F493507

General Info

Members Datasets Scaffolds Average Seq Length
1380 458 1380 325

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10007017|Ga0081455_1000701713
Length 348
Sequence VDWIWLSTATAEENREEATMTRGQRITRRHTLGLCGASALSLSFKAHPAIAQAAVLRQGYQTNLWGMPTYYLLRSGALEKHGLKIEEFGVPSGNLTMQQMVARQVDLGTYAGPSFILGHDKGGLVGIAVIAHVGRTTRVMARKDLGLSKIEQLKGLKVANQTGSSVGNIFVDQIAPAAGLKKGDYQEVRMDVNNMVAAMAAKTVDAMVNVEPYNTIAEADGLATTIMDYREVDKMPVFMAATPEFVAKSAEALVAYLKAWLEVAGDFKTQPNKVADTIYSFYAGKGYSMSQDTFRKALATVDVEPGFPSDLQPYLQRHAEVLLKEKKISALPDWSKALRPEFMDKARA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
23 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
130 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
247 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
250 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
253 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
256 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
257 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
258 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
259 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
262 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
263 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
264 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
265 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
266 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
271 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
275 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
276 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
277 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
278 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
279 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
280 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
281 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
282 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
283 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
284 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
285 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
286 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
287 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
288 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
297 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
302 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
303 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
304 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
305 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
306 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
307 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
318 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
319 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
330 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
331 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
338 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
349 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
365 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
373 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
374 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
375 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
411 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
412 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
413 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
414 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
417 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
418 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
419 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
420 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
421 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
422 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
432 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
436 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
437 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
438 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
439 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
440 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
441 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
442 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
448 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
449 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
450 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
451 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
452 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 6.23
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_149540 2162886006 Bacteria 1409
2 2214772980 2209111006 Bacteria 12584
3 ARcpr5oldR_c000026 3300000041 Bacteria 30226
4 ARSoilYngRDRAFT_c00029 3300000042 Bacteria 22121
5 ARcpr5yngRDRAFT_c000044 3300000043 Bacteria 19945
6 ARSoilOldRDRAFT_c000037 3300000044 Bacteria 30277
7 ARCol0yngRDRAFT_1000020 3300000652 Bacteria 30273
8 JGI24747J21853_1003341 3300001978 Bacteria 1382
9 JGI24739J22299_10004550 3300001989 Bacteria 5302
10 JGI24739J22299_10008850 3300001989 Bacteria 3753
11 JGI24737J22298_10001930 3300001990 Bacteria 7416
12 JGI24737J22298_10004430 3300001990 Bacteria 4894
13 JGI24750J21931_1000586 3300002070 Bacteria 5547
14 JGI24750J21931_1004848 3300002070 Bacteria 1640
15 JGI24745J21846_1000864 3300002073 Bacteria 2808
16 JGI24748J21848_1002686 3300002074 Bacteria 2021
17 JGI24738J21930_10002565 3300002075 Bacteria 4714
18 JGI24749J21850_1001223 3300002076 Bacteria 3648
19 JGI24744J21845_10000745 3300002077 Bacteria 6048
20 JGI24033J26618_1004836 3300002155 Bacteria 1465
21 JGI24034J26672_10009358 3300002239 Bacteria 1443
22 JGI24742J22300_10000139 3300002244 Bacteria 10736
23 JGI24742J22300_10013412 3300002244 Bacteria 1371
24 JGI25406J46586_10009736 3300003203 Bacteria 4295
25 JGI25405J52794_10004445 3300003911 Bacteria 2504
26 JGI25405J52794_10030165 3300003911 Bacteria 1123
27 Ga0065717_1002108 3300005276 Bacteria 2893
28 Ga0065716_1001673 3300005277 Bacteria 4322
29 Ga0065704_10089952 3300005289 Bacteria 2821
30 Ga0065704_10118765 3300005289 Bacteria 1811
31 Ga0065712_10026023 3300005290 Bacteria 1564
32 Ga0065712_10071735 3300005290 Bacteria 5090
33 Ga0065712_10077193 3300005290 Bacteria 3510
34 Ga0065712_10079021 3300005290 Bacteria 3255
35 Ga0065712_10109644 3300005290 Bacteria 1851
36 Ga0065715_10092917 3300005293 Bacteria 4880
37 Ga0065715_10094907 3300005293 Bacteria 4208
38 Ga0065715_10113387 3300005293 Bacteria 2491
39 Ga0065707_10015385 3300005295 Bacteria 1480
40 Ga0065707_10113495 3300005295 Bacteria 2319
41 Ga0065707_10126631 3300005295 Bacteria 1999
42 Ga0070658_10087550 3300005327 Bacteria 2563
43 Ga0070676_10001078 3300005328 Bacteria 13598
44 Ga0070676_10054636 3300005328 Bacteria 2355
45 Ga0070676_10122285 3300005328 Bacteria 1635
46 Ga0070683_100007390 3300005329 Bacteria 9282
47 Ga0070683_100131327 3300005329 Bacteria 2370
48 Ga0070683_100290541 3300005329 Bacteria 1555
49 Ga0070690_100020059 3300005330 Bacteria 4068
50 Ga0070690_100023267 3300005330 Bacteria 3798
51 Ga0070690_100052599 3300005330 Bacteria 2604
52 Ga0070690_100080239 3300005330 Bacteria 2134
53 Ga0070690_100115033 3300005330 Bacteria 1799
54 Ga0070670_100037546 3300005331 Bacteria 4168
55 Ga0070670_100211992 3300005331 Unclassified 1684
56 Ga0070670_100249424 3300005331 Bacteria 1546
57 Ga0070677_10000009 3300005333 Bacteria 65648
58 Ga0068869_100023901 3300005334 Bacteria 4228
59 Ga0068869_100062092 3300005334 Bacteria 2742
60 Ga0068869_100181230 3300005334 Unclassified 1651
61 Ga0070666_10087321 3300005335 Bacteria 2137
62 Ga0070666_10257883 3300005335 Bacteria 1235
63 Ga0070680_100004715 3300005336 Bacteria 10260
64 Ga0070680_100069756 3300005336 Bacteria 2886
65 Ga0070680_100081718 3300005336 Bacteria 2666
66 Ga0070680_100412129 3300005336 Bacteria 1152
67 Ga0070682_100001091 3300005337 Bacteria 15614
68 Ga0070682_100049089 3300005337 Bacteria 2630
69 Ga0070682_100127156 3300005337 Bacteria 1719
70 Ga0068868_100037790 3300005338 Bacteria 3744
71 Ga0068868_100239938 3300005338 Bacteria 1522
72 Ga0068868_100261789 3300005338 Bacteria 1459
73 Ga0070660_100001398 3300005339 Bacteria 16443
74 Ga0070660_100144322 3300005339 Bacteria 1911
75 Ga0070660_100196169 3300005339 Bacteria 1637
76 Ga0070660_100231278 3300005339 Bacteria 1504
77 Ga0070689_100008504 3300005340 Bacteria 7234
78 Ga0070689_100044808 3300005340 Bacteria 3404
79 Ga0070689_100063151 3300005340 Bacteria 2882
80 Ga0070689_100086925 3300005340 Bacteria 2459
81 Ga0070691_10000769 3300005341 Bacteria 12720
82 Ga0070691_10002420 3300005341 Bacteria 8280
83 Ga0070687_100000649 3300005343 Bacteria 11529
84 Ga0070687_100071219 3300005343 Bacteria 1867
85 Ga0070687_100094904 3300005343 Bacteria 1657
86 Ga0070687_100119767 3300005343 Bacteria 1503
87 Ga0070661_100001076 3300005344 Bacteria 19335
88 Ga0070661_100289923 3300005344 Bacteria 1271
89 Ga0070692_10015532 3300005345 Bacteria 3603
90 Ga0070668_100012317 3300005347 Bacteria 6370
91 Ga0070669_100005888 3300005353 Bacteria 8845
92 Ga0070669_100042372 3300005353 Bacteria 3312
93 Ga0070669_100271323 3300005353 Bacteria 1357
94 Ga0070675_100000727 3300005354 Bacteria 22927
95 Ga0070675_100102688 3300005354 Bacteria 2409
96 Ga0070671_100000438 3300005355 Bacteria 28920
97 Ga0070674_100001976 3300005356 Bacteria 11215
98 Ga0070673_100001186 3300005364 Bacteria 14992
99 Ga0070673_100291181 3300005364 Bacteria 1435
100 Ga0070688_100022325 3300005365 Bacteria 3706
101 Ga0070688_100060450 3300005365 Bacteria 2392
102 Ga0070688_100075351 3300005365 Bacteria 2168
103 Ga0070688_100203341 3300005365 Bacteria 1387
104 Ga0070688_100320875 3300005365 Bacteria 1125
105 Ga0070659_100005874 3300005366 Bacteria 8843
106 Ga0070659_100019477 3300005366 Bacteria 5143
107 Ga0070659_100058285 3300005366 Bacteria 3048
108 Ga0070667_100005963 3300005367 Bacteria 10128
109 Ga0070667_100128914 3300005367 Bacteria 2206
110 Ga0070667_100199136 3300005367 Bacteria 1777
111 Ga0070703_10002528 3300005406 Bacteria 5263
112 Ga0070709_10107117 3300005434 Bacteria 1872
113 Ga0070709_10112306 3300005434 Bacteria 1833
114 Ga0070714_100036372 3300005435 Bacteria 4129
115 Ga0070714_100055527 3300005435 Bacteria 3385
116 Ga0070714_100137127 3300005435 Bacteria 2192
117 Ga0070714_100502951 3300005435 Bacteria 1156
118 Ga0070713_100005553 3300005436 Bacteria 8640
119 Ga0070713_100015791 3300005436 Bacteria 5658
120 Ga0070713_100028859 3300005436 Bacteria 4385
121 Ga0070713_100064124 3300005436 Bacteria 3082
122 Ga0070713_100174721 3300005436 Bacteria 1927
123 Ga0070710_10010566 3300005437 Bacteria 4538
124 Ga0070710_10204869 3300005437 Bacteria 1247
125 Ga0070701_10000339 3300005438 Bacteria 15527
126 Ga0070701_10037392 3300005438 Bacteria 2450
127 Ga0070701_10054327 3300005438 Bacteria 2088
128 Ga0070701_10095736 3300005438 Bacteria 1635
129 Ga0070701_10146773 3300005438 Bacteria 1354
130 Ga0070701_10203237 3300005438 Bacteria 1172
131 Ga0070711_100027442 3300005439 Bacteria 3738
132 Ga0070711_100073831 3300005439 Bacteria 2411
133 Ga0070711_100199809 3300005439 Bacteria 1542
134 Ga0070711_100253768 3300005439 Bacteria 1381
135 Ga0070705_100000010 3300005440 Bacteria 102079
136 Ga0070705_100005352 3300005440 Bacteria 6249
137 Ga0070700_100000783 3300005441 Bacteria 15666
138 Ga0070700_100022570 3300005441 Bacteria 3672
139 Ga0070700_100036344 3300005441 Bacteria 2987
140 Ga0070694_100006633 3300005444 Bacteria 7034
141 Ga0070694_100120006 3300005444 Bacteria 1885
142 Ga0070694_100268004 3300005444 Bacteria 1298
143 Ga0070708_100466820 3300005445 Bacteria 1191
144 Ga0070708_100544493 3300005445 Bacteria 1095
145 Ga0070663_100006904 3300005455 Bacteria 6875
146 Ga0070663_100017471 3300005455 Bacteria 4682
147 Ga0070663_100025858 3300005455 Bacteria 3968
148 Ga0070663_100028384 3300005455 Bacteria 3810
149 Ga0070663_100033005 3300005455 Bacteria 3573
150 Ga0070663_100039036 3300005455 Bacteria 3316
151 Ga0070663_100284134 3300005455 Bacteria 1319
152 Ga0070678_100011564 3300005456 Bacteria 5451
153 Ga0070678_100092572 3300005456 Bacteria 2323
154 Ga0070678_100237424 3300005456 Bacteria 1522
155 Ga0070678_100248890 3300005456 Bacteria 1489
156 Ga0070662_100017941 3300005457 Bacteria 4778
157 Ga0070662_100103866 3300005457 Bacteria 2155
158 Ga0070681_10070525 3300005458 Bacteria 3460
159 Ga0070681_10081473 3300005458 Bacteria 3192
160 Ga0070681_10222552 3300005458 Bacteria 1802
161 Ga0070681_10245025 3300005458 Bacteria 1705
162 Ga0068867_100021953 3300005459 Bacteria 4559
163 Ga0068867_100363538 3300005459 Bacteria 1211
164 Ga0068867_100434058 3300005459 Bacteria 1115
165 Ga0070685_10005962 3300005466 Bacteria 6203
166 Ga0070685_10022940 3300005466 Bacteria 3410
167 Ga0070685_10023443 3300005466 Bacteria 3380
168 Ga0070685_10097760 3300005466 Bacteria 1788
169 Ga0070707_100160119 3300005468 Bacteria 2193
170 Ga0070698_100079534 3300005471 Bacteria 3275
171 Ga0070699_100001314 3300005518 Bacteria 22902
172 Ga0070679_100009564 3300005530 Bacteria 9168
173 Ga0070679_100021002 3300005530 Bacteria 6371
174 Ga0070679_100050983 3300005530 Bacteria 4122
175 Ga0070679_100127315 3300005530 Bacteria 2528
176 Ga0070679_100134755 3300005530 Bacteria 2451
177 Ga0070684_100031662 3300005535 Bacteria 4505
178 Ga0070684_100034741 3300005535 Bacteria 4312
179 Ga0070684_100161110 3300005535 Bacteria 2035
180 Ga0070697_100039300 3300005536 Bacteria 3825
181 Ga0070697_100201176 3300005536 Bacteria 1693
182 Ga0068853_100004375 3300005539 Bacteria 10933
183 Ga0068853_100594483 3300005539 Bacteria 1051
184 Ga0070672_100011149 3300005543 Bacteria 6259
185 Ga0070672_100022463 3300005543 Bacteria 4635
186 Ga0070686_100006762 3300005544 Bacteria 6383
187 Ga0070686_100028126 3300005544 Bacteria 3407
188 Ga0070695_100001719 3300005545 Bacteria 12317
189 Ga0070695_100012898 3300005545 Bacteria 5017
190 Ga0070695_100110603 3300005545 Bacteria 1863
191 Ga0070695_100152637 3300005545 Bacteria 1613
192 Ga0070696_100002812 3300005546 Bacteria 11557
193 Ga0070696_100029222 3300005546 Bacteria 3766
194 Ga0070696_100045814 3300005546 Bacteria 3031
195 Ga0070696_100127308 3300005546 Bacteria 1849
196 Ga0070693_100000577 3300005547 Bacteria 16215
197 Ga0070693_100010134 3300005547 Bacteria 4709
198 Ga0070693_100023786 3300005547 Bacteria 3279
199 Ga0070693_100122989 3300005547 Bacteria 1612
200 Ga0070693_100236167 3300005547 Bacteria 1205
201 Ga0070665_100072419 3300005548 Bacteria 3454
202 Ga0070665_100240155 3300005548 Bacteria 1812
203 Ga0070704_100008088 3300005549 Bacteria 6283
204 Ga0070704_100013846 3300005549 Bacteria 5022
205 Ga0070704_100028556 3300005549 Bacteria 3713
206 Ga0070704_100126371 3300005549 Bacteria 1974
207 Ga0070704_100303866 3300005549 Bacteria 1330
208 Ga0070704_100314933 3300005549 Bacteria 1309
209 Ga0068855_100014148 3300005563 Bacteria 9611
210 Ga0068855_100021980 3300005563 Bacteria 7648
211 Ga0068855_100031300 3300005563 Bacteria 6354
212 Ga0068855_100185531 3300005563 Bacteria 2349
213 Ga0068855_100437051 3300005563 Bacteria 1430
214 Ga0070664_100002073 3300005564 Bacteria 16008
215 Ga0070664_100070153 3300005564 Bacteria 3000
216 Ga0070664_100145517 3300005564 Bacteria 2089
217 Ga0070664_100284498 3300005564 Bacteria 1492
218 Ga0070664_100424861 3300005564 Bacteria 1218
219 Ga0068857_100008536 3300005577 Bacteria 8859
220 Ga0068857_100011549 3300005577 Bacteria 7685
221 Ga0068857_100101644 3300005577 Bacteria 2580
222 Ga0068857_100313354 3300005577 Bacteria 1448
223 Ga0068854_100153463 3300005578 Bacteria 1778
224 Ga0068856_100271248 3300005614 Bacteria 1713
225 Ga0068856_100506165 3300005614 Bacteria 1229
226 Ga0068856_100578229 3300005614 Bacteria 1144
227 Ga0070702_100005245 3300005615 Bacteria 6011
228 Ga0070702_100023173 3300005615 Bacteria 3295
229 Ga0068852_100001086 3300005616 Bacteria 17979
230 Ga0068852_100054483 3300005616 Bacteria 3447
231 Ga0068852_100089360 3300005616 Bacteria 2753
232 Ga0068859_100023234 3300005617 Bacteria 6221
233 Ga0068859_100047095 3300005617 Bacteria 4331
234 Ga0068859_100087792 3300005617 Bacteria 3159
235 Ga0068859_100104533 3300005617 Bacteria 2891
236 Ga0068859_100231880 3300005617 Bacteria 1935
237 Ga0068859_100259579 3300005617 Bacteria 1828
238 Ga0068859_100307236 3300005617 Bacteria 1679
239 Ga0068864_100017473 3300005618 Bacteria 5980
240 Ga0068864_100021486 3300005618 Bacteria 5408
241 Ga0068864_100025772 3300005618 Bacteria 4956
242 Ga0068864_100053465 3300005618 Bacteria 3484
243 Ga0068864_100138872 3300005618 Bacteria 2190
244 Ga0068864_100444139 3300005618 Bacteria 1239
245 Ga0068866_10000403 3300005718 Bacteria 20138
246 Ga0068866_10020659 3300005718 Bacteria 3020
247 Ga0068861_100001047 3300005719 Bacteria 16998
248 Ga0068861_100201519 3300005719 Bacteria 1671
249 Ga0068870_10000860 3300005840 Bacteria 11868
250 Ga0068870_10018357 3300005840 Bacteria 3376
251 Ga0068863_100003728 3300005841 Bacteria 15069
252 Ga0068863_100046330 3300005841 Bacteria 4126
253 Ga0068863_100107195 3300005841 Bacteria 2658
254 Ga0068858_100032605 3300005842 Bacteria 4837
255 Ga0068858_100051742 3300005842 Bacteria 3800
256 Ga0068858_100098651 3300005842 Bacteria 2723
257 Ga0068858_100173525 3300005842 Bacteria 2034
258 Ga0068858_100283910 3300005842 Bacteria 1576
259 Ga0068860_100013440 3300005843 Bacteria 8028
260 Ga0068860_100023327 3300005843 Bacteria 5980
261 Ga0068860_100036747 3300005843 Bacteria 4690
262 Ga0068860_100038963 3300005843 Bacteria 4546
263 Ga0068862_100003043 3300005844 Bacteria 14604
264 Ga0068862_100024080 3300005844 Bacteria 5105
265 Ga0068862_100041039 3300005844 Bacteria 3936
266 Ga0068862_100068170 3300005844 Bacteria 3068
267 Ga0068862_100256818 3300005844 Bacteria 1594
268 Ga0081455_10000012 3300005937 Bacteria 201668
269 Ga0081455_10003284 3300005937 Bacteria 18715
270 Ga0081455_10007017 3300005937 Bacteria 11967
271 Ga0081455_10016936 3300005937 Bacteria 7006
272 Ga0081455_10018308 3300005937 Bacteria 6677
273 Ga0081455_10048782 3300005937 Bacteria 3655
274 Ga0081538_10018338 3300005981 Bacteria 5260
275 Ga0081538_10059042 3300005981 Bacteria 2219
276 Ga0081540_1000185 3300005983 Bacteria 64858
277 Ga0081540_1002413 3300005983 Bacteria 15223
278 Ga0081540_1011112 3300005983 Bacteria 6044
279 Ga0081540_1048822 3300005983 Bacteria 2116
280 Ga0081539_10008542 3300005985 Bacteria 8868
281 Ga0081539_10023001 3300005985 Bacteria 4097
282 Ga0070717_10007114 3300006028 Bacteria 8292
283 Ga0070717_10010759 3300006028 Bacteria 6925
284 Ga0070717_10279432 3300006028 Bacteria 1481
285 Ga0075365_10041913 3300006038 Bacteria 2991
286 Ga0075363_100064023 3300006048 Bacteria 1986
