070663_100017471 | Ga0070663_1000174712 | 263 |
| 285 | 3300005455 | Ga0070663_100025858 | Ga0070663_1000258582 | 263 |
| 286 | 3300005455 | Ga0070663_100028384 | Ga0070663_1000283843 | 263 |
| 287 | 3300005455 | Ga0070663_100033005 | Ga0070663_1000330052 | 263 |
| 288 | 3300005455 | Ga0070663_100039036 | Ga0070663_1000390362 | 263 |
| 289 | 3300005455 | Ga0070663_100284134 | Ga0070663_1002841341 | 263 |
| 290 | 3300005456 | Ga0070678_100011564 | Ga0070678_1000115644 | 263 |
| 291 | 3300005456 | Ga0070678_100092572 | Ga0070678_1000925722 | 263 |
| 292 | 3300005456 | Ga0070678_100237424 | Ga0070678_1002374242 | 263 |
| 293 | 3300005456 | Ga0070678_100248890 | Ga0070678_1002488902 | 263 |
| 294 | 3300005457 | Ga0070662_100017941 | Ga0070662_1000179413 | 263 |
| 295 | 3300005457 | Ga0070662_100103866 | Ga0070662_1001038662 | 263 |
| 296 | 3300005458 | Ga0070681_10070525 | Ga0070681_100705252 | 263 |
| 297 | 3300005458 | Ga0070681_10081473 | Ga0070681_100814732 | 263 |
| 298 | 3300005458 | Ga0070681_10222552 | Ga0070681_102225522 | 263 |
| 299 | 3300005458 | Ga0070681_10245025 | Ga0070681_102450252 | 263 |
| 300 | 3300005459 | Ga0068867_100021953 | Ga0068867_1000219534 | 263 |
| 301 | 3300005459 | Ga0068867_100363538 | Ga0068867_1003635382 | 263 |
| 302 | 3300005466 | Ga0070685_10005962 | Ga0070685_100059621 | 263 |
| 303 | 3300005466 | Ga0070685_10022940 | Ga0070685_100229402 | 263 |
| 304 | 3300005466 | Ga0070685_10097760 | Ga0070685_100977602 | 263 |
| 305 | 3300005468 | Ga0070707_100160119 | Ga0070707_1001601192 | 263 |
| 306 | 3300005471 | Ga0070698_100079534 | Ga0070698_1000795342 | 263 |
| 307 | 3300005518 | Ga0070699_100001314 | Ga0070699_1000013145 | 263 |
| 308 | 3300005530 | Ga0070679_100009564 | Ga0070679_1000095649 | 263 |
| 309 | 3300005530 | Ga0070679_100021002 | Ga0070679_1000210028 | 263 |
| 310 | 3300005530 | Ga0070679_100050983 | Ga0070679_1000509834 | 263 |
| 311 | 3300005530 | Ga0070679_100127315 | Ga0070679_1001273152 | 263 |
| 312 | 3300005530 | Ga0070679_100134755 | Ga0070679_1001347551 | 263 |
| 313 | 3300005535 | Ga0070684_100034741 | Ga0070684_1000347412 | 263 |
| 314 | 3300005535 | Ga0070684_100161110 | Ga0070684_1001611102 | 263 |
| 315 | 3300005536 | Ga0070697_100039300 | Ga0070697_1000393004 | 263 |
| 316 | 3300005536 | Ga0070697_100201176 | Ga0070697_1002011761 | 263 |
| 317 | 3300005539 | Ga0068853_100004375 | Ga0068853_1000043757 | 263 |
| 318 | 3300005539 | Ga0068853_100594483 | Ga0068853_1005944831 | 263 |
| 319 | 3300005543 | Ga0070672_100011149 | Ga0070672_1000111491 | 263 |
| 320 | 3300005543 | Ga0070672_100022463 | Ga0070672_1000224634 | 263 |
| 321 | 3300005544 | Ga0070686_100006762 | Ga0070686_1000067628 | 263 |
| 322 | 3300005544 | Ga0070686_100028126 | Ga0070686_1000281262 | 263 |
| 323 | 3300005545 | Ga0070695_100001719 | Ga0070695_1000017198 | 263 |
| 324 | 3300005545 | Ga0070695_100012898 | Ga0070695_1000128982 | 263 |
| 325 | 3300005545 | Ga0070695_100152637 | Ga0070695_1001526372 | 263 |
| 326 | 3300005546 | Ga0070696_100002812 | Ga0070696_1000028126 | 263 |
| 327 | 3300005546 | Ga0070696_100045814 | Ga0070696_1000458143 | 263 |
| 328 | 3300005546 | Ga0070696_100127308 | Ga0070696_1001273082 | 263 |
| 329 | 3300005547 | Ga0070693_100000577 | Ga0070693_10000057713 | 263 |
| 330 | 3300005547 | Ga0070693_100010134 | Ga0070693_1000101345 | 263 |
| 331 | 3300005547 | Ga0070693_100023786 | Ga0070693_1000237863 | 263 |
| 332 | 3300005547 | Ga0070693_100122989 | Ga0070693_1001229892 | 263 |
| 333 | 3300005547 | Ga0070693_100236167 | Ga0070693_1002361671 | 263 |
| 334 | 3300005548 | Ga0070665_100072419 | Ga0070665_1000724192 | 263 |
| 335 | 3300005548 | Ga0070665_100240155 | Ga0070665_1002401552 | 263 |
| 336 | 3300005549 | Ga0070704_100008088 | Ga0070704_1000080882 | 263 |
| 337 | 3300005549 | Ga0070704_100013846 | Ga0070704_1000138463 | 263 |
| 338 | 3300005549 | Ga0070704_100028556 | Ga0070704_1000285561 | 263 |
| 339 | 3300005549 | Ga0070704_100126371 | Ga0070704_1001263712 | 263 |
| 340 | 3300005549 | Ga0070704_100303866 | Ga0070704_1003038661 | 263 |
| 341 | 3300005563 | Ga0068855_100014148 | Ga0068855_1000141486 | 263 |
| 342 | 3300005563 | Ga0068855_100021980 | Ga0068855_1000219807 | 263 |
| 343 | 3300005563 | Ga0068855_100031300 | Ga0068855_1000313003 | 263 |
| 344 | 3300005563 | Ga0068855_100185531 | Ga0068855_1001855311 | 263 |
| 345 | 3300005563 | Ga0068855_100437051 | Ga0068855_1004370511 | 263 |
| 346 | 3300005564 | Ga0070664_100002073 | Ga0070664_1000020734 | 263 |
| 347 | 3300005564 | Ga0070664_100070153 | Ga0070664_1000701532 | 263 |
| 348 | 3300005564 | Ga0070664_100145517 | Ga0070664_1001455172 | 263 |
| 349 | 3300005564 | Ga0070664_100284498 | Ga0070664_1002844982 | 263 |
| 350 | 3300005564 | Ga0070664_100424861 | Ga0070664_1004248612 | 263 |
| 351 | 3300005577 | Ga0068857_100008536 | Ga0068857_1000085361 | 263 |
| 352 | 3300005577 | Ga0068857_100011549 | Ga0068857_1000115492 | 263 |
| 353 | 3300005577 | Ga0068857_100101644 | Ga0068857_1001016442 | 263 |
| 354 | 3300005577 | Ga0068857_100313354 | Ga0068857_1003133542 | 263 |
| 355 | 3300005578 | Ga0068854_100153463 | Ga0068854_1001534632 | 263 |
| 356 | 3300005614 | Ga0068856_100271248 | Ga0068856_1002712481 | 263 |
| 357 | 3300005614 | Ga0068856_100506165 | Ga0068856_1005061651 | 263 |
| 358 | 3300005614 | Ga0068856_100578229 | Ga0068856_1005782291 | 263 |
| 359 | 3300005615 | Ga0070702_100005245 | Ga0070702_1000052458 | 263 |
| 360 | 3300005615 | Ga0070702_100023173 | Ga0070702_1000231734 | 263 |
| 361 | 3300005616 | Ga0068852_100001086 | Ga0068852_10000108613 | 263 |
| 362 | 3300005616 | Ga0068852_100054483 | Ga0068852_1000544834 | 263 |
| 363 | 3300005616 | Ga0068852_100089360 | Ga0068852_1000893602 | 263 |
| 364 | 3300005617 | Ga0068859_100023234 | Ga0068859_1000232344 | 263 |
| 365 | 3300005617 | Ga0068859_100047095 | Ga0068859_1000470952 | 263 |
| 366 | 3300005617 | Ga0068859_100087792 | Ga0068859_1000877922 | 263 |
| 367 | 3300005617 | Ga0068859_100231880 | Ga0068859_1002318801 | 263 |
| 368 | 3300005617 | Ga0068859_100307236 | Ga0068859_1003072362 | 263 |
| 369 | 3300005618 | Ga0068864_100017473 | Ga0068864_1000174735 | 263 |
| 370 | 3300005618 | Ga0068864_100021486 | Ga0068864_1000214864 | 263 |
| 371 | 3300005618 | Ga0068864_100025772 | Ga0068864_1000257724 | 263 |
| 372 | 3300005618 | Ga0068864_100138872 | Ga0068864_1001388722 | 263 |
| 373 | 3300005718 | Ga0068866_10000403 | Ga0068866_1000040321 | 263 |
| 374 | 3300005718 | Ga0068866_10020659 | Ga0068866_100206592 | 263 |
| 375 | 3300005719 | Ga0068861_100001047 | Ga0068861_10000104715 | 263 |
| 376 | 3300005719 | Ga0068861_100201519 | Ga0068861_1002015192 | 263 |
| 377 | 3300005840 | Ga0068870_10000860 | Ga0068870_100008608 | 263 |
| 378 | 3300005840 | Ga0068870_10018357 | Ga0068870_100183572 | 263 |
| 379 | 3300005841 | Ga0068863_100003728 | Ga0068863_1000037284 | 263 |
| 380 | 3300005841 | Ga0068863_100046330 | Ga0068863_1000463302 | 263 |
| 381 | 3300005842 | Ga0068858_100032605 | Ga0068858_1000326051 | 263 |
| 382 | 3300005842 | Ga0068858_100051742 | Ga0068858_1000517423 | 263 |
| 383 | 3300005842 | Ga0068858_100098651 | Ga0068858_1000986513 | 263 |
| 384 | 3300005842 | Ga0068858_100283910 | Ga0068858_1002839102 | 263 |
| 385 | 3300005843 | Ga0068860_100013440 | Ga0068860_1000134406 | 263 |
| 386 | 3300005843 | Ga0068860_100023327 | Ga0068860_1000233272 | 263 |
| 387 | 3300005843 | Ga0068860_100036747 | Ga0068860_1000367473 | 263 |
| 388 | 3300005843 | Ga0068860_100038963 | Ga0068860_1000389632 | 263 |
| 389 | 3300005844 | Ga0068862_100003043 | Ga0068862_1000030439 | 263 |
| 390 | 3300005844 | Ga0068862_100024080 | Ga0068862_1000240806 | 263 |
| 391 | 3300005844 | Ga0068862_100041039 | Ga0068862_1000410392 | 263 |
| 392 | 3300005844 | Ga0068862_100068170 | Ga0068862_1000681702 | 263 |
| 393 | 3300005937 | Ga0081455_10000012 | Ga0081455_10000012130 | 263 |
| 394 | 3300005937 | Ga0081455_10007017 | Ga0081455_1000701713 | 263 |
| 395 | 3300005937 | Ga0081455_10016936 | Ga0081455_100169366 | 263 |
| 396 | 3300005937 | Ga0081455_10018308 | Ga0081455_100183082 | 263 |
| 397 | 3300005937 | Ga0081455_10048782 | Ga0081455_100487822 | 263 |
| 398 | 3300005981 | Ga0081538_10018338 | Ga0081538_100183387 | 263 |
| 399 | 3300005981 | Ga0081538_10059042 | Ga0081538_100590421 | 263 |
| 400 | 3300005983 | Ga0081540_1000185 | Ga0081540_100018540 | 263 |
| 401 | 3300005983 | Ga0081540_1002413 | Ga0081540_10024137 | 263 |
| 402 | 3300005983 | Ga0081540_1011112 | Ga0081540_10111129 | 263 |
| 403 | 3300005983 | Ga0081540_1048822 | Ga0081540_10488222 | 263 |
| 404 | 3300006028 | Ga0070717_10007114 | Ga0070717_100071146 | 263 |
| 405 | 3300006028 | Ga0070717_10010759 | Ga0070717_100107594 | 263 |
| 406 | 3300006028 | Ga0070717_10279432 | Ga0070717_102794322 | 263 |
| 407 | 3300006038 | Ga0075365_10041913 | Ga0075365_100419132 | 263 |
| 408 | 3300006048 | Ga0075363_100064023 | Ga0075363_1000640232 | 263 |
| 409 | 3300006051 | Ga0075364_10289916 | Ga0075364_102899161 | 263 |
| 410 | 3300006058 | Ga0075432_10001490 | Ga0075432_100014907 | 263 |
| 411 | 3300006163 | Ga0070715_10015144 | Ga0070715_100151442 | 263 |
| 412 | 3300006163 | Ga0070715_10043536 | Ga0070715_100435362 | 263 |
| 413 | 3300006163 | Ga0070715_10051397 | Ga0070715_100513971 | 263 |
| 414 | 3300006163 | Ga0070715_10100637 | Ga0070715_101006371 | 263 |
| 415 | 3300006173 | Ga0070716_100012292 | Ga0070716_1000122922 | 263 |
| 416 | 3300006173 | Ga0070716_100048777 | Ga0070716_1000487772 | 263 |
| 417 | 3300006173 | Ga0070716_100107036 | Ga0070716_1001070362 | 263 |
| 418 | 3300006175 | Ga0070712_100172611 | Ga0070712_1001726112 | 263 |
| 419 | 3300006175 | Ga0070712_100279375 | Ga0070712_1002793752 | 263 |
| 420 | 3300006177 | Ga0075362_10042644 | Ga0075362_100426442 | 263 |
| 421 | 3300006194 | Ga0075427_10001112 | Ga0075427_100011122 | 263 |
| 422 | 3300006195 | Ga0075366_10210171 | Ga0075366_102101711 | 263 |
| 423 | 3300006237 | Ga0097621_100000421 | Ga0097621_1000004214 | 263 |
| 424 | 3300006237 | Ga0097621_100008029 | Ga0097621_1000080295 | 263 |
| 425 | 3300006237 | Ga0097621_100043497 | Ga0097621_1000434972 | 263 |
| 426 | 3300006237 | Ga0097621_100081579 | Ga0097621_1000815792 | 263 |
| 427 | 3300006358 | Ga0068871_100000515 | Ga0068871_10000051512 | 263 |
| 428 | 3300006358 | Ga0068871_100012948 | Ga0068871_1000129485 | 263 |
| 429 | 3300006358 | Ga0068871_100109481 | Ga0068871_1001094812 | 263 |
| 430 | 3300006844 | Ga0075428_100007282 | Ga0075428_1000072829 | 263 |
| 431 | 3300006844 | Ga0075428_100013216 | Ga0075428_1000132162 | 263 |
| 432 | 3300006844 | Ga0075428_100124513 | Ga0075428_1001245132 | 263 |
| 433 | 3300006844 | Ga0075428_100124758 | Ga0075428_1001247582 | 263 |
| 434 | 3300006844 | Ga0075428_100138610 | Ga0075428_1001386102 | 263 |
| 435 | 3300006844 | Ga0075428_100280433 | Ga0075428_1002804332 | 263 |
| 436 | 3300006844 | Ga0075428_100377007 | Ga0075428_1003770071 | 263 |
| 437 | 3300006846 | Ga0075430_100021979 | Ga0075430_1000219795 | 263 |
| 438 | 3300006846 | Ga0075430_100026411 | Ga0075430_1000264112 | 263 |
| 439 | 3300006846 | Ga0075430_100028858 | Ga0075430_1000288585 | 263 |
| 440 | 3300006846 | Ga0075430_100085576 | Ga0075430_1000855763 | 263 |
| 441 | 3300006847 | Ga0075431_100001810 | Ga0075431_10000181015 | 263 |
| 442 | 3300006847 | Ga0075431_100002413 | Ga0075431_1000024133 | 263 |
| 443 | 3300006847 | Ga0075431_100003540 | Ga0075431_10000354012 | 263 |
| 444 | 3300006847 | Ga0075431_100072177 | Ga0075431_1000721774 | 263 |
| 445 | 3300006847 | Ga0075431_100082800 | Ga0075431_1000828002 | 263 |
| 446 | 3300006847 | Ga0075431_100109344 | Ga0075431_1001093443 | 263 |
| 447 | 3300006847 | Ga0075431_100143787 | Ga0075431_1001437873 | 263 |
| 448 | 3300006852 | Ga0075433_10002034 | Ga0075433_100020348 | 263 |
| 449 | 3300006852 | Ga0075433_10008633 | Ga0075433_100086334 | 263 |
| 450 | 3300006852 | Ga0075433_10036232 | Ga0075433_100362324 | 263 |
| 451 | 3300006852 | Ga0075433_10097947 | Ga0075433_100979473 | 263 |
| 452 | 3300006852 | Ga0075433_10203189 | Ga0075433_102031893 | 263 |
| 453 | 3300006871 | Ga0075434_100000007 | Ga0075434_10000000793 | 263 |
| 454 | 3300006871 | Ga0075434_100000693 | Ga0075434_10000069320 | 263 |
| 455 | 3300006871 | Ga0075434_100005025 | Ga0075434_1000050253 | 263 |
| 456 | 3300006871 | Ga0075434_100082088 | Ga0075434_1000820882 | 263 |
| 457 | 3300006871 | Ga0075434_100215803 | Ga0075434_1002158031 | 263 |
| 458 | 3300006871 | Ga0075434_100260622 | Ga0075434_1002606221 | 263 |
| 459 | 3300006871 | Ga0075434_100313884 | Ga0075434_1003138842 | 263 |
| 460 | 3300006880 | Ga0075429_100004783 | Ga0075429_10000478312 | 263 |
| 461 | 3300006880 | Ga0075429_100006663 | Ga0075429_1000066638 | 263 |
| 462 | 3300006880 | Ga0075429_100026387 | Ga0075429_1000263875 | 263 |
| 463 | 3300006880 | Ga0075429_100119201 | Ga0075429_1001192012 | 263 |
| 464 | 3300006880 | Ga0075429_100430059 | Ga0075429_1004300591 | 263 |
| 465 | 3300006881 | Ga0068865_100002115 | Ga0068865_1000021158 | 263 |
| 466 | 3300006881 | Ga0068865_100156928 | Ga0068865_1001569282 | 263 |
| 467 | 3300006914 | Ga0075436_100037473 | Ga0075436_1000374733 | 263 |
| 468 | 3300006914 | Ga0075436_100167778 | Ga0075436_1001677782 | 263 |
| 469 | 3300006914 | Ga0075436_100226373 | Ga0075436_1002263731 | 263 |
| 470 | 3300006931 | Ga0097620_100023234 | Ga0097620_1000232344 | 263 |
| 471 | 3300006931 | Ga0097620_100047094 | Ga0097620_1000470942 | 263 |
| 472 | 3300006931 | Ga0097620_100087787 | Ga0097620_1000877872 | 263 |
| 473 | 3300006931 | Ga0097620_100231869 | Ga0097620_1002318691 | 263 |
| 474 | 3300006931 | Ga0097620_100307236 | Ga0097620_1003072362 | 263 |
| 475 | 3300007076 | Ga0075435_100025823 | Ga0075435_1000258233 | 263 |
| 476 | 3300007076 | Ga0075435_100026492 | Ga0075435_1000264922 | 263 |
| 477 | 3300007076 | Ga0075435_100049630 | Ga0075435_1000496303 | 263 |
| 478 | 3300007076 | Ga0075435_100150894 | Ga0075435_1001508942 | 263 |
| 479 | 3300007076 | Ga0075435_100172380 | Ga0075435_1001723802 | 263 |
| 480 | 3300007265 | Ga0099794_10058103 | Ga0099794_100581032 | 263 |
| 481 | 3300007788 | Ga0099795_10011526 | Ga0099795_100115264 | 263 |
| 482 | 3300007788 | Ga0099795_10018796 | Ga0099795_100187962 | 263 |
| 483 | 3300009011 | Ga0105251_10040087 | Ga0105251_100400873 | 263 |
| 484 | 3300009011 | Ga0105251_10053918 | Ga0105251_100539182 | 263 |
| 485 | 3300009036 | Ga0105244_10161476 | Ga0105244_101614761 | 263 |
| 486 | 3300009093 | Ga0105240_10037315 | Ga0105240_100373157 | 263 |
| 487 | 3300009093 | Ga0105240_10154042 | Ga0105240_101540422 | 263 |
| 488 | 3300009094 | Ga0111539_10004448 | Ga0111539_1000444811 | 263 |
| 489 | 3300009094 | Ga0111539_10005607 | Ga0111539_100056078 | 263 |
| 490 | 3300009094 | Ga0111539_10013539 | Ga0111539_100135397 | 263 |
| 491 | 3300009094 | Ga0111539_10017591 | Ga0111539_100175918 | 263 |
| 492 | 3300009094 | Ga0111539_10022696 | Ga0111539_100226967 | 263 |
| 493 | 3300009094 | Ga0111539_10029537 | Ga0111539_100295373 | 263 |
| 494 | 3300009094 | Ga0111539_10146086 | Ga0111539_101460863 | 263 |
| 495 | 3300009094 | Ga0111539_10279279 | Ga0111539_102792792 | 263 |
| 496 | 3300009094 | Ga0111539_10420466 | Ga0111539_104204661 | 263 |
| 497 | 3300009094 | Ga0111539_10512699 | Ga0111539_105126992 | 263 |
| 498 | 3300009094 | Ga0111539_10572289 | Ga0111539_105722892 | 263 |
| 499 | 3300009094 | Ga0111539_10722476 | Ga0111539_107224762 | 263 |
| 500 | 3300009098 | Ga0105245_10029148 | Ga0105245_100291484 | 263 |
| 501 | 3300009098 | Ga0105245_10145527 | Ga0105245_101455272 | 263 |
| 502 | 3300009098 | Ga0105245_10265153 | Ga0105245_102651532 | 263 |
| 503 | 3300009101 | Ga0105247_10012837 | Ga0105247_100128375 | 263 |
| 504 | 3300009101 | Ga0105247_10013130 | Ga0105247_100131305 | 263 |
| 505 | 3300009147 | Ga0114129_10000742 | Ga0114129_1000074236 | 263 |
| 506 | 3300009147 | Ga0114129_10059035 | Ga0114129_100590352 | 263 |
| 507 | 3300009147 | Ga0114129_10105879 | Ga0114129_101058795 | 263 |
| 508 | 3300009147 | Ga0114129_10179865 | Ga0114129_101798652 | 263 |
| 509 | 3300009147 | Ga0114129_10212542 | Ga0114129_102125423 | 263 |
| 510 | 3300009147 | Ga0114129_10293458 | Ga0114129_102934582 | 263 |
| 511 | 3300009147 | Ga0114129_10643719 | Ga0114129_106437191 | 263 |
| 512 | 3300009148 | Ga0105243_10002574 | Ga0105243_100025748 | 263 |
| 513 | 3300009148 | Ga0105243_10011951 | Ga0105243_100119515 | 263 |
| 514 | 3300009174 | Ga0105241_10111008 | Ga0105241_101110081 | 263 |
| 515 | 3300009174 | Ga0105241_10244434 | Ga0105241_102444342 | 263 |
| 516 | 3300009174 | Ga0105241_10299267 | Ga0105241_102992672 | 263 |
| 517 | 3300009176 | Ga0105242_10004599 | Ga0105242_1000459911 | 263 |
| 518 | 3300009176 | Ga0105242_10110869 | Ga0105242_101108692 | 263 |
| 519 | 3300009177 | Ga0105248_10000821 | Ga0105248_100008213 | 263 |
| 520 | 3300009177 | Ga0105248_10076409 | Ga0105248_100764092 | 263 |
| 521 | 3300009177 | Ga0105248_10084997 | Ga0105248_100849972 | 263 |
| 522 | 3300009177 | Ga0105248_10121013 | Ga0105248_101210133 | 263 |
| 523 | 3300009545 | Ga0105237_10042956 | Ga0105237_100429564 | 263 |
| 524 | 3300009545 | Ga0105237_10128596 | Ga0105237_101285962 | 263 |
| 525 | 3300009545 | Ga0105237_10298174 | Ga0105237_102981741 | 263 |
| 526 | 3300009545 | Ga0105237_10364152 | Ga0105237_103641521 | 263 |
| 527 | 3300009551 | Ga0105238_10009936 | Ga0105238_1000993610 | 263 |
| 528 | 3300009551 | Ga0105238_10226060 | Ga0105238_102260601 | 263 |
| 529 | 3300009551 | Ga0105238_10272723 | Ga0105238_102727232 | 263 |
| 530 | 3300009553 | Ga0105249_10015879 | Ga0105249_100158794 | 263 |
| 531 | 3300009553 | Ga0105249_10017602 | Ga0105249_100176025 | 263 |
| 532 | 3300009553 | Ga0105249_10084737 | Ga0105249_100847372 | 263 |
| 533 | 3300009553 | Ga0105249_10197852 | Ga0105249_101978522 | 263 |
| 534 | 3300009553 | Ga0105249_10510758 | Ga0105249_105107582 | 263 |
| 535 | 3300010375 | Ga0105239_10004537 | Ga0105239_100045378 | 263 |
| 536 | 3300010375 | Ga0105239_10196874 | Ga0105239_101968743 | 263 |
| 537 | 3300010375 | Ga0105239_10286295 | Ga0105239_102862952 | 263 |
| 538 | 3300010375 | Ga0105239_10446827 | Ga0105239_104468272 | 263 |
| 539 | 3300011119 | Ga0105246_10001092 | Ga0105246_1000109211 | 263 |
| 540 | 3300011119 | Ga0105246_10097849 | Ga0105246_100978491 | 263 |
| 541 | 3300012492 | Ga0157335_1001950 | Ga0157335_10019501 | 263 |
| 542 | 3300013102 | Ga0157371_10007315 | Ga0157371_100073154 | 263 |
| 543 | 3300013104 | Ga0157370_10056317 | Ga0157370_100563171 | 263 |
| 544 | 3300013104 | Ga0157370_10241917 | Ga0157370_102419172 | 263 |
| 545 | 3300013296 | Ga0157374_10002049 | Ga0157374_1000204918 | 263 |
| 546 | 3300013296 | Ga0157374_10032857 | Ga0157374_100328572 | 263 |
| 547 | 3300013296 | Ga0157374_10427440 | Ga0157374_104274401 | 263 |
| 548 | 3300013297 | Ga0157378_10007541 | Ga0157378_100075414 | 263 |
| 549 | 3300013306 | Ga0163162_10005029 | Ga0163162_100050298 | 263 |
| 550 | 3300013306 | Ga0163162_10046419 | Ga0163162_100464192 | 263 |
| 551 | 3300013306 | Ga0163162_10343621 | Ga0163162_103436211 | 263 |
| 552 | 3300013306 | Ga0163162_10517261 | Ga0163162_105172612 | 263 |
| 553 | 3300013307 | Ga0157372_10012748 | Ga0157372_100127486 | 263 |
| 554 | 3300013307 | Ga0157372_10362354 | Ga0157372_103623542 | 263 |
| 555 | 3300013308 | Ga0157375_10005227 | Ga0157375_100052272 | 263 |
| 556 | 3300013308 | Ga0157375_10019784 | Ga0157375_100197842 | 263 |
| 557 | 3300014325 | Ga0163163_10005574 | Ga0163163_100055748 | 263 |
| 558 | 3300014325 | Ga0163163_10049189 | Ga0163163_100491894 | 263 |
| 559 | 3300014325 | Ga0163163_10057095 | Ga0163163_100570951 | 263 |
| 560 | 3300014325 | Ga0163163_10065275 | Ga0163163_100652752 | 263 |
| 561 | 3300014325 | Ga0163163_10178827 | Ga0163163_101788272 | 263 |
| 562 | 3300014325 | Ga0163163_10384246 | Ga0163163_103842462 | 263 |
| 563 | 3300014326 | Ga0157380_10001279 | Ga0157380_100012798 | 263 |
| 564 | 3300014326 | Ga0157380_10057392 | Ga0157380_100573922 | 263 |
| 565 | 3300014745 | Ga0157377_10000312 | Ga0157377_1000031216 | 263 |
| 566 | 3300014968 | Ga0157379_10001989 | Ga0157379_100019898 | 263 |
| 567 | 3300014968 | Ga0157379_10063884 | Ga0157379_100638842 | 263 |
| 568 | 3300014968 | Ga0157379_10237266 | Ga0157379_102372662 | 263 |
| 569 | 3300014969 | Ga0157376_10001372 | Ga0157376_1000137217 | 263 |
| 570 | 3300014969 | Ga0157376_10019925 | Ga0157376_100199255 | 263 |
| 571 | 3300014969 | Ga0157376_10106846 | Ga0157376_101068462 | 263 |
| 572 | 3300014969 | Ga0157376_10278940 | Ga0157376_102789402 | 263 |
| 573 | 3300014969 | Ga0157376_10503392 | Ga0157376_105033921 | 263 |
| 574 | 3300017792 | Ga0163161_10003480 | Ga0163161_100034808 | 263 |
| 575 | 3300017792 | Ga0163161_10103438 | Ga0163161_101034382 | 263 |
| 576 | 3300020070 | Ga0206356_10050520 | Ga0206356_100505202 | 263 |
| 577 | 3300025271 | Ga0207666_1000038 | Ga0207666_100003820 | 263 |