287 Ga0075364_10289916 3300006051 Bacteria 1114
288 Ga0075432_10001490 3300006058 Bacteria 7644
289 Ga0070715_10015144 3300006163 Bacteria 2870
290 Ga0070715_10043536 3300006163 Bacteria 1893
291 Ga0070715_10051397 3300006163 Bacteria 1773
292 Ga0070715_10100637 3300006163 Bacteria 1347
293 Ga0070716_100012292 3300006173 Bacteria 4336
294 Ga0070716_100048777 3300006173 Bacteria 2396
295 Ga0070716_100107036 3300006173 Bacteria 1726
296 Ga0070712_100172611 3300006175 Bacteria 1679
297 Ga0070712_100279375 3300006175 Bacteria 1344
298 Ga0075362_10000839 3300006177 Bacteria 9234
299 Ga0075362_10042644 3300006177 Bacteria 2006
300 Ga0075367_10103410 3300006178 Bacteria 1743
301 Ga0075427_10001112 3300006194 Bacteria 3382
302 Ga0075366_10001687 3300006195 Bacteria 11092
303 Ga0075366_10210171 3300006195 Bacteria 1184
304 Ga0097621_100000421 3300006237 Bacteria 29460
305 Ga0097621_100008029 3300006237 Bacteria 7577
306 Ga0097621_100043497 3300006237 Bacteria 3621
307 Ga0097621_100081579 3300006237 Bacteria 2692
308 Ga0068871_100000515 3300006358 Bacteria 26586
309 Ga0068871_100012948 3300006358 Bacteria 6177
310 Ga0068871_100109481 3300006358 Bacteria 2322
311 Ga0075428_100007282 3300006844 Bacteria 12256
312 Ga0075428_100013216 3300006844 Bacteria 9185
313 Ga0075428_100124513 3300006844 Bacteria 2805
314 Ga0075428_100124758 3300006844 Bacteria 2803
315 Ga0075428_100138610 3300006844 Bacteria 2645
316 Ga0075428_100280433 3300006844 Bacteria 1793
317 Ga0075428_100377007 3300006844 Bacteria 1521
318 Ga0075430_100021979 3300006846 Bacteria 5422
319 Ga0075430_100026411 3300006846 Bacteria 4941
320 Ga0075430_100028858 3300006846 Bacteria 4711
321 Ga0075430_100085576 3300006846 Bacteria 2639
322 Ga0075431_100001810 3300006847 Bacteria 20184
323 Ga0075431_100002413 3300006847 Bacteria 17988
324 Ga0075431_100003540 3300006847 Bacteria 15121
325 Ga0075431_100072177 3300006847 Bacteria 3562
326 Ga0075431_100082800 3300006847 Bacteria 3312
327 Ga0075431_100109344 3300006847 Unclassified 2853
328 Ga0075431_100143787 3300006847 Bacteria 2458
329 Ga0075433_10002034 3300006852 Bacteria 15272
330 Ga0075433_10006137 3300006852 Bacteria 9468
331 Ga0075433_10008633 3300006852 Bacteria 8131
332 Ga0075433_10036232 3300006852 Bacteria 4248
333 Ga0075433_10097947 3300006852 Bacteria 2596
334 Ga0075433_10149589 3300006852 Bacteria 2077
335 Ga0075433_10203189 3300006852 Bacteria 1761
336 Ga0075433_10218749 3300006852 Bacteria 1692
337 Ga0075434_100000007 3300006871 Bacteria 95975
338 Ga0075434_100000693 3300006871 Bacteria 26314
339 Ga0075434_100001159 3300006871 Bacteria 21806
340 Ga0075434_100005025 3300006871 Bacteria 12006
341 Ga0075434_100038594 3300006871 Bacteria 4730
342 Ga0075434_100082088 3300006871 Bacteria 3221
343 Ga0075434_100096480 3300006871 Bacteria 2961
344 Ga0075434_100171810 3300006871 Bacteria 2187
345 Ga0075434_100215803 3300006871 Bacteria 1939
346 Ga0075434_100260622 3300006871 Bacteria 1753
347 Ga0075434_100313884 3300006871 Bacteria 1588
348 Ga0075429_100004783 3300006880 Bacteria 11659
349 Ga0075429_100006663 3300006880 Bacteria 10011
350 Ga0075429_100026387 3300006880 Bacteria 5044
351 Ga0075429_100119201 3300006880 Bacteria 2306
352 Ga0075429_100128342 3300006880 Bacteria 2218
353 Ga0075429_100430059 3300006880 Unclassified 1156
354 Ga0068865_100002115 3300006881 Bacteria 11728
355 Ga0068865_100156928 3300006881 Bacteria 1732
356 Ga0075436_100002192 3300006914 Bacteria 13473
357 Ga0075436_100037473 3300006914 Bacteria 3348
358 Ga0075436_100167778 3300006914 Bacteria 1549
359 Ga0075436_100226373 3300006914 Bacteria 1328
360 Ga0097620_100023234 3300006931 Bacteria 6221
361 Ga0097620_100047094 3300006931 Bacteria 4331
362 Ga0097620_100087787 3300006931 Bacteria 3159
363 Ga0097620_100104537 3300006931 Bacteria 2891
364 Ga0097620_100231869 3300006931 Bacteria 1935
365 Ga0097620_100259577 3300006931 Bacteria 1828
366 Ga0097620_100307236 3300006931 Bacteria 1679
367 Ga0075435_100000432 3300007076 Bacteria 25629
368 Ga0075435_100025823 3300007076 Bacteria 4577
369 Ga0075435_100026492 3300007076 Bacteria 4524
370 Ga0075435_100049630 3300007076 Bacteria 3375
371 Ga0075435_100150894 3300007076 Bacteria 1954
372 Ga0075435_100172380 3300007076 Bacteria 1826
373 Ga0099794_10058103 3300007265 Bacteria 1875
374 Ga0099795_10011526 3300007788 Bacteria 2646
375 Ga0099795_10018796 3300007788 Bacteria 2227
376 Ga0105251_10040087 3300009011 Bacteria 2284
377 Ga0105251_10053918 3300009011 Bacteria 1911
378 Ga0105244_10161476 3300009036 Bacteria 1070
379 Ga0105240_10037315 3300009093 Bacteria 6246
380 Ga0105240_10154042 3300009093 Bacteria 2735
381 Ga0111539_10004448 3300009094 Bacteria 18316
382 Ga0111539_10005607 3300009094 Bacteria 16233
383 Ga0111539_10013539 3300009094 Bacteria 10195
384 Ga0111539_10017591 3300009094 Bacteria 8846
385 Ga0111539_10019998 3300009094 Bacteria 8247
386 Ga0111539_10022696 3300009094 Bacteria 7708
387 Ga0111539_10029537 3300009094 Bacteria 6675
388 Ga0111539_10146086 3300009094 Bacteria 2769
389 Ga0111539_10279279 3300009094 Unclassified 1943
390 Ga0111539_10420466 3300009094 Bacteria 1557
391 Ga0111539_10512699 3300009094 Bacteria 1397
392 Ga0111539_10572289 3300009094 Bacteria 1316
393 Ga0111539_10722476 3300009094 Unclassified 1159
394 Ga0105245_10029148 3300009098 Bacteria 4874
395 Ga0105245_10131013 3300009098 Bacteria 2352
396 Ga0105245_10145527 3300009098 Bacteria 2236
397 Ga0105245_10265153 3300009098 Bacteria 1673
398 Ga0105247_10012837 3300009101 Bacteria 5028
399 Ga0105247_10013130 3300009101 Bacteria 4968
400 Ga0114129_10000742 3300009147 Bacteria 41451
401 Ga0114129_10059035 3300009147 Bacteria 5364
402 Ga0114129_10065278 3300009147 Bacteria 5080
403 Ga0114129_10105879 3300009147 Bacteria 3886
404 Ga0114129_10179865 3300009147 Bacteria 2878
405 Ga0114129_10212542 3300009147 Bacteria 2614
406 Ga0114129_10293458 3300009147 Bacteria 2169
407 Ga0114129_10643719 3300009147 Bacteria 1369
408 Ga0105243_10002574 3300009148 Bacteria 15152
409 Ga0105243_10011951 3300009148 Bacteria 6563
410 Ga0105241_10111008 3300009174 Bacteria 2194
411 Ga0105241_10244434 3300009174 Bacteria 1518
412 Ga0105241_10299267 3300009174 Bacteria 1380
413 Ga0105242_10004599 3300009176 Bacteria 10698
414 Ga0105242_10110869 3300009176 Bacteria 2339
415 Ga0105248_10000821 3300009177 Bacteria 34849
416 Ga0105248_10076409 3300009177 Bacteria 3764
417 Ga0105248_10084997 3300009177 Bacteria 3561
418 Ga0105248_10121013 3300009177 Bacteria 2953
419 Ga0105237_10042956 3300009545 Bacteria 4556
420 Ga0105237_10128596 3300009545 Bacteria 2527
421 Ga0105237_10298174 3300009545 Bacteria 1615
422 Ga0105237_10364152 3300009545 Bacteria 1450
423 Ga0105238_10009936 3300009551 Bacteria 9542
424 Ga0105238_10011216 3300009551 Bacteria 9016
425 Ga0105238_10226060 3300009551 Bacteria 1848
426 Ga0105238_10272723 3300009551 Bacteria 1672
427 Ga0105249_10015879 3300009553 Bacteria 6674
428 Ga0105249_10017602 3300009553 Bacteria 6345
429 Ga0105249_10084737 3300009553 Bacteria 2952
430 Ga0105249_10197852 3300009553 Bacteria 1965
431 Ga0105249_10510758 3300009553 Bacteria 1248
432 Ga0105239_10004537 3300010375 Bacteria 16545
433 Ga0105239_10196874 3300010375 Bacteria 2257
434 Ga0105239_10286295 3300010375 Bacteria 1855
435 Ga0105239_10446827 3300010375 Bacteria 1466
436 Ga0105246_10001092 3300011119 Bacteria 15711
437 Ga0105246_10097849 3300011119 Bacteria 2130
438 Ga0157335_1001950 3300012492 Unclassified 1192
439 Ga0157371_10007315 3300013102 Bacteria 8965
440 Ga0157370_10056317 3300013104 Bacteria 3742
441 Ga0157370_10241917 3300013104 Bacteria 1669
442 Ga0157374_10002049 3300013296 Bacteria 16945
443 Ga0157374_10032857 3300013296 Bacteria 4729
444 Ga0157374_10427440 3300013296 Bacteria 1324
445 Ga0157378_10007541 3300013297 Bacteria 9498
446 Ga0163162_10005029 3300013306 Bacteria 12738
447 Ga0163162_10046419 3300013306 Bacteria 4354
448 Ga0163162_10343621 3300013306 Bacteria 1625
449 Ga0163162_10517261 3300013306 Bacteria 1323
450 Ga0157372_10012748 3300013307 Bacteria 8955
451 Ga0157372_10362354 3300013307 Bacteria 1689
452 Ga0157375_10005227 3300013308 Bacteria 11266
453 Ga0157375_10019784 3300013308 Bacteria 6134
454 Ga0163163_10005574 3300014325 Bacteria 10905
455 Ga0163163_10049189 3300014325 Bacteria 4148
456 Ga0163163_10057095 3300014325 Bacteria 3859
457 Ga0163163_10065275 3300014325 Bacteria 3613
458 Ga0163163_10178827 3300014325 Bacteria 2168
459 Ga0163163_10384246 3300014325 Bacteria 1461
460 Ga0157380_10001279 3300014326 Bacteria 16357
461 Ga0157380_10057392 3300014326 Bacteria 3100
462 Ga0157377_10000312 3300014745 Bacteria 22340
463 Ga0157379_10001989 3300014968 Bacteria 16918
464 Ga0157379_10063884 3300014968 Bacteria 3291
465 Ga0157379_10237266 3300014968 Bacteria 1654
466 Ga0157376_10001372 3300014969 Bacteria 16037
467 Ga0157376_10019925 3300014969 Bacteria 5179
468 Ga0157376_10106846 3300014969 Bacteria 2456
469 Ga0157376_10278940 3300014969 Bacteria 1573
470 Ga0157376_10503392 3300014969 Bacteria 1191
471 Ga0163161_10003480 3300017792 Bacteria 11037
472 Ga0163161_10103438 3300017792 Bacteria 2122
473 Ga0206356_10050520 3300020070 Bacteria 1940
474 Ga0207666_1000038 3300025271 Bacteria 26508
475 Ga0207666_1000670 3300025271 Bacteria 4106
476 Ga0207673_1006959 3300025290 Bacteria 1410
477 Ga0209758_1000079 3300025297 Bacteria 262874
478 Ga0207697_10000373 3300025315 Bacteria 25127
479 Ga0207697_10017294 3300025315 Bacteria 2964
480 Ga0207697_10025362 3300025315 Bacteria 2422
481 Ga0207697_10084636 3300025315 Bacteria 1339
482 Ga0207713_1072809 3300025735 Unclassified 1263
483 Ga0207653_10000559 3300025885 Bacteria 13532
484 Ga0207682_10000071 3300025893 Bacteria 44843
485 Ga0207692_10010499 3300025898 Bacteria 3906
486 Ga0207692_10050472 3300025898 Bacteria 2104
487 Ga0207642_10004072 3300025899 Bacteria 4683
488 Ga0207642_10010782 3300025899 Bacteria 3237
489 Ga0207642_10070749 3300025899 Bacteria 1659
490 Ga0207710_10007020 3300025900 Bacteria 4785
491 Ga0207710_10007122 3300025900 Bacteria 4745
492 Ga0207710_10093911 3300025900 Bacteria 1408
493 Ga0207688_10000237 3300025901 Bacteria 25119
494 Ga0207688_10023508 3300025901 Bacteria 3376
495 Ga0207680_10037949 3300025903 Bacteria 2785
496 Ga0207647_10009005 3300025904 Bacteria 7113
497 Ga0207647_10064700 3300025904 Bacteria 2222
498 Ga0207647_10099247 3300025904 Bacteria 1729
499 Ga0207647_10110025 3300025904 Bacteria 1629
500 Ga0207647_10144254 3300025904 Bacteria 1394
501 Ga0207647_10145926 3300025904 Bacteria 1385
502 Ga0207699_10079821 3300025906 Bacteria 2025
503 Ga0207699_10127180 3300025906 Bacteria 1656
504 Ga0207699_10186277 3300025906 Bacteria 1398
505 Ga0207645_10000779 3300025907 Bacteria 26604
506 Ga0207645_10028585 3300025907 Bacteria 3598
507 Ga0207645_10038461 3300025907 Bacteria 3068
508 Ga0207645_10063209 3300025907 Bacteria 2365
509 Ga0207645_10079328 3300025907 Bacteria 2104
510 Ga0207643_10000276 3300025908 Bacteria 35671
511 Ga0207643_10022449 3300025908 Bacteria 3474
512 Ga0207705_10077767 3300025909 Bacteria 2414
513 Ga0207684_10097682 3300025910 Bacteria 2507
514 Ga0207654_10014702 3300025911 Bacteria 4048
515 Ga0207654_10093334 3300025911 Bacteria 1840
516 Ga0207654_10196411 3300025911 Bacteria 1326
517 Ga0207654_10244704 3300025911 Bacteria 1200
518 Ga0207707_10000454 3300025912 Bacteria 42654
519 Ga0207707_10069691 3300025912 Bacteria 3065
520 Ga0207707_10083619 3300025912 Bacteria 2787
521 Ga0207707_10131233 3300025912 Bacteria 2191
522 Ga0207695_10364338 3300025913 Bacteria 1332
523 Ga0207671_10016484 3300025914 Bacteria 5741
524 Ga0207671_10037376 3300025914 Bacteria 3601
525 Ga0207671_10188217 3300025914 Bacteria 1608
526 Ga0207693_10005073 3300025915 Bacteria 11046
527 Ga0207693_10007312 3300025915 Bacteria 9084
528 Ga0207693_10010113 3300025915 Bacteria 7663
529 Ga0207693_10051746 3300025915 Bacteria 3222
530 Ga0207693_10073450 3300025915 Bacteria 2677
531 Ga0207693_10078058 3300025915 Bacteria 2592
532 Ga0207693_10085039 3300025915 Bacteria 2478
533 Ga0207693_10097721 3300025915 Bacteria 2302
534 Ga0207663_10061077 3300025916 Bacteria 2390
535 Ga0207663_10072881 3300025916 Bacteria 2221
536 Ga0207663_10119841 3300025916 Bacteria 1800
537 Ga0207660_10000087 3300025917 Bacteria 49552
538 Ga0207660_10078775 3300025917 Bacteria 2416
539 Ga0207660_10107168 3300025917 Bacteria 2096
540 Ga0207660_10225179 3300025917 Bacteria 1473
541 Ga0207662_10000659 3300025918 Bacteria 15653
542 Ga0207662_10009020 3300025918 Bacteria 5479
543 Ga0207662_10022432 3300025918 Bacteria 3620
544 Ga0207662_10109719 3300025918 Bacteria 1719
545 Ga0207662_10180772 3300025918 Bacteria 1357
546 Ga0207657_10003101 3300025919 Bacteria 17768
547 Ga0207657_10005173 3300025919 Bacteria 13682
548 Ga0207657_10035321 3300025919 Bacteria 4483
549 Ga0207657_10051853 3300025919 Bacteria 3564
550 Ga0207657_10158047 3300025919 Bacteria 1842
551 Ga0207657_10167303 3300025919 Bacteria 1783
552 Ga0207649_10000662 3300025920 Bacteria 22982
553 Ga0207649_10095650 3300025920 Bacteria 1955
554 Ga0207649_10127807 3300025920 Bacteria 1722
555 Ga0207652_10001908 3300025921 Bacteria 18069
556 Ga0207652_10023549 3300025921 Bacteria 5101
557 Ga0207681_10001262 3300025923 Bacteria 16334
558 Ga0207681_10211519 3300025923 Bacteria 1495
559 Ga0207694_10017984 3300025924 Bacteria 5342
560 Ga0207694_10044775 3300025924 Bacteria 3417
561 Ga0207650_10005107 3300025925 Bacteria 8956
562 Ga0207650_10377855 3300025925 Bacteria 1170
563 Ga0207659_10000143 3300025926 Bacteria 42200
564 Ga0207659_10139648 3300025926 Bacteria 1880
565 Ga0207687_10000865 3300025927 Bacteria 20461
566 Ga0207687_10030379 3300025927 Bacteria 3643
567 Ga0207687_10290565 3300025927 Bacteria 1313
568 Ga0207687_10315623 3300025927 Bacteria 1263
569 Ga0207700_10000323 3300025928 Bacteria 28133
570 Ga0207700_10072896 3300025928 Bacteria 2650
571 Ga0207700_10083953 3300025928 Bacteria 2495
572 Ga0207700_10145360 3300025928 Bacteria 1953
573 Ga0207664_10049417 3300025929 Bacteria 3311
574 Ga0207664_10104335 3300025929 Bacteria 2347
575 Ga0207664_10205112 3300025929 Bacteria 1703
576 Ga0207664_10370743 3300025929 Bacteria 1270
577 Ga0207644_10000532 3300025931 Bacteria 24677
578 Ga0207644_10042290 3300025931 Bacteria 3228
579 Ga0207644_10120249 3300025931 Bacteria 1999
580 Ga0207644_10225091 3300025931 Bacteria 1488
581 Ga0207690_10000409 3300025932 Bacteria 28156
582 Ga0207706_10001338 3300025933 Bacteria 24639
583 Ga0207706_10006493 3300025933 Bacteria 10857
584 Ga0207706_10006705 3300025933 Bacteria 10645
585 Ga0207706_10046748 3300025933 Bacteria 3831
586 Ga0207706_10058641 3300025933 Bacteria 3390
587 Ga0207706_10064354 3300025933 Bacteria 3229
588 Ga0207686_10000500 3300025934 Bacteria 25713
589 Ga0207686_10042200 3300025934 Bacteria 2786
590 Ga0207686_10075339 3300025934 Bacteria 2184
591 Ga0207709_10001266 3300025935 Bacteria 18089
592 Ga0207709_10050874 3300025935 Bacteria 2536
593 Ga0207709_10141359 3300025935 Bacteria 1655
594 Ga0207670_10007354 3300025936 Bacteria 6140
595 Ga0207670_10016040 3300025936 Bacteria 4493
596 Ga0207670_10027140 3300025936 Bacteria 3617
597 Ga0207670_10083746 3300025936 Bacteria 2238
598 Ga0207670_10198058 3300025936 Bacteria 1524
599 Ga0207669_10001125 3300025937 Bacteria 11423
600 Ga0207704_10000613 3300025938 Bacteria 15794
601 Ga0207665_10001192 3300025939 Bacteria 17511
602 Ga0207665_10003934 3300025939 Bacteria 9947
603 Ga0207665_10073486 3300025939 Bacteria 2338
604 Ga0207665_10319638 3300025939 Bacteria 1164
605 Ga0207691_10002493 3300025940 Bacteria 18001
606 Ga0207691_10003339 3300025940 Bacteria 15624
607 Ga0207691_10130622 3300025940 Bacteria 2219
608 Ga0207711_10003987 3300025941 Bacteria 12681
609 Ga0207711_10029326 3300025941 Bacteria 4640
610 Ga0207711_10050370 3300025941 Bacteria 3565
611 Ga0207711_10238615 3300025941 Bacteria 1667
612 Ga0207711_10286694 3300025941 Bacteria 1517
613 Ga0207689_10000440 3300025942 Bacteria 38932
614 Ga0207689_10021598 3300025942 Bacteria 5412
615 Ga0207689_10273806 3300025942 Bacteria 1398
616 Ga0207661_10059018 3300025944 Bacteria 3090
617 Ga0207661_10061762 3300025944 Bacteria 3028
618 Ga0207661_10125939 3300025944 Bacteria 2188
619 Ga0207661_10150552 3300025944 Bacteria 2011
620 Ga0207679_10005990 3300025945 Bacteria 7648
621 Ga0207679_10016049 3300025945 Bacteria 4965
622 Ga0207679_10110913 3300025945 Bacteria 2165
623 Ga0207667_10018606 3300025949 Bacteria 7784
624 Ga0207667_10040968 3300025949 Bacteria 4929
625 Ga0207651_10000335 3300025960 Bacteria 19911
626 Ga0207712_10002448 3300025961 Bacteria 11985
627 Ga0207712_10004065 3300025961 Bacteria 9233
628 Ga0207712_10194903 3300025961 Bacteria 1602
629 Ga0207668_10000065 3300025972 Bacteria 86273
630 Ga0207668_10100099 3300025972 Bacteria 2152
631 Ga0207668_10176418 3300025972 Bacteria 1681
632 Ga0207640_10000339 3300025981 Bacteria 31004
633 Ga0207658_10004428 3300025986 Bacteria 9771
634 Ga0207658_10034444 3300025986 Bacteria 3620
635 Ga0207658_10185666 3300025986 Bacteria 1724
636 Ga0207658_10291234 3300025986 Bacteria 1403
637 Ga0207677_10003580 3300026023 Bacteria 8226
638 Ga0207677_10229464 3300026023 Bacteria 1494
639 Ga0207703_10001885 3300026035 Bacteria 18620
640 Ga0207703_10124556 3300026035 Bacteria 2217
641 Ga0207703_10195052 3300026035 Bacteria 1796
642 Ga0207639_10041384 3300026041 Bacteria 3447
643 Ga0207678_10000944 3300026067 Bacteria 26538
644 Ga0207678_10006342 3300026067 Bacteria 10500
645 Ga0207678_10019284 3300026067 Bacteria 5990
646 Ga0207678_10036592 3300026067 Bacteria 4273
647 Ga0207678_10062862 3300026067 Bacteria 3190
648 Ga0207708_10002019 3300026075 Bacteria 14954
649 Ga0207708_10002166 3300026075 Bacteria 14494
650 Ga0207708_10033326 3300026075 Bacteria 3913
651 Ga0207708_10039810 3300026075 Bacteria 3583
652 Ga0207708_10115624 3300026075 Bacteria 2086
653 Ga0207708_10126975 3300026075 Bacteria 1991
654 Ga0207702_10056555 3300026078 Bacteria 3331
655 Ga0207641_10005810 3300026088 Bacteria 10470
656 Ga0207641_10085777 3300026088 Bacteria 2744
657 Ga0207648_10004730 3300026089 Bacteria 13904
658 Ga0207648_10049631 3300026089 Bacteria 3672
659 Ga0207648_10087607 3300026089 Bacteria 2717
660 Ga0207648_10167995 3300026089 Bacteria 1939
661 Ga0207676_10008134 3300026095 Bacteria 7455
662 Ga0207676_10046203 3300026095 Bacteria 3368
663 Ga0207676_10100203 3300026095 Bacteria 2399
664 Ga0207676_10127208 3300026095 Bacteria 2160
665 Ga0207674_10003323 3300026116 Bacteria 19775
666 Ga0207674_10005364 3300026116 Bacteria 15249
667 Ga0207674_10082603 3300026116 Bacteria 3213
668 Ga0207674_10091204 3300026116 Bacteria 3038
669 Ga0207675_100000815 3300026118 Bacteria 31016
670 Ga0207675_100011636 3300026118 Bacteria 8227