| 578 | 3300025271 | Ga0207666_1000670 | Ga0207666_10006703 | 263 |
| 579 | 3300025290 | Ga0207673_1006959 | Ga0207673_10069592 | 263 |
| 580 | 3300025297 | Ga0209758_1000079 | Ga0209758_1000079112 | 263 |
| 581 | 3300025315 | Ga0207697_10000373 | Ga0207697_1000037319 | 263 |
| 582 | 3300025315 | Ga0207697_10017294 | Ga0207697_100172942 | 263 |
| 583 | 3300025315 | Ga0207697_10025362 | Ga0207697_100253622 | 263 |
| 584 | 3300025315 | Ga0207697_10084636 | Ga0207697_100846361 | 263 |
| 585 | 3300025735 | Ga0207713_1072809 | Ga0207713_10728092 | 263 |
| 586 | 3300025885 | Ga0207653_10000559 | Ga0207653_100005592 | 263 |
| 587 | 3300025893 | Ga0207682_10000071 | Ga0207682_1000007121 | 263 |
| 588 | 3300025898 | Ga0207692_10010499 | Ga0207692_100104994 | 263 |
| 589 | 3300025898 | Ga0207692_10050472 | Ga0207692_100504722 | 263 |
| 590 | 3300025899 | Ga0207642_10004072 | Ga0207642_100040723 | 263 |
| 591 | 3300025899 | Ga0207642_10010782 | Ga0207642_100107823 | 263 |
| 592 | 3300025899 | Ga0207642_10070749 | Ga0207642_100707492 | 263 |
| 593 | 3300025900 | Ga0207710_10007020 | Ga0207710_100070202 | 263 |
| 594 | 3300025900 | Ga0207710_10007122 | Ga0207710_100071221 | 263 |
| 595 | 3300025900 | Ga0207710_10093911 | Ga0207710_100939111 | 263 |
| 596 | 3300025901 | Ga0207688_10000237 | Ga0207688_1000023711 | 263 |
| 597 | 3300025901 | Ga0207688_10023508 | Ga0207688_100235082 | 263 |
| 598 | 3300025903 | Ga0207680_10037949 | Ga0207680_100379491 | 263 |
| 599 | 3300025904 | Ga0207647_10009005 | Ga0207647_100090052 | 263 |
| 600 | 3300025904 | Ga0207647_10064700 | Ga0207647_100647002 | 263 |
| 601 | 3300025904 | Ga0207647_10099247 | Ga0207647_100992471 | 263 |
| 602 | 3300025904 | Ga0207647_10110025 | Ga0207647_101100252 | 263 |
| 603 | 3300025904 | Ga0207647_10144254 | Ga0207647_101442542 | 263 |
| 604 | 3300025904 | Ga0207647_10145926 | Ga0207647_101459261 | 263 |
| 605 | 3300025906 | Ga0207699_10079821 | Ga0207699_100798212 | 263 |
| 606 | 3300025906 | Ga0207699_10127180 | Ga0207699_101271801 | 263 |
| 607 | 3300025906 | Ga0207699_10186277 | Ga0207699_101862771 | 263 |
| 608 | 3300025907 | Ga0207645_10000779 | Ga0207645_1000077920 | 263 |
| 609 | 3300025907 | Ga0207645_10028585 | Ga0207645_100285852 | 263 |
| 610 | 3300025907 | Ga0207645_10038461 | Ga0207645_100384612 | 263 |
| 611 | 3300025907 | Ga0207645_10079328 | Ga0207645_100793282 | 263 |
| 612 | 3300025908 | Ga0207643_10000276 | Ga0207643_1000027610 | 263 |
| 613 | 3300025908 | Ga0207643_10022449 | Ga0207643_100224493 | 263 |
| 614 | 3300025909 | Ga0207705_10077767 | Ga0207705_100777673 | 263 |
| 615 | 3300025910 | Ga0207684_10097682 | Ga0207684_100976822 | 263 |
| 616 | 3300025911 | Ga0207654_10014702 | Ga0207654_100147024 | 263 |
| 617 | 3300025911 | Ga0207654_10093334 | Ga0207654_100933342 | 263 |
| 618 | 3300025911 | Ga0207654_10244704 | Ga0207654_102447041 | 263 |
| 619 | 3300025912 | Ga0207707_10000454 | Ga0207707_1000045418 | 263 |
| 620 | 3300025912 | Ga0207707_10069691 | Ga0207707_100696912 | 263 |
| 621 | 3300025912 | Ga0207707_10083619 | Ga0207707_100836192 | 263 |
| 622 | 3300025912 | Ga0207707_10131233 | Ga0207707_101312332 | 263 |
| 623 | 3300025913 | Ga0207695_10364338 | Ga0207695_103643381 | 263 |
| 624 | 3300025914 | Ga0207671_10016484 | Ga0207671_100164844 | 263 |
| 625 | 3300025914 | Ga0207671_10037376 | Ga0207671_100373762 | 263 |
| 626 | 3300025914 | Ga0207671_10188217 | Ga0207671_101882172 | 263 |
| 627 | 3300025915 | Ga0207693_10005073 | Ga0207693_100050735 | 263 |
| 628 | 3300025915 | Ga0207693_10007312 | Ga0207693_100073127 | 263 |
| 629 | 3300025915 | Ga0207693_10010113 | Ga0207693_100101133 | 263 |
| 630 | 3300025915 | Ga0207693_10051746 | Ga0207693_100517463 | 263 |
| 631 | 3300025915 | Ga0207693_10073450 | Ga0207693_100734502 | 263 |
| 632 | 3300025915 | Ga0207693_10078058 | Ga0207693_100780582 | 263 |
| 633 | 3300025915 | Ga0207693_10085039 | Ga0207693_100850392 | 263 |
| 634 | 3300025915 | Ga0207693_10097721 | Ga0207693_100977213 | 263 |
| 635 | 3300025916 | Ga0207663_10061077 | Ga0207663_100610772 | 263 |
| 636 | 3300025916 | Ga0207663_10072881 | Ga0207663_100728812 | 263 |
| 637 | 3300025917 | Ga0207660_10000087 | Ga0207660_100000879 | 263 |
| 638 | 3300025917 | Ga0207660_10078775 | Ga0207660_100787753 | 263 |
| 639 | 3300025917 | Ga0207660_10107168 | Ga0207660_101071682 | 263 |
| 640 | 3300025917 | Ga0207660_10225179 | Ga0207660_102251792 | 263 |
| 641 | 3300025918 | Ga0207662_10000659 | Ga0207662_1000065911 | 263 |
| 642 | 3300025918 | Ga0207662_10009020 | Ga0207662_100090204 | 263 |
| 643 | 3300025918 | Ga0207662_10022432 | Ga0207662_100224322 | 263 |
| 644 | 3300025918 | Ga0207662_10109719 | Ga0207662_101097191 | 263 |
| 645 | 3300025918 | Ga0207662_10180772 | Ga0207662_101807722 | 263 |
| 646 | 3300025919 | Ga0207657_10003101 | Ga0207657_1000310112 | 263 |
| 647 | 3300025919 | Ga0207657_10005173 | Ga0207657_100051739 | 263 |
| 648 | 3300025919 | Ga0207657_10035321 | Ga0207657_100353213 | 263 |
| 649 | 3300025919 | Ga0207657_10051853 | Ga0207657_100518533 | 263 |
| 650 | 3300025919 | Ga0207657_10158047 | Ga0207657_101580471 | 263 |
| 651 | 3300025919 | Ga0207657_10167303 | Ga0207657_101673031 | 263 |
| 652 | 3300025920 | Ga0207649_10000662 | Ga0207649_1000066211 | 263 |
| 653 | 3300025920 | Ga0207649_10095650 | Ga0207649_100956502 | 263 |
| 654 | 3300025920 | Ga0207649_10127807 | Ga0207649_101278072 | 263 |
| 655 | 3300025921 | Ga0207652_10001908 | Ga0207652_1000190815 | 263 |
| 656 | 3300025921 | Ga0207652_10023549 | Ga0207652_100235492 | 263 |
| 657 | 3300025923 | Ga0207681_10001262 | Ga0207681_100012625 | 263 |
| 658 | 3300025923 | Ga0207681_10211519 | Ga0207681_102115192 | 263 |
| 659 | 3300025924 | Ga0207694_10017984 | Ga0207694_100179843 | 263 |
| 660 | 3300025925 | Ga0207650_10005107 | Ga0207650_100051072 | 263 |
| 661 | 3300025925 | Ga0207650_10377855 | Ga0207650_103778551 | 263 |
| 662 | 3300025926 | Ga0207659_10000143 | Ga0207659_1000014321 | 263 |
| 663 | 3300025927 | Ga0207687_10000865 | Ga0207687_1000086518 | 263 |
| 664 | 3300025927 | Ga0207687_10290565 | Ga0207687_102905651 | 263 |
| 665 | 3300025927 | Ga0207687_10315623 | Ga0207687_103156231 | 263 |
| 666 | 3300025928 | Ga0207700_10000323 | Ga0207700_1000032320 | 263 |
| 667 | 3300025928 | Ga0207700_10072896 | Ga0207700_100728962 | 263 |
| 668 | 3300025928 | Ga0207700_10145360 | Ga0207700_101453602 | 263 |
| 669 | 3300025929 | Ga0207664_10049417 | Ga0207664_100494172 | 263 |
| 670 | 3300025929 | Ga0207664_10104335 | Ga0207664_101043352 | 263 |
| 671 | 3300025929 | Ga0207664_10370743 | Ga0207664_103707431 | 263 |
| 672 | 3300025931 | Ga0207644_10000532 | Ga0207644_1000053215 | 263 |
| 673 | 3300025931 | Ga0207644_10042290 | Ga0207644_100422902 | 263 |
| 674 | 3300025931 | Ga0207644_10225091 | Ga0207644_102250912 | 263 |
| 675 | 3300025932 | Ga0207690_10000409 | Ga0207690_1000040912 | 263 |
| 676 | 3300025933 | Ga0207706_10001338 | Ga0207706_1000133819 | 263 |
| 677 | 3300025933 | Ga0207706_10006493 | Ga0207706_100064932 | 263 |
| 678 | 3300025933 | Ga0207706_10006705 | Ga0207706_100067059 | 263 |
| 679 | 3300025933 | Ga0207706_10046748 | Ga0207706_100467483 | 263 |
| 680 | 3300025933 | Ga0207706_10058641 | Ga0207706_100586412 | 263 |
| 681 | 3300025934 | Ga0207686_10000500 | Ga0207686_1000050020 | 263 |
| 682 | 3300025934 | Ga0207686_10042200 | Ga0207686_100422003 | 263 |
| 683 | 3300025934 | Ga0207686_10075339 | Ga0207686_100753392 | 263 |
| 684 | 3300025935 | Ga0207709_10001266 | Ga0207709_1000126614 | 263 |
| 685 | 3300025935 | Ga0207709_10050874 | Ga0207709_100508742 | 263 |
| 686 | 3300025935 | Ga0207709_10141359 | Ga0207709_101413592 | 263 |
| 687 | 3300025936 | Ga0207670_10007354 | Ga0207670_100073541 | 263 |
| 688 | 3300025936 | Ga0207670_10016040 | Ga0207670_100160404 | 263 |
| 689 | 3300025936 | Ga0207670_10083746 | Ga0207670_100837462 | 263 |
| 690 | 3300025936 | Ga0207670_10198058 | Ga0207670_101980582 | 263 |
| 691 | 3300025937 | Ga0207669_10001125 | Ga0207669_100011257 | 263 |
| 692 | 3300025938 | Ga0207704_10000613 | Ga0207704_100006137 | 263 |
| 693 | 3300025939 | Ga0207665_10001192 | Ga0207665_1000119213 | 263 |
| 694 | 3300025939 | Ga0207665_10003934 | Ga0207665_100039346 | 263 |
| 695 | 3300025939 | Ga0207665_10073486 | Ga0207665_100734862 | 263 |
| 696 | 3300025939 | Ga0207665_10319638 | Ga0207665_103196381 | 263 |
| 697 | 3300025940 | Ga0207691_10002493 | Ga0207691_100024933 | 263 |
| 698 | 3300025940 | Ga0207691_10003339 | Ga0207691_1000333911 | 263 |
| 699 | 3300025940 | Ga0207691_10130622 | Ga0207691_101306221 | 263 |
| 700 | 3300025941 | Ga0207711_10003987 | Ga0207711_1000398711 | 263 |
| 701 | 3300025941 | Ga0207711_10029326 | Ga0207711_100293264 | 263 |
| 702 | 3300025941 | Ga0207711_10050370 | Ga0207711_100503704 | 263 |
| 703 | 3300025941 | Ga0207711_10238615 | Ga0207711_102386152 | 263 |
| 704 | 3300025941 | Ga0207711_10286694 | Ga0207711_102866942 | 263 |
| 705 | 3300025942 | Ga0207689_10000440 | Ga0207689_1000044020 | 263 |
| 706 | 3300025942 | Ga0207689_10021598 | Ga0207689_100215983 | 263 |
| 707 | 3300025942 | Ga0207689_10273806 | Ga0207689_102738061 | 263 |
| 708 | 3300025944 | Ga0207661_10059018 | Ga0207661_100590182 | 263 |
| 709 | 3300025944 | Ga0207661_10061762 | Ga0207661_100617622 | 263 |
| 710 | 3300025944 | Ga0207661_10125939 | Ga0207661_101259392 | 263 |
| 711 | 3300025944 | Ga0207661_10150552 | Ga0207661_101505522 | 263 |
| 712 | 3300025945 | Ga0207679_10005990 | Ga0207679_100059902 | 263 |
| 713 | 3300025945 | Ga0207679_10016049 | Ga0207679_100160492 | 263 |
| 714 | 3300025945 | Ga0207679_10110913 | Ga0207679_101109132 | 263 |
| 715 | 3300025949 | Ga0207667_10018606 | Ga0207667_100186068 | 263 |
| 716 | 3300025949 | Ga0207667_10040968 | Ga0207667_100409682 | 263 |
| 717 | 3300025960 | Ga0207651_10000335 | Ga0207651_100003358 | 263 |
| 718 | 3300025961 | Ga0207712_10002448 | Ga0207712_100024488 | 263 |
| 719 | 3300025961 | Ga0207712_10004065 | Ga0207712_100040655 | 263 |
| 720 | 3300025961 | Ga0207712_10194903 | Ga0207712_101949032 | 263 |
| 721 | 3300025972 | Ga0207668_10000065 | Ga0207668_100000658 | 263 |
| 722 | 3300025972 | Ga0207668_10100099 | Ga0207668_101000992 | 263 |
| 723 | 3300025972 | Ga0207668_10176418 | Ga0207668_101764182 | 263 |
| 724 | 3300025981 | Ga0207640_10000339 | Ga0207640_1000033912 | 263 |
| 725 | 3300025986 | Ga0207658_10004428 | Ga0207658_100044287 | 263 |
| 726 | 3300025986 | Ga0207658_10185666 | Ga0207658_101856662 | 263 |