671 Ga0207675_100081484 3300026118 Bacteria 3034
672 Ga0207675_100175686 3300026118 Bacteria 2049
673 Ga0207675_100191507 3300026118 Bacteria 1962
674 Ga0207683_10000001 3300026121 Bacteria 352047
675 Ga0207683_10074307 3300026121 Bacteria 3007
676 Ga0207683_10096807 3300026121 Bacteria 2631
677 Ga0207683_10124322 3300026121 Bacteria 2318
678 Ga0207683_10327574 3300026121 Bacteria 1404
679 Ga0207698_10024447 3300026142 Bacteria 4240
680 Ga0209967_1000489 3300027364 Bacteria 5203
681 Ga0209981_1000830 3300027378 Bacteria 3900
682 Ga0209996_1008254 3300027395 Bacteria 1363
683 Ga0210000_1001264 3300027462 Bacteria 3559
684 Ga0209968_1006091 3300027526 Bacteria 1816
685 Ga0209999_1003822 3300027543 Bacteria 2705
686 Ga0209971_1014174 3300027682 Bacteria 1889
687 Ga0209971_1017209 3300027682 Bacteria 1714
688 Ga0209966_1000743 3300027695 Bacteria 6783
689 Ga0209966_1001998 3300027695 Bacteria 3413
690 Ga0209998_10001042 3300027717 Bacteria 6950
691 Ga0209998_10011704 3300027717 Bacteria 1818
692 Ga0209974_10050686 3300027876 Bacteria 1395
693 Ga0207428_10000172 3300027907 Bacteria 90200
694 Ga0207428_10000255 3300027907 Bacteria 72962
695 Ga0207428_10003313 3300027907 Bacteria 15665
696 Ga0207428_10013736 3300027907 Bacteria 7059
697 Ga0207428_10016308 3300027907 Bacteria 6392
698 Ga0207428_10058144 3300027907 Bacteria 3069
699 Ga0207428_10142280 3300027907 Unclassified 1830
700 Ga0268266_10020037 3300028379 Bacteria 5701
701 Ga0268266_10128823 3300028379 Bacteria 2262
702 Ga0268266_10247664 3300028379 Bacteria 1647
703 Ga0268265_10009461 3300028380 Bacteria 6580
704 Ga0268265_10029653 3300028380 Bacteria 3930
705 Ga0268264_10001153 3300028381 Bacteria 25764
706 Ga0268264_10006938 3300028381 Bacteria 9501
707 Ga0265337_1001632 3300028556 Bacteria 10908
708 Ga0265337_1029353 3300028556 Bacteria 1645
709 Ga0265338_10020616 3300028800 Bacteria 6924
710 Ga0265338_10038131 3300028800 Bacteria 4558
711 Ga0265338_10076159 3300028800 Bacteria 2843
712 Ga0265763_1000066 3300030763 Bacteria 4406
713 Ga0265760_10071838 3300031090 Bacteria 1062
714 Ga0265330_10009242 3300031235 Bacteria 4693
715 Ga0265330_10014275 3300031235 Bacteria 3687
716 Ga0265325_10000320 3300031241 Bacteria 33866
717 Ga0265325_10000901 3300031241 Bacteria 21471
718 Ga0265325_10001624 3300031241 Bacteria 15665
719 Ga0265339_10000107 3300031249 Bacteria 68261
720 Ga0265339_10000387 3300031249 Bacteria 34871
721 Ga0265339_10119541 3300031249 Bacteria 1356
722 Ga0265331_10024832 3300031250 Bacteria 3028
723 Ga0265313_10000850 3300031595 Bacteria 30762
724 Ga0265313_10004004 3300031595 Bacteria 11532
725 Ga0265314_10007897 3300031711 Bacteria 9182
726 Ga0265342_10000196 3300031712 Bacteria 67364
727 Ga0373930_0000014 3300034816 Bacteria 17170
728 Ga0373948_0000493 3300034817 Bacteria 4922
729 Ga0373948_0034839 3300034817 Bacteria 1031
730 Ga0373950_0000145 3300034818 Bacteria 11351
731 Ga0373958_0000064 3300034819 Bacteria 10619
732 Ga0373959_0013423 3300034820 Bacteria 1477
733 Ga0373938_0001531 3300034957 Bacteria 3712
734 Ga0373926_0017053 3300035083 Bacteria 2489
735 Ga0373926_0026074 3300035083 Bacteria 2043
736 Ga0373928_0001389 3300035084 Bacteria 4719
737 Ga0373928_0028267 3300035084 Bacteria 1226
738 Ga0373929_0000101 3300035085 Bacteria 14304
739 Ga0373929_0002654 3300035085 Bacteria 3273
740 Ga0373929_0016173 3300035085 Bacteria 1459
741 Ga0373934_0055179 3300035086 Bacteria 1578
742 Ga0373940_0022780 3300035088 Bacteria 1611
743 Ga0373944_0013599 3300035089 Bacteria 2261
744 Ga0373949_0000293 3300035090 Bacteria 18099
745 Ga0373949_0000952 3300035090 Bacteria 8980
746 Ga0373949_0015900 3300035090 Bacteria 1684
747 Ga0373949_0027664 3300035090 Bacteria 1334
748 Ga0373951_0001275 3300035091 Bacteria 6672
749 Ga0373952_0000030 3300035092 Bacteria 16323
750 Ga0373952_0010083 3300035092 Bacteria 1821
751 Ga0373952_0013911 3300035092 Bacteria 1603
752 Ga0373952_0034855 3300035092 Bacteria 1137
753 Ga0373923_0053917 3300035111 Bacteria 1692
754 Ga0373923_0077086 3300035111 Bacteria 1440
755 Ga0373932_0024430 3300035112 Bacteria 1626
756 Ga0373932_0055616 3300035112 Bacteria 1187
757 Ga0373932_0077125 3300035112 Bacteria 1045
758 Ga0373936_0009974 3300035113 Bacteria 3585
759 Ga0373936_0019684 3300035113 Bacteria 2616
760 Ga0373939_0000791 3300035114 Bacteria 7801
761 Ga0373941_0000050 3300035115 Bacteria 17747
762 Ga0373941_0002899 3300035115 Bacteria 3823
763 Ga0373941_0004506 3300035115 Bacteria 3224
764 Ga0373941_0046160 3300035115 Bacteria 1367
765 Ga0373945_0001214 3300035116 Bacteria 7848
766 Ga0373945_0005087 3300035116 Bacteria 4193
767 Ga0373945_0114844 3300035116 Bacteria 1065
768 Ga0373953_0001444 3300035117 Bacteria 6890
769 Ga0373953_0051017 3300035117 Bacteria 1672
770 Ga0373954_0001943 3300035118 Bacteria 8567
771 Ga0373954_0006970 3300035118 Bacteria 4934
772 Ga0373954_0008746 3300035118 Bacteria 4451
773 Ga0373954_0021614 3300035118 Bacteria 2914
774 Ga0373954_0041945 3300035118 Bacteria 2134
775 Ga0373956_0024531 3300035119 Bacteria 2599
776 Ga0373957_0003309 3300035120 Bacteria 4749
777 Ga0373957_0005066 3300035120 Bacteria 4066
778 Ga0373957_0024044 3300035120 Bacteria 2184
779 Ga0373960_0004388 3300035121 Bacteria 3230
780 Ga0373960_0007174 3300035121 Bacteria 2633
781 Ga0373960_0016939 3300035121 Bacteria 1881
782 Ga0373960_0045372 3300035121 Bacteria 1286
783 Ga0373943_0001792 3300035170 Bacteria 9710
784 Ga0373943_0006259 3300035170 Bacteria 5347
785 Ga0373943_0011476 3300035170 Bacteria 3986
786 Ga0373946_0000496 3300035171 Bacteria 13068
787 Ga0373946_0007440 3300035171 Bacteria 4005
788 Ga0373946_0044280 3300035171 Bacteria 1837
789 Ga0373946_0088151 3300035171 Bacteria 1371
790 Ga0373955_0000779 3300035172 Bacteria 13651
791 Ga0373955_0005131 3300035172 Bacteria 5853
792 Ga0373955_0017746 3300035172 Bacteria 3526
793 Ga0373955_0136417 3300035172 Bacteria 1435
794 Ga0373942_0000073 3300035207 Bacteria 21344
795 Ga0373942_0056815 3300035207 Bacteria 1112
796 Ga0373961_0000480 3300035241 Bacteria 15603
797 Ga0373961_0009096 3300035241 Bacteria 2425
798 Ga0373962_0001214 3300035242 Bacteria 6025
799 Ga0373962_0008813 3300035242 Bacteria 2490
800 Ga0373962_0011212 3300035242 Bacteria 2244
801 Ga0373962_0036676 3300035242 Bacteria 1366
802 Ga0373924_0036219 3300035410 Bacteria 2004
803 Ga0373924_0053087 3300035410 Bacteria 1683
804 Ga0373931_0000537 3300035691 Bacteria 15543
805 Ga0373931_0004302 3300035691 Bacteria 6489
806 Ga0373931_0006018 3300035691 Bacteria 5644
807 Ga0373931_0023545 3300035691 Bacteria 3111
808 Ga0373931_0025443 3300035691 Bacteria 3006
809 Ga0373931_0027531 3300035691 Bacteria 2902
810 Ga0373931_0346212 3300035691 Bacteria 929
811 Ga0373935_0000053 3300035692 Bacteria 46838
812 Ga0373935_0001261 3300035692 Bacteria 13962
813 Ga0373935_0016092 3300035692 Bacteria 4526
814 Ga0373935_0030809 3300035692 Bacteria 3325
815 Ga0373935_0111894 3300035692 Bacteria 1813
816 Ga0373935_0187353 3300035692 Bacteria 1423
817 Ga0373927_0014200 3300035695 Bacteria 5280
818 Ga0373927_0035423 3300035695 Bacteria 3245
819 Ga0373933_0001426 3300035724 Bacteria 14019
820 Ga0373933_0002786 3300035724 Bacteria 9757
821 Ga0373933_0021557 3300035724 Bacteria 3661
822 Ga0373933_0022272 3300035724 Bacteria 3606
823 Ga0373933_0051395 3300035724 Bacteria 2463
824 Ga0373947_0000259 3300035725 Bacteria 29909
825 Ga0373947_0054577 3300035725 Bacteria 2411
826 Ga0373937_0000030 3300036401 Bacteria 122176
827 Ga0373937_0000907 3300036401 Bacteria 25212
828 Ga0373937_0003255 3300036401 Bacteria 13620
829 Ga0373937_0036814 3300036401 Bacteria 4458
830 Ga0373937_0046962 3300036401 Bacteria 3949
831 Ga0373937_0160827 3300036401 Bacteria 2105
832 Ga0373925_0000002 3300037068 Bacteria 368879
833 Ga0373925_0010040 3300037068 Bacteria 6877
834 Ga0373925_0019842 3300037068 Bacteria 4890
835 Ga0373925_0120679 3300037068 Bacteria 2034
836 Ga0395900_0009186 3300037418 Bacteria 10132
837 Ga0395900_0022366 3300037418 Bacteria 6466
838 Ga0395898_0001841 3300037466 Bacteria 27267
839 Ga0395898_0003941 3300037466 Bacteria 16375
840 Ga0436364_0478575 3300037853 Bacteria 1314
841 Ga0395901_0014006 3300038443 Bacteria 8161
842 Ga0395901_0125602 3300038443 Bacteria 2696
843 Ga0395901_0194074 3300038443 Bacteria 2129
844 Ga0395901_0310785 3300038443 Bacteria 1632
845 Ga0436365_0556834 3300039437 Bacteria 1651
846 Ga0439453_0002489 3300041408 Bacteria 2549
847 Ga0439443_000477 3300042003 Bacteria 3560
848 Ga0439450_002377 3300042008 Bacteria 2951
849 Ga0439446_0001019 3300042156 Bacteria 6142
850 Ga0439435_0000002 3300042436 Bacteria 34816
851 Ga0439435_0000646 3300042436 Bacteria 5729
852 Ga0451577_0147580 3300042876 Bacteria 2115
853 Ga0451577_0206376 3300042876 Bacteria 1774
854 Ga0453683_0000968 3300044673 Bacteria 27176
855 Ga0466963_0013664 3300044694 Bacteria 4992
856 Ga0466963_0046783 3300044694 Bacteria 2854
857 Ga0453684_0283538 3300044712 Bacteria 1888
858 Ga0466968_0091790 3300044735 Bacteria 1347
859 Ga0466959_0065728 3300045049 Bacteria 2632
860 Ga0451576_0017130 3300045051 Bacteria 7970
861 Ga0451576_0559512 3300045051 Bacteria 1201
862 Ga0466958_0076835 3300045836 Bacteria 2050
863 Ga0466967_0000135 3300045976 Bacteria 28276
864 Ga0495592_0000046 3300046454 Bacteria 117345
865 Ga0495592_0001393 3300046454 Bacteria 16741
866 Ga0495592_0002484 3300046454 Bacteria 13030
867 Ga0495592_0075149 3300046454 Bacteria 2454
868 Ga0495592_0257395 3300046454 Bacteria 1151
869 Ga0495603_0001804 3300046455 Bacteria 12638
870 Ga0495603_0002249 3300046455 Bacteria 11338
871 Ga0495603_0014184 3300046455 Bacteria 4821
872 Ga0495629_0000594 3300046459 Bacteria 29414
873 Ga0495629_0001140 3300046459 Bacteria 20980
874 Ga0495629_0002311 3300046459 Bacteria 14684
875 Ga0495629_0032319 3300046459 Bacteria 3705
876 Ga0495629_0088951 3300046459 Bacteria 2154
877 Ga0495638_0003988 3300046460 Bacteria 11355
878 Ga0495638_0077367 3300046460 Bacteria 2026
879 Ga0495641_0011331 3300046461 Bacteria 5090
880 Ga0495641_0017820 3300046461 Bacteria 3686
881 Ga0495651_0000822 3300046462 Bacteria 24113
882 Ga0495651_0004816 3300046462 Bacteria 10326
883 Ga0495651_0006482 3300046462 Bacteria 8945
884 Ga0495651_0047233 3300046462 Bacteria 3330
885 Ga0495651_0062848 3300046462 Bacteria 2840
886 Ga0495651_0086884 3300046462 Bacteria 2352
887 Ga0495653_0000006 3300046463 Bacteria 363285
888 Ga0495653_0004798 3300046463 Bacteria 10964
889 Ga0495653_0181253 3300046463 Bacteria 1445
890 Ga0495580_0012844 3300046472 Bacteria 6417
891 Ga0495580_0057444 3300046472 Bacteria 2738
892 Ga0495580_0070869 3300046472 Bacteria 2435
893 Ga0495582_0000379 3300046473 Bacteria 24152
894 Ga0495582_0009407 3300046473 Bacteria 5384
895 Ga0495582_0010594 3300046473 Bacteria 5072
896 Ga0495582_0052800 3300046473 Bacteria 2241
897 Ga0495605_0136938 3300046474 Bacteria 1101
898 Ga0495639_0046773 3300046475 Bacteria 1959
899 Ga0495662_0000084 3300046476 Bacteria 33781
900 Ga0495662_0027194 3300046476 Bacteria 2763
901 Ga0495664_0000002 3300046477 Bacteria 625183
902 Ga0495664_0007745 3300046477 Bacteria 5977
903 Ga0495664_0043029 3300046477 Bacteria 2676
904 Ga0495664_0048292 3300046477 Bacteria 2526
905 Ga0495664_0050575 3300046477 Bacteria 2467
906 Ga0495584_0048021 3300046491 Bacteria 2153
907 Ga0495585_0001932 3300046492 Bacteria 15492
908 Ga0495594_0009110 3300046499 Bacteria 5124
909 Ga0495594_0011284 3300046499 Bacteria 4642
910 Ga0495594_0055076 3300046499 Bacteria 2192
911 Ga0495583_0074035 3300046506 Bacteria 1492
912 Ga0495608_0000006 3300046511 Bacteria 324334
913 Ga0495608_0017846 3300046511 Bacteria 4905
914 Ga0495608_0215979 3300046511 Bacteria 1204
915 Ga0495616_0048796 3300046513 Bacteria 2125
916 Ga0495616_0154975 3300046513 Bacteria 1034
917 Ga0495618_0000034 3300046514 Bacteria 104335
918 Ga0495618_0001547 3300046514 Bacteria 15443
919 Ga0495628_0000002 3300046516 Bacteria 589399
920 Ga0495628_0003624 3300046516 Bacteria 13800
921 Ga0495628_0027943 3300046516 Bacteria 4586
922 Ga0495630_0000662 3300046517 Bacteria 24856
923 Ga0495630_0005622 3300046517 Bacteria 8855
924 Ga0495630_0042264 3300046517 Bacteria 3404
925 Ga0495630_0178293 3300046517 Bacteria 1620
926 Ga0495644_0003085 3300046523 Bacteria 6594
927 Ga0495666_0001508 3300046526 Bacteria 11395
928 Ga0495652_0000004 3300046529 Bacteria 588877
929 Ga0495652_0013904 3300046529 Bacteria 7238
930 Ga0495652_0014845 3300046529 Bacteria 6981
931 Ga0495652_0019057 3300046529 Bacteria 6112
932 Ga0495652_0078363 3300046529 Bacteria 2736
933 Ga0495652_0154159 3300046529 Bacteria 1791
934 Ga0495652_0154943 3300046529 Bacteria 1785
935 Ga0495665_0003909 3300046531 Bacteria 8063
936 Ga0495640_0000007 3300046533 Bacteria 265481
937 Ga0495640_0006199 3300046533 Bacteria 9472
938 Ga0495640_0010455 3300046533 Bacteria 7168
939 Ga0495640_0050524 3300046533 Bacteria 2864
940 Ga0495640_0075109 3300046533 Bacteria 2257
941 Ga0495640_0211013 3300046533 Bacteria 1227
942 Ga0495587_0000031 3300046536 Bacteria 126721
943 Ga0495587_0002979 3300046536 Bacteria 11321
944 Ga0495587_0016339 3300046536 Bacteria 4618
945 Ga0495587_0114061 3300046536 Bacteria 1550
946 Ga0495587_0118380 3300046536 Bacteria 1517
947 Ga0495598_0004396 3300046537 Bacteria 3048
948 Ga0495598_0019744 3300046537 Bacteria 1771
949 Ga0495598_0021953 3300046537 Bacteria 1703
950 Ga0495645_0000003 3300046543 Bacteria 570133
951 Ga0495645_0010875 3300046543 Bacteria 6391
952 Ga0495622_0013050 3300046557 Bacteria 3855
953 Ga0495667_0000002 3300046559 Bacteria 437535
954 Ga0495667_0000202 3300046559 Bacteria 40046
955 Ga0495667_0000365 3300046559 Bacteria 28797
956 Ga0495667_0250301 3300046559 Bacteria 1128
957 Ga0495667_0302345 3300046559 Bacteria 1013
958 Ga0495656_0026229 3300046615 Bacteria 2318
959 Ga0495634_0000533 3300046642 Bacteria 37336
960 Ga0495634_0007719 3300046642 Bacteria 8052
961 Ga0495634_0008544 3300046642 Bacteria 7612
962 Ga0495634_0050245 3300046642 Bacteria 2801
963 Ga0495634_0098239 3300046642 Bacteria 1894
964 Ga0495634_0186293 3300046642 Bacteria 1297
965 Ga0495611_0053259 3300046648 Bacteria 1826
966 Ga0495635_0000022 3300046663 Bacteria 160907
967 Ga0495635_0000981 3300046663 Bacteria 18808
968 Ga0495635_0013894 3300046663 Bacteria 5633
969 Ga0495635_0087593 3300046663 Bacteria 2131
970 Ga0495635_0116019 3300046663 Bacteria 1828
971 Ga0495659_0004216 3300046664 Bacteria 4538
972 Ga0495659_0034053 3300046664 Bacteria 1790
973 Ga0495661_0010683 3300046665 Bacteria 6254
974 Ga0495588_0108007 3300046674 Bacteria 1465
975 Ga0495657_0000276 3300046675 Bacteria 46295
976 Ga0495657_0090215 3300046675 Bacteria 1968
977 Ga0495599_0000001 3300046678 Bacteria 537563
978 Ga0495599_0002835 3300046678 Bacteria 10095
979 Ga0495599_0046540 3300046678 Bacteria 2720
980 Ga0495623_0000094 3300046679 Bacteria 53328
981 Ga0495623_0001448 3300046679 Bacteria 16089
982 Ga0495623_0093803 3300046679 Bacteria 1837
983 Ga0495646_0000007 3300046680 Bacteria 236764
984 Ga0495646_0002316 3300046680 Bacteria 11659
985 Ga0495646_0038495 3300046680 Bacteria 2952
986 Ga0495646_0080686 3300046680 Bacteria 1897
987 Ga0495647_0000122 3300046681 Bacteria 19930
988 Ga0495647_0000393 3300046681 Bacteria 12484
989 Ga0495647_0001922 3300046681 Bacteria 6479
990 Ga0495658_0000210 3300046683 Bacteria 33648
991 Ga0495658_0005298 3300046683 Bacteria 6345
992 Ga0495658_0009937 3300046683 Bacteria 4747
993 Ga0495658_0026729 3300046683 Bacteria 3096
994 Ga0495658_0198856 3300046683 Bacteria 1249
995 Ga0495669_0040626 3300046684 Bacteria 2064
996 Ga0495669_0058211 3300046684 Bacteria 1744
997 Ga0495613_0014661 3300046689 Bacteria 5816
998 Ga0495613_0018397 3300046689 Bacteria 5211
999 Ga0495613_0083862 3300046689 Bacteria 2314
1000 Ga0495624_0000222 3300046690 Bacteria 44293
1001 Ga0495624_0020416 3300046690 Bacteria 4410
1002 Ga0495624_0024713 3300046690 Bacteria 3951
1003 Ga0495624_0034304 3300046690 Bacteria 3283
1004 Ga0495670_0001624 3300046691 Bacteria 11000
1005 Ga0495670_0045447 3300046691 Bacteria 2193
1006 Ga0495670_0072999 3300046691 Bacteria 1739
1007 Ga0495671_0128272 3300046692 Bacteria 1237
1008 Ga0495600_0000033 3300046809 Bacteria 83590
1009 Ga0495600_0000506 3300046809 Bacteria 20198
1010 Ga0495600_0002658 3300046809 Bacteria 10329
1011 Ga0495600_0030323 3300046809 Bacteria 3503
1012 Ga0495600_0124399 3300046809 Bacteria 1677
1013 Ga0495581_0005193 3300047315 Bacteria 7534
1014 Ga0495581_0014416 3300047315 Bacteria 4584
1015 Ga0495581_0020808 3300047315 Bacteria 3806
1016 Ga0495581_0046003 3300047315 Bacteria 2522
1017 Ga0495604_0000005 3300047317 Bacteria 424516
1018 Ga0495604_0001089 3300047317 Bacteria 22540
1019 Ga0495604_0002751 3300047317 Bacteria 14105
1020 Ga0495604_0007025 3300047317 Bacteria 8925
1021 Ga0495674_0000003 3300047319 Bacteria 562126
1022 Ga0495674_0001490 3300047319 Bacteria 22945
1023 Ga0495674_0014630 3300047319 Bacteria 7343
1024 Ga0495674_0071080 3300047319 Bacteria 3006
1025 Ga0495674_0144775 3300047319 Bacteria 1995
1026 Ga0495674_0214125 3300047319 Bacteria 1595
1027 Ga0495672_0144545 3300047320 Bacteria 1239
1028 Ga0495676_0000289 3300047321 Bacteria 40718
1029 Ga0495676_0021676 3300047321 Bacteria 5605
1030 Ga0495676_0059814 3300047321 Bacteria 2989
1031 Ga0495676_0079695 3300047321 Bacteria 2489
1032 Ga0495680_0000091 3300047322 Bacteria 81622
1033 Ga0495680_0001414 3300047322 Bacteria 25878
1034 Ga0495680_0012301 3300047322 Bacteria 7541
1035 Ga0495680_0018026 3300047322 Bacteria 6007
1036 Ga0495680_0037109 3300047322 Bacteria 3906
1037 Ga0495680_0072323 3300047322 Bacteria 2623
1038 Ga0495680_0273037 3300047322 Bacteria 1193
1039 Ga0495680_0408977 3300047322 Bacteria 935
1040 Ga0495675_0000064 3300047444 Bacteria 74132
1041 Ga0495675_0006504 3300047444 Bacteria 7152
1042 Ga0495685_021278 3300047447 Bacteria 2232
1043 Ga0495684_0000035 3300047471 Bacteria 107768
1044 Ga0495684_0000075 3300047471 Bacteria 67922
1045 Ga0495684_0073421 3300047471 Bacteria 2599
1046 Ga0495684_0202056 3300047471 Bacteria 1465
1047 Ga0495686_0194647 3300047472 Bacteria 1167
1048 Ga0495593_0001106 3300047673 Bacteria 15737
1049 Ga0495593_0033459 3300047673 Bacteria 2799
1050 Ga0495602_0000029 3300048088 Bacteria 142344
1051 Ga0495602_0002033 3300048088 Bacteria 20344
1052 Ga0495602_0018847 3300048088 Bacteria 6872
1053 Ga0495602_0139834 3300048088 Bacteria 1918
1054 Ga0495615_0025543 3300048090 Bacteria 1372
1055 Ga0496100_0000404 3300048903 Bacteria 20908
1056 Ga0496100_0000823 3300048903 Bacteria 14892
1057 Ga0496100_0013536 3300048903 Bacteria 4709
1058 Ga0496100_0200173 3300048903 Bacteria 1455
1059 Ga0496101_0000423 3300048904 Bacteria 27228
1060 Ga0496101_0042230 3300048904 Bacteria 3254
1061 Ga0496101_0074352 3300048904 Bacteria 2499