| 727 | 3300025986 | Ga0207658_10291234 | Ga0207658_102912342 | 263 |
| 728 | 3300026023 | Ga0207677_10003580 | Ga0207677_100035808 | 263 |
| 729 | 3300026035 | Ga0207703_10001885 | Ga0207703_1000188521 | 263 |
| 730 | 3300026035 | Ga0207703_10124556 | Ga0207703_101245562 | 263 |
| 731 | 3300026041 | Ga0207639_10041384 | Ga0207639_100413844 | 263 |
| 732 | 3300026067 | Ga0207678_10000944 | Ga0207678_100009448 | 263 |
| 733 | 3300026067 | Ga0207678_10006342 | Ga0207678_100063422 | 263 |
| 734 | 3300026067 | Ga0207678_10019284 | Ga0207678_100192843 | 263 |
| 735 | 3300026067 | Ga0207678_10036592 | Ga0207678_100365922 | 263 |
| 736 | 3300026067 | Ga0207678_10062862 | Ga0207678_100628623 | 263 |
| 737 | 3300026075 | Ga0207708_10002019 | Ga0207708_100020198 | 263 |
| 738 | 3300026075 | Ga0207708_10002166 | Ga0207708_100021666 | 263 |
| 739 | 3300026075 | Ga0207708_10033326 | Ga0207708_100333262 | 263 |
| 740 | 3300026075 | Ga0207708_10039810 | Ga0207708_100398102 | 263 |
| 741 | 3300026075 | Ga0207708_10126975 | Ga0207708_101269752 | 263 |
| 742 | 3300026078 | Ga0207702_10056555 | Ga0207702_100565553 | 263 |
| 743 | 3300026088 | Ga0207641_10005810 | Ga0207641_100058102 | 263 |
| 744 | 3300026088 | Ga0207641_10085777 | Ga0207641_100857772 | 263 |
| 745 | 3300026089 | Ga0207648_10004730 | Ga0207648_1000473013 | 263 |
| 746 | 3300026089 | Ga0207648_10049631 | Ga0207648_100496313 | 263 |
| 747 | 3300026089 | Ga0207648_10087607 | Ga0207648_100876073 | 263 |
| 748 | 3300026095 | Ga0207676_10008134 | Ga0207676_100081342 | 263 |
| 749 | 3300026095 | Ga0207676_10046203 | Ga0207676_100462032 | 263 |
| 750 | 3300026116 | Ga0207674_10003323 | Ga0207674_100033236 | 263 |
| 751 | 3300026116 | Ga0207674_10005364 | Ga0207674_1000536411 | 263 |
| 752 | 3300026116 | Ga0207674_10091204 | Ga0207674_100912042 | 263 |
| 753 | 3300026118 | Ga0207675_100000815 | Ga0207675_10000081513 | 263 |
| 754 | 3300026118 | Ga0207675_100011636 | Ga0207675_1000116362 | 263 |
| 755 | 3300026118 | Ga0207675_100081484 | Ga0207675_1000814841 | 263 |
| 756 | 3300026118 | Ga0207675_100175686 | Ga0207675_1001756862 | 263 |
| 757 | 3300026121 | Ga0207683_10000001 | Ga0207683_10000001329 | 263 |
| 758 | 3300026121 | Ga0207683_10074307 | Ga0207683_100743073 | 263 |
| 759 | 3300026121 | Ga0207683_10096807 | Ga0207683_100968072 | 263 |
| 760 | 3300026121 | Ga0207683_10124322 | Ga0207683_101243222 | 263 |
| 761 | 3300026142 | Ga0207698_10024447 | Ga0207698_100244472 | 263 |
| 762 | 3300027364 | Ga0209967_1000489 | Ga0209967_10004895 | 263 |
| 763 | 3300027378 | Ga0209981_1000830 | Ga0209981_10008305 | 263 |
| 764 | 3300027395 | Ga0209996_1008254 | Ga0209996_10082542 | 263 |
| 765 | 3300027462 | Ga0210000_1001264 | Ga0210000_10012644 | 263 |
| 766 | 3300027526 | Ga0209968_1006091 | Ga0209968_10060912 | 263 |
| 767 | 3300027543 | Ga0209999_1003822 | Ga0209999_10038223 | 263 |
| 768 | 3300027682 | Ga0209971_1014174 | Ga0209971_10141742 | 263 |
| 769 | 3300027682 | Ga0209971_1017209 | Ga0209971_10172092 | 263 |
| 770 | 3300027695 | Ga0209966_1000743 | Ga0209966_10007435 | 263 |
| 771 | 3300027695 | Ga0209966_1001998 | Ga0209966_10019982 | 263 |
| 772 | 3300027717 | Ga0209998_10001042 | Ga0209998_100010424 | 263 |
| 773 | 3300027717 | Ga0209998_10011704 | Ga0209998_100117041 | 263 |
| 774 | 3300027876 | Ga0209974_10050686 | Ga0209974_100506862 | 263 |
| 775 | 3300027907 | Ga0207428_10000172 | Ga0207428_1000017210 | 263 |
| 776 | 3300027907 | Ga0207428_10000255 | Ga0207428_1000025531 | 263 |
| 777 | 3300027907 | Ga0207428_10003313 | Ga0207428_1000331311 | 263 |
| 778 | 3300027907 | Ga0207428_10013736 | Ga0207428_100137368 | 263 |
| 779 | 3300027907 | Ga0207428_10016308 | Ga0207428_100163081 | 263 |
| 780 | 3300027907 | Ga0207428_10058144 | Ga0207428_100581443 | 263 |
| 781 | 3300027907 | Ga0207428_10142280 | Ga0207428_101422802 | 263 |
| 782 | 3300028379 | Ga0268266_10020037 | Ga0268266_100200372 | 263 |
| 783 | 3300028379 | Ga0268266_10128823 | Ga0268266_101288232 | 263 |
| 784 | 3300028379 | Ga0268266_10247664 | Ga0268266_102476642 | 263 |
| 785 | 3300028380 | Ga0268265_10009461 | Ga0268265_100094615 | 263 |
| 786 | 3300028380 | Ga0268265_10029653 | Ga0268265_100296532 | 263 |
| 787 | 3300028381 | Ga0268264_10001153 | Ga0268264_1000115311 | 263 |
| 788 | 3300028381 | Ga0268264_10006938 | Ga0268264_100069384 | 263 |
| 789 | 3300028556 | Ga0265337_1001632 | Ga0265337_10016322 | 263 |
| 790 | 3300028556 | Ga0265337_1029353 | Ga0265337_10293532 | 263 |
| 791 | 3300028800 | Ga0265338_10038131 | Ga0265338_100381313 | 263 |
| 792 | 3300030763 | Ga0265763_1000066 | Ga0265763_10000662 | 263 |
| 793 | 3300031235 | Ga0265330_10009242 | Ga0265330_100092422 | 263 |
| 794 | 3300031235 | Ga0265330_10014275 | Ga0265330_100142752 | 263 |
| 795 | 3300031241 | Ga0265325_10000320 | Ga0265325_1000032010 | 263 |
| 796 | 3300031241 | Ga0265325_10000901 | Ga0265325_100009018 | 263 |
| 797 | 3300031241 | Ga0265325_10001624 | Ga0265325_100016246 | 263 |
| 798 | 3300031249 | Ga0265339_10000387 | Ga0265339_1000038713 | 263 |
| 799 | 3300031249 | Ga0265339_10119541 | Ga0265339_101195412 | 263 |
| 800 | 3300031250 | Ga0265331_10024832 | Ga0265331_100248322 | 263 |
| 801 | 3300031595 | Ga0265313_10000850 | Ga0265313_1000085018 | 263 |
| 802 | 3300031595 | Ga0265313_10004004 | Ga0265313_100040041 | 263 |
| 803 | 3300031711 | Ga0265314_10007897 | Ga0265314_100078972 | 263 |
| 804 | 3300031712 | Ga0265342_10000196 | Ga0265342_1000019663 | 263 |
| 805 | 3300034816 | Ga0373930_0000014 | Ga0373930_0000014_9334_10323 | 263 |
| 806 | 3300034817 | Ga0373948_0000493 | Ga0373948_0000493_3259_4248 | 263 |
| 807 | 3300034817 | Ga0373948_0034839 | Ga0373948_0034839_85_1020 | 263 |
| 808 | 3300034818 | Ga0373950_0000145 | Ga0373950_0000145_4778_5767 | 263 |
| 809 | 3300034819 | Ga0373958_0000064 | Ga0373958_0000064_2784_3773 | 263 |
| 810 | 3300034820 | Ga0373959_0013423 | Ga0373959_0013423_253_1242 | 263 |
| 811 | 3300034957 | Ga0373938_0001531 | Ga0373938_0001531_1515_2504 | 263 |
| 812 | 3300035083 | Ga0373926_0017053 | Ga0373926_0017053_1179_2168 | 263 |
| 813 | 3300035083 | Ga0373926_0026074 | Ga0373926_0026074_442_1431 | 263 |
| 814 | 3300035084 | Ga0373928_0001389 | Ga0373928_0001389_1687_2676 | 263 |
| 815 | 3300035084 | Ga0373928_0028267 | Ga0373928_0028267_85_1038 | 263 |
| 816 | 3300035085 | Ga0373929_0000101 | Ga0373929_0000101_9097_10086 | 263 |
| 817 | 3300035085 | Ga0373929_0002654 | Ga0373929_0002654_1114_2112 | 263 |
| 818 | 3300035085 | Ga0373929_0016173 | Ga0373929_0016173_188_1177 | 263 |
| 819 | 3300035086 | Ga0373934_0055179 | Ga0373934_0055179_410_1381 | 263 |
| 820 | 3300035088 | Ga0373940_0022780 | Ga0373940_0022780_72_1061 | 263 |
| 821 | 3300035089 | Ga0373944_0013599 | Ga0373944_0013599_1017_2003 | 263 |
| 822 | 3300035090 | Ga0373949_0000293 | Ga0373949_0000293_7801_8790 | 263 |
| 823 | 3300035090 | Ga0373949_0000952 | Ga0373949_0000952_5207_6196 | 263 |
| 824 | 3300035090 | Ga0373949_0015900 | Ga0373949_0015900_23_1012 | 263 |
| 825 | 3300035090 | Ga0373949_0027664 | Ga0373949_0027664_93_1079 | 263 |
| 826 | 3300035091 | Ga0373951_0001275 | Ga0373951_0001275_5285_6274 | 263 |
| 827 | 3300035092 | Ga0373952_0000030 | Ga0373952_0000030_8920_9909 | 263 |
| 828 | 3300035092 | Ga0373952_0010083 | Ga0373952_0010083_421_1410 | 263 |
| 829 | 3300035092 | Ga0373952_0013911 | Ga0373952_0013911_48_1001 | 263 |
| 830 | 3300035092 | Ga0373952_0034855 | Ga0373952_0034855_121_1110 | 263 |
| 831 | 3300035111 | Ga0373923_0077086 | Ga0373923_0077086_214_1203 | 263 |
| 832 | 3300035112 | Ga0373932_0024430 | Ga0373932_0024430_160_1149 | 263 |
| 833 | 3300035112 | Ga0373932_0055616 | Ga0373932_0055616_124_1074 | 263 |
| 834 | 3300035112 | Ga0373932_0077125 | Ga0373932_0077125_40_1026 | 263 |
| 835 | 3300035113 | Ga0373936_0009974 | Ga0373936_0009974_1371_2342 | 263 |
| 836 | 3300035113 | Ga0373936_0019684 | Ga0373936_0019684_336_1325 | 263 |
| 837 | 3300035114 | Ga0373939_0000791 | Ga0373939_0000791_3303_4292 | 263 |
| 838 | 3300035115 | Ga0373941_0000050 | Ga0373941_0000050_14602_15591 | 263 |
| 839 | 3300035115 | Ga0373941_0002899 | Ga0373941_0002899_536_1528 | 263 |
| 840 | 3300035115 | Ga0373941_0004506 | Ga0373941_0004506_612_1601 | 263 |
| 841 | 3300035115 | Ga0373941_0046160 | Ga0373941_0046160_315_1304 | 263 |
| 842 | 3300035116 | Ga0373945_0001214 | Ga0373945_0001214_1704_2690 | 263 |
| 843 | 3300035116 | Ga0373945_0005087 | Ga0373945_0005087_1737_2726 | 263 |
| 844 | 3300035116 | Ga0373945_0114844 | Ga0373945_0114844_137_994 | 263 |
| 845 | 3300035117 | Ga0373953_0001444 | Ga0373953_0001444_391_1362 | 263 |
| 846 | 3300035117 | Ga0373953_0051017 | Ga0373953_0051017_652_1641 | 263 |
| 847 | 3300035118 | Ga0373954_0001943 | Ga0373954_0001943_3198_4184 | 263 |
| 848 | 3300035118 | Ga0373954_0006970 | Ga0373954_0006970_246_1214 | 263 |
| 849 | 3300035118 | Ga0373954_0008746 | Ga0373954_0008746_2544_3515 | 263 |
| 850 | 3300035118 | Ga0373954_0021614 | Ga0373954_0021614_1755_2744 | 263 |
| 851 | 3300035118 | Ga0373954_0041945 | Ga0373954_0041945_321_1310 | 263 |
| 852 | 3300035119 | Ga0373956_0024531 | Ga0373956_0024531_680_1669 | 263 |
| 853 | 3300035120 | Ga0373957_0003309 | Ga0373957_0003309_305_1297 | 263 |
| 854 | 3300035120 | Ga0373957_0005066 | Ga0373957_0005066_514_1485 | 263 |
| 855 | 3300035120 | Ga0373957_0024044 | Ga0373957_0024044_974_1942 | 263 |
| 856 | 3300035121 | Ga0373960_0004388 | Ga0373960_0004388_1397_2395 | 263 |
| 857 | 3300035121 | Ga0373960_0007174 | Ga0373960_0007174_1710_2567 | 263 |
| 858 | 3300035121 | Ga0373960_0016939 | Ga0373960_0016939_879_1868 | 263 |
| 859 | 3300035121 | Ga0373960_0045372 | Ga0373960_0045372_255_1244 | 263 |
| 860 | 3300035170 | Ga0373943_0001792 | Ga0373943_0001792_3846_4832 | 263 |
| 861 | 3300035170 | Ga0373943_0006259 | Ga0373943_0006259_945_1916 | 263 |
| 862 | 3300035170 | Ga0373943_0011476 | Ga0373943_0011476_1743_2732 | 263 |
| 863 | 3300035171 | Ga0373946_0000496 | Ga0373946_0000496_1494_2480 | 263 |
| 864 | 3300035171 | Ga0373946_0007440 | Ga0373946_0007440_258_1244 | 263 |
| 865 | 3300035171 | Ga0373946_0044280 | Ga0373946_0044280_215_1201 | 263 |
| 866 | 3300035171 | Ga0373946_0088151 | Ga0373946_0088151_343_1341 | 263 |
| 867 | 3300035172 | Ga0373955_0000779 | Ga0373955_0000779_9273_10265 | 263 |
| 868 | 3300035172 | Ga0373955_0005131 | Ga0373955_0005131_2937_3929 | 263 |
| 869 | 3300035172 | Ga0373955_0017746 | Ga0373955_0017746_305_1294 | 263 |
| 870 | 3300035172 | Ga0373955_0136417 | Ga0373955_0136417_137_1126 | 263 |
| 871 | 3300035207 | Ga0373942_0000073 | Ga0373942_0000073_8088_9077 | 263 |
| 872 | 3300035241 | Ga0373961_0000480 | Ga0373961_0000480_1684_2673 | 263 |
| 873 | 3300035241 | Ga0373961_0009096 | Ga0373961_0009096_867_1856 | 263 |
| 874 | 3300035242 | Ga0373962_0001214 | Ga0373962_0001214_157_1146 | 263 |
| 875 | 3300035242 | Ga0373962_0008813 | Ga0373962_0008813_1375_2364 | 263 |
| 876 | 3300035242 | Ga0373962_0011212 | Ga0373962_0011212_1181_2167 | 263 |
| 877 | 3300035242 | Ga0373962_0036676 | Ga0373962_0036676_122_1111 | 263 |
| 878 | 3300035410 | Ga0373924_0036219 | Ga0373924_0036219_1126_1989 | 263 |
| 879 | 3300035410 | Ga0373924_0053087 | Ga0373924_0053087_87_1079 | 263 |
| 880 | 3300035691 | Ga0373931_0000537 | Ga0373931_0000537_9407_10396 | 263 |
| 881 | 3300035691 | Ga0373931_0004302 | Ga0373931_0004302_1405_2394 | 263 |
| 882 | 3300035691 | Ga0373931_0006018 | Ga0373931_0006018_3114_4103 | 263 |
| 883 | 3300035691 | Ga0373931_0023545 | Ga0373931_0023545_1716_2708 | 263 |
| 884 | 3300035691 | Ga0373931_0025443 | Ga0373931_0025443_1317_2165 | 263 |
| 885 | 3300035691 | Ga0373931_0027531 | Ga0373931_0027531_1145_2143 | 263 |
| 886 | 3300035692 | Ga0373935_0000053 | Ga0373935_0000053_9810_10781 | 263 |
| 887 | 3300035692 | Ga0373935_0001261 | Ga0373935_0001261_6256_7242 | 263 |
| 888 | 3300035692 | Ga0373935_0016092 | Ga0373935_0016092_661_1647 | 263 |
| 889 | 3300035692 | Ga0373935_0030809 | Ga0373935_0030809_1169_2158 | 263 |
| 890 | 3300035692 | Ga0373935_0111894 | Ga0373935_0111894_564_1556 | 263 |
| 891 | 3300035692 | Ga0373935_0187353 | Ga0373935_0187353_113_1102 | 263 |
| 892 | 3300035695 | Ga0373927_0014200 | Ga0373927_0014200_2239_3228 | 263 |
| 893 | 3300035695 | Ga0373927_0035423 | Ga0373927_0035423_1510_2502 | 263 |
| 894 | 3300035724 | Ga0373933_0001426 | Ga0373933_0001426_8841_9812 | 263 |
| 895 | 3300035724 | Ga0373933_0002786 | Ga0373933_0002786_6587_7579 | 263 |
| 896 | 3300035724 | Ga0373933_0021557 | Ga0373933_0021557_859_1848 | 263 |
| 897 | 3300035724 | Ga0373933_0022272 | Ga0373933_0022272_1229_2197 | 263 |
| 898 | 3300035724 | Ga0373933_0051395 | Ga0373933_0051395_183_1169 | 263 |
| 899 | 3300035725 | Ga0373947_0000259 | Ga0373947_0000259_17950_18921 | 263 |
| 900 | 3300035725 | Ga0373947_0054577 | Ga0373947_0054577_463_1449 | 263 |
| 901 | 3300036401 | Ga0373937_0000030 | Ga0373937_0000030_28885_29856 | 263 |
| 902 | 3300036401 | Ga0373937_0000907 | Ga0373937_0000907_21324_22292 | 263 |
| 903 | 3300036401 | Ga0373937_0003255 | Ga0373937_0003255_3613_4599 | 263 |
| 904 | 3300036401 | Ga0373937_0036814 | Ga0373937_0036814_1708_2697 | 263 |
| 905 | 3300036401 | Ga0373937_0046962 | Ga0373937_0046962_2729_3721 | 263 |
| 906 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_36420_37391 | 263 |
| 907 | 3300037068 | Ga0373925_0010040 | Ga0373925_0010040_5192_6178 | 263 |
| 908 | 3300037068 | Ga0373925_0019842 | Ga0373925_0019842_3543_4529 | 263 |
| 909 | 3300037068 | Ga0373925_0120679 | Ga0373925_0120679_169_1158 | 263 |
| 910 | 3300037418 | Ga0395900_0009186 | Ga0395900_0009186_2365_3357 | 263 |
| 911 | 3300037418 | Ga0395900_0022366 | Ga0395900_0022366_4516_5505 | 263 |
| 912 | 3300037466 | Ga0395898_0001841 | Ga0395898_0001841_25786_26778 | 263 |
| 913 | 3300037466 | Ga0395898_0003941 | Ga0395898_0003941_4993_5982 | 263 |
| 914 | 3300037853 | Ga0436364_0478575 | Ga0436364_0478575_156_1142 | 263 |
| 915 | 3300038443 | Ga0395901_0014006 | Ga0395901_0014006_4645_5634 | 263 |
| 916 | 3300038443 | Ga0395901_0125602 | Ga0395901_0125602_1796_2644 | 263 |
| 917 | 3300038443 | Ga0395901_0194074 | Ga0395901_0194074_12_1004 | 263 |
| 918 | 3300038443 | Ga0395901_0310785 | Ga0395901_0310785_575_1567 | 263 |
| 919 | 3300039437 | Ga0436365_0556834 | Ga0436365_0556834_92_1075 | 263 |
| 920 | 3300041408 | Ga0439453_0002489 | Ga0439453_0002489_1028_2008 | 263 |
| 921 | 3300042003 | Ga0439443_000477 | Ga0439443_000477_1361_2341 | 263 |
| 922 | 3300042008 | Ga0439450_002377 | Ga0439450_002377_1730_2719 | 263 |
| 923 | 3300042156 | Ga0439446_0001019 | Ga0439446_0001019_1875_2840 | 263 |
| 924 | 3300042436 | Ga0439435_0000002 | Ga0439435_0000002_14068_15033 | 263 |
| 925 | 3300042436 | Ga0439435_0000646 | Ga0439435_0000646_2657_3637 | 263 |
| 926 | 3300042876 | Ga0451577_0206376 | Ga0451577_0206376_100_1089 | 263 |
| 927 | 3300044673 | Ga0453683_0000968 | Ga0453683_0000968_25441_26418 | 263 |
| 928 | 3300044694 | Ga0466963_0013664 | Ga0466963_0013664_62_1018 | 263 |
| 929 | 3300044712 | Ga0453684_0283538 | Ga0453684_0283538_865_1854 | 263 |
| 930 | 3300045051 | Ga0451576_0559512 | Ga0451576_0559512_140_1129 | 263 |
| 931 | 3300045976 | Ga0466967_0000135 | Ga0466967_0000135_3694_4650 | 263 |
| 932 | 3300046454 | Ga0495592_0000046 | Ga0495592_0000046_72063_73034 | 263 |
| 933 | 3300046454 | Ga0495592_0001393 | Ga0495592_0001393_6480_7448 | 263 |
| 934 | 3300046454 | Ga0495592_0002484 | Ga0495592_0002484_8279_9265 | 263 |
| 935 | 3300046454 | Ga0495592_0075149 | Ga0495592_0075149_1470_2438 | 263 |
| 936 | 3300046454 | Ga0495592_0257395 | Ga0495592_0257395_99_1085 | 263 |
| 937 | 3300046455 | Ga0495603_0001804 | Ga0495603_0001804_10745_11731 | 263 |
| 938 | 3300046455 | Ga0495603_0002249 | Ga0495603_0002249_5161_6147 | 263 |
| 939 | 3300046455 | Ga0495603_0014184 | Ga0495603_0014184_27_1013 | 263 |
| 940 | 3300046459 | Ga0495629_0000594 | Ga0495629_0000594_23154_24140 | 263 |
| 941 | 3300046459 | Ga0495629_0001140 | Ga0495629_0001140_2804_3790 | 263 |
| 942 | 3300046459 | Ga0495629_0002311 | Ga0495629_0002311_10634_11605 | 263 |
| 943 | 3300046459 | Ga0495629_0032319 | Ga0495629_0032319_21_1007 | 263 |
| 944 | 3300046459 | Ga0495629_0088951 | Ga0495629_0088951_826_1815 | 263 |
| 945 | 3300046461 | Ga0495641_0011331 | Ga0495641_0011331_216_1205 | 263 |
| 946 | 3300046461 | Ga0495641_0017820 | Ga0495641_0017820_978_1964 | 263 |
| 947 | 3300046462 | Ga0495651_0000822 | Ga0495651_0000822_14108_15079 | 263 |
| 948 | 3300046462 | Ga0495651_0004816 | Ga0495651_0004816_7624_8613 | 263 |
| 949 | 3300046462 | Ga0495651_0006482 | Ga0495651_0006482_7202_8170 | 263 |
| 950 | 3300046462 | Ga0495651_0047233 | Ga0495651_0047233_1495_2481 | 263 |
| 951 | 3300046462 | Ga0495651_0062848 | Ga0495651_0062848_1327_2313 | 263 |
| 952 | 3300046462 | Ga0495651_0086884 | Ga0495651_0086884_902_1894 | 263 |
| 953 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_36466_37437 | 263 |
| 954 | 3300046463 | Ga0495653_0004798 | Ga0495653_0004798_3572_4558 | 263 |
| 955 | 3300046463 | Ga0495653_0181253 | Ga0495653_0181253_442_1434 | 263 |
| 956 | 3300046472 | Ga0495580_0012844 | Ga0495580_0012844_4718_5704 | 263 |
| 957 | 3300046472 | Ga0495580_0057444 | Ga0495580_0057444_1320_2309 | 263 |
| 958 | 3300046472 | Ga0495580_0070869 | Ga0495580_0070869_819_1805 | 263 |
| 959 | 3300046473 | Ga0495582_0000379 | Ga0495582_0000379_1691_2677 | 263 |
| 960 | 3300046473 | Ga0495582_0009407 | Ga0495582_0009407_383_1369 | 263 |
| 961 | 3300046473 | Ga0495582_0010594 | Ga0495582_0010594_3868_4857 | 263 |
| 962 | 3300046473 | Ga0495582_0052800 | Ga0495582_0052800_881_1867 | 263 |
| 963 | 3300046474 | Ga0495605_0136938 | Ga0495605_0136938_55_1041 | 263 |
| 964 | 3300046475 | Ga0495639_0046773 | Ga0495639_0046773_932_1918 | 263 |
| 965 | 3300046476 | Ga0495662_0000084 | Ga0495662_0000084_29545_30531 | 263 |
| 966 | 3300046476 | Ga0495662_0027194 | Ga0495662_0027194_1256_2245 | 263 |
| 967 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_72100_73071 | 263 |
| 968 | 3300046477 | Ga0495664_0007745 | Ga0495664_0007745_109_1095 | 263 |
| 969 | 3300046477 | Ga0495664_0043029 | Ga0495664_0043029_1391_2377 | 263 |
| 970 | 3300046477 | Ga0495664_0048292 | Ga0495664_0048292_1046_2014 | 263 |
| 971 | 3300046477 | Ga0495664_0050575 | Ga0495664_0050575_215_1204 | 263 |
| 972 | 3300046491 | Ga0495584_0048021 | Ga0495584_0048021_128_1117 | 263 |
| 973 | 3300046492 | Ga0495585_0001932 | Ga0495585_0001932_8487_9473 | 263 |
| 974 | 3300046499 | Ga0495594_0009110 | Ga0495594_0009110_3535_4524 | 263 |
| 975 | 3300046499 | Ga0495594_0011284 | Ga0495594_0011284_21_1007 | 263 |
| 976 | 3300046499 | Ga0495594_0055076 | Ga0495594_0055076_1073_2059 | 263 |
| 977 | 3300046506 | Ga0495583_0074035 | Ga0495583_0074035_472_1458 | 263 |
| 978 | 3300046511 | Ga0495608_0000006 | Ga0495608_0000006_141475_142446 | 263 |
| 979 | 3300046511 | Ga0495608_0017846 | Ga0495608_0017846_3788_4774 | 263 |
| 980 | 3300046511 | Ga0495608_0215979 | Ga0495608_0215979_88_1080 | 263 |
| 981 | 3300046513 | Ga0495616_0048796 | Ga0495616_0048796_905_1891 | 263 |
| 982 | 3300046513 | Ga0495616_0154975 | Ga0495616_0154975_15_1004 | 263 |
| 983 | 3300046514 | Ga0495618_0000034 | Ga0495618_0000034_89279_90250 | 263 |
| 984 | 3300046514 | Ga0495618_0001547 | Ga0495618_0001547_3379_4365 | 263 |
| 985 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_36383_37354 | 263 |
| 986 | 3300046516 | Ga0495628_0003624 | Ga0495628_0003624_10706_11695 | 263 |
| 987 | 3300046516 | Ga0495628_0027943 | Ga0495628_0027943_1415_2383 | 263 |
| 988 | 3300046517 | Ga0495630_0000662 | Ga0495630_0000662_14140_15111 | 263 |
| 989 | 3300046517 | Ga0495630_0005622 | Ga0495630_0005622_3359_4345 | 263 |
| 990 | 3300046517 | Ga0495630_0042264 | Ga0495630_0042264_112_1098 | 263 |
| 991 | 3300046517 | Ga0495630_0178293 | Ga0495630_0178293_53_1039 | 263 |
| 992 | 3300046523 | Ga0495644_0003085 | Ga0495644_0003085_2312_3298 | 263 |
| 993 | 3300046526 | Ga0495666_0001508 | Ga0495666_0001508_5159_6145 | 263 |
| 994 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_551427_552398 | 263 |
| 995 | 3300046529 | Ga0495652_0013904 | Ga0495652_0013904_3378_4364 | 263 |
| 996 | 3300046529 | Ga0495652_0014845 | Ga0495652_0014845_5314_6282 | 263 |
| 997 | 3300046529 | Ga0495652_0019057 | Ga0495652_0019057_5026_6015 | 263 |
| 998 | 3300046529 | Ga0495652_0078363 | Ga0495652_0078363_856_1842 | 263 |
| 999 | 3300046529 | Ga0495652_0154943 | Ga0495652_0154943_112_969 | 263 |
| 1000 | 3300046531 | Ga0495665_0003909 | Ga0495665_0003909_4605_5591 | 263 |
| 1001 | 3300046533 | Ga0495640_0000007 | Ga0495640_0000007_89161_90132 | 263 |
| 1002 | 3300046533 | Ga0495640_0006199 | Ga0495640_0006199_896_1882 | 263 |
| 1003 | 3300046533 | Ga0495640_0010455 | Ga0495640_0010455_2804_3790 | 263 |
| 1004 | 3300046533 | Ga0495640_0050524 | Ga0495640_0050524_1249_2235 | 263 |