1062 Ga0496102_0003323 3300048905 Bacteria 13636
1063 Ga0496102_0004385 3300048905 Bacteria 11921
1064 Ga0496102_0017907 3300048905 Bacteria 6213
1065 Ga0496102_0050819 3300048905 Bacteria 3775
1066 Ga0496102_0185693 3300048905 Bacteria 1959
1067 Ga0496102_0199970 3300048905 Bacteria 1883
1068 Ga0496103_0000967 3300048906 Bacteria 20341
1069 Ga0496103_0161660 3300048906 Bacteria 1436
1070 Ga0496104_0000711 3300048907 Bacteria 28620
1071 Ga0496104_0000925 3300048907 Bacteria 25187
1072 Ga0496104_0005217 3300048907 Bacteria 11362
1073 Ga0496104_0005466 3300048907 Bacteria 11129
1074 Ga0496104_0014835 3300048907 Bacteria 7042
1075 Ga0496104_0018532 3300048907 Bacteria 6351
1076 Ga0496104_0026724 3300048907 Bacteria 5333
1077 Ga0496104_0037384 3300048907 Bacteria 4540
1078 Ga0496104_0462323 3300048907 Bacteria 1180
1079 Ga0496105_0007195 3300048908 Bacteria 8589
1080 Ga0496105_0010049 3300048908 Bacteria 7427
1081 Ga0496105_0017905 3300048908 Bacteria 5685
1082 Ga0496105_0020189 3300048908 Bacteria 5380
1083 Ga0496105_0025218 3300048908 Bacteria 4837
1084 Ga0496105_0096900 3300048908 Bacteria 2436
1085 Ga0496105_0124462 3300048908 Bacteria 2125
1086 Ga0496105_0245365 3300048908 Bacteria 1452
1087 Ga0496105_0339947 3300048908 Bacteria 1200
1088 Ga0496106_0002446 3300048909 Bacteria 13839
1089 Ga0496106_0003669 3300048909 Bacteria 11448
1090 Ga0496106_0005520 3300048909 Bacteria 9359
1091 Ga0496106_0015174 3300048909 Bacteria 5701
1092 Ga0496106_0269363 3300048909 Bacteria 1363
1093 Ga0496107_0000500 3300048910 Bacteria 21655
1094 Ga0496107_0021517 3300048910 Bacteria 4558
1095 Ga0496107_0130304 3300048910 Bacteria 1856
1096 Ga0496108_0018949 3300048911 Bacteria 5643
1097 Ga0496108_0040996 3300048911 Bacteria 3862
1098 Ga0496108_0053124 3300048911 Bacteria 3396
1099 Ga0496108_0068004 3300048911 Bacteria 3005
1100 Ga0496108_0115535 3300048911 Bacteria 2298
1101 Ga0496109_0000340 3300048912 Bacteria 43565
1102 Ga0496109_0000359 3300048912 Bacteria 42297
1103 Ga0496109_0000976 3300048912 Bacteria 23658
1104 Ga0496109_0005940 3300048912 Bacteria 10246
1105 Ga0496109_0015600 3300048912 Bacteria 6625
1106 Ga0496109_0056951 3300048912 Bacteria 3567
1107 Ga0496109_0082278 3300048912 Bacteria 2967
1108 Ga0496110_0002357 3300048913 Bacteria 14148
1109 Ga0496110_0003362 3300048913 Bacteria 12213
1110 Ga0496110_0020674 3300048913 Bacteria 5559
1111 Ga0496110_0027384 3300048913 Bacteria 4886
1112 Ga0496110_0229269 3300048913 Bacteria 1689
1113 Ga0496111_0023917 3300048914 Bacteria 4294
1114 Ga0496111_0030852 3300048914 Bacteria 3814
1115 Ga0496111_0040590 3300048914 Bacteria 3338
1116 Ga0496111_0083227 3300048914 Bacteria 2338
1117 Ga0496111_0090226 3300048914 Bacteria 2245
1118 Ga0496111_0276562 3300048914 Bacteria 1245
1119 Ga0496112_0021049 3300048915 Bacteria 6194
1120 Ga0496112_0032947 3300048915 Bacteria 5032
1121 Ga0496112_0038798 3300048915 Bacteria 4652
1122 Ga0496112_0044120 3300048915 Bacteria 4367
1123 Ga0496112_0051703 3300048915 Bacteria 4030
1124 Ga0496112_0078758 3300048915 Bacteria 3259
1125 Ga0496112_0122219 3300048915 Bacteria 2574
1126 Ga0496112_0216613 3300048915 Bacteria 1871
1127 Ga0496112_0338368 3300048915 Bacteria 1448
1128 Ga0496113_0001950 3300048916 Bacteria 11812
1129 Ga0496113_0008785 3300048916 Bacteria 6598
1130 Ga0496113_0087302 3300048916 Bacteria 2398
1131 Ga0496113_0189124 3300048916 Bacteria 1634
1132 Ga0496114_0122875 3300048917 Bacteria 2234
1133 Ga0496114_0253543 3300048917 Bacteria 1548
1134 Ga0496115_0009549 3300048918 Bacteria 7206
1135 Ga0496115_0019987 3300048918 Bacteria 5160
1136 Ga0496115_0073699 3300048918 Bacteria 2771
1137 Ga0496115_0127875 3300048918 Bacteria 2093
1138 Ga0496115_0139123 3300048918 Bacteria 2002
1139 Ga0496115_0152345 3300048918 Bacteria 1909
1140 Ga0496115_0189422 3300048918 Bacteria 1699
1141 Ga0501031_0016693 3300049568 Bacteria 4769
1142 Ga0501031_0055503 3300049568 Bacteria 2581
1143 Ga0501031_0062823 3300049568 Bacteria 2420
1144 Ga0501031_0111803 3300049568 Bacteria 1784
1145 Ga0501031_0128683 3300049568 Bacteria 1654
1146 Ga0501032_0062347 3300049569 Bacteria 2498
1147 Ga0501033_0008227 3300049570 Bacteria 8079
1148 Ga0501033_0017629 3300049570 Bacteria 5394
1149 Ga0501033_0044445 3300049570 Bacteria 3307
1150 Ga0501034_0006692 3300049571 Bacteria 12361
1151 Ga0501034_0029366 3300049571 Bacteria 5588
1152 Ga0501034_0039017 3300049571 Bacteria 4810
1153 Ga0501034_0080158 3300049571 Bacteria 3268
1154 Ga0501034_0311184 3300049571 Bacteria 1509
1155 Ga0501036_0018021 3300049572 Bacteria 5912
1156 Ga0501036_0054799 3300049572 Bacteria 3378
1157 Ga0501036_0090209 3300049572 Bacteria 2589
1158 Ga0501036_0166604 3300049572 Bacteria 1857
1159 Ga0501036_0246470 3300049572 Bacteria 1498
1160 Ga0501037_0116612 3300049573 Bacteria 1922
1161 Ga0501038_0000775 3300049574 Bacteria 28264
1162 Ga0501038_0134268 3300049574 Bacteria 2029
1163 Ga0501038_0153148 3300049574 Bacteria 1879
1164 Ga0501039_0044530 3300049575 Bacteria 3428
1165 Ga0501039_0057887 3300049575 Bacteria 3001
1166 Ga0501039_0163702 3300049575 Bacteria 1749
1167 Ga0501039_0201796 3300049575 Bacteria 1563
1168 Ga0501039_0297066 3300049575 Bacteria 1270
1169 Ga0501040_0009567 3300049576 Bacteria 6324
1170 Ga0501040_0012594 3300049576 Bacteria 5545
1171 Ga0501040_0138114 3300049576 Unclassified 1716
1172 Ga0501040_0301252 3300049576 Bacteria 1146
1173 Ga0501041_0017024 3300049577 Bacteria 4325
1174 Ga0501041_0027793 3300049577 Bacteria 3410
1175 Ga0501041_0095703 3300049577 Bacteria 1835
1176 Ga0501041_0288703 3300049577 Bacteria 1033
1177 Ga0501042_0044547 3300049578 Bacteria 3162
1178 Ga0501042_0056371 3300049578 Bacteria 2804
1179 Ga0501042_0082155 3300049578 Bacteria 2310
1180 Ga0501042_0121352 3300049578 Bacteria 1882
1181 Ga0501043_0050356 3300049579 Bacteria 3274
1182 Ga0501043_0103007 3300049579 Bacteria 2243
1183 Ga0501043_0138409 3300049579 Bacteria 1907
1184 Ga0501046_0032814 3300049580 Bacteria 4201
1185 Ga0501046_0039215 3300049580 Bacteria 3795
1186 Ga0501046_0062896 3300049580 Bacteria 2899
1187 Ga0501046_0120856 3300049580 Bacteria 1993
1188 Ga0501046_0344041 3300049580 Bacteria 1083
1189 Ga0501047_0006347 3300049581 Bacteria 11116
1190 Ga0501047_0009067 3300049581 Bacteria 9395
1191 Ga0501047_0018859 3300049581 Bacteria 6617
1192 Ga0501047_0039533 3300049581 Bacteria 4562
1193 Ga0501048_0107955 3300049582 Bacteria 1965
1194 Ga0501068_0098761 3300049584 Bacteria 1808
1195 Ga0501068_0139895 3300049584 Bacteria 1517
1196 Ga0501069_0038797 3300049585 Bacteria 2630
1197 Ga0501070_0027193 3300049586 Bacteria 4799
1198 Ga0501070_0056684 3300049586 Bacteria 3248
1199 Ga0501070_0097024 3300049586 Bacteria 2438
1200 Ga0501071_0095714 3300049587 Bacteria 2185
1201 Ga0501071_0156383 3300049587 Bacteria 1702
1202 Ga0501072_0009124 3300049588 Bacteria 7532
1203 Ga0501072_0020826 3300049588 Bacteria 5082
1204 Ga0501072_0222407 3300049588 Bacteria 1504
1205 Ga0501073_0123601 3300049589 Bacteria 1794
1206 Ga0501074_0073296 3300049590 Bacteria 2460
1207 Ga0501075_0004734 3300049591 Bacteria 9250
1208 Ga0501075_0005155 3300049591 Bacteria 8937
1209 Ga0501076_0001405 3300049592 Bacteria 16125
1210 Ga0501076_0016440 3300049592 Bacteria 5610
1211 Ga0501076_0064247 3300049592 Bacteria 2925
1212 Ga0501076_0155999 3300049592 Bacteria 1858
1213 Ga0501076_0212696 3300049592 Bacteria 1580
1214 Ga0501076_0361151 3300049592 Bacteria 1193
1215 Ga0501076_0579486 3300049592 Unclassified 925
1216 Ga0501077_0007341 3300049593 Bacteria 6798
1217 Ga0501077_0103962 3300049593 Bacteria 1800
1218 Ga0501077_0150602 3300049593 Unclassified 1476
1219 Ga0501077_0233313 3300049593 Bacteria 1170
1220 Ga0501077_0248646 3300049593 Bacteria 1130
1221 Ga0501079_0003233 3300049741 Bacteria 11932
1222 Ga0501079_0040616 3300049741 Bacteria 3589
1223 Ga0501079_0062842 3300049741 Bacteria 2864
1224 Ga0501079_0118220 3300049741 Bacteria 2060
1225 Ga0501079_0139506 3300049741 Bacteria 1888
1226 Ga0501080_0021206 3300049742 Bacteria 6013
1227 Ga0501080_0028713 3300049742 Bacteria 5178
1228 Ga0501080_0096741 3300049742 Bacteria 2741
1229 Ga0501081_0001767 3300049743 Bacteria 13415
1230 Ga0501081_0010499 3300049743 Bacteria 6045
1231 Ga0501081_0010888 3300049743 Bacteria 5945
1232 Ga0501081_0024939 3300049743 Bacteria 4020
1233 Ga0501081_0054812 3300049743 Bacteria 2755
1234 Ga0501081_0055859 3300049743 Bacteria 2728
1235 Ga0501083_0029184 3300049744 Bacteria 3796
1236 Ga0501083_0063014 3300049744 Bacteria 2473
1237 Ga0501083_0106169 3300049744 Bacteria 1849
1238 Ga0501083_0141130 3300049744 Bacteria 1578
1239 Ga0501035_0000127 3300049822 Bacteria 92397
1240 Ga0501035_0022579 3300049822 Bacteria 5779
1241 Ga0501044_0008177 3300049823 Bacteria 11483
1242 Ga0501044_0023098 3300049823 Bacteria 6621
1243 Ga0501044_0088157 3300049823 Bacteria 3133
1244 Ga0501045_0018155 3300049824 Bacteria 4999
1245 Ga0501045_0057834 3300049824 Bacteria 2838
1246 Ga0501045_0133245 3300049824 Bacteria 1847
1247 Ga0501045_0153487 3300049824 Bacteria 1713
1248 Ga0501045_0162931 3300049824 Bacteria 1660
1249 Ga0501045_0173509 3300049824 Unclassified 1606
1250 nmdc:mga03683_4783_c1 3300050489 Bacteria 4521
1251 nmdc:mga03683_56333_c1 3300050489 Bacteria 1652
1252 nmdc:mga03n38_22752_c1 3300050490 Bacteria 2541
1253 nmdc:mga00v17_126627_c1 3300050491 Bacteria 1630
1254 nmdc:mga00v17_4490_c1 3300050491 Bacteria 7264
1255 nmdc:mga0yw44_65200_c1 3300050492 Bacteria 2244
1256 nmdc:mga0k408_2408_c1 3300050493 Bacteria 9952
1257 nmdc:mga06z11_200577_c1 3300050494 Unclassified 1159
1258 nmdc:mga07m45_84329_c2 3300050496 Bacteria 1514
1259 nmdc:mga05p37_114724_c1 3300050507 Bacteria 3312
1260 nmdc:mga05p37_148901_c1 3300050507 Bacteria 2865
1261 nmdc:mga05p37_1808_c2 3300050507 Bacteria 13333
1262 nmdc:mga05p37_227255_c1 3300050507 Bacteria 2250
1263 nmdc:mga05p37_295597_c1 3300050507 Bacteria 1926
1264 nmdc:mga05p37_356208_c1 3300050507 Bacteria 1722
1265 nmdc:mga05p37_45950_c1 3300050507 Bacteria 5370
1266 nmdc:mga05p37_508_c2 3300050507 Bacteria 7955
1267 nmdc:mga05p37_711641_c1 3300050507 Bacteria 1114
1268 nmdc:mga05p37_75031_c1 3300050507 Bacteria 4163
1269 nmdc:mga05p37_888971_c1 3300050507 Bacteria 962
1270 nmdc:mga09592_152046_c1 3300050508 Bacteria 1997
1271 nmdc:mga09592_239014_c1 3300050508 Bacteria 1574
1272 nmdc:mga09592_30039_c1 3300050508 Bacteria 4523
1273 nmdc:mga09592_49791_c1 3300050508 Bacteria 3532
1274 nmdc:mga09592_5057_c1 3300050508 Bacteria 10702
1275 nmdc:mga0qj67_15510_c1 3300050509 Bacteria 5769
1276 nmdc:mga0qj67_5333_c1 3300050509 Bacteria 9380
1277 nmdc:mga06r32_124972_c1 3300050510 Bacteria 2540
1278 nmdc:mga06r32_146979_c1 3300050510 Bacteria 2334
1279 nmdc:mga06r32_1960_c1 3300050510 Bacteria 18367
1280 nmdc:mga06r32_236663_c1 3300050510 Bacteria 1813
1281 nmdc:mga06r32_33897_c1 3300050510 Bacteria 4812
1282 nmdc:mga06r32_3441_c1 3300050510 Bacteria 14162
1283 nmdc:mga06r32_4445_c1 3300050510 Bacteria 12549
1284 nmdc:mga06r32_479484_c1 3300050510 Bacteria 1222
1285 nmdc:mga06r32_53801_c1 3300050510 Bacteria 3858
1286 nmdc:mga08y16_14675_c1 3300050511 Bacteria 8238
1287 nmdc:mga08y16_2332_c1 3300050511 Bacteria 19466
1288 nmdc:mga08y16_3146_c1 3300050511 Bacteria 17090
1289 nmdc:mga08y16_378174_c1 3300050511 Unclassified 1452
1290 nmdc:mga08y16_3939_c1 3300050511 Bacteria 15466
1291 nmdc:mga08y16_566179_c1 3300050511 Bacteria 1149
1292 nmdc:mga08y16_63381_c1 3300050511 Bacteria 3860
1293 nmdc:mga08y16_640818_c1 3300050511 Bacteria 1068
1294 nmdc:mga08y16_75718_c1 3300050511 Bacteria 3508
1295 nmdc:mga08y16_9215_c1 3300050511 Bacteria 10357
1296 nmdc:mga0n895_142493_c1 3300050512 Bacteria 2426
1297 nmdc:mga0n895_145_c1 3300050512 Bacteria 43408
1298 nmdc:mga0n895_149686_c1 3300050512 Bacteria 2364
1299 nmdc:mga0n895_159698_c1 3300050512 Bacteria 2285
1300 nmdc:mga0n895_204112_c1 3300050512 Bacteria 2007
1301 nmdc:mga0n895_37534_c1 3300050512 Bacteria 4688
1302 nmdc:mga0n895_429381_c1 3300050512 Bacteria 1335
1303 nmdc:mga0n895_450487_c1 3300050512 Bacteria 1300
1304 nmdc:mga0n895_4696_c1 3300050512 Bacteria 11271
1305 nmdc:mga0n895_494323_c1 3300050512 Bacteria 1233
1306 nmdc:mga0n895_4964_c1 3300050512 Bacteria 11037
1307 nmdc:mga0n895_545530_c1 3300050512 Bacteria 1165
1308 nmdc:mga0n895_56995_c1 3300050512 Bacteria 3851
1309 nmdc:mga0n895_662439_c1 3300050512 Bacteria 1042
1310 nmdc:mga0n895_697_c1 3300050512 Bacteria 23592
1311 nmdc:mga0n895_79449_c1 3300050512 Bacteria 3267
1312 nmdc:mga0rr50_1966_c1 3300050513 Bacteria 11411
1313 nmdc:mga0rr50_2684_c1 3300050513 Bacteria 10078
1314 nmdc:mga0rr50_26927_c1 3300050513 Bacteria 4020
1315 nmdc:mga0rr50_354727_c1 3300050513 Bacteria 1234
1316 nmdc:mga0rr50_42859_c1 3300050513 Bacteria 3308
1317 nmdc:mga0rr50_48815_c1 3300050513 Bacteria 3131
1318 nmdc:mga0rr50_59705_c1 3300050513 Bacteria 2865
1319 nmdc:mga08x19_113019_c1 3300050514 Bacteria 1813
1320 nmdc:mga08x19_1133_c1 3300050514 Bacteria 16621
1321 nmdc:mga08x19_33203_c1 3300050514 Bacteria 3256
1322 nmdc:mga08x19_73938_c1 3300050514 Bacteria 1451
1323 nmdc:mga0a205_17058_c2 3300050515 Bacteria 3488
1324 nmdc:mga0a205_17080_c2 3300050515 Bacteria 3784
1325 nmdc:mga0a205_18201_c1 3300050515 Bacteria 6599
1326 nmdc:mga0a205_1921_c1 3300050515 Bacteria 18059
1327 nmdc:mga0a205_19981_c1 3300050515 Bacteria 6319
1328 nmdc:mga0a205_212511_c1 3300050515 Bacteria 1822
1329 nmdc:mga0a205_2724_c1 3300050515 Bacteria 15622
1330 nmdc:mga0a205_44400_c1 3300050515 Bacteria 4284
1331 Ga0495601_0000008 3300053077 Bacteria 362152
1332 Ga0495601_0001042 3300053077 Bacteria 15154
1333 Ga0495601_0001925 3300053077 Bacteria 11619
1334 Ga0495601_0044685 3300053077 Bacteria 2784
1335 Ga0495601_0153402 3300053077 Bacteria 1504
1336 Ga0495601_0224351 3300053077 Bacteria 1227
1337 Ga0495601_0230234 3300053077 Bacteria 1210
1338 Ga0495612_0000026 3300053078 Bacteria 111627
1339 Ga0495612_0000858 3300053078 Bacteria 12361
1340 Ga0495612_0012643 3300053078 Bacteria 3403
1341 Ga0495612_0021006 3300053078 Bacteria 2618
1342 Ga0495595_0000024 3300053084 Bacteria 108008
1343 Ga0495595_0000879 3300053084 Bacteria 11535
1344 Ga0495595_0006336 3300053084 Bacteria 4819
1345 Ga0495595_0010002 3300053084 Bacteria 3933
1346 Ga0495595_0026796 3300053084 Bacteria 2563
1347 Ga0495619_0000002 3300053085 Bacteria 530226
1348 Ga0495619_0000229 3300053085 Bacteria 40785
1349 Ga0495619_0002881 3300053085 Bacteria 11182
1350 Ga0495619_0005795 3300053085 Bacteria 7828
1351 Ga0495619_0013992 3300053085 Bacteria 5062
1352 Ga0495619_0018217 3300053085 Bacteria 4453
1353 Ga0495619_0022907 3300053085 Bacteria 3998
1354 Ga0495619_0177839 3300053085 Bacteria 1472
1355 Ga0500643_009516 3300053087 Bacteria 3706
1356 Ga0500593_023541 3300053117 Bacteria 2727
1357 Ga0500594_0047434 3300053118 Bacteria 1198
1358 Ga0500595_000010 3300053119 Bacteria 275806
1359 Ga0500589_072464 3300053147 Bacteria 1556
1360 Ga0500604_0030341 3300053151 Bacteria 1581
1361 Ga0500604_0069737 3300053151 Bacteria 1119
1362 Ga0500616_0000001 3300053153 Bacteria 1986011
1363 Ga0500616_0042710 3300053153 Bacteria 2426
1364 Ga0500645_000015 3300053730 Bacteria 150140
1365 Ga0501084_0046785 3300054114 Bacteria 3624
1366 Ga0501084_0068704 3300054114 Bacteria 2966
1367 Ga0501084_0077346 3300054114 Bacteria 2790
1368 Ga0501084_0137519 3300054114 Bacteria 2056
1369 Ga0501084_0170353 3300054114 Bacteria 1838
1370 Ga0590077_005770 3300059426 Bacteria 2536
1371 Ga0501082_0000013 3300060353 Bacteria 119623
1372 Ga0501082_0011948 3300060353 Bacteria 7466
1373 Ga0501082_0013431 3300060353 Bacteria 7039
1374 Ga0501082_0015413 3300060353 Bacteria 6579
1375 Ga0501082_0152268 3300060353 Bacteria 2009
1376 Ga0501082_0271122 3300060353 Bacteria 1477
1377 Ga0530510_0000596 3300061734 Bacteria 23255
1378 Ga0530510_0030147 3300061734 Bacteria 3895
1379 Ga0530510_0111429 3300061734 Bacteria 2004
1380 Ga0530510_0224288 3300061734 Bacteria 1397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0016693 Ga0501031_0016693_362_1372 231
2 3300049569 Ga0501032_0062347 Ga0501032_0062347_881_1891 231
3 3300049570 Ga0501033_0017629 Ga0501033_0017629_3881_4891 231
4 3300049571 Ga0501034_0039017 Ga0501034_0039017_229_1239 231
5 3300049572 Ga0501036_0054799 Ga0501036_0054799_1841_2851 231
6 3300049575 Ga0501039_0057887 Ga0501039_0057887_268_1278 231
7 3300049822 Ga0501035_0022579 Ga0501035_0022579_1612_2622 231
8 3300049571 Ga0501034_0311184 Ga0501034_0311184_248_1258 233
9 3300049572 Ga0501036_0166604 Ga0501036_0166604_490_1500 233
10 3300049573 Ga0501037_0116612 Ga0501037_0116612_550_1560 233
11 3300049574 Ga0501038_0134268 Ga0501038_0134268_266_1276 233
12 3300049579 Ga0501043_0138409 Ga0501043_0138409_604_1614 233
13 3300049580 Ga0501046_0120856 Ga0501046_0120856_400_1410 233
14 3300049586 Ga0501070_0097024 Ga0501070_0097024_961_1971 233
15 3300028800 Ga0265338_10076159 Ga0265338_100761593 250
16 3300049568 Ga0501031_0128683 Ga0501031_0128683_464_1429 251
17 3300049570 Ga0501033_0008227 Ga0501033_0008227_653_1618 251
18 3300049572 Ga0501036_0090209 Ga0501036_0090209_407_1372 251
19 3300049574 Ga0501038_0000775 Ga0501038_0000775_1428_2393 251
20 3300049575 Ga0501039_0201796 Ga0501039_0201796_266_1231 251
21 3300049576 Ga0501040_0009567 Ga0501040_0009567_1052_2017 251
22 3300049577 Ga0501041_0027793 Ga0501041_0027793_762_1727 251
23 3300049578 Ga0501042_0056371 Ga0501042_0056371_1365_2330 251
24 3300049579 Ga0501043_0050356 Ga0501043_0050356_391_1356 251
25 3300049580 Ga0501046_0344041 Ga0501046_0344041_63_1028 251
26 3300049584 Ga0501068_0098761 Ga0501068_0098761_718_1683 251
27 3300049587 Ga0501071_0095714 Ga0501071_0095714_1006_1971 251
28 3300049591 Ga0501075_0005155 Ga0501075_0005155_1215_2180 251
29 3300049592 Ga0501076_0155999 Ga0501076_0155999_527_1492 251
30 3300049593 Ga0501077_0248646 Ga0501077_0248646_102_1067 251
31 3300049741 Ga0501079_0040616 Ga0501079_0040616_1527_2492 251
32 3300049742 Ga0501080_0028713 Ga0501080_0028713_1036_2001 251
33 3300049743 Ga0501081_0010499 Ga0501081_0010499_4205_5170 251
34 3300049824 Ga0501045_0153487 Ga0501045_0153487_146_1111 251
35 3300054114 Ga0501084_0137519 Ga0501084_0137519_521_1486 251
36 3300060353 Ga0501082_0011948 Ga0501082_0011948_6435_7400 251
37 3300061734 Ga0530510_0111429 Ga0530510_0111429_898_1863 251
38 3300003911 JGI25405J52794_10004445 JGI25405J52794_100044452 252
39 3300005459 Ga0068867_100434058 Ga0068867_1004340581 252
40 3300005937 Ga0081455_10003284 Ga0081455_100032846 252
41 3300005985 Ga0081539_10023001 Ga0081539_100230012 252
42 3300006177 Ga0075362_10000839 Ga0075362_100008398 252
43 3300006178 Ga0075367_10103410 Ga0075367_101034102 252
44 3300006195 Ga0075366_10001687 Ga0075366_100016876 252
45 3300006852 Ga0075433_10149589 Ga0075433_101495892 252