| 1005 | 3300046533 | Ga0495640_0075109 | Ga0495640_0075109_233_1222 | 263 |
| 1006 | 3300046533 | Ga0495640_0211013 | Ga0495640_0211013_162_1151 | 263 |
| 1007 | 3300046536 | Ga0495587_0000031 | Ga0495587_0000031_36485_37456 | 263 |
| 1008 | 3300046536 | Ga0495587_0002979 | Ga0495587_0002979_840_1826 | 263 |
| 1009 | 3300046536 | Ga0495587_0016339 | Ga0495587_0016339_3445_4413 | 263 |
| 1010 | 3300046536 | Ga0495587_0114061 | Ga0495587_0114061_471_1463 | 263 |
| 1011 | 3300046536 | Ga0495587_0118380 | Ga0495587_0118380_26_1015 | 263 |
| 1012 | 3300046537 | Ga0495598_0004396 | Ga0495598_0004396_1646_2632 | 263 |
| 1013 | 3300046537 | Ga0495598_0019744 | Ga0495598_0019744_542_1531 | 263 |
| 1014 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_17736_18707 | 263 |
| 1015 | 3300046543 | Ga0495645_0010875 | Ga0495645_0010875_3348_4316 | 263 |
| 1016 | 3300046557 | Ga0495622_0013050 | Ga0495622_0013050_1609_2598 | 263 |
| 1017 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_400267_401238 | 263 |
| 1018 | 3300046559 | Ga0495667_0000202 | Ga0495667_0000202_34439_35425 | 263 |
| 1019 | 3300046559 | Ga0495667_0000365 | Ga0495667_0000365_1341_2309 | 263 |
| 1020 | 3300046559 | Ga0495667_0250301 | Ga0495667_0250301_84_1070 | 263 |
| 1021 | 3300046559 | Ga0495667_0302345 | Ga0495667_0302345_14_931 | 263 |
| 1022 | 3300046615 | Ga0495656_0026229 | Ga0495656_0026229_1212_2201 | 263 |
| 1023 | 3300046642 | Ga0495634_0000533 | Ga0495634_0000533_1028_1999 | 263 |
| 1024 | 3300046642 | Ga0495634_0007719 | Ga0495634_0007719_273_1259 | 263 |
| 1025 | 3300046642 | Ga0495634_0008544 | Ga0495634_0008544_3098_4084 | 263 |
| 1026 | 3300046642 | Ga0495634_0050245 | Ga0495634_0050245_692_1660 | 263 |
| 1027 | 3300046642 | Ga0495634_0098239 | Ga0495634_0098239_234_1223 | 263 |
| 1028 | 3300046642 | Ga0495634_0186293 | Ga0495634_0186293_181_1170 | 263 |
| 1029 | 3300046648 | Ga0495611_0053259 | Ga0495611_0053259_183_1169 | 263 |
| 1030 | 3300046663 | Ga0495635_0000022 | Ga0495635_0000022_6768_7739 | 263 |
| 1031 | 3300046663 | Ga0495635_0000981 | Ga0495635_0000981_1183_2169 | 263 |
| 1032 | 3300046663 | Ga0495635_0013894 | Ga0495635_0013894_3108_4097 | 263 |
| 1033 | 3300046663 | Ga0495635_0087593 | Ga0495635_0087593_523_1491 | 263 |
| 1034 | 3300046663 | Ga0495635_0116019 | Ga0495635_0116019_754_1740 | 263 |
| 1035 | 3300046664 | Ga0495659_0004216 | Ga0495659_0004216_274_1260 | 263 |
| 1036 | 3300046664 | Ga0495659_0034053 | Ga0495659_0034053_761_1750 | 263 |
| 1037 | 3300046665 | Ga0495661_0010683 | Ga0495661_0010683_1506_2492 | 263 |
| 1038 | 3300046674 | Ga0495588_0108007 | Ga0495588_0108007_466_1452 | 263 |
| 1039 | 3300046675 | Ga0495657_0000276 | Ga0495657_0000276_9864_10835 | 263 |
| 1040 | 3300046675 | Ga0495657_0090215 | Ga0495657_0090215_268_1257 | 263 |
| 1041 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_175163_176134 | 263 |
| 1042 | 3300046678 | Ga0495599_0002835 | Ga0495599_0002835_8630_9619 | 263 |
| 1043 | 3300046678 | Ga0495599_0046540 | Ga0495599_0046540_1583_2569 | 263 |
| 1044 | 3300046679 | Ga0495623_0000094 | Ga0495623_0000094_17671_18642 | 263 |
| 1045 | 3300046679 | Ga0495623_0001448 | Ga0495623_0001448_2203_3171 | 263 |
| 1046 | 3300046679 | Ga0495623_0093803 | Ga0495623_0093803_254_1246 | 263 |
| 1047 | 3300046680 | Ga0495646_0000007 | Ga0495646_0000007_60671_61642 | 263 |
| 1048 | 3300046680 | Ga0495646_0038495 | Ga0495646_0038495_649_1617 | 263 |
| 1049 | 3300046680 | Ga0495646_0080686 | Ga0495646_0080686_911_1879 | 263 |
| 1050 | 3300046681 | Ga0495647_0000122 | Ga0495647_0000122_6305_7291 | 263 |
| 1051 | 3300046681 | Ga0495647_0000393 | Ga0495647_0000393_5320_6306 | 263 |
| 1052 | 3300046681 | Ga0495647_0001922 | Ga0495647_0001922_1555_2544 | 263 |
| 1053 | 3300046683 | Ga0495658_0000210 | Ga0495658_0000210_15612_16598 | 263 |
| 1054 | 3300046683 | Ga0495658_0005298 | Ga0495658_0005298_1298_2284 | 263 |
| 1055 | 3300046683 | Ga0495658_0009937 | Ga0495658_0009937_3448_4437 | 263 |
| 1056 | 3300046683 | Ga0495658_0026729 | Ga0495658_0026729_345_1331 | 263 |
| 1057 | 3300046683 | Ga0495658_0198856 | Ga0495658_0198856_180_1166 | 263 |
| 1058 | 3300046684 | Ga0495669_0040626 | Ga0495669_0040626_852_1838 | 263 |
| 1059 | 3300046684 | Ga0495669_0058211 | Ga0495669_0058211_582_1571 | 263 |
| 1060 | 3300046689 | Ga0495613_0014661 | Ga0495613_0014661_4144_5115 | 263 |
| 1061 | 3300046689 | Ga0495613_0018397 | Ga0495613_0018397_2731_3717 | 263 |
| 1062 | 3300046689 | Ga0495613_0083862 | Ga0495613_0083862_1204_2190 | 263 |
| 1063 | 3300046690 | Ga0495624_0000222 | Ga0495624_0000222_8884_9870 | 263 |
| 1064 | 3300046690 | Ga0495624_0020416 | Ga0495624_0020416_2445_3416 | 263 |
| 1065 | 3300046690 | Ga0495624_0024713 | Ga0495624_0024713_1739_2728 | 263 |
| 1066 | 3300046690 | Ga0495624_0034304 | Ga0495624_0034304_939_1907 | 263 |
| 1067 | 3300046691 | Ga0495670_0001624 | Ga0495670_0001624_1245_2231 | 263 |
| 1068 | 3300046691 | Ga0495670_0045447 | Ga0495670_0045447_321_1310 | 263 |
| 1069 | 3300046691 | Ga0495670_0072999 | Ga0495670_0072999_373_1362 | 263 |
| 1070 | 3300046692 | Ga0495671_0128272 | Ga0495671_0128272_218_1207 | 263 |
| 1071 | 3300046809 | Ga0495600_0000033 | Ga0495600_0000033_46231_47202 | 263 |
| 1072 | 3300046809 | Ga0495600_0000506 | Ga0495600_0000506_592_1578 | 263 |
| 1073 | 3300046809 | Ga0495600_0002658 | Ga0495600_0002658_3550_4539 | 263 |
| 1074 | 3300046809 | Ga0495600_0030323 | Ga0495600_0030323_450_1418 | 263 |
| 1075 | 3300046809 | Ga0495600_0124399 | Ga0495600_0124399_656_1648 | 263 |
| 1076 | 3300047315 | Ga0495581_0005193 | Ga0495581_0005193_3745_4731 | 263 |
| 1077 | 3300047315 | Ga0495581_0014416 | Ga0495581_0014416_2979_3968 | 263 |
| 1078 | 3300047315 | Ga0495581_0020808 | Ga0495581_0020808_2786_3772 | 263 |
| 1079 | 3300047315 | Ga0495581_0046003 | Ga0495581_0046003_196_1182 | 263 |
| 1080 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_62129_63100 | 263 |
| 1081 | 3300047317 | Ga0495604_0001089 | Ga0495604_0001089_2612_3598 | 263 |
| 1082 | 3300047317 | Ga0495604_0002751 | Ga0495604_0002751_1821_2810 | 263 |
| 1083 | 3300047317 | Ga0495604_0007025 | Ga0495604_0007025_5186_6154 | 263 |
| 1084 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_524670_525641 | 263 |
| 1085 | 3300047319 | Ga0495674_0001490 | Ga0495674_0001490_20086_21072 | 263 |
| 1086 | 3300047319 | Ga0495674_0014630 | Ga0495674_0014630_2616_3602 | 263 |
| 1087 | 3300047319 | Ga0495674_0071080 | Ga0495674_0071080_243_1211 | 263 |
| 1088 | 3300047319 | Ga0495674_0144775 | Ga0495674_0144775_838_1827 | 263 |
| 1089 | 3300047320 | Ga0495672_0144545 | Ga0495672_0144545_244_1224 | 263 |
| 1090 | 3300047321 | Ga0495676_0000289 | Ga0495676_0000289_13846_14832 | 263 |
| 1091 | 3300047321 | Ga0495676_0021676 | Ga0495676_0021676_3794_4783 | 263 |
| 1092 | 3300047321 | Ga0495676_0059814 | Ga0495676_0059814_1052_2041 | 263 |
| 1093 | 3300047321 | Ga0495676_0079695 | Ga0495676_0079695_1480_2466 | 263 |
| 1094 | 3300047322 | Ga0495680_0000091 | Ga0495680_0000091_63012_63983 | 263 |
| 1095 | 3300047322 | Ga0495680_0001414 | Ga0495680_0001414_11991_12977 | 263 |
| 1096 | 3300047322 | Ga0495680_0012301 | Ga0495680_0012301_1607_2593 | 263 |
| 1097 | 3300047322 | Ga0495680_0018026 | Ga0495680_0018026_1313_2281 | 263 |
| 1098 | 3300047322 | Ga0495680_0037109 | Ga0495680_0037109_1579_2568 | 263 |
| 1099 | 3300047322 | Ga0495680_0072323 | Ga0495680_0072323_438_1424 | 263 |
| 1100 | 3300047322 | Ga0495680_0408977 | Ga0495680_0408977_17_874 | 263 |
| 1101 | 3300047444 | Ga0495675_0000064 | Ga0495675_0000064_36779_37750 | 263 |
| 1102 | 3300047444 | Ga0495675_0006504 | Ga0495675_0006504_5536_6504 | 263 |
| 1103 | 3300047471 | Ga0495684_0000035 | Ga0495684_0000035_17638_18609 | 263 |
| 1104 | 3300047471 | Ga0495684_0000075 | Ga0495684_0000075_58658_59644 | 263 |
| 1105 | 3300047471 | Ga0495684_0073421 | Ga0495684_0073421_1565_2551 | 263 |
| 1106 | 3300047471 | Ga0495684_0202056 | Ga0495684_0202056_455_1447 | 263 |
| 1107 | 3300047472 | Ga0495686_0194647 | Ga0495686_0194647_113_1102 | 263 |
| 1108 | 3300047673 | Ga0495593_0001106 | Ga0495593_0001106_10807_11778 | 263 |
| 1109 | 3300047673 | Ga0495593_0033459 | Ga0495593_0033459_344_1330 | 263 |
| 1110 | 3300048088 | Ga0495602_0000029 | Ga0495602_0000029_17628_18599 | 263 |
| 1111 | 3300048088 | Ga0495602_0002033 | Ga0495602_0002033_7073_8041 | 263 |
| 1112 | 3300048088 | Ga0495602_0018847 | Ga0495602_0018847_4440_5429 | 263 |
| 1113 | 3300048088 | Ga0495602_0139834 | Ga0495602_0139834_476_1462 | 263 |
| 1114 | 3300048903 | Ga0496100_0000404 | Ga0496100_0000404_19181_20170 | 263 |
| 1115 | 3300048903 | Ga0496100_0000823 | Ga0496100_0000823_929_1915 | 263 |
| 1116 | 3300048903 | Ga0496100_0013536 | Ga0496100_0013536_3311_4300 | 263 |
| 1117 | 3300048903 | Ga0496100_0200173 | Ga0496100_0200173_19_882 | 263 |
| 1118 | 3300048904 | Ga0496101_0000423 | Ga0496101_0000423_19548_20537 | 263 |
| 1119 | 3300048904 | Ga0496101_0042230 | Ga0496101_0042230_47_1039 | 263 |
| 1120 | 3300048904 | Ga0496101_0074352 | Ga0496101_0074352_118_1116 | 263 |
| 1121 | 3300048905 | Ga0496102_0003323 | Ga0496102_0003323_10204_11193 | 263 |
| 1122 | 3300048905 | Ga0496102_0004385 | Ga0496102_0004385_10226_11224 | 263 |
| 1123 | 3300048905 | Ga0496102_0017907 | Ga0496102_0017907_3824_4813 | 263 |
| 1124 | 3300048905 | Ga0496102_0050819 | Ga0496102_0050819_2773_3765 | 263 |
| 1125 | 3300048905 | Ga0496102_0185693 | Ga0496102_0185693_567_1559 | 263 |
| 1126 | 3300048905 | Ga0496102_0199970 | Ga0496102_0199970_131_1117 | 263 |
| 1127 | 3300048906 | Ga0496103_0000967 | Ga0496103_0000967_76_1065 | 263 |
| 1128 | 3300048906 | Ga0496103_0161660 | Ga0496103_0161660_143_1135 | 263 |
| 1129 | 3300048907 | Ga0496104_0000711 | Ga0496104_0000711_9056_10039 | 263 |
| 1130 | 3300048907 | Ga0496104_0000925 | Ga0496104_0000925_10427_11410 | 263 |
| 1131 | 3300048907 | Ga0496104_0005217 | Ga0496104_0005217_4985_5977 | 263 |
| 1132 | 3300048907 | Ga0496104_0005466 | Ga0496104_0005466_6405_7373 | 263 |
| 1133 | 3300048907 | Ga0496104_0014835 | Ga0496104_0014835_2191_3180 | 263 |
| 1134 | 3300048907 | Ga0496104_0018532 | Ga0496104_0018532_1579_2571 | 263 |
| 1135 | 3300048907 | Ga0496104_0026724 | Ga0496104_0026724_3400_4389 | 263 |
| 1136 | 3300048907 | Ga0496104_0037384 | Ga0496104_0037384_197_1213 | 263 |
| 1137 | 3300048907 | Ga0496104_0462323 | Ga0496104_0462323_124_1116 | 263 |
| 1138 | 3300048908 | Ga0496105_0007195 | Ga0496105_0007195_7403_8401 | 263 |
| 1139 | 3300048908 | Ga0496105_0010049 | Ga0496105_0010049_5336_6304 | 263 |
| 1140 | 3300048908 | Ga0496105_0017905 | Ga0496105_0017905_4445_5437 | 263 |
| 1141 | 3300048908 | Ga0496105_0020189 | Ga0496105_0020189_22_1014 | 263 |
| 1142 | 3300048908 | Ga0496105_0025218 | Ga0496105_0025218_3430_4398 | 263 |
| 1143 | 3300048908 | Ga0496105_0096900 | Ga0496105_0096900_478_1461 | 263 |
| 1144 | 3300048908 | Ga0496105_0124462 | Ga0496105_0124462_662_1651 | 263 |
| 1145 | 3300048908 | Ga0496105_0245365 | Ga0496105_0245365_54_1046 | 263 |
| 1146 | 3300048908 | Ga0496105_0339947 | Ga0496105_0339947_162_1151 | 263 |
| 1147 | 3300048909 | Ga0496106_0002446 | Ga0496106_0002446_10193_11182 | 263 |
| 1148 | 3300048909 | Ga0496106_0003669 | Ga0496106_0003669_8590_9588 | 263 |
| 1149 | 3300048909 | Ga0496106_0005520 | Ga0496106_0005520_1167_2159 | 263 |
| 1150 | 3300048909 | Ga0496106_0015174 | Ga0496106_0015174_3085_4074 | 263 |
| 1151 | 3300048909 | Ga0496106_0269363 | Ga0496106_0269363_325_1314 | 263 |
| 1152 | 3300048910 | Ga0496107_0000500 | Ga0496107_0000500_10065_11054 | 263 |
| 1153 | 3300048910 | Ga0496107_0021517 | Ga0496107_0021517_827_1816 | 263 |
| 1154 | 3300048910 | Ga0496107_0130304 | Ga0496107_0130304_13_1002 | 263 |
| 1155 | 3300048911 | Ga0496108_0018949 | Ga0496108_0018949_4251_5240 | 263 |
| 1156 | 3300048911 | Ga0496108_0040996 | Ga0496108_0040996_178_1167 | 263 |
| 1157 | 3300048911 | Ga0496108_0053124 | Ga0496108_0053124_621_1613 | 263 |
| 1158 | 3300048911 | Ga0496108_0068004 | Ga0496108_0068004_455_1444 | 263 |
| 1159 | 3300048911 | Ga0496108_0115535 | Ga0496108_0115535_1175_2173 | 263 |
| 1160 | 3300048912 | Ga0496109_0000340 | Ga0496109_0000340_7903_8892 | 263 |
| 1161 | 3300048912 | Ga0496109_0000359 | Ga0496109_0000359_8691_9680 | 263 |
| 1162 | 3300048912 | Ga0496109_0000976 | Ga0496109_0000976_16805_17794 | 263 |
| 1163 | 3300048912 | Ga0496109_0005940 | Ga0496109_0005940_3855_4847 | 263 |
| 1164 | 3300048912 | Ga0496109_0015600 | Ga0496109_0015600_3654_4646 | 263 |
| 1165 | 3300048912 | Ga0496109_0056951 | Ga0496109_0056951_1001_1984 | 263 |
| 1166 | 3300048912 | Ga0496109_0082278 | Ga0496109_0082278_1224_2192 | 263 |
| 1167 | 3300048913 | Ga0496110_0002357 | Ga0496110_0002357_8387_9379 | 263 |
| 1168 | 3300048913 | Ga0496110_0003362 | Ga0496110_0003362_6745_7731 | 263 |
| 1169 | 3300048913 | Ga0496110_0020674 | Ga0496110_0020674_3711_4703 | 263 |
| 1170 | 3300048913 | Ga0496110_0027384 | Ga0496110_0027384_1693_2682 | 263 |
| 1171 | 3300048913 | Ga0496110_0229269 | Ga0496110_0229269_583_1566 | 263 |
| 1172 | 3300048914 | Ga0496111_0023917 | Ga0496111_0023917_1329_2321 | 263 |
| 1173 | 3300048914 | Ga0496111_0030852 | Ga0496111_0030852_959_1948 | 263 |
| 1174 | 3300048914 | Ga0496111_0040590 | Ga0496111_0040590_1882_2874 | 263 |
| 1175 | 3300048914 | Ga0496111_0083227 | Ga0496111_0083227_656_1645 | 263 |
| 1176 | 3300048914 | Ga0496111_0090226 | Ga0496111_0090226_1160_2176 | 263 |
| 1177 | 3300048914 | Ga0496111_0276562 | Ga0496111_0276562_103_1095 | 263 |
| 1178 | 3300048915 | Ga0496112_0021049 | Ga0496112_0021049_3621_4613 | 263 |
| 1179 | 3300048915 | Ga0496112_0032947 | Ga0496112_0032947_2237_3226 | 263 |
| 1180 | 3300048915 | Ga0496112_0038798 | Ga0496112_0038798_421_1410 | 263 |
| 1181 | 3300048915 | Ga0496112_0044120 | Ga0496112_0044120_1740_2726 | 263 |
| 1182 | 3300048915 | Ga0496112_0051703 | Ga0496112_0051703_2774_3766 | 263 |
| 1183 | 3300048915 | Ga0496112_0078758 | Ga0496112_0078758_989_1981 | 263 |
| 1184 | 3300048915 | Ga0496112_0122219 | Ga0496112_0122219_1154_2002 | 263 |
| 1185 | 3300048915 | Ga0496112_0216613 | Ga0496112_0216613_149_1147 | 263 |
| 1186 | 3300048915 | Ga0496112_0338368 | Ga0496112_0338368_54_1043 | 263 |
| 1187 | 3300048916 | Ga0496113_0001950 | Ga0496113_0001950_3479_4468 | 263 |
| 1188 | 3300048916 | Ga0496113_0008785 | Ga0496113_0008785_3716_4708 | 263 |
| 1189 | 3300048916 | Ga0496113_0087302 | Ga0496113_0087302_243_1235 | 263 |
| 1190 | 3300048916 | Ga0496113_0189124 | Ga0496113_0189124_378_1367 | 263 |
| 1191 | 3300048917 | Ga0496114_0122875 | Ga0496114_0122875_165_1157 | 263 |
| 1192 | 3300048917 | Ga0496114_0253543 | Ga0496114_0253543_426_1415 | 263 |
| 1193 | 3300048918 | Ga0496115_0009549 | Ga0496115_0009549_2690_3688 | 263 |
| 1194 | 3300048918 | Ga0496115_0019987 | Ga0496115_0019987_434_1426 | 263 |
| 1195 | 3300048918 | Ga0496115_0073699 | Ga0496115_0073699_1683_2669 | 263 |
| 1196 | 3300048918 | Ga0496115_0127875 | Ga0496115_0127875_1031_2029 | 263 |
| 1197 | 3300048918 | Ga0496115_0139123 | Ga0496115_0139123_194_1162 | 263 |
| 1198 | 3300048918 | Ga0496115_0152345 | Ga0496115_0152345_291_1280 | 263 |
| 1199 | 3300048918 | Ga0496115_0189422 | Ga0496115_0189422_658_1647 | 263 |
| 1200 | 3300049568 | Ga0501031_0055503 | Ga0501031_0055503_688_1650 | 263 |
| 1201 | 3300049568 | Ga0501031_0062823 | Ga0501031_0062823_1397_2386 | 263 |
| 1202 | 3300049568 | Ga0501031_0111803 | Ga0501031_0111803_129_1127 | 263 |
| 1203 | 3300049570 | Ga0501033_0044445 | Ga0501033_0044445_1997_2986 | 263 |
| 1204 | 3300049571 | Ga0501034_0006692 | Ga0501034_0006692_10576_11571 | 263 |
| 1205 | 3300049571 | Ga0501034_0029366 | Ga0501034_0029366_1286_2275 | 263 |
| 1206 | 3300049571 | Ga0501034_0080158 | Ga0501034_0080158_1663_2643 | 263 |
| 1207 | 3300049572 | Ga0501036_0018021 | Ga0501036_0018021_4651_5619 | 263 |
| 1208 | 3300049572 | Ga0501036_0246470 | Ga0501036_0246470_179_1168 | 263 |
| 1209 | 3300049574 | Ga0501038_0153148 | Ga0501038_0153148_748_1737 | 263 |
| 1210 | 3300049575 | Ga0501039_0044530 | Ga0501039_0044530_165_1133 | 263 |
| 1211 | 3300049575 | Ga0501039_0297066 | Ga0501039_0297066_243_1226 | 263 |
| 1212 | 3300049576 | Ga0501040_0012594 | Ga0501040_0012594_1431_2399 | 263 |
| 1213 | 3300049576 | Ga0501040_0138114 | Ga0501040_0138114_60_1013 | 263 |
| 1214 | 3300049576 | Ga0501040_0301252 | Ga0501040_0301252_35_1030 | 263 |
| 1215 | 3300049577 | Ga0501041_0017024 | Ga0501041_0017024_2860_3828 | 263 |
| 1216 | 3300049577 | Ga0501041_0095703 | Ga0501041_0095703_792_1754 | 263 |
| 1217 | 3300049578 | Ga0501042_0044547 | Ga0501042_0044547_1111_2094 | 263 |
| 1218 | 3300049578 | Ga0501042_0082155 | Ga0501042_0082155_1424_2275 | 263 |
| 1219 | 3300049578 | Ga0501042_0121352 | Ga0501042_0121352_693_1655 | 263 |
| 1220 | 3300049579 | Ga0501043_0103007 | Ga0501043_0103007_73_1041 | 263 |
| 1221 | 3300049580 | Ga0501046_0032814 | Ga0501046_0032814_2747_3745 | 263 |
| 1222 | 3300049580 | Ga0501046_0039215 | Ga0501046_0039215_2685_3680 | 263 |
| 1223 | 3300049580 | Ga0501046_0062896 | Ga0501046_0062896_1566_2552 | 263 |
| 1224 | 3300049581 | Ga0501047_0006347 | Ga0501047_0006347_3272_4261 | 263 |
| 1225 | 3300049581 | Ga0501047_0009067 | Ga0501047_0009067_4392_5375 | 263 |
| 1226 | 3300049581 | Ga0501047_0018859 | Ga0501047_0018859_2508_3497 | 263 |
| 1227 | 3300049581 | Ga0501047_0039533 | Ga0501047_0039533_259_1239 | 263 |
| 1228 | 3300049582 | Ga0501048_0107955 | Ga0501048_0107955_21_971 | 263 |
| 1229 | 3300049584 | Ga0501068_0139895 | Ga0501068_0139895_179_1162 | 263 |
| 1230 | 3300049586 | Ga0501070_0027193 | Ga0501070_0027193_3626_4606 | 263 |
| 1231 | 3300049586 | Ga0501070_0056684 | Ga0501070_0056684_1617_2606 | 263 |
| 1232 | 3300049587 | Ga0501071_0156383 | Ga0501071_0156383_58_1020 | 263 |
| 1233 | 3300049588 | Ga0501072_0009124 | Ga0501072_0009124_31_993 | 263 |
| 1234 | 3300049588 | Ga0501072_0020826 | Ga0501072_0020826_3994_4962 | 263 |
| 1235 | 3300049588 | Ga0501072_0222407 | Ga0501072_0222407_83_1063 | 263 |
| 1236 | 3300049589 | Ga0501073_0123601 | Ga0501073_0123601_23_1018 | 263 |
| 1237 | 3300049590 | Ga0501074_0073296 | Ga0501074_0073296_1244_2239 | 263 |
| 1238 | 3300049591 | Ga0501075_0004734 | Ga0501075_0004734_7155_8123 | 263 |
| 1239 | 3300049592 | Ga0501076_0001405 | Ga0501076_0001405_8212_9180 | 263 |
| 1240 | 3300049592 | Ga0501076_0016440 | Ga0501076_0016440_841_1824 | 263 |
| 1241 | 3300049592 | Ga0501076_0212696 | Ga0501076_0212696_37_990 | 263 |
| 1242 | 3300049592 | Ga0501076_0361151 | Ga0501076_0361151_38_1030 | 263 |
| 1243 | 3300049592 | Ga0501076_0579486 | Ga0501076_0579486_13_867 | 263 |
| 1244 | 3300049593 | Ga0501077_0007341 | Ga0501077_0007341_5590_6558 | 263 |
| 1245 | 3300049593 | Ga0501077_0103962 | Ga0501077_0103962_256_1254 | 263 |
| 1246 | 3300049593 | Ga0501077_0150602 | Ga0501077_0150602_70_1023 | 263 |
| 1247 | 3300049593 | Ga0501077_0233313 | Ga0501077_0233313_37_1032 | 263 |
| 1248 | 3300049741 | Ga0501079_0003233 | Ga0501079_0003233_7707_8675 | 263 |
| 1249 | 3300049741 | Ga0501079_0062842 | Ga0501079_0062842_1695_2681 | 263 |
| 1250 | 3300049741 | Ga0501079_0118220 | Ga0501079_0118220_152_1105 | 263 |
| 1251 | 3300049741 | Ga0501079_0139506 | Ga0501079_0139506_787_1749 | 263 |
| 1252 | 3300049742 | Ga0501080_0021206 | Ga0501080_0021206_4940_5908 | 263 |
| 1253 | 3300049742 | Ga0501080_0096741 | Ga0501080_0096741_972_1952 | 263 |
| 1254 | 3300049743 | Ga0501081_0001767 | Ga0501081_0001767_9030_9998 | 263 |
| 1255 | 3300049743 | Ga0501081_0010888 | Ga0501081_0010888_4607_5560 | 263 |
| 1256 | 3300049743 | Ga0501081_0024939 | Ga0501081_0024939_826_1809 | 263 |
| 1257 | 3300049743 | Ga0501081_0054812 | Ga0501081_0054812_395_1393 | 263 |
| 1258 | 3300049743 | Ga0501081_0055859 | Ga0501081_0055859_990_1952 | 263 |
| 1259 | 3300049744 | Ga0501083_0029184 | Ga0501083_0029184_395_1384 | 263 |
| 1260 | 3300049744 | Ga0501083_0106169 | Ga0501083_0106169_863_1831 | 263 |
| 1261 | 3300049744 | Ga0501083_0141130 | Ga0501083_0141130_543_1505 | 263 |
| 1262 | 3300049822 | Ga0501035_0000127 | Ga0501035_0000127_55642_56622 | 263 |
| 1263 | 3300049823 | Ga0501044_0008177 | Ga0501044_0008177_6582_7571 | 263 |
| 1264 | 3300049823 | Ga0501044_0023098 | Ga0501044_0023098_2394_3374 | 263 |
| 1265 | 3300049823 | Ga0501044_0088157 | Ga0501044_0088157_1307_2296 | 263 |
| 1266 | 3300049824 | Ga0501045_0018155 | Ga0501045_0018155_2042_3010 | 263 |
| 1267 | 3300049824 | Ga0501045_0057834 | Ga0501045_0057834_1826_2812 | 263 |
| 1268 | 3300049824 | Ga0501045_0133245 | Ga0501045_0133245_28_981 | 263 |
| 1269 | 3300049824 | Ga0501045_0162931 | Ga0501045_0162931_26_976 | 263 |
| 1270 | 3300049824 | Ga0501045_0173509 | Ga0501045_0173509_191_1144 | 263 |
| 1271 | 3300050489 | nmdc:mga03683_56333_c1 | nmdc:mga03683_56333_c1_650_1633 | 263 |
| 1272 | 3300050491 | nmdc:mga00v17_126627_c1 | nmdc:mga00v17_126627_c1_101_1084 | 263 |
| 1273 | 3300050492 | nmdc:mga0yw44_65200_c1 | nmdc:mga0yw44_65200_c1_634_1617 | 263 |