46 3300006871 Ga0075434_100038594 Ga0075434_1000385943 252
47 3300009147 Ga0114129_10065278 Ga0114129_100652785 252
48 3300046460 Ga0495638_0003988 Ga0495638_0003988_5934_6914 252
49 3300046460 Ga0495638_0077367 Ga0495638_0077367_850_1824 252
50 3300047447 Ga0495685_021278 Ga0495685_021278_523_1506 252
51 3300050489 nmdc:mga03683_4783_c1 nmdc:mga03683_4783_c1_3504_4481 252
52 3300050490 nmdc:mga03n38_22752_c1 nmdc:mga03n38_22752_c1_54_1031 252
53 3300050491 nmdc:mga00v17_4490_c1 nmdc:mga00v17_4490_c1_1812_2789 252
54 3300050493 nmdc:mga0k408_2408_c1 nmdc:mga0k408_2408_c1_1142_2119 252
55 3300050507 nmdc:mga05p37_148901_c1 nmdc:mga05p37_148901_c1_922_1929 252
56 3300050510 nmdc:mga06r32_479484_c1 nmdc:mga06r32_479484_c1_175_1161 252
57 3300050512 nmdc:mga0n895_79449_c1 nmdc:mga0n895_79449_c1_1133_2140 252
58 3300053147 Ga0500589_072464 Ga0500589_072464_346_1326 252
59 3300053151 Ga0500604_0030341 Ga0500604_0030341_586_1566 252
60 3300060353 Ga0501082_0000013 Ga0501082_0000013_80136_81116 252
61 3300003203 JGI25406J46586_10009736 JGI25406J46586_100097363 253
62 3300005985 Ga0081539_10008542 Ga0081539_100085424 253
63 3300006871 Ga0075434_100171810 Ga0075434_1001718102 253
64 3300050512 nmdc:mga0n895_56995_c1 nmdc:mga0n895_56995_c1_521_1519 253
65 3300005340 Ga0070689_100063151 Ga0070689_1000631513 254
66 3300005343 Ga0070687_100094904 Ga0070687_1000949042 254
67 3300005466 Ga0070685_10023443 Ga0070685_100234434 254
68 3300006880 Ga0075429_100128342 Ga0075429_1001283422 254
69 3300009098 Ga0105245_10131013 Ga0105245_101310132 254
70 3300025927 Ga0207687_10030379 Ga0207687_100303792 254
71 3300025936 Ga0207670_10027140 Ga0207670_100271402 254
72 3300026023 Ga0207677_10229464 Ga0207677_102294642 254
73 3300026118 Ga0207675_100191507 Ga0207675_1001915072 254
74 3300050508 nmdc:mga09592_49791_c1 nmdc:mga09592_49791_c1_2067_3053 254
75 3300005329 Ga0070683_100131327 Ga0070683_1001313271 255
76 3300005338 Ga0068868_100239938 Ga0068868_1002399382 255
77 3300005340 Ga0070689_100086925 Ga0070689_1000869253 255
78 3300005438 Ga0070701_10203237 Ga0070701_102032371 255
79 3300005535 Ga0070684_100031662 Ga0070684_1000316622 255
80 3300005549 Ga0070704_100314933 Ga0070704_1003149331 255
81 3300005617 Ga0068859_100259579 Ga0068859_1002595792 255
82 3300005618 Ga0068864_100444139 Ga0068864_1004441392 255
83 3300005841 Ga0068863_100107195 Ga0068863_1001071952 255
84 3300006931 Ga0097620_100259577 Ga0097620_1002595772 255
85 3300009551 Ga0105238_10011216 Ga0105238_100112168 255
86 3300025907 Ga0207645_10063209 Ga0207645_100632092 255
87 3300025911 Ga0207654_10196411 Ga0207654_101964111 255
88 3300025924 Ga0207694_10044775 Ga0207694_100447752 255
89 3300025931 Ga0207644_10120249 Ga0207644_101202492 255
90 3300026075 Ga0207708_10115624 Ga0207708_101156242 255
91 3300026095 Ga0207676_10100203 Ga0207676_101002031 255
92 3300026116 Ga0207674_10082603 Ga0207674_100826033 255
93 3300035691 Ga0373931_0346212 Ga0373931_0346212_11_898 255
94 3300005290 Ga0065712_10026023 Ga0065712_100260231 256
95 3300005367 Ga0070667_100128914 Ga0070667_1001289143 256
96 3300025926 Ga0207659_10139648 Ga0207659_101396482 256
97 3300025933 Ga0207706_10064354 Ga0207706_100643543 256
98 3300025986 Ga0207658_10034444 Ga0207658_100344443 256
99 3300026089 Ga0207648_10167995 Ga0207648_101679952 256
100 3300026121 Ga0207683_10327574 Ga0207683_103275742 256
101 3300046537 Ga0495598_0021953 Ga0495598_0021953_618_1595 256
102 3300048090 Ga0495615_0025543 Ga0495615_0025543_153_1130 256
103 3300005334 Ga0068869_100181230 Ga0068869_1001812302 257
104 3300005617 Ga0068859_100104533 Ga0068859_1001045333 257
105 3300005618 Ga0068864_100053465 Ga0068864_1000534652 257
106 3300005842 Ga0068858_100173525 Ga0068858_1001735252 257
107 3300005844 Ga0068862_100256818 Ga0068862_1002568182 257
108 3300006852 Ga0075433_10006137 Ga0075433_100061375 257
109 3300006871 Ga0075434_100001159 Ga0075434_10000115915 257
110 3300006914 Ga0075436_100002192 Ga0075436_1000021925 257
111 3300006931 Ga0097620_100104537 Ga0097620_1001045372 257
112 3300007076 Ga0075435_100000432 Ga0075435_10000043225 257
113 3300009094 Ga0111539_10019998 Ga0111539_100199982 257
114 3300026035 Ga0207703_10195052 Ga0207703_101950522 257
115 3300026095 Ga0207676_10127208 Ga0207676_101272082 257
116 3300050511 nmdc:mga08y16_9215_c1 nmdc:mga08y16_9215_c1_6155_7123 257
117 3300050512 nmdc:mga0n895_4696_c1 nmdc:mga0n895_4696_c1_8343_9311 257
118 3300050513 nmdc:mga0rr50_1966_c1 nmdc:mga0rr50_1966_c1_8483_9451 257
119 3300050514 nmdc:mga08x19_1133_c1 nmdc:mga08x19_1133_c1_6710_7678 257
120 3300050515 nmdc:mga0a205_1921_c1 nmdc:mga0a205_1921_c1_9307_10275 257
121 3300006852 Ga0075433_10218749 Ga0075433_102187492 258
122 3300005545 Ga0070695_100110603 Ga0070695_1001106032 259
123 3300042876 Ga0451577_0147580 Ga0451577_0147580_857_1825 259
124 3300045051 Ga0451576_0017130 Ga0451576_0017130_5951_6919 259
125 3300005293 Ga0065715_10094907 Ga0065715_100949074 260
126 3300005546 Ga0070696_100029222 Ga0070696_1000292221 260
127 3300035207 Ga0373942_0056815 Ga0373942_0056815_37_885 260
128 3300050515 nmdc:mga0a205_212511_c1 nmdc:mga0a205_212511_c1_483_1331 260
129 3300005436 Ga0070713_100064124 Ga0070713_1000641242 262
130 3300006871 Ga0075434_100096480 Ga0075434_1000964803 262
131 3300025916 Ga0207663_10119841 Ga0207663_101198411 262
132 3300025928 Ga0207700_10083953 Ga0207700_100839533 262
133 3300025929 Ga0207664_10205112 Ga0207664_102051122 262
134 3300028800 Ga0265338_10020616 Ga0265338_100206162 262
135 3300031090 Ga0265760_10071838 Ga0265760_100718381 262
136 3300031249 Ga0265339_10000107 Ga0265339_1000010764 262
137 3300035111 Ga0373923_0053917 Ga0373923_0053917_292_1296 262
138 3300036401 Ga0373937_0160827 Ga0373937_0160827_1044_2036 262
139 3300044694 Ga0466963_0046783 Ga0466963_0046783_758_1744 262
140 3300044735 Ga0466968_0091790 Ga0466968_0091790_309_1301 262
141 3300045049 Ga0466959_0065728 Ga0466959_0065728_1030_2016 262
142 3300045836 Ga0466958_0076835 Ga0466958_0076835_58_1044 262
143 3300046529 Ga0495652_0154159 Ga0495652_0154159_695_1687 262
144 3300046680 Ga0495646_0002316 Ga0495646_0002316_9392_10375 262
145 3300047319 Ga0495674_0214125 Ga0495674_0214125_93_1085 262
146 3300047322 Ga0495680_0273037 Ga0495680_0273037_103_1095 262
147 3300049575 Ga0501039_0163702 Ga0501039_0163702_167_1156 262
148 3300049577 Ga0501041_0288703 Ga0501041_0288703_56_1021 262
149 3300049585 Ga0501069_0038797 Ga0501069_0038797_676_1665 262
150 3300049592 Ga0501076_0064247 Ga0501076_0064247_481_1470 262
151 3300049744 Ga0501083_0063014 Ga0501083_0063014_503_1492 262
152 2162886006 SwRhRL3b_contig_149540 SwRhRL3b_0814.00002160 263
153 2209111006 2214772980 2213792851 263
154 3300000041 ARcpr5oldR_c000026 ARcpr5oldR_00002613 263
155 3300000042 ARSoilYngRDRAFT_c00029 ARSoilYngRDRAFT_0002913 263
156 3300000043 ARcpr5yngRDRAFT_c000044 ARcpr5yngRDRAFT_00004413 263
157 3300000044 ARSoilOldRDRAFT_c000037 ARSoilOldRDRAFT_00003721 263
158 3300000652 ARCol0yngRDRAFT_1000020 ARCol0yngRDRAFT_100002013 263
159 3300001978 JGI24747J21853_1003341 JGI24747J21853_10033412 263
160 3300001989 JGI24739J22299_10004550 JGI24739J22299_100045507 263
161 3300001989 JGI24739J22299_10008850 JGI24739J22299_100088504 263
162 3300001990 JGI24737J22298_10001930 JGI24737J22298_100019302 263
163 3300001990 JGI24737J22298_10004430 JGI24737J22298_100044305 263
164 3300002070 JGI24750J21931_1000586 JGI24750J21931_10005867 263
165 3300002070 JGI24750J21931_1004848 JGI24750J21931_10048482 263
166 3300002073 JGI24745J21846_1000864 JGI24745J21846_10008641 263
167 3300002074 JGI24748J21848_1002686 JGI24748J21848_10026862 263
168 3300002075 JGI24738J21930_10002565 JGI24738J21930_100025652 263
169 3300002076 JGI24749J21850_1001223 JGI24749J21850_10012233 263
170 3300002077 JGI24744J21845_10000745 JGI24744J21845_100007457 263
171 3300002155 JGI24033J26618_1004836 JGI24033J26618_10048362 263
172 3300002239 JGI24034J26672_10009358 JGI24034J26672_100093582 263
173 3300002244 JGI24742J22300_10000139 JGI24742J22300_1000013913 263
174 3300002244 JGI24742J22300_10013412 JGI24742J22300_100134121 263
175 3300003911 JGI25405J52794_10030165 JGI25405J52794_100301651 263
176 3300005276 Ga0065717_1002108 Ga0065717_10021082 263
177 3300005277 Ga0065716_1001673 Ga0065716_10016732 263
178 3300005289 Ga0065704_10089952 Ga0065704_100899522 263
179 3300005289 Ga0065704_10118765 Ga0065704_101187652 263
180 3300005290 Ga0065712_10071735 Ga0065712_100717354 263
181 3300005290 Ga0065712_10077193 Ga0065712_100771931 263
182 3300005290 Ga0065712_10079021 Ga0065712_100790212 263
183 3300005290 Ga0065712_10109644 Ga0065712_101096442 263
184 3300005293 Ga0065715_10092917 Ga0065715_100929171 263
185 3300005293 Ga0065715_10113387 Ga0065715_101133873 263
186 3300005295 Ga0065707_10015385 Ga0065707_100153852 263
187 3300005295 Ga0065707_10113495 Ga0065707_101134952 263
188 3300005295 Ga0065707_10126631 Ga0065707_101266312 263
189 3300005327 Ga0070658_10087550 Ga0070658_100875502 263
190 3300005328 Ga0070676_10001078 Ga0070676_100010785 263
191 3300005328 Ga0070676_10054636 Ga0070676_100546362 263
192 3300005328 Ga0070676_10122285 Ga0070676_101222852 263
193 3300005329 Ga0070683_100007390 Ga0070683_1000073904 263
194 3300005329 Ga0070683_100290541 Ga0070683_1002905412 263
195 3300005330 Ga0070690_100020059 Ga0070690_1000200593 263
196 3300005330 Ga0070690_100023267 Ga0070690_1000232673 263
197 3300005330 Ga0070690_100052599 Ga0070690_1000525992 263
198 3300005330 Ga0070690_100080239 Ga0070690_1000802392 263
199 3300005330 Ga0070690_100115033 Ga0070690_1001150332 263
200 3300005331 Ga0070670_100037546 Ga0070670_1000375464 263
201 3300005331 Ga0070670_100211992 Ga0070670_1002119922 263
202 3300005331 Ga0070670_100249424 Ga0070670_1002494241 263
203 3300005333 Ga0070677_10000009 Ga0070677_100000092 263
204 3300005334 Ga0068869_100023901 Ga0068869_1000239012 263
205 3300005334 Ga0068869_100062092 Ga0068869_1000620922 263
206 3300005335 Ga0070666_10087321 Ga0070666_100873212 263
207 3300005335 Ga0070666_10257883 Ga0070666_102578832 263
208 3300005336 Ga0070680_100004715 Ga0070680_1000047155 263
209 3300005336 Ga0070680_100069756 Ga0070680_1000697563 263
210 3300005336 Ga0070680_100081718 Ga0070680_1000817182 263
211 3300005336 Ga0070680_100412129 Ga0070680_1004121291 263
212 3300005337 Ga0070682_100001091 Ga0070682_10000109119 263
213 3300005337 Ga0070682_100049089 Ga0070682_1000490892 263
214 3300005337 Ga0070682_100127156 Ga0070682_1001271562 263
215 3300005338 Ga0068868_100037790 Ga0068868_1000377904 263
216 3300005338 Ga0068868_100261789 Ga0068868_1002617892 263
217 3300005339 Ga0070660_100001398 Ga0070660_1000013989 263
218 3300005339 Ga0070660_100144322 Ga0070660_1001443222 263
219 3300005339 Ga0070660_100196169 Ga0070660_1001961691 263
220 3300005339 Ga0070660_100231278 Ga0070660_1002312781 263
221 3300005340 Ga0070689_100008504 Ga0070689_1000085044 263
222 3300005340 Ga0070689_100044808 Ga0070689_1000448083 263
223 3300005341 Ga0070691_10000769 Ga0070691_100007698 263
224 3300005341 Ga0070691_10002420 Ga0070691_100024208 263
225 3300005343 Ga0070687_100000649 Ga0070687_1000006492 263
226 3300005343 Ga0070687_100071219 Ga0070687_1000712192 263
227 3300005343 Ga0070687_100119767 Ga0070687_1001197671 263
228 3300005344 Ga0070661_100001076 Ga0070661_10000107620 263
229 3300005344 Ga0070661_100289923 Ga0070661_1002899231 263
230 3300005345 Ga0070692_10015532 Ga0070692_100155323 263
231 3300005347 Ga0070668_100012317 Ga0070668_1000123171 263
232 3300005353 Ga0070669_100005888 Ga0070669_1000058884 263
233 3300005353 Ga0070669_100042372 Ga0070669_1000423721 263
234 3300005353 Ga0070669_100271323 Ga0070669_1002713231 263
235 3300005354 Ga0070675_100000727 Ga0070675_10000072723 263
236 3300005354 Ga0070675_100102688 Ga0070675_1001026882 263
237 3300005355 Ga0070671_100000438 Ga0070671_10000043815 263
238 3300005356 Ga0070674_100001976 Ga0070674_1000019768 263
239 3300005364 Ga0070673_100001186 Ga0070673_1000011868 263
240 3300005364 Ga0070673_100291181 Ga0070673_1002911811 263
241 3300005365 Ga0070688_100022325 Ga0070688_1000223251 263
242 3300005365 Ga0070688_100060450 Ga0070688_1000604502 263
243 3300005365 Ga0070688_100075351 Ga0070688_1000753512 263
244 3300005365 Ga0070688_100203341 Ga0070688_1002033411 263
245 3300005365 Ga0070688_100320875 Ga0070688_1003208751 263
246 3300005366 Ga0070659_100005874 Ga0070659_1000058744 263
247 3300005366 Ga0070659_100019477 Ga0070659_1000194775 263
248 3300005366 Ga0070659_100058285 Ga0070659_1000582854 263
249 3300005367 Ga0070667_100005963 Ga0070667_1000059634 263
250 3300005367 Ga0070667_100199136 Ga0070667_1001991361 263
251 3300005406 Ga0070703_10002528 Ga0070703_100025285 263
252 3300005434 Ga0070709_10107117 Ga0070709_101071172 263
253 3300005434 Ga0070709_10112306 Ga0070709_101123062 263
254 3300005435 Ga0070714_100036372 Ga0070714_1000363722 263
255 3300005435 Ga0070714_100055527 Ga0070714_1000555271 263
256 3300005435 Ga0070714_100137127 Ga0070714_1001371272 263
257 3300005435 Ga0070714_100502951 Ga0070714_1005029511 263
258 3300005436 Ga0070713_100005553 Ga0070713_1000055532 263
259 3300005436 Ga0070713_100015791 Ga0070713_1000157911 263
260 3300005436 Ga0070713_100028859 Ga0070713_1000288594 263
261 3300005436 Ga0070713_100174721 Ga0070713_1001747212 263
262 3300005437 Ga0070710_10010566 Ga0070710_100105663 263
263 3300005437 Ga0070710_10204869 Ga0070710_102048691 263
264 3300005438 Ga0070701_10000339 Ga0070701_100003398 263
265 3300005438 Ga0070701_10037392 Ga0070701_100373922 263
266 3300005438 Ga0070701_10054327 Ga0070701_100543272 263
267 3300005438 Ga0070701_10095736 Ga0070701_100957361 263
268 3300005438 Ga0070701_10146773 Ga0070701_101467731 263
269 3300005439 Ga0070711_100027442 Ga0070711_1000274422 263
270 3300005439 Ga0070711_100073831 Ga0070711_1000738311 263
271 3300005439 Ga0070711_100199809 Ga0070711_1001998092 263
272 3300005439 Ga0070711_100253768 Ga0070711_1002537682 263
273 3300005440 Ga0070705_100000010 Ga0070705_10000001045 263
274 3300005440 Ga0070705_100005352 Ga0070705_1000053528 263
275 3300005441 Ga0070700_100000783 Ga0070700_10000078311 263
276 3300005441 Ga0070700_100022570 Ga0070700_1000225703 263
277 3300005441 Ga0070700_100036344 Ga0070700_1000363442 263
278 3300005444 Ga0070694_100006633 Ga0070694_1000066335 263
279 3300005444 Ga0070694_100120006 Ga0070694_1001200062 263
280 3300005444 Ga0070694_100268004 Ga0070694_1002680041 263
281 3300005445 Ga0070708_100466820 Ga0070708_1004668201 263
282 3300005445 Ga0070708_100544493 Ga0070708_1005444931 263
283 3300005455 Ga0070663_100006904 Ga0070663_1000069046 263
284 3300005455 Ga0070663_100017471 Ga0070663_1000174712 263
285 3300005455 Ga0070663_100025858 Ga0070663_1000258582 263
286 3300005455 Ga0070663_100028384 Ga0070663_1000283843 263
287 3300005455 Ga0070663_100033005 Ga0070663_1000330052 263
288 3300005455 Ga0070663_100039036 Ga0070663_1000390362 263
289 3300005455 Ga0070663_100284134 Ga0070663_1002841341 263
290 3300005456 Ga0070678_100011564 Ga0070678_1000115644 263
291 3300005456 Ga0070678_100092572 Ga0070678_1000925722 263
292 3300005456 Ga0070678_100237424 Ga0070678_1002374242 263
293 3300005456 Ga0070678_100248890 Ga0070678_1002488902 263
294 3300005457 Ga0070662_100017941 Ga0070662_1000179413 263
295 3300005457 Ga0070662_100103866 Ga0070662_1001038662 263
296 3300005458 Ga0070681_10070525 Ga0070681_100705252 263
297 3300005458 Ga0070681_10081473 Ga0070681_100814732 263
298 3300005458 Ga0070681_10222552 Ga0070681_102225522 263
299 3300005458 Ga0070681_10245025 Ga0070681_102450252 263
300 3300005459 Ga0068867_100021953 Ga0068867_1000219534 263
301 3300005459 Ga0068867_100363538 Ga0068867_1003635382 263
302 3300005466 Ga0070685_10005962 Ga0070685_100059621 263
303 3300005466 Ga0070685_10022940 Ga0070685_100229402 263
304 3300005466 Ga0070685_10097760 Ga0070685_100977602 263
305 3300005468 Ga0070707_100160119 Ga0070707_1001601192 263
306 3300005471 Ga0070698_100079534 Ga0070698_1000795342 263
307 3300005518 Ga0070699_100001314 Ga0070699_1000013145 263
308 3300005530 Ga0070679_100009564 Ga0070679_1000095649 263
309 3300005530 Ga0070679_100021002 Ga0070679_1000210028 263
310 3300005530 Ga0070679_100050983 Ga0070679_1000509834 263
311 3300005530 Ga0070679_100127315 Ga0070679_1001273152 263
312 3300005530 Ga0070679_100134755 Ga0070679_1001347551 263
313 3300005535 Ga0070684_100034741 Ga0070684_1000347412 263
314 3300005535 Ga0070684_100161110 Ga0070684_1001611102 263
315 3300005536 Ga0070697_100039300 Ga0070697_1000393004 263
316 3300005536 Ga0070697_100201176 Ga0070697_1002011761 263
317 3300005539 Ga0068853_100004375 Ga0068853_1000043757 263
318 3300005539 Ga0068853_100594483 Ga0068853_1005944831 263
319 3300005543 Ga0070672_100011149 Ga0070672_1000111491 263
320 3300005543 Ga0070672_100022463 Ga0070672_1000224634 263
321 3300005544 Ga0070686_100006762 Ga0070686_1000067628 263
322 3300005544 Ga0070686_100028126 Ga0070686_1000281262 263
323 3300005545 Ga0070695_100001719 Ga0070695_1000017198 263
324 3300005545 Ga0070695_100012898 Ga0070695_1000128982 263
325 3300005545 Ga0070695_100152637 Ga0070695_1001526372 263
326 3300005546 Ga0070696_100002812 Ga0070696_1000028126 263
327 3300005546 Ga0070696_100045814 Ga0070696_1000458143 263
328 3300005546 Ga0070696_100127308 Ga0070696_1001273082 263
329 3300005547 Ga0070693_100000577 Ga0070693_10000057713 263
330 3300005547 Ga0070693_100010134 Ga0070693_1000101345 263
331 3300005547 Ga0070693_100023786 Ga0070693_1000237863 263
332 3300005547 Ga0070693_100122989 Ga0070693_1001229892 263
333 3300005547 Ga0070693_100236167 Ga0070693_1002361671 263
334 3300005548 Ga0070665_100072419 Ga0070665_1000724192 263
335 3300005548 Ga0070665_100240155 Ga0070665_1002401552 263
336 3300005549 Ga0070704_100008088 Ga0070704_1000080882 263
337 3300005549 Ga0070704_100013846 Ga0070704_1000138463 263
338 3300005549 Ga0070704_100028556 Ga0070704_1000285561 263
339 3300005549 Ga0070704_100126371 Ga0070704_1001263712 263
340 3300005549 Ga0070704_100303866 Ga0070704_1003038661 263
341 3300005563 Ga0068855_100014148 Ga0068855_1000141486 263
342 3300005563 Ga0068855_100021980 Ga0068855_1000219807 263
343 3300005563 Ga0068855_100031300 Ga0068855_1000313003 263
344 3300005563 Ga0068855_100185531 Ga0068855_1001855311 263
345 3300005563 Ga0068855_100437051 Ga0068855_1004370511 263
346 3300005564 Ga0070664_100002073 Ga0070664_1000020734 263
347 3300005564 Ga0070664_100070153 Ga0070664_1000701532 263
348 3300005564 Ga0070664_100145517 Ga0070664_1001455172 263
349 3300005564 Ga0070664_100284498 Ga0070664_1002844982 263
350 3300005564 Ga0070664_100424861 Ga0070664_1004248612 263
351 3300005577 Ga0068857_100008536 Ga0068857_1000085361 263
352 3300005577 Ga0068857_100011549 Ga0068857_1000115492 263
353 3300005577 Ga0068857_100101644 Ga0068857_1001016442 263
354 3300005577 Ga0068857_100313354 Ga0068857_1003133542 263
355 3300005578 Ga0068854_100153463 Ga0068854_1001534632 263
356 3300005614 Ga0068856_100271248 Ga0068856_1002712481 263
357 3300005614 Ga0068856_100506165 Ga0068856_1005061651 263
358 3300005614 Ga0068856_100578229 Ga0068856_1005782291 263
359 3300005615 Ga0070702_100005245 Ga0070702_1000052458 263
360 3300005615 Ga0070702_100023173 Ga0070702_1000231734 263
361 3300005616 Ga0068852_100001086 Ga0068852_10000108613 263
362 3300005616 Ga0068852_100054483 Ga0068852_1000544834 263
363 3300005616 Ga0068852_100089360 Ga0068852_1000893602 263
364 3300005617 Ga0068859_100023234 Ga0068859_1000232344 263
365 3300005617 Ga0068859_100047095 Ga0068859_1000470952 263
366 3300005617 Ga0068859_100087792 Ga0068859_1000877922 263
367 3300005617 Ga0068859_100231880 Ga0068859_1002318801 263
368 3300005617 Ga0068859_100307236 Ga0068859_1003072362 263
369 3300005618 Ga0068864_100017473 Ga0068864_1000174735 263
370 3300005618 Ga0068864_100021486 Ga0068864_1000214864 263
371 3300005618 Ga0068864_100025772 Ga0068864_1000257724 263
372 3300005618 Ga0068864_100138872 Ga0068864_1001388722 263
373 3300005718 Ga0068866_10000403 Ga0068866_1000040321 263
374 3300005718 Ga0068866_10020659 Ga0068866_100206592 263
375 3300005719 Ga0068861_100001047 Ga0068861_10000104715 263
376 3300005719 Ga0068861_100201519 Ga0068861_1002015192 263
377 3300005840 Ga0068870_10000860 Ga0068870_100008608 263
378 3300005840 Ga0068870_10018357 Ga0068870_100183572 263
379 3300005841 Ga0068863_100003728 Ga0068863_1000037284 263
380 3300005841 Ga0068863_100046330 Ga0068863_1000463302 263
381 3300005842 Ga0068858_100032605 Ga0068858_1000326051 263
382 3300005842 Ga0068858_100051742 Ga0068858_1000517423 263
383 3300005842 Ga0068858_100098651 Ga0068858_1000986513 263
384 3300005842 Ga0068858_100283910 Ga0068858_1002839102 263
385 3300005843 Ga0068860_100013440 Ga0068860_1000134406 263
386 3300005843 Ga0068860_100023327 Ga0068860_1000233272 263
387 3300005843 Ga0068860_100036747 Ga0068860_1000367473 263
388 3300005843 Ga0068860_100038963 Ga0068860_1000389632 263
389 3300005844 Ga0068862_100003043 Ga0068862_1000030439 263
390 3300005844 Ga0068862_100024080 Ga0068862_1000240806 263
391 3300005844 Ga0068862_100041039 Ga0068862_1000410392 263
392 3300005844 Ga0068862_100068170 Ga0068862_1000681702 263
393 3300005937 Ga0081455_10000012 Ga0081455_10000012130 263
394 3300005937 Ga0081455_10007017 Ga0081455_1000701713 263
395 3300005937 Ga0081455_10016936 Ga0081455_100169366 263
396 3300005937 Ga0081455_10018308 Ga0081455_100183082 263
397 3300005937 Ga0081455_10048782 Ga0081455_100487822 263
398 3300005981 Ga0081538_10018338 Ga0081538_100183387 263
399 3300005981 Ga0081538_10059042 Ga0081538_100590421 263
400 3300005983 Ga0081540_1000185 Ga0081540_100018540 263
401 3300005983 Ga0081540_1002413 Ga0081540_10024137 263
402 3300005983 Ga0081540_1011112 Ga0081540_10111129 263
403 3300005983 Ga0081540_1048822 Ga0081540_10488222 263
404 3300006028 Ga0070717_10007114 Ga0070717_100071146 263
405 3300006028 Ga0070717_10010759 Ga0070717_100107594 263
406 3300006028 Ga0070717_10279432 Ga0070717_102794322 263
407 3300006038 Ga0075365_10041913 Ga0075365_100419132 263
408 3300006048 Ga0075363_100064023 Ga0075363_1000640232 263
409 3300006051 Ga0075364_10289916 Ga0075364_102899161 263
410 3300006058 Ga0075432_10001490 Ga0075432_100014907 263
411 3300006163 Ga0070715_10015144 Ga0070715_100151442 263
412 3300006163 Ga0070715_10043536 Ga0070715_100435362 263
413 3300006163 Ga0070715_10051397 Ga0070715_100513971 263
414 3300006163 Ga0070715_10100637 Ga0070715_101006371 263
415 3300006173 Ga0070716_100012292 Ga0070716_1000122922 263
416 3300006173 Ga0070716_100048777 Ga0070716_1000487772 263
417 3300006173 Ga0070716_100107036 Ga0070716_1001070362 263
418 3300006175 Ga0070712_100172611 Ga0070712_1001726112 263
419 3300006175 Ga0070712_100279375 Ga0070712_1002793752 263
420 3300006177 Ga0075362_10042644 Ga0075362_100426442 263
421 3300006194 Ga0075427_10001112 Ga0075427_100011122 263
422 3300006195 Ga0075366_10210171 Ga0075366_102101711 263
423 3300006237 Ga0097621_100000421 Ga0097621_1000004214 263
424 3300006237 Ga0097621_100008029 Ga0097621_1000080295 263
425 3300006237 Ga0097621_100043497 Ga0097621_1000434972 263
426 3300006237 Ga0097621_100081579 Ga0097621_1000815792 263
427 3300006358 Ga0068871_100000515 Ga0068871_10000051512 263
428 3300006358 Ga0068871_100012948 Ga0068871_1000129485 263
429 3300006358 Ga0068871_100109481 Ga0068871_1001094812 263
430 3300006844 Ga0075428_100007282 Ga0075428_1000072829 263
431 3300006844 Ga0075428_100013216 Ga0075428_1000132162 263
432 3300006844 Ga0075428_100124513 Ga0075428_1001245132 263
433 3300006844 Ga0075428_100124758 Ga0075428_1001247582 263
434 3300006844 Ga0075428_100138610 Ga0075428_1001386102 263
435 3300006844 Ga0075428_100280433 Ga0075428_1002804332 263
436 3300006844 Ga0075428_100377007 Ga0075428_1003770071 263
437 3300006846 Ga0075430_100021979 Ga0075430_1000219795 263
438 3300006846 Ga0075430_100026411 Ga0075430_1000264112 263
439 3300006846 Ga0075430_100028858 Ga0075430_1000288585 263
440 3300006846 Ga0075430_100085576 Ga0075430_1000855763 263
441 3300006847 Ga0075431_100001810 Ga0075431_10000181015 263
442 3300006847 Ga0075431_100002413 Ga0075431_1000024133 263
443 3300006847 Ga0075431_100003540 Ga0075431_10000354012 263
444 3300006847 Ga0075431_100072177 Ga0075431_1000721774 263
445 3300006847 Ga0075431_100082800 Ga0075431_1000828002 263
446 3300006847 Ga0075431_100109344 Ga0075431_1001093443 263
447 3300006847 Ga0075431_100143787 Ga0075431_1001437873 263
448 3300006852 Ga0075433_10002034 Ga0075433_100020348 263
449 3300006852 Ga0075433_10008633 Ga0075433_100086334 263
450 3300006852 Ga0075433_10036232 Ga0075433_100362324 263
451 3300006852 Ga0075433_10097947 Ga0075433_100979473 263
452 3300006852 Ga0075433_10203189 Ga0075433_102031893 263
453 3300006871 Ga0075434_100000007 Ga0075434_10000000793 263
454 3300006871 Ga0075434_100000693 Ga0075434_10000069320 263
455 3300006871 Ga0075434_100005025 Ga0075434_1000050253 263
456 3300006871 Ga0075434_100082088 Ga0075434_1000820882 263
457 3300006871 Ga0075434_100215803 Ga0075434_1002158031 263
458 3300006871 Ga0075434_100260622 Ga0075434_1002606221 263
459 3300006871 Ga0075434_100313884 Ga0075434_1003138842 263
460 3300006880 Ga0075429_100004783 Ga0075429_10000478312 263
461 3300006880 Ga0075429_100006663 Ga0075429_1000066638 263
462 3300006880 Ga0075429_100026387 Ga0075429_1000263875 263
463 3300006880 Ga0075429_100119201 Ga0075429_1001192012 263
464 3300006880 Ga0075429_100430059 Ga0075429_1004300591 263
465 3300006881 Ga0068865_100002115 Ga0068865_1000021158 263
466 3300006881 Ga0068865_100156928 Ga0068865_1001569282 263
467 3300006914 Ga0075436_100037473 Ga0075436_1000374733 263
468 3300006914 Ga0075436_100167778 Ga0075436_1001677782 263
469 3300006914 Ga0075436_100226373 Ga0075436_1002263731 263
470 3300006931 Ga0097620_100023234 Ga0097620_1000232344 263
471 3300006931 Ga0097620_100047094 Ga0097620_1000470942 263
472 3300006931 Ga0097620_100087787 Ga0097620_1000877872 263
473 3300006931 Ga0097620_100231869 Ga0097620_1002318691 263
474 3300006931 Ga0097620_100307236 Ga0097620_1003072362 263
475 3300007076 Ga0075435_100025823 Ga0075435_1000258233 263
476 3300007076 Ga0075435_100026492 Ga0075435_1000264922 263
477 3300007076 Ga0075435_100049630 Ga0075435_1000496303 263
478 3300007076 Ga0075435_100150894 Ga0075435_1001508942 263
479 3300007076 Ga0075435_100172380 Ga0075435_1001723802 263
480 3300007265 Ga0099794_10058103 Ga0099794_100581032 263
481 3300007788 Ga0099795_10011526 Ga0099795_100115264 263
482 3300007788 Ga0099795_10018796 Ga0099795_100187962 263
483 3300009011 Ga0105251_10040087 Ga0105251_100400873 263
484 3300009011 Ga0105251_10053918 Ga0105251_100539182 263
485 3300009036 Ga0105244_10161476 Ga0105244_101614761 263
486 3300009093 Ga0105240_10037315 Ga0105240_100373157 263
487 3300009093 Ga0105240_10154042 Ga0105240_101540422 263
488 3300009094 Ga0111539_10004448 Ga0111539_1000444811 263
489 3300009094 Ga0111539_10005607 Ga0111539_100056078 263
490 3300009094 Ga0111539_10013539 Ga0111539_100135397 263
491 3300009094 Ga0111539_10017591 Ga0111539_100175918 263
492 3300009094 Ga0111539_10022696 Ga0111539_100226967 263
493 3300009094 Ga0111539_10029537 Ga0111539_100295373 263
494 3300009094 Ga0111539_10146086 Ga0111539_101460863 263
495 3300009094 Ga0111539_10279279 Ga0111539_102792792 263
496 3300009094 Ga0111539_10420466 Ga0111539_104204661 263
497 3300009094 Ga0111539_10512699 Ga0111539_105126992 263
498 3300009094 Ga0111539_10572289 Ga0111539_105722892 263
499 3300009094 Ga0111539_10722476 Ga0111539_107224762 263
500 3300009098 Ga0105245_10029148 Ga0105245_100291484 263
501 3300009098 Ga0105245_10145527 Ga0105245_101455272 263
502 3300009098 Ga0105245_10265153 Ga0105245_102651532 263
503 3300009101 Ga0105247_10012837 Ga0105247_100128375 263
504 3300009101 Ga0105247_10013130 Ga0105247_100131305 263
505 3300009147 Ga0114129_10000742 Ga0114129_1000074236 263
506 3300009147 Ga0114129_10059035 Ga0114129_100590352 263
507 3300009147 Ga0114129_10105879 Ga0114129_101058795 263
508 3300009147 Ga0114129_10179865 Ga0114129_101798652 263
509 3300009147 Ga0114129_10212542 Ga0114129_102125423 263
510 3300009147 Ga0114129_10293458 Ga0114129_102934582 263
511 3300009147 Ga0114129_10643719 Ga0114129_106437191 263
512 3300009148 Ga0105243_10002574 Ga0105243_100025748 263
513 3300009148 Ga0105243_10011951 Ga0105243_100119515 263
514 3300009174 Ga0105241_10111008 Ga0105241_101110081 263
515 3300009174 Ga0105241_10244434 Ga0105241_102444342 263
516 3300009174 Ga0105241_10299267 Ga0105241_102992672 263
517 3300009176 Ga0105242_10004599 Ga0105242_1000459911 263
518 3300009176 Ga0105242_10110869 Ga0105242_101108692 263
519 3300009177 Ga0105248_10000821 Ga0105248_100008213 263
520 3300009177 Ga0105248_10076409 Ga0105248_100764092 263
521 3300009177 Ga0105248_10084997 Ga0105248_100849972 263
522 3300009177 Ga0105248_10121013 Ga0105248_101210133 263
523 3300009545 Ga0105237_10042956 Ga0105237_100429564 263
524 3300009545 Ga0105237_10128596 Ga0105237_101285962 263
525 3300009545 Ga0105237_10298174 Ga0105237_102981741 263
526 3300009545 Ga0105237_10364152 Ga0105237_103641521 263
527 3300009551 Ga0105238_10009936 Ga0105238_1000993610 263
528 3300009551 Ga0105238_10226060 Ga0105238_102260601 263
529 3300009551 Ga0105238_10272723 Ga0105238_102727232 263
530 3300009553 Ga0105249_10015879 Ga0105249_100158794 263
531 3300009553 Ga0105249_10017602 Ga0105249_100176025 263
532 3300009553 Ga0105249_10084737 Ga0105249_100847372 263
533 3300009553 Ga0105249_10197852 Ga0105249_101978522 263
534 3300009553 Ga0105249_10510758 Ga0105249_105107582 263
535 3300010375 Ga0105239_10004537 Ga0105239_100045378 263
536 3300010375 Ga0105239_10196874 Ga0105239_101968743 263
537 3300010375 Ga0105239_10286295 Ga0105239_102862952 263
538 3300010375 Ga0105239_10446827 Ga0105239_104468272 263
539 3300011119 Ga0105246_10001092 Ga0105246_1000109211 263
540 3300011119 Ga0105246_10097849 Ga0105246_100978491 263
541 3300012492 Ga0157335_1001950 Ga0157335_10019501 263
542 3300013102 Ga0157371_10007315 Ga0157371_100073154 263
543 3300013104 Ga0157370_10056317 Ga0157370_100563171 263
544 3300013104 Ga0157370_10241917 Ga0157370_102419172 263
545 3300013296 Ga0157374_10002049 Ga0157374_1000204918 263
546 3300013296 Ga0157374_10032857 Ga0157374_100328572 263
547 3300013296 Ga0157374_10427440 Ga0157374_104274401 263
548 3300013297 Ga0157378_10007541 Ga0157378_100075414 263
549 3300013306 Ga0163162_10005029 Ga0163162_100050298 263
550 3300013306 Ga0163162_10046419 Ga0163162_100464192 263
551 3300013306 Ga0163162_10343621 Ga0163162_103436211 263
552 3300013306 Ga0163162_10517261 Ga0163162_105172612 263
553 3300013307 Ga0157372_10012748 Ga0157372_100127486 263
554 3300013307 Ga0157372_10362354 Ga0157372_103623542 263
555 3300013308 Ga0157375_10005227 Ga0157375_100052272 263
556 3300013308 Ga0157375_10019784 Ga0157375_100197842 263
557 3300014325 Ga0163163_10005574 Ga0163163_100055748 263
558 3300014325 Ga0163163_10049189 Ga0163163_100491894 263
559 3300014325 Ga0163163_10057095 Ga0163163_100570951 263
560 3300014325 Ga0163163_10065275 Ga0163163_100652752 263
561 3300014325 Ga0163163_10178827 Ga0163163_101788272 263
562 3300014325 Ga0163163_10384246 Ga0163163_103842462 263
563 3300014326 Ga0157380_10001279 Ga0157380_100012798 263
564 3300014326 Ga0157380_10057392 Ga0157380_100573922 263
565 3300014745 Ga0157377_10000312 Ga0157377_1000031216 263
566 3300014968 Ga0157379_10001989 Ga0157379_100019898 263
567 3300014968 Ga0157379_10063884 Ga0157379_100638842 263
568 3300014968 Ga0157379_10237266 Ga0157379_102372662 263
569 3300014969 Ga0157376_10001372 Ga0157376_1000137217 263
570 3300014969 Ga0157376_10019925 Ga0157376_100199255 263
571 3300014969 Ga0157376_10106846 Ga0157376_101068462 263
572 3300014969 Ga0157376_10278940 Ga0157376_102789402 263
573 3300014969 Ga0157376_10503392 Ga0157376_105033921 263
574 3300017792 Ga0163161_10003480 Ga0163161_100034808 263
575 3300017792 Ga0163161_10103438 Ga0163161_101034382 263
576 3300020070 Ga0206356_10050520 Ga0206356_100505202 263
577 3300025271 Ga0207666_1000038 Ga0207666_100003820 263
578 3300025271 Ga0207666_1000670 Ga0207666_10006703 263
579 3300025290 Ga0207673_1006959 Ga0207673_10069592 263
580 3300025297 Ga0209758_1000079 Ga0209758_1000079112 263
581 3300025315 Ga0207697_10000373 Ga0207697_1000037319 263
582 3300025315 Ga0207697_10017294 Ga0207697_100172942 263
583 3300025315 Ga0207697_10025362 Ga0207697_100253622 263
584 3300025315 Ga0207697_10084636 Ga0207697_100846361 263
585 3300025735 Ga0207713_1072809 Ga0207713_10728092 263
586 3300025885 Ga0207653_10000559 Ga0207653_100005592 263
587 3300025893 Ga0207682_10000071 Ga0207682_1000007121 263
588 3300025898 Ga0207692_10010499 Ga0207692_100104994 263
589 3300025898 Ga0207692_10050472 Ga0207692_100504722 263
590 3300025899 Ga0207642_10004072 Ga0207642_100040723 263
591 3300025899 Ga0207642_10010782 Ga0207642_100107823 263
592 3300025899 Ga0207642_10070749 Ga0207642_100707492 263
593 3300025900 Ga0207710_10007020 Ga0207710_100070202 263
594 3300025900 Ga0207710_10007122 Ga0207710_100071221 263
595 3300025900 Ga0207710_10093911 Ga0207710_100939111 263
596 3300025901 Ga0207688_10000237 Ga0207688_1000023711 263
597 3300025901 Ga0207688_10023508 Ga0207688_100235082 263
598 3300025903 Ga0207680_10037949 Ga0207680_100379491 263
599 3300025904 Ga0207647_10009005 Ga0207647_100090052 263
600 3300025904 Ga0207647_10064700 Ga0207647_100647002 263
601 3300025904 Ga0207647_10099247 Ga0207647_100992471 263
602 3300025904 Ga0207647_10110025 Ga0207647_101100252 263
603 3300025904 Ga0207647_10144254 Ga0207647_101442542 263
604 3300025904 Ga0207647_10145926 Ga0207647_101459261 263
605 3300025906 Ga0207699_10079821 Ga0207699_100798212 263
606 3300025906 Ga0207699_10127180 Ga0207699_101271801 263
607 3300025906 Ga0207699_10186277 Ga0207699_101862771 263
608 3300025907 Ga0207645_10000779 Ga0207645_1000077920 263
609 3300025907 Ga0207645_10028585 Ga0207645_100285852 263
610 3300025907 Ga0207645_10038461 Ga0207645_100384612 263
611 3300025907 Ga0207645_10079328 Ga0207645_100793282 263
612 3300025908 Ga0207643_10000276 Ga0207643_1000027610 263
613 3300025908 Ga0207643_10022449 Ga0207643_100224493 263
614 3300025909 Ga0207705_10077767 Ga0207705_100777673 263
615 3300025910 Ga0207684_10097682 Ga0207684_100976822 263
616 3300025911 Ga0207654_10014702 Ga0207654_100147024 263
617 3300025911 Ga0207654_10093334 Ga0207654_100933342 263
618 3300025911 Ga0207654_10244704 Ga0207654_102447041 263
619 3300025912 Ga0207707_10000454 Ga0207707_1000045418 263
620 3300025912 Ga0207707_10069691 Ga0207707_100696912 263
621 3300025912 Ga0207707_10083619 Ga0207707_100836192 263
622 3300025912 Ga0207707_10131233 Ga0207707_101312332 263
623 3300025913 Ga0207695_10364338 Ga0207695_103643381 263
624 3300025914 Ga0207671_10016484 Ga0207671_100164844 263
625 3300025914 Ga0207671_10037376 Ga0207671_100373762 263
626 3300025914 Ga0207671_10188217 Ga0207671_101882172 263
627 3300025915 Ga0207693_10005073 Ga0207693_100050735 263
628 3300025915 Ga0207693_10007312 Ga0207693_100073127 263
629 3300025915 Ga0207693_10010113 Ga0207693_100101133 263
630 3300025915 Ga0207693_10051746 Ga0207693_100517463 263
631 3300025915 Ga0207693_10073450 Ga0207693_100734502 263
632 3300025915 Ga0207693_10078058 Ga0207693_100780582 263
633 3300025915 Ga0207693_10085039 Ga0207693_100850392 263
634 3300025915 Ga0207693_10097721 Ga0207693_100977213 263
635 3300025916 Ga0207663_10061077 Ga0207663_100610772 263
636 3300025916 Ga0207663_10072881 Ga0207663_100728812 263
637 3300025917 Ga0207660_10000087 Ga0207660_100000879 263
638 3300025917 Ga0207660_10078775 Ga0207660_100787753 263
639 3300025917 Ga0207660_10107168 Ga0207660_101071682 263
640 3300025917 Ga0207660_10225179 Ga0207660_102251792 263
641 3300025918 Ga0207662_10000659 Ga0207662_1000065911 263
642 3300025918 Ga0207662_10009020 Ga0207662_100090204 263
643 3300025918 Ga0207662_10022432 Ga0207662_100224322 263
644 3300025918 Ga0207662_10109719 Ga0207662_101097191 263
645 3300025918 Ga0207662_10180772 Ga0207662_101807722 263
646 3300025919 Ga0207657_10003101 Ga0207657_1000310112 263
647 3300025919 Ga0207657_10005173 Ga0207657_100051739 263
648 3300025919 Ga0207657_10035321 Ga0207657_100353213 263
649 3300025919 Ga0207657_10051853 Ga0207657_100518533 263
650 3300025919 Ga0207657_10158047 Ga0207657_101580471 263
651 3300025919 Ga0207657_10167303 Ga0207657_101673031 263
652 3300025920 Ga0207649_10000662 Ga0207649_1000066211 263
653 3300025920 Ga0207649_10095650 Ga0207649_100956502 263
654 3300025920 Ga0207649_10127807 Ga0207649_101278072 263
655 3300025921 Ga0207652_10001908 Ga0207652_1000190815 263
656 3300025921 Ga0207652_10023549 Ga0207652_100235492 263
657 3300025923 Ga0207681_10001262 Ga0207681_100012625 263
658 3300025923 Ga0207681_10211519 Ga0207681_102115192 263
659 3300025924 Ga0207694_10017984 Ga0207694_100179843 263
660 3300025925 Ga0207650_10005107 Ga0207650_100051072 263
661 3300025925 Ga0207650_10377855 Ga0207650_103778551 263
662 3300025926 Ga0207659_10000143 Ga0207659_1000014321 263
663 3300025927 Ga0207687_10000865 Ga0207687_1000086518 263
664 3300025927 Ga0207687_10290565 Ga0207687_102905651 263
665 3300025927 Ga0207687_10315623 Ga0207687_103156231 263
666 3300025928 Ga0207700_10000323 Ga0207700_1000032320 263
667 3300025928 Ga0207700_10072896 Ga0207700_100728962 263
668 3300025928 Ga0207700_10145360 Ga0207700_101453602 263
669 3300025929 Ga0207664_10049417 Ga0207664_100494172 263
670 3300025929 Ga0207664_10104335 Ga0207664_101043352 263
671 3300025929 Ga0207664_10370743 Ga0207664_103707431 263
672 3300025931 Ga0207644_10000532 Ga0207644_1000053215 263
673 3300025931 Ga0207644_10042290 Ga0207644_100422902 263
674 3300025931 Ga0207644_10225091 Ga0207644_102250912 263
675 3300025932 Ga0207690_10000409 Ga0207690_1000040912 263
676 3300025933 Ga0207706_10001338 Ga0207706_1000133819 263
677 3300025933 Ga0207706_10006493 Ga0207706_100064932 263
678 3300025933 Ga0207706_10006705 Ga0207706_100067059 263
679 3300025933 Ga0207706_10046748 Ga0207706_100467483 263
680 3300025933 Ga0207706_10058641 Ga0207706_100586412 263
681 3300025934 Ga0207686_10000500 Ga0207686_1000050020 263
682 3300025934 Ga0207686_10042200 Ga0207686_100422003 263
683 3300025934 Ga0207686_10075339 Ga0207686_100753392 263
684 3300025935 Ga0207709_10001266 Ga0207709_1000126614 263
685 3300025935 Ga0207709_10050874 Ga0207709_100508742 263
686 3300025935 Ga0207709_10141359 Ga0207709_101413592 263
687 3300025936 Ga0207670_10007354 Ga0207670_100073541 263
688 3300025936 Ga0207670_10016040 Ga0207670_100160404 263
689 3300025936 Ga0207670_10083746 Ga0207670_100837462 263
690 3300025936 Ga0207670_10198058 Ga0207670_101980582 263
691 3300025937 Ga0207669_10001125 Ga0207669_100011257 263
692 3300025938 Ga0207704_10000613 Ga0207704_100006137 263
693 3300025939 Ga0207665_10001192 Ga0207665_1000119213 263
694 3300025939 Ga0207665_10003934 Ga0207665_100039346 263
695 3300025939 Ga0207665_10073486 Ga0207665_100734862 263
696 3300025939 Ga0207665_10319638 Ga0207665_103196381 263
697 3300025940 Ga0207691_10002493 Ga0207691_100024933 263
698 3300025940 Ga0207691_10003339 Ga0207691_1000333911 263
699 3300025940 Ga0207691_10130622 Ga0207691_101306221 263
700 3300025941 Ga0207711_10003987 Ga0207711_1000398711 263
701 3300025941 Ga0207711_10029326 Ga0207711_100293264 263
702 3300025941 Ga0207711_10050370 Ga0207711_100503704 263
703 3300025941 Ga0207711_10238615 Ga0207711_102386152 263
704 3300025941 Ga0207711_10286694 Ga0207711_102866942 263
705 3300025942 Ga0207689_10000440 Ga0207689_1000044020 263
706 3300025942 Ga0207689_10021598 Ga0207689_100215983 263
707 3300025942 Ga0207689_10273806 Ga0207689_102738061 263
708 3300025944 Ga0207661_10059018 Ga0207661_100590182 263
709 3300025944 Ga0207661_10061762 Ga0207661_100617622 263
710 3300025944 Ga0207661_10125939 Ga0207661_101259392 263
711 3300025944 Ga0207661_10150552 Ga0207661_101505522 263
712 3300025945 Ga0207679_10005990 Ga0207679_100059902 263
713 3300025945 Ga0207679_10016049 Ga0207679_100160492 263
714 3300025945 Ga0207679_10110913 Ga0207679_101109132 263
715 3300025949 Ga0207667_10018606 Ga0207667_100186068 263
716 3300025949 Ga0207667_10040968 Ga0207667_100409682 263
717 3300025960 Ga0207651_10000335 Ga0207651_100003358 263
718 3300025961 Ga0207712_10002448 Ga0207712_100024488 263
719 3300025961 Ga0207712_10004065 Ga0207712_100040655 263
720 3300025961 Ga0207712_10194903 Ga0207712_101949032 263
721 3300025972 Ga0207668_10000065 Ga0207668_100000658 263
722 3300025972 Ga0207668_10100099 Ga0207668_101000992 263
723 3300025972 Ga0207668_10176418 Ga0207668_101764182 263
724 3300025981 Ga0207640_10000339 Ga0207640_1000033912 263
725 3300025986 Ga0207658_10004428 Ga0207658_100044287 263
726 3300025986 Ga0207658_10185666 Ga0207658_101856662 263
727 3300025986 Ga0207658_10291234 Ga0207658_102912342 263
728 3300026023 Ga0207677_10003580 Ga0207677_100035808 263
729 3300026035 Ga0207703_10001885 Ga0207703_1000188521 263
730 3300026035 Ga0207703_10124556 Ga0207703_101245562 263
731 3300026041 Ga0207639_10041384 Ga0207639_100413844 263
732 3300026067 Ga0207678_10000944 Ga0207678_100009448 263
733 3300026067 Ga0207678_10006342 Ga0207678_100063422 263
734 3300026067 Ga0207678_10019284 Ga0207678_100192843 263
735 3300026067 Ga0207678_10036592 Ga0207678_100365922 263
736 3300026067 Ga0207678_10062862 Ga0207678_100628623 263
737 3300026075 Ga0207708_10002019 Ga0207708_100020198 263
738 3300026075 Ga0207708_10002166 Ga0207708_100021666 263
739 3300026075 Ga0207708_10033326 Ga0207708_100333262 263
740 3300026075 Ga0207708_10039810 Ga0207708_100398102 263
741 3300026075 Ga0207708_10126975 Ga0207708_101269752 263
742 3300026078 Ga0207702_10056555 Ga0207702_100565553 263
743 3300026088 Ga0207641_10005810 Ga0207641_100058102 263
744 3300026088 Ga0207641_10085777 Ga0207641_100857772 263
745 3300026089 Ga0207648_10004730 Ga0207648_1000473013 263
746 3300026089 Ga0207648_10049631 Ga0207648_100496313 263
747 3300026089 Ga0207648_10087607 Ga0207648_100876073 263
748 3300026095 Ga0207676_10008134 Ga0207676_100081342 263
749 3300026095 Ga0207676_10046203 Ga0207676_100462032 263
750 3300026116 Ga0207674_10003323 Ga0207674_100033236 263
751 3300026116 Ga0207674_10005364 Ga0207674_1000536411 263
752 3300026116 Ga0207674_10091204 Ga0207674_100912042 263
753 3300026118 Ga0207675_100000815 Ga0207675_10000081513 263
754 3300026118 Ga0207675_100011636 Ga0207675_1000116362 263
755 3300026118 Ga0207675_100081484 Ga0207675_1000814841 263
756 3300026118 Ga0207675_100175686 Ga0207675_1001756862 263
757 3300026121 Ga0207683_10000001 Ga0207683_10000001329 263
758 3300026121 Ga0207683_10074307 Ga0207683_100743073 263
759 3300026121 Ga0207683_10096807 Ga0207683_100968072 263
760 3300026121 Ga0207683_10124322 Ga0207683_101243222 263
761 3300026142 Ga0207698_10024447 Ga0207698_100244472 263
762 3300027364 Ga0209967_1000489 Ga0209967_10004895 263
763 3300027378 Ga0209981_1000830 Ga0209981_10008305 263
764 3300027395 Ga0209996_1008254 Ga0209996_10082542 263
765 3300027462 Ga0210000_1001264 Ga0210000_10012644 263
766 3300027526 Ga0209968_1006091 Ga0209968_10060912 263
767 3300027543 Ga0209999_1003822 Ga0209999_10038223 263
768 3300027682 Ga0209971_1014174 Ga0209971_10141742 263
769 3300027682 Ga0209971_1017209 Ga0209971_10172092 263
770 3300027695 Ga0209966_1000743 Ga0209966_10007435 263
771 3300027695 Ga0209966_1001998 Ga0209966_10019982 263
772 3300027717 Ga0209998_10001042 Ga0209998_100010424 263
773 3300027717 Ga0209998_10011704 Ga0209998_100117041 263
774 3300027876 Ga0209974_10050686 Ga0209974_100506862 263
775 3300027907 Ga0207428_10000172 Ga0207428_1000017210 263
776 3300027907 Ga0207428_10000255 Ga0207428_1000025531 263
777 3300027907 Ga0207428_10003313 Ga0207428_1000331311 263
778 3300027907 Ga0207428_10013736 Ga0207428_100137368 263
779 3300027907 Ga0207428_10016308 Ga0207428_100163081 263
780 3300027907 Ga0207428_10058144 Ga0207428_100581443 263
781 3300027907 Ga0207428_10142280 Ga0207428_101422802 263
782 3300028379 Ga0268266_10020037 Ga0268266_100200372 263
783 3300028379 Ga0268266_10128823 Ga0268266_101288232 263
784 3300028379 Ga0268266_10247664 Ga0268266_102476642 263
785 3300028380 Ga0268265_10009461 Ga0268265_100094615 263
786 3300028380 Ga0268265_10029653 Ga0268265_100296532 263
787 3300028381 Ga0268264_10001153 Ga0268264_1000115311 263
788 3300028381 Ga0268264_10006938 Ga0268264_100069384 263
789 3300028556 Ga0265337_1001632 Ga0265337_10016322 263
790 3300028556 Ga0265337_1029353 Ga0265337_10293532 263
791 3300028800 Ga0265338_10038131 Ga0265338_100381313 263
792 3300030763 Ga0265763_1000066 Ga0265763_10000662 263
793 3300031235 Ga0265330_10009242 Ga0265330_100092422 263
794 3300031235 Ga0265330_10014275 Ga0265330_100142752 263
795 3300031241 Ga0265325_10000320 Ga0265325_1000032010 263
796 3300031241 Ga0265325_10000901 Ga0265325_100009018 263
797 3300031241 Ga0265325_10001624 Ga0265325_100016246 263
798 3300031249 Ga0265339_10000387 Ga0265339_1000038713 263
799 3300031249 Ga0265339_10119541 Ga0265339_101195412 263
800 3300031250 Ga0265331_10024832 Ga0265331_100248322 263
801 3300031595 Ga0265313_10000850 Ga0265313_1000085018 263
802 3300031595 Ga0265313_10004004 Ga0265313_100040041 263
803 3300031711 Ga0265314_10007897 Ga0265314_100078972 263
804 3300031712 Ga0265342_10000196 Ga0265342_1000019663 263
805 3300034816 Ga0373930_0000014 Ga0373930_0000014_9334_10323 263
806 3300034817 Ga0373948_0000493 Ga0373948_0000493_3259_4248 263
807 3300034817 Ga0373948_0034839 Ga0373948_0034839_85_1020 263
808 3300034818 Ga0373950_0000145 Ga0373950_0000145_4778_5767 263
809 3300034819 Ga0373958_0000064 Ga0373958_0000064_2784_3773 263
810 3300034820 Ga0373959_0013423 Ga0373959_0013423_253_1242 263
811 3300034957 Ga0373938_0001531 Ga0373938_0001531_1515_2504 263
812 3300035083 Ga0373926_0017053 Ga0373926_0017053_1179_2168 263
813 3300035083 Ga0373926_0026074 Ga0373926_0026074_442_1431 263
814 3300035084 Ga0373928_0001389 Ga0373928_0001389_1687_2676 263
815 3300035084 Ga0373928_0028267 Ga0373928_0028267_85_1038 263
816 3300035085 Ga0373929_0000101 Ga0373929_0000101_9097_10086 263
817 3300035085 Ga0373929_0002654 Ga0373929_0002654_1114_2112 263
818 3300035085 Ga0373929_0016173 Ga0373929_0016173_188_1177 263
819 3300035086 Ga0373934_0055179 Ga0373934_0055179_410_1381 263
820 3300035088 Ga0373940_0022780 Ga0373940_0022780_72_1061 263
821 3300035089 Ga0373944_0013599 Ga0373944_0013599_1017_2003 263
822 3300035090 Ga0373949_0000293 Ga0373949_0000293_7801_8790 263
823 3300035090 Ga0373949_0000952 Ga0373949_0000952_5207_6196 263
824 3300035090 Ga0373949_0015900 Ga0373949_0015900_23_1012 263
825 3300035090 Ga0373949_0027664 Ga0373949_0027664_93_1079 263
826 3300035091 Ga0373951_0001275 Ga0373951_0001275_5285_6274 263
827 3300035092 Ga0373952_0000030 Ga0373952_0000030_8920_9909 263
828 3300035092 Ga0373952_0010083 Ga0373952_0010083_421_1410 263
829 3300035092 Ga0373952_0013911 Ga0373952_0013911_48_1001 263
830 3300035092 Ga0373952_0034855 Ga0373952_0034855_121_1110 263
831 3300035111 Ga0373923_0077086 Ga0373923_0077086_214_1203 263
832 3300035112 Ga0373932_0024430 Ga0373932_0024430_160_1149 263
833 3300035112 Ga0373932_0055616 Ga0373932_0055616_124_1074 263
834 3300035112 Ga0373932_0077125 Ga0373932_0077125_40_1026 263
835 3300035113 Ga0373936_0009974 Ga0373936_0009974_1371_2342 263
836 3300035113 Ga0373936_0019684 Ga0373936_0019684_336_1325 263
837 3300035114 Ga0373939_0000791 Ga0373939_0000791_3303_4292 263
838 3300035115 Ga0373941_0000050 Ga0373941_0000050_14602_15591 263
839 3300035115 Ga0373941_0002899 Ga0373941_0002899_536_1528 263
840 3300035115 Ga0373941_0004506 Ga0373941_0004506_612_1601 263
841 3300035115 Ga0373941_0046160 Ga0373941_0046160_315_1304 263
842 3300035116 Ga0373945_0001214 Ga0373945_0001214_1704_2690 263
843 3300035116 Ga0373945_0005087 Ga0373945_0005087_1737_2726 263
844 3300035116 Ga0373945_0114844 Ga0373945_0114844_137_994 263
845 3300035117 Ga0373953_0001444 Ga0373953_0001444_391_1362 263
846 3300035117 Ga0373953_0051017 Ga0373953_0051017_652_1641 263
847 3300035118 Ga0373954_0001943 Ga0373954_0001943_3198_4184 263
848 3300035118 Ga0373954_0006970 Ga0373954_0006970_246_1214 263
849 3300035118 Ga0373954_0008746 Ga0373954_0008746_2544_3515 263
850 3300035118 Ga0373954_0021614 Ga0373954_0021614_1755_2744 263
851 3300035118 Ga0373954_0041945 Ga0373954_0041945_321_1310 263
852 3300035119 Ga0373956_0024531 Ga0373956_0024531_680_1669 263
853 3300035120 Ga0373957_0003309 Ga0373957_0003309_305_1297 263
854 3300035120 Ga0373957_0005066 Ga0373957_0005066_514_1485 263
855 3300035120 Ga0373957_0024044 Ga0373957_0024044_974_1942 263
856 3300035121 Ga0373960_0004388 Ga0373960_0004388_1397_2395 263
857 3300035121 Ga0373960_0007174 Ga0373960_0007174_1710_2567 263
858 3300035121 Ga0373960_0016939 Ga0373960_0016939_879_1868 263
859 3300035121 Ga0373960_0045372 Ga0373960_0045372_255_1244 263
860 3300035170 Ga0373943_0001792 Ga0373943_0001792_3846_4832 263
861 3300035170 Ga0373943_0006259 Ga0373943_0006259_945_1916 263
862 3300035170 Ga0373943_0011476 Ga0373943_0011476_1743_2732 263
863 3300035171 Ga0373946_0000496 Ga0373946_0000496_1494_2480 263
864 3300035171 Ga0373946_0007440 Ga0373946_0007440_258_1244 263
865 3300035171 Ga0373946_0044280 Ga0373946_0044280_215_1201 263
866 3300035171 Ga0373946_0088151 Ga0373946_0088151_343_1341 263
867 3300035172 Ga0373955_0000779 Ga0373955_0000779_9273_10265 263
868 3300035172 Ga0373955_0005131 Ga0373955_0005131_2937_3929 263
869 3300035172 Ga0373955_0017746 Ga0373955_0017746_305_1294 263
870 3300035172 Ga0373955_0136417 Ga0373955_0136417_137_1126 263
871 3300035207 Ga0373942_0000073 Ga0373942_0000073_8088_9077 263
872 3300035241 Ga0373961_0000480 Ga0373961_0000480_1684_2673 263
873 3300035241 Ga0373961_0009096 Ga0373961_0009096_867_1856 263
874 3300035242 Ga0373962_0001214 Ga0373962_0001214_157_1146 263
875 3300035242 Ga0373962_0008813 Ga0373962_0008813_1375_2364 263
876 3300035242 Ga0373962_0011212 Ga0373962_0011212_1181_2167 263
877 3300035242 Ga0373962_0036676 Ga0373962_0036676_122_1111 263
878 3300035410 Ga0373924_0036219 Ga0373924_0036219_1126_1989 263
879 3300035410 Ga0373924_0053087 Ga0373924_0053087_87_1079 263
880 3300035691 Ga0373931_0000537 Ga0373931_0000537_9407_10396 263
881 3300035691 Ga0373931_0004302 Ga0373931_0004302_1405_2394 263
882 3300035691 Ga0373931_0006018 Ga0373931_0006018_3114_4103 263
883 3300035691 Ga0373931_0023545 Ga0373931_0023545_1716_2708 263
884 3300035691 Ga0373931_0025443 Ga0373931_0025443_1317_2165 263
885 3300035691 Ga0373931_0027531 Ga0373931_0027531_1145_2143 263
886 3300035692 Ga0373935_0000053 Ga0373935_0000053_9810_10781 263
887 3300035692 Ga0373935_0001261 Ga0373935_0001261_6256_7242 263
888 3300035692 Ga0373935_0016092 Ga0373935_0016092_661_1647 263
889 3300035692 Ga0373935_0030809 Ga0373935_0030809_1169_2158 263
890 3300035692 Ga0373935_0111894 Ga0373935_0111894_564_1556 263
891 3300035692 Ga0373935_0187353 Ga0373935_0187353_113_1102 263
892 3300035695 Ga0373927_0014200 Ga0373927_0014200_2239_3228 263
893 3300035695 Ga0373927_0035423 Ga0373927_0035423_1510_2502 263
894 3300035724 Ga0373933_0001426 Ga0373933_0001426_8841_9812 263
895 3300035724 Ga0373933_0002786 Ga0373933_0002786_6587_7579 263
896 3300035724 Ga0373933_0021557 Ga0373933_0021557_859_1848 263
897 3300035724 Ga0373933_0022272 Ga0373933_0022272_1229_2197 263
898 3300035724 Ga0373933_0051395 Ga0373933_0051395_183_1169 263
899 3300035725 Ga0373947_0000259 Ga0373947_0000259_17950_18921 263
900 3300035725 Ga0373947_0054577 Ga0373947_0054577_463_1449 263
901 3300036401 Ga0373937_0000030 Ga0373937_0000030_28885_29856 263
902 3300036401 Ga0373937_0000907 Ga0373937_0000907_21324_22292 263
903 3300036401 Ga0373937_0003255 Ga0373937_0003255_3613_4599 263
904 3300036401 Ga0373937_0036814 Ga0373937_0036814_1708_2697 263
905 3300036401 Ga0373937_0046962 Ga0373937_0046962_2729_3721 263
906 3300037068 Ga0373925_0000002 Ga0373925_0000002_36420_37391 263
907 3300037068 Ga0373925_0010040 Ga0373925_0010040_5192_6178 263
908 3300037068 Ga0373925_0019842 Ga0373925_0019842_3543_4529 263
909 3300037068 Ga0373925_0120679 Ga0373925_0120679_169_1158 263
910 3300037418 Ga0395900_0009186 Ga0395900_0009186_2365_3357 263
911 3300037418 Ga0395900_0022366 Ga0395900_0022366_4516_5505 263
912 3300037466 Ga0395898_0001841 Ga0395898_0001841_25786_26778 263
913 3300037466 Ga0395898_0003941 Ga0395898_0003941_4993_5982 263
914 3300037853 Ga0436364_0478575 Ga0436364_0478575_156_1142 263
915 3300038443 Ga0395901_0014006 Ga0395901_0014006_4645_5634 263
916 3300038443 Ga0395901_0125602 Ga0395901_0125602_1796_2644 263
917 3300038443 Ga0395901_0194074 Ga0395901_0194074_12_1004 263
918 3300038443 Ga0395901_0310785 Ga0395901_0310785_575_1567 263
919 3300039437 Ga0436365_0556834 Ga0436365_0556834_92_1075 263
920 3300041408 Ga0439453_0002489 Ga0439453_0002489_1028_2008 263
921 3300042003 Ga0439443_000477 Ga0439443_000477_1361_2341 263
922 3300042008 Ga0439450_002377 Ga0439450_002377_1730_2719 263
923 3300042156 Ga0439446_0001019 Ga0439446_0001019_1875_2840 263
924 3300042436 Ga0439435_0000002 Ga0439435_0000002_14068_15033 263
925 3300042436 Ga0439435_0000646 Ga0439435_0000646_2657_3637 263
926 3300042876 Ga0451577_0206376 Ga0451577_0206376_100_1089 263
927 3300044673 Ga0453683_0000968 Ga0453683_0000968_25441_26418 263
928 3300044694 Ga0466963_0013664 Ga0466963_0013664_62_1018 263
929 3300044712 Ga0453684_0283538 Ga0453684_0283538_865_1854 263
930 3300045051 Ga0451576_0559512 Ga0451576_0559512_140_1129 263
931 3300045976 Ga0466967_0000135 Ga0466967_0000135_3694_4650 263
932 3300046454 Ga0495592_0000046 Ga0495592_0000046_72063_73034 263
933 3300046454 Ga0495592_0001393 Ga0495592_0001393_6480_7448 263
934 3300046454 Ga0495592_0002484 Ga0495592_0002484_8279_9265 263
935 3300046454 Ga0495592_0075149 Ga0495592_0075149_1470_2438 263
936 3300046454 Ga0495592_0257395 Ga0495592_0257395_99_1085 263
937 3300046455 Ga0495603_0001804 Ga0495603_0001804_10745_11731 263
938 3300046455 Ga0495603_0002249 Ga0495603_0002249_5161_6147 263
939 3300046455 Ga0495603_0014184 Ga0495603_0014184_27_1013 263
940 3300046459 Ga0495629_0000594 Ga0495629_0000594_23154_24140 263
941 3300046459 Ga0495629_0001140 Ga0495629_0001140_2804_3790 263
942 3300046459 Ga0495629_0002311 Ga0495629_0002311_10634_11605 263
943 3300046459 Ga0495629_0032319 Ga0495629_0032319_21_1007 263
944 3300046459 Ga0495629_0088951 Ga0495629_0088951_826_1815 263
945 3300046461 Ga0495641_0011331 Ga0495641_0011331_216_1205 263
946 3300046461 Ga0495641_0017820 Ga0495641_0017820_978_1964 263
947 3300046462 Ga0495651_0000822 Ga0495651_0000822_14108_15079 263
948 3300046462 Ga0495651_0004816 Ga0495651_0004816_7624_8613 263
949 3300046462 Ga0495651_0006482 Ga0495651_0006482_7202_8170 263
950 3300046462 Ga0495651_0047233 Ga0495651_0047233_1495_2481 263
951 3300046462 Ga0495651_0062848 Ga0495651_0062848_1327_2313 263
952 3300046462 Ga0495651_0086884 Ga0495651_0086884_902_1894 263
953 3300046463 Ga0495653_0000006 Ga0495653_0000006_36466_37437 263
954 3300046463 Ga0495653_0004798 Ga0495653_0004798_3572_4558 263
955 3300046463 Ga0495653_0181253 Ga0495653_0181253_442_1434 263
956 3300046472 Ga0495580_0012844 Ga0495580_0012844_4718_5704 263
957 3300046472 Ga0495580_0057444 Ga0495580_0057444_1320_2309 263
958 3300046472 Ga0495580_0070869 Ga0495580_0070869_819_1805 263
959 3300046473 Ga0495582_0000379 Ga0495582_0000379_1691_2677 263
960 3300046473 Ga0495582_0009407 Ga0495582_0009407_383_1369 263
961 3300046473 Ga0495582_0010594 Ga0495582_0010594_3868_4857 263
962 3300046473 Ga0495582_0052800 Ga0495582_0052800_881_1867 263
963 3300046474 Ga0495605_0136938 Ga0495605_0136938_55_1041 263
964 3300046475 Ga0495639_0046773 Ga0495639_0046773_932_1918 263
965 3300046476 Ga0495662_0000084 Ga0495662_0000084_29545_30531 263
966 3300046476 Ga0495662_0027194 Ga0495662_0027194_1256_2245 263
967 3300046477 Ga0495664_0000002 Ga0495664_0000002_72100_73071 263
968 3300046477 Ga0495664_0007745 Ga0495664_0007745_109_1095 263
969 3300046477 Ga0495664_0043029 Ga0495664_0043029_1391_2377 263
970 3300046477 Ga0495664_0048292 Ga0495664_0048292_1046_2014 263
971 3300046477 Ga0495664_0050575 Ga0495664_0050575_215_1204 263
972 3300046491 Ga0495584_0048021 Ga0495584_0048021_128_1117 263
973 3300046492 Ga0495585_0001932 Ga0495585_0001932_8487_9473 263
974 3300046499 Ga0495594_0009110 Ga0495594_0009110_3535_4524 263
975 3300046499 Ga0495594_0011284 Ga0495594_0011284_21_1007 263
976 3300046499 Ga0495594_0055076 Ga0495594_0055076_1073_2059 263
977 3300046506 Ga0495583_0074035 Ga0495583_0074035_472_1458 263
978 3300046511 Ga0495608_0000006 Ga0495608_0000006_141475_142446 263
979 3300046511 Ga0495608_0017846 Ga0495608_0017846_3788_4774 263
980 3300046511 Ga0495608_0215979 Ga0495608_0215979_88_1080 263
981 3300046513 Ga0495616_0048796 Ga0495616_0048796_905_1891 263
982 3300046513 Ga0495616_0154975 Ga0495616_0154975_15_1004 263
983 3300046514 Ga0495618_0000034 Ga0495618_0000034_89279_90250 263
984 3300046514 Ga0495618_0001547 Ga0495618_0001547_3379_4365 263
985 3300046516 Ga0495628_0000002 Ga0495628_0000002_36383_37354 263
986 3300046516 Ga0495628_0003624 Ga0495628_0003624_10706_11695 263
987 3300046516 Ga0495628_0027943 Ga0495628_0027943_1415_2383 263
988 3300046517 Ga0495630_0000662 Ga0495630_0000662_14140_15111 263
989 3300046517 Ga0495630_0005622 Ga0495630_0005622_3359_4345 263
990 3300046517 Ga0495630_0042264 Ga0495630_0042264_112_1098 263
991 3300046517 Ga0495630_0178293 Ga0495630_0178293_53_1039 263
992 3300046523 Ga0495644_0003085 Ga0495644_0003085_2312_3298 263
993 3300046526 Ga0495666_0001508 Ga0495666_0001508_5159_6145 263
994 3300046529 Ga0495652_0000004 Ga0495652_0000004_551427_552398 263
995 3300046529 Ga0495652_0013904 Ga0495652_0013904_3378_4364 263
996 3300046529 Ga0495652_0014845 Ga0495652_0014845_5314_6282 263
997 3300046529 Ga0495652_0019057 Ga0495652_0019057_5026_6015 263
998 3300046529 Ga0495652_0078363 Ga0495652_0078363_856_1842 263
999 3300046529 Ga0495652_0154943 Ga0495652_0154943_112_969 263
1000 3300046531 Ga0495665_0003909 Ga0495665_0003909_4605_5591 263
1001 3300046533 Ga0495640_0000007 Ga0495640_0000007_89161_90132 263
1002 3300046533 Ga0495640_0006199 Ga0495640_0006199_896_1882 263
1003 3300046533 Ga0495640_0010455 Ga0495640_0010455_2804_3790 263
1004 3300046533 Ga0495640_0050524 Ga0495640_0050524_1249_2235 263
1005 3300046533 Ga0495640_0075109 Ga0495640_0075109_233_1222 263
1006 3300046533 Ga0495640_0211013 Ga0495640_0211013_162_1151 263
1007 3300046536 Ga0495587_0000031 Ga0495587_0000031_36485_37456 263
1008 3300046536 Ga0495587_0002979 Ga0495587_0002979_840_1826 263
1009 3300046536 Ga0495587_0016339 Ga0495587_0016339_3445_4413 263
1010 3300046536 Ga0495587_0114061 Ga0495587_0114061_471_1463 263
1011 3300046536 Ga0495587_0118380 Ga0495587_0118380_26_1015 263
1012 3300046537 Ga0495598_0004396 Ga0495598_0004396_1646_2632 263
1013 3300046537 Ga0495598_0019744 Ga0495598_0019744_542_1531 263
1014 3300046543 Ga0495645_0000003 Ga0495645_0000003_17736_18707 263
1015 3300046543 Ga0495645_0010875 Ga0495645_0010875_3348_4316 263
1016 3300046557 Ga0495622_0013050 Ga0495622_0013050_1609_2598 263
1017 3300046559 Ga0495667_0000002 Ga0495667_0000002_400267_401238 263
1018 3300046559 Ga0495667_0000202 Ga0495667_0000202_34439_35425 263
1019 3300046559 Ga0495667_0000365 Ga0495667_0000365_1341_2309 263
1020 3300046559 Ga0495667_0250301 Ga0495667_0250301_84_1070 263
1021 3300046559 Ga0495667_0302345 Ga0495667_0302345_14_931 263
1022 3300046615 Ga0495656_0026229 Ga0495656_0026229_1212_2201 263
1023 3300046642 Ga0495634_0000533 Ga0495634_0000533_1028_1999 263
1024 3300046642 Ga0495634_0007719 Ga0495634_0007719_273_1259 263
1025 3300046642 Ga0495634_0008544 Ga0495634_0008544_3098_4084 263
1026 3300046642 Ga0495634_0050245 Ga0495634_0050245_692_1660 263
1027 3300046642 Ga0495634_0098239 Ga0495634_0098239_234_1223 263
1028 3300046642 Ga0495634_0186293 Ga0495634_0186293_181_1170 263
1029 3300046648 Ga0495611_0053259 Ga0495611_0053259_183_1169 263
1030 3300046663 Ga0495635_0000022 Ga0495635_0000022_6768_7739 263
1031 3300046663 Ga0495635_0000981 Ga0495635_0000981_1183_2169 263
1032 3300046663 Ga0495635_0013894 Ga0495635_0013894_3108_4097 263
1033 3300046663 Ga0495635_0087593 Ga0495635_0087593_523_1491 263
1034 3300046663 Ga0495635_0116019 Ga0495635_0116019_754_1740 263
1035 3300046664 Ga0495659_0004216 Ga0495659_0004216_274_1260 263
1036 3300046664 Ga0495659_0034053 Ga0495659_0034053_761_1750 263
1037 3300046665 Ga0495661_0010683 Ga0495661_0010683_1506_2492 263
1038 3300046674 Ga0495588_0108007 Ga0495588_0108007_466_1452 263
1039 3300046675 Ga0495657_0000276 Ga0495657_0000276_9864_10835 263
1040 3300046675 Ga0495657_0090215 Ga0495657_0090215_268_1257 263
1041 3300046678 Ga0495599_0000001 Ga0495599_0000001_175163_176134 263
1042 3300046678 Ga0495599_0002835 Ga0495599_0002835_8630_9619 263
1043 3300046678 Ga0495599_0046540 Ga0495599_0046540_1583_2569 263
1044 3300046679 Ga0495623_0000094 Ga0495623_0000094_17671_18642 263
1045 3300046679 Ga0495623_0001448 Ga0495623_0001448_2203_3171 263
1046 3300046679 Ga0495623_0093803 Ga0495623_0093803_254_1246 263
1047 3300046680 Ga0495646_0000007 Ga0495646_0000007_60671_61642 263
1048 3300046680 Ga0495646_0038495 Ga0495646_0038495_649_1617 263
1049 3300046680 Ga0495646_0080686 Ga0495646_0080686_911_1879 263
1050 3300046681 Ga0495647_0000122 Ga0495647_0000122_6305_7291 263
1051 3300046681 Ga0495647_0000393 Ga0495647_0000393_5320_6306 263
1052 3300046681 Ga0495647_0001922 Ga0495647_0001922_1555_2544 263
1053 3300046683 Ga0495658_0000210 Ga0495658_0000210_15612_16598 263
1054 3300046683 Ga0495658_0005298 Ga0495658_0005298_1298_2284 263
1055 3300046683 Ga0495658_0009937 Ga0495658_0009937_3448_4437 263
1056 3300046683 Ga0495658_0026729 Ga0495658_0026729_345_1331 263
1057 3300046683 Ga0495658_0198856 Ga0495658_0198856_180_1166 263
1058 3300046684 Ga0495669_0040626 Ga0495669_0040626_852_1838 263
1059 3300046684 Ga0495669_0058211 Ga0495669_0058211_582_1571 263
1060 3300046689 Ga0495613_0014661 Ga0495613_0014661_4144_5115 263
1061 3300046689 Ga0495613_0018397 Ga0495613_0018397_2731_3717 263
1062 3300046689 Ga0495613_0083862 Ga0495613_0083862_1204_2190 263
1063 3300046690 Ga0495624_0000222 Ga0495624_0000222_8884_9870 263
1064 3300046690 Ga0495624_0020416 Ga0495624_0020416_2445_3416 263
1065 3300046690 Ga0495624_0024713 Ga0495624_0024713_1739_2728 263
1066 3300046690 Ga0495624_0034304 Ga0495624_0034304_939_1907 263
1067 3300046691 Ga0495670_0001624 Ga0495670_0001624_1245_2231 263
1068 3300046691 Ga0495670_0045447 Ga0495670_0045447_321_1310 263
1069 3300046691 Ga0495670_0072999 Ga0495670_0072999_373_1362 263
1070 3300046692 Ga0495671_0128272 Ga0495671_0128272_218_1207 263
1071 3300046809 Ga0495600_0000033 Ga0495600_0000033_46231_47202 263
1072 3300046809 Ga0495600_0000506 Ga0495600_0000506_592_1578 263
1073 3300046809 Ga0495600_0002658 Ga0495600_0002658_3550_4539 263
1074 3300046809 Ga0495600_0030323 Ga0495600_0030323_450_1418 263
1075 3300046809 Ga0495600_0124399 Ga0495600_0124399_656_1648 263
1076 3300047315 Ga0495581_0005193 Ga0495581_0005193_3745_4731 263
1077 3300047315 Ga0495581_0014416 Ga0495581_0014416_2979_3968 263
1078 3300047315 Ga0495581_0020808 Ga0495581_0020808_2786_3772 263
1079 3300047315 Ga0495581_0046003 Ga0495581_0046003_196_1182 263
1080 3300047317 Ga0495604_0000005 Ga0495604_0000005_62129_63100 263
1081 3300047317 Ga0495604_0001089 Ga0495604_0001089_2612_3598 263
1082 3300047317 Ga0495604_0002751 Ga0495604_0002751_1821_2810 263
1083 3300047317 Ga0495604_0007025 Ga0495604_0007025_5186_6154 263
1084 3300047319 Ga0495674_0000003 Ga0495674_0000003_524670_525641 263
1085 3300047319 Ga0495674_0001490 Ga0495674_0001490_20086_21072 263
1086 3300047319 Ga0495674_0014630 Ga0495674_0014630_2616_3602 263
1087 3300047319 Ga0495674_0071080 Ga0495674_0071080_243_1211 263
1088 3300047319 Ga0495674_0144775 Ga0495674_0144775_838_1827 263
1089 3300047320 Ga0495672_0144545 Ga0495672_0144545_244_1224 263
1090 3300047321 Ga0495676_0000289 Ga0495676_0000289_13846_14832 263
1091 3300047321 Ga0495676_0021676 Ga0495676_0021676_3794_4783 263
1092 3300047321 Ga0495676_0059814 Ga0495676_0059814_1052_2041 263
1093 3300047321 Ga0495676_0079695 Ga0495676_0079695_1480_2466 263
1094 3300047322 Ga0495680_0000091 Ga0495680_0000091_63012_63983 263
1095 3300047322 Ga0495680_0001414 Ga0495680_0001414_11991_12977 263
1096 3300047322 Ga0495680_0012301 Ga0495680_0012301_1607_2593 263
1097 3300047322 Ga0495680_0018026 Ga0495680_0018026_1313_2281 263
1098 3300047322 Ga0495680_0037109 Ga0495680_0037109_1579_2568 263
1099 3300047322 Ga0495680_0072323 Ga0495680_0072323_438_1424 263
1100 3300047322 Ga0495680_0408977 Ga0495680_0408977_17_874 263
1101 3300047444 Ga0495675_0000064 Ga0495675_0000064_36779_37750 263
1102 3300047444 Ga0495675_0006504 Ga0495675_0006504_5536_6504 263
1103 3300047471 Ga0495684_0000035 Ga0495684_0000035_17638_18609 263
1104 3300047471 Ga0495684_0000075 Ga0495684_0000075_58658_59644 263
1105 3300047471 Ga0495684_0073421 Ga0495684_0073421_1565_2551 263
1106 3300047471 Ga0495684_0202056 Ga0495684_0202056_455_1447 263
1107 3300047472 Ga0495686_0194647 Ga0495686_0194647_113_1102 263
1108 3300047673 Ga0495593_0001106 Ga0495593_0001106_10807_11778 263
1109 3300047673 Ga0495593_0033459 Ga0495593_0033459_344_1330 263
1110 3300048088 Ga0495602_0000029 Ga0495602_0000029_17628_18599 263
1111 3300048088 Ga0495602_0002033 Ga0495602_0002033_7073_8041 263
1112 3300048088 Ga0495602_0018847 Ga0495602_0018847_4440_5429 263
1113 3300048088 Ga0495602_0139834 Ga0495602_0139834_476_1462 263
1114 3300048903 Ga0496100_0000404 Ga0496100_0000404_19181_20170 263
1115 3300048903 Ga0496100_0000823 Ga0496100_0000823_929_1915 263
1116 3300048903 Ga0496100_0013536 Ga0496100_0013536_3311_4300 263
1117 3300048903 Ga0496100_0200173 Ga0496100_0200173_19_882 263
1118 3300048904 Ga0496101_0000423 Ga0496101_0000423_19548_20537 263
1119 3300048904 Ga0496101_0042230 Ga0496101_0042230_47_1039 263
1120 3300048904 Ga0496101_0074352 Ga0496101_0074352_118_1116 263
1121 3300048905 Ga0496102_0003323 Ga0496102_0003323_10204_11193 263
1122 3300048905 Ga0496102_0004385 Ga0496102_0004385_10226_11224 263
1123 3300048905 Ga0496102_0017907 Ga0496102_0017907_3824_4813 263
1124 3300048905 Ga0496102_0050819 Ga0496102_0050819_2773_3765 263
1125 3300048905 Ga0496102_0185693 Ga0496102_0185693_567_1559 263
1126 3300048905 Ga0496102_0199970 Ga0496102_0199970_131_1117 263
1127 3300048906 Ga0496103_0000967 Ga0496103_0000967_76_1065 263
1128 3300048906 Ga0496103_0161660 Ga0496103_0161660_143_1135 263
1129 3300048907 Ga0496104_0000711 Ga0496104_0000711_9056_10039 263
1130 3300048907 Ga0496104_0000925 Ga0496104_0000925_10427_11410 263
1131 3300048907 Ga0496104_0005217 Ga0496104_0005217_4985_5977 263
1132 3300048907 Ga0496104_0005466 Ga0496104_0005466_6405_7373 263
1133 3300048907 Ga0496104_0014835 Ga0496104_0014835_2191_3180 263
1134 3300048907 Ga0496104_0018532 Ga0496104_0018532_1579_2571 263
1135 3300048907 Ga0496104_0026724 Ga0496104_0026724_3400_4389 263
1136 3300048907 Ga0496104_0037384 Ga0496104_0037384_197_1213 263
1137 3300048907 Ga0496104_0462323 Ga0496104_0462323_124_1116 263
1138 3300048908 Ga0496105_0007195 Ga0496105_0007195_7403_8401 263
1139 3300048908 Ga0496105_0010049 Ga0496105_0010049_5336_6304 263
1140 3300048908 Ga0496105_0017905 Ga0496105_0017905_4445_5437 263
1141 3300048908 Ga0496105_0020189 Ga0496105_0020189_22_1014 263
1142 3300048908 Ga0496105_0025218 Ga0496105_0025218_3430_4398 263
1143 3300048908 Ga0496105_0096900 Ga0496105_0096900_478_1461 263
1144 3300048908 Ga0496105_0124462 Ga0496105_0124462_662_1651 263
1145 3300048908 Ga0496105_0245365 Ga0496105_0245365_54_1046 263
1146 3300048908 Ga0496105_0339947 Ga0496105_0339947_162_1151 263
1147 3300048909 Ga0496106_0002446 Ga0496106_0002446_10193_11182 263
1148 3300048909 Ga0496106_0003669 Ga0496106_0003669_8590_9588 263
1149 3300048909 Ga0496106_0005520 Ga0496106_0005520_1167_2159 263
1150 3300048909 Ga0496106_0015174 Ga0496106_0015174_3085_4074 263
1151 3300048909 Ga0496106_0269363 Ga0496106_0269363_325_1314 263
1152 3300048910 Ga0496107_0000500 Ga0496107_0000500_10065_11054 263
1153 3300048910 Ga0496107_0021517 Ga0496107_0021517_827_1816 263
1154 3300048910 Ga0496107_0130304 Ga0496107_0130304_13_1002 263
1155 3300048911 Ga0496108_0018949 Ga0496108_0018949_4251_5240 263
1156 3300048911 Ga0496108_0040996 Ga0496108_0040996_178_1167 263
1157 3300048911 Ga0496108_0053124 Ga0496108_0053124_621_1613 263
1158 3300048911 Ga0496108_0068004 Ga0496108_0068004_455_1444 263
1159 3300048911 Ga0496108_0115535 Ga0496108_0115535_1175_2173 263
1160 3300048912 Ga0496109_0000340 Ga0496109_0000340_7903_8892 263
1161 3300048912 Ga0496109_0000359 Ga0496109_0000359_8691_9680 263
1162 3300048912 Ga0496109_0000976 Ga0496109_0000976_16805_17794 263
1163 3300048912 Ga0496109_0005940 Ga0496109_0005940_3855_4847 263
1164 3300048912 Ga0496109_0015600 Ga0496109_0015600_3654_4646 263
1165 3300048912 Ga0496109_0056951 Ga0496109_0056951_1001_1984 263
1166 3300048912 Ga0496109_0082278 Ga0496109_0082278_1224_2192 263
1167 3300048913 Ga0496110_0002357 Ga0496110_0002357_8387_9379 263
1168 3300048913 Ga0496110_0003362 Ga0496110_0003362_6745_7731 263
1169 3300048913 Ga0496110_0020674 Ga0496110_0020674_3711_4703 263
1170 3300048913 Ga0496110_0027384 Ga0496110_0027384_1693_2682 263
1171 3300048913 Ga0496110_0229269 Ga0496110_0229269_583_1566 263
1172 3300048914 Ga0496111_0023917 Ga0496111_0023917_1329_2321 263
1173 3300048914 Ga0496111_0030852 Ga0496111_0030852_959_1948 263
1174 3300048914 Ga0496111_0040590 Ga0496111_0040590_1882_2874 263
1175 3300048914 Ga0496111_0083227 Ga0496111_0083227_656_1645 263
1176 3300048914 Ga0496111_0090226 Ga0496111_0090226_1160_2176 263
1177 3300048914 Ga0496111_0276562 Ga0496111_0276562_103_1095 263
1178 3300048915 Ga0496112_0021049 Ga0496112_0021049_3621_4613 263
1179 3300048915 Ga0496112_0032947 Ga0496112_0032947_2237_3226 263
1180 3300048915 Ga0496112_0038798 Ga0496112_0038798_421_1410 263
1181 3300048915 Ga0496112_0044120 Ga0496112_0044120_1740_2726 263
1182 3300048915 Ga0496112_0051703 Ga0496112_0051703_2774_3766 263
1183 3300048915 Ga0496112_0078758 Ga0496112_0078758_989_1981 263
1184 3300048915 Ga0496112_0122219 Ga0496112_0122219_1154_2002 263
1185 3300048915 Ga0496112_0216613 Ga0496112_0216613_149_1147 263
1186 3300048915 Ga0496112_0338368 Ga0496112_0338368_54_1043 263
1187 3300048916 Ga0496113_0001950 Ga0496113_0001950_3479_4468 263
1188 3300048916 Ga0496113_0008785 Ga0496113_0008785_3716_4708 263
1189 3300048916 Ga0496113_0087302 Ga0496113_0087302_243_1235 263
1190 3300048916 Ga0496113_0189124 Ga0496113_0189124_378_1367 263
1191 3300048917 Ga0496114_0122875 Ga0496114_0122875_165_1157 263
1192 3300048917 Ga0496114_0253543 Ga0496114_0253543_426_1415 263
1193 3300048918 Ga0496115_0009549 Ga0496115_0009549_2690_3688 263
1194 3300048918 Ga0496115_0019987 Ga0496115_0019987_434_1426 263
1195 3300048918 Ga0496115_0073699 Ga0496115_0073699_1683_2669 263
1196 3300048918 Ga0496115_0127875 Ga0496115_0127875_1031_2029 263
1197 3300048918 Ga0496115_0139123 Ga0496115_0139123_194_1162 263
1198 3300048918 Ga0496115_0152345 Ga0496115_0152345_291_1280 263
1199 3300048918 Ga0496115_0189422 Ga0496115_0189422_658_1647 263
1200 3300049568 Ga0501031_0055503 Ga0501031_0055503_688_1650 263
1201 3300049568 Ga0501031_0062823 Ga0501031_0062823_1397_2386 263
1202 3300049568 Ga0501031_0111803 Ga0501031_0111803_129_1127 263
1203 3300049570 Ga0501033_0044445 Ga0501033_0044445_1997_2986 263
1204 3300049571 Ga0501034_0006692 Ga0501034_0006692_10576_11571 263
1205 3300049571 Ga0501034_0029366 Ga0501034_0029366_1286_2275 263
1206 3300049571 Ga0501034_0080158 Ga0501034_0080158_1663_2643 263
1207 3300049572 Ga0501036_0018021 Ga0501036_0018021_4651_5619 263
1208 3300049572 Ga0501036_0246470 Ga0501036_0246470_179_1168 263
1209 3300049574 Ga0501038_0153148 Ga0501038_0153148_748_1737 263
1210 3300049575 Ga0501039_0044530 Ga0501039_0044530_165_1133 263
1211 3300049575 Ga0501039_0297066 Ga0501039_0297066_243_1226 263
1212 3300049576 Ga0501040_0012594 Ga0501040_0012594_1431_2399 263
1213 3300049576 Ga0501040_0138114 Ga0501040_0138114_60_1013 263
1214 3300049576 Ga0501040_0301252 Ga0501040_0301252_35_1030 263
1215 3300049577 Ga0501041_0017024 Ga0501041_0017024_2860_3828 263
1216 3300049577 Ga0501041_0095703 Ga0501041_0095703_792_1754 263
1217 3300049578 Ga0501042_0044547 Ga0501042_0044547_1111_2094 263
1218 3300049578 Ga0501042_0082155 Ga0501042_0082155_1424_2275 263
1219 3300049578 Ga0501042_0121352 Ga0501042_0121352_693_1655 263
1220 3300049579 Ga0501043_0103007 Ga0501043_0103007_73_1041 263
1221 3300049580 Ga0501046_0032814 Ga0501046_0032814_2747_3745 263
1222 3300049580 Ga0501046_0039215 Ga0501046_0039215_2685_3680 263
1223 3300049580 Ga0501046_0062896 Ga0501046_0062896_1566_2552 263
1224 3300049581 Ga0501047_0006347 Ga0501047_0006347_3272_4261 263
1225 3300049581 Ga0501047_0009067 Ga0501047_0009067_4392_5375 263
1226 3300049581 Ga0501047_0018859 Ga0501047_0018859_2508_3497 263
1227 3300049581 Ga0501047_0039533 Ga0501047_0039533_259_1239 263
1228 3300049582 Ga0501048_0107955 Ga0501048_0107955_21_971 263
1229 3300049584 Ga0501068_0139895 Ga0501068_0139895_179_1162 263
1230 3300049586 Ga0501070_0027193 Ga0501070_0027193_3626_4606 263
1231 3300049586 Ga0501070_0056684 Ga0501070_0056684_1617_2606 263
1232 3300049587 Ga0501071_0156383 Ga0501071_0156383_58_1020 263
1233 3300049588 Ga0501072_0009124 Ga0501072_0009124_31_993 263
1234 3300049588 Ga0501072_0020826 Ga0501072_0020826_3994_4962 263
1235 3300049588 Ga0501072_0222407 Ga0501072_0222407_83_1063 263
1236 3300049589 Ga0501073_0123601 Ga0501073_0123601_23_1018 263
1237 3300049590 Ga0501074_0073296 Ga0501074_0073296_1244_2239 263
1238 3300049591 Ga0501075_0004734 Ga0501075_0004734_7155_8123 263
1239 3300049592 Ga0501076_0001405 Ga0501076_0001405_8212_9180 263
1240 3300049592 Ga0501076_0016440 Ga0501076_0016440_841_1824 263
1241 3300049592 Ga0501076_0212696 Ga0501076_0212696_37_990 263
1242 3300049592 Ga0501076_0361151 Ga0501076_0361151_38_1030 263
1243 3300049592 Ga0501076_0579486 Ga0501076_0579486_13_867 263
1244 3300049593 Ga0501077_0007341 Ga0501077_0007341_5590_6558 263
1245 3300049593 Ga0501077_0103962 Ga0501077_0103962_256_1254 263
1246 3300049593 Ga0501077_0150602 Ga0501077_0150602_70_1023 263
1247 3300049593 Ga0501077_0233313 Ga0501077_0233313_37_1032 263
1248 3300049741 Ga0501079_0003233 Ga0501079_0003233_7707_8675 263
1249 3300049741 Ga0501079_0062842 Ga0501079_0062842_1695_2681 263
1250 3300049741 Ga0501079_0118220 Ga0501079_0118220_152_1105 263
1251 3300049741 Ga0501079_0139506 Ga0501079_0139506_787_1749 263
1252 3300049742 Ga0501080_0021206 Ga0501080_0021206_4940_5908 263
1253 3300049742 Ga0501080_0096741 Ga