| 1274 | 3300050494 | nmdc:mga06z11_200577_c1 | nmdc:mga06z11_200577_c1_261_1118 | 263 |
| 1275 | 3300050496 | nmdc:mga07m45_84329_c2 | nmdc:mga07m45_84329_c2_363_1352 | 263 |
| 1276 | 3300050507 | nmdc:mga05p37_114724_c1 | nmdc:mga05p37_114724_c1_143_1132 | 263 |
| 1277 | 3300050507 | nmdc:mga05p37_1808_c2 | nmdc:mga05p37_1808_c2_7541_8548 | 263 |
| 1278 | 3300050507 | nmdc:mga05p37_227255_c1 | nmdc:mga05p37_227255_c1_44_1018 | 263 |
| 1279 | 3300050507 | nmdc:mga05p37_295597_c1 | nmdc:mga05p37_295597_c1_723_1709 | 263 |
| 1280 | 3300050507 | nmdc:mga05p37_356208_c1 | nmdc:mga05p37_356208_c1_326_1315 | 263 |
| 1281 | 3300050507 | nmdc:mga05p37_45950_c1 | nmdc:mga05p37_45950_c1_3711_4706 | 263 |
| 1282 | 3300050507 | nmdc:mga05p37_508_c2 | nmdc:mga05p37_508_c2_3613_4608 | 263 |
| 1283 | 3300050507 | nmdc:mga05p37_711641_c1 | nmdc:mga05p37_711641_c1_51_1049 | 263 |
| 1284 | 3300050507 | nmdc:mga05p37_75031_c1 | nmdc:mga05p37_75031_c1_1725_2714 | 263 |
| 1285 | 3300050507 | nmdc:mga05p37_888971_c1 | nmdc:mga05p37_888971_c1_72_920 | 263 |
| 1286 | 3300050508 | nmdc:mga09592_152046_c1 | nmdc:mga09592_152046_c1_85_1074 | 263 |
| 1287 | 3300050508 | nmdc:mga09592_239014_c1 | nmdc:mga09592_239014_c1_326_1324 | 263 |
| 1288 | 3300050508 | nmdc:mga09592_30039_c1 | nmdc:mga09592_30039_c1_925_1920 | 263 |
| 1289 | 3300050508 | nmdc:mga09592_5057_c1 | nmdc:mga09592_5057_c1_8220_9227 | 263 |
| 1290 | 3300050509 | nmdc:mga0qj67_15510_c1 | nmdc:mga0qj67_15510_c1_3439_4434 | 263 |
| 1291 | 3300050509 | nmdc:mga0qj67_5333_c1 | nmdc:mga0qj67_5333_c1_8220_9227 | 263 |
| 1292 | 3300050510 | nmdc:mga06r32_124972_c1 | nmdc:mga06r32_124972_c1_264_1253 | 263 |
| 1293 | 3300050510 | nmdc:mga06r32_146979_c1 | nmdc:mga06r32_146979_c1_363_1358 | 263 |
| 1294 | 3300050510 | nmdc:mga06r32_1960_c1 | nmdc:mga06r32_1960_c1_5179_6174 | 263 |
| 1295 | 3300050510 | nmdc:mga06r32_236663_c1 | nmdc:mga06r32_236663_c1_414_1409 | 263 |
| 1296 | 3300050510 | nmdc:mga06r32_33897_c1 | nmdc:mga06r32_33897_c1_1168_2166 | 263 |
| 1297 | 3300050510 | nmdc:mga06r32_3441_c1 | nmdc:mga06r32_3441_c1_7231_8238 | 263 |
| 1298 | 3300050510 | nmdc:mga06r32_4445_c1 | nmdc:mga06r32_4445_c1_88_1086 | 263 |
| 1299 | 3300050510 | nmdc:mga06r32_53801_c1 | nmdc:mga06r32_53801_c1_1864_2847 | 263 |
| 1300 | 3300050511 | nmdc:mga08y16_14675_c1 | nmdc:mga08y16_14675_c1_6783_7763 | 263 |
| 1301 | 3300050511 | nmdc:mga08y16_2332_c1 | nmdc:mga08y16_2332_c1_5178_6173 | 263 |
| 1302 | 3300050511 | nmdc:mga08y16_3146_c1 | nmdc:mga08y16_3146_c1_2777_3784 | 263 |
| 1303 | 3300050511 | nmdc:mga08y16_378174_c1 | nmdc:mga08y16_378174_c1_94_1083 | 263 |
| 1304 | 3300050511 | nmdc:mga08y16_3939_c1 | nmdc:mga08y16_3939_c1_8680_9669 | 263 |
| 1305 | 3300050511 | nmdc:mga08y16_566179_c1 | nmdc:mga08y16_566179_c1_128_1117 | 263 |
| 1306 | 3300050511 | nmdc:mga08y16_63381_c1 | nmdc:mga08y16_63381_c1_1119_2111 | 263 |
| 1307 | 3300050511 | nmdc:mga08y16_640818_c1 | nmdc:mga08y16_640818_c1_60_1043 | 263 |
| 1308 | 3300050511 | nmdc:mga08y16_75718_c1 | nmdc:mga08y16_75718_c1_1789_2742 | 263 |
| 1309 | 3300050512 | nmdc:mga0n895_142493_c1 | nmdc:mga0n895_142493_c1_705_1553 | 263 |
| 1310 | 3300050512 | nmdc:mga0n895_145_c1 | nmdc:mga0n895_145_c1_12771_13718 | 263 |
| 1311 | 3300050512 | nmdc:mga0n895_149686_c1 | nmdc:mga0n895_149686_c1_798_1790 | 263 |
| 1312 | 3300050512 | nmdc:mga0n895_159698_c1 | nmdc:mga0n895_159698_c1_868_1857 | 263 |
| 1313 | 3300050512 | nmdc:mga0n895_204112_c1 | nmdc:mga0n895_204112_c1_271_1254 | 263 |
| 1314 | 3300050512 | nmdc:mga0n895_37534_c1 | nmdc:mga0n895_37534_c1_3542_4531 | 263 |
| 1315 | 3300050512 | nmdc:mga0n895_429381_c1 | nmdc:mga0n895_429381_c1_185_1165 | 263 |
| 1316 | 3300050512 | nmdc:mga0n895_450487_c1 | nmdc:mga0n895_450487_c1_282_1289 | 263 |
| 1317 | 3300050512 | nmdc:mga0n895_494323_c1 | nmdc:mga0n895_494323_c1_52_909 | 263 |
| 1318 | 3300050512 | nmdc:mga0n895_4964_c1 | nmdc:mga0n895_4964_c1_4357_5346 | 263 |
| 1319 | 3300050512 | nmdc:mga0n895_545530_c1 | nmdc:mga0n895_545530_c1_79_1071 | 263 |
| 1320 | 3300050512 | nmdc:mga0n895_662439_c1 | nmdc:mga0n895_662439_c1_15_974 | 263 |
| 1321 | 3300050512 | nmdc:mga0n895_697_c1 | nmdc:mga0n895_697_c1_21870_22823 | 263 |
| 1322 | 3300050513 | nmdc:mga0rr50_2684_c1 | nmdc:mga0rr50_2684_c1_7437_8384 | 263 |
| 1323 | 3300050513 | nmdc:mga0rr50_26927_c1 | nmdc:mga0rr50_26927_c1_1464_2450 | 263 |
| 1324 | 3300050513 | nmdc:mga0rr50_354727_c1 | nmdc:mga0rr50_354727_c1_17_865 | 263 |
| 1325 | 3300050513 | nmdc:mga0rr50_42859_c1 | nmdc:mga0rr50_42859_c1_667_1656 | 263 |
| 1326 | 3300050513 | nmdc:mga0rr50_48815_c1 | nmdc:mga0rr50_48815_c1_24_1031 | 263 |
| 1327 | 3300050513 | nmdc:mga0rr50_59705_c1 | nmdc:mga0rr50_59705_c1_517_1509 | 263 |
| 1328 | 3300050514 | nmdc:mga08x19_113019_c1 | nmdc:mga08x19_113019_c1_669_1616 | 263 |
| 1329 | 3300050514 | nmdc:mga08x19_33203_c1 | nmdc:mga08x19_33203_c1_114_1100 | 263 |
| 1330 | 3300050514 | nmdc:mga08x19_73938_c1 | nmdc:mga08x19_73938_c1_212_1237 | 263 |
| 1331 | 3300050515 | nmdc:mga0a205_17058_c2 | nmdc:mga0a205_17058_c2_2189_3178 | 263 |
| 1332 | 3300050515 | nmdc:mga0a205_17080_c2 | nmdc:mga0a205_17080_c2_1407_2399 | 263 |
| 1333 | 3300050515 | nmdc:mga0a205_18201_c1 | nmdc:mga0a205_18201_c1_56_1042 | 263 |
| 1334 | 3300050515 | nmdc:mga0a205_19981_c1 | nmdc:mga0a205_19981_c1_3808_4797 | 263 |
| 1335 | 3300050515 | nmdc:mga0a205_2724_c1 | nmdc:mga0a205_2724_c1_6685_7692 | 263 |
| 1336 | 3300050515 | nmdc:mga0a205_44400_c1 | nmdc:mga0a205_44400_c1_332_1321 | 263 |
| 1337 | 3300053077 | Ga0495601_0000008 | Ga0495601_0000008_285286_286257 | 263 |
| 1338 | 3300053077 | Ga0495601_0001042 | Ga0495601_0001042_13234_14223 | 263 |
| 1339 | 3300053077 | Ga0495601_0001925 | Ga0495601_0001925_8632_9618 | 263 |
| 1340 | 3300053077 | Ga0495601_0044685 | Ga0495601_0044685_1279_2268 | 263 |
| 1341 | 3300053077 | Ga0495601_0153402 | Ga0495601_0153402_409_1398 | 263 |
| 1342 | 3300053077 | Ga0495601_0224351 | Ga0495601_0224351_201_1193 | 263 |
| 1343 | 3300053077 | Ga0495601_0230234 | Ga0495601_0230234_65_1042 | 263 |
| 1344 | 3300053078 | Ga0495612_0000026 | Ga0495612_0000026_59702_60673 | 263 |
| 1345 | 3300053078 | Ga0495612_0000858 | Ga0495612_0000858_5465_6451 | 263 |
| 1346 | 3300053078 | Ga0495612_0012643 | Ga0495612_0012643_1047_2036 | 263 |
| 1347 | 3300053078 | Ga0495612_0021006 | Ga0495612_0021006_1463_2452 | 263 |
| 1348 | 3300053084 | Ga0495595_0000024 | Ga0495595_0000024_17745_18716 | 263 |
| 1349 | 3300053084 | Ga0495595_0000879 | Ga0495595_0000879_2311_3279 | 263 |
| 1350 | 3300053084 | Ga0495595_0006336 | Ga0495595_0006336_2658_3647 | 263 |
| 1351 | 3300053084 | Ga0495595_0010002 | Ga0495595_0010002_2258_3250 | 263 |
| 1352 | 3300053084 | Ga0495595_0026796 | Ga0495595_0026796_828_1826 | 263 |
| 1353 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_36488_37459 | 263 |
| 1354 | 3300053085 | Ga0495619_0000229 | Ga0495619_0000229_15587_16573 | 263 |
| 1355 | 3300053085 | Ga0495619_0002881 | Ga0495619_0002881_9230_10216 | 263 |
| 1356 | 3300053085 | Ga0495619_0005795 | Ga0495619_0005795_1404_2390 | 263 |
| 1357 | 3300053085 | Ga0495619_0013992 | Ga0495619_0013992_1822_2811 | 263 |
| 1358 | 3300053085 | Ga0495619_0018217 | Ga0495619_0018217_3153_4121 | 263 |
| 1359 | 3300053085 | Ga0495619_0022907 | Ga0495619_0022907_203_1192 | 263 |
| 1360 | 3300053085 | Ga0495619_0177839 | Ga0495619_0177839_147_1145 | 263 |
| 1361 | 3300053087 | Ga0500643_009516 | Ga0500643_009516_1661_2653 | 263 |
| 1362 | 3300053117 | Ga0500593_023541 | Ga0500593_023541_478_1470 | 263 |
| 1363 | 3300053118 | Ga0500594_0047434 | Ga0500594_0047434_78_1085 | 263 |
| 1364 | 3300053119 | Ga0500595_000010 | Ga0500595_000010_62148_63140 | 263 |
| 1365 | 3300053151 | Ga0500604_0069737 | Ga0500604_0069737_255_1103 | 263 |
| 1366 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_757425_758432 | 263 |
| 1367 | 3300053153 | Ga0500616_0042710 | Ga0500616_0042710_242_1228 | 263 |
| 1368 | 3300053730 | Ga0500645_000015 | Ga0500645_000015_113111_114130 | 263 |
| 1369 | 3300054114 | Ga0501084_0046785 | Ga0501084_0046785_201_1184 | 263 |
| 1370 | 3300054114 | Ga0501084_0068704 | Ga0501084_0068704_1022_1984 | 263 |
| 1371 | 3300054114 | Ga0501084_0077346 | Ga0501084_0077346_944_1942 | 263 |
| 1372 | 3300054114 | Ga0501084_0170353 | Ga0501084_0170353_64_1059 | 263 |
| 1373 | 3300059426 | Ga0590077_005770 | Ga0590077_005770_1409_2374 | 263 |
| 1374 | 3300060353 | Ga0501082_0013431 | Ga0501082_0013431_2708_3697 | 263 |
| 1375 | 3300060353 | Ga0501082_0015413 | Ga0501082_0015413_1480_2475 | 263 |
| 1376 | 3300060353 | Ga0501082_0152268 | Ga0501082_0152268_614_1612 | 263 |
| 1377 | 3300060353 | Ga0501082_0271122 | Ga0501082_0271122_104_1093 | 263 |
| 1378 | 3300061734 | Ga0530510_0000596 | Ga0530510_0000596_9952_10920 | 263 |
| 1379 | 3300061734 | Ga0530510_0030147 | Ga0530510_0030147_2533_3486 | 263 |
| 1380 | 3300061734 | Ga0530510_0224288 | Ga0530510_0224288_241_1236 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7837 | 1 | 254 |
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.7599 | 2 | 252 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7581 | 1 | 254 |
| 2x26-assembly1.cif.gz_A | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.7454 | 2 | 254 |
| 4h6d-assembly2.cif.gz_H | crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae | 0.736 | 2 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4h6dB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7915 | 2 | 257 | 3.40.190.10 |
| 2i4cA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7567 | 70 | 144 | 3.40.190.10 |
| 4h65B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7507 | 2 | 257 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7437 | 69 | 142 | 3.40.190.10 |
| 3e4rA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7334 | 2 | 254 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A7LX51-F1-model_v4 | PhnD/SsuA/transferrin family substrate-binding protein | 0.9199 | 2 | 262 |
|
| AF-A0A6A7LX51-F1-model_v4 | PhnD/SsuA/transferrin family substrate-binding protein | 0.91 | 2 | 262 |
|
| AF-A0A522QMN1-F1-model_v4 | Transporter substrate-binding domain-containing protein | 0.9011 | 2 | 262 |
|
| AF-A0A537RUM9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9003 | 2 | 263 |
|
| AF-A0A1F4DDW2-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.8972 | 6 | 262 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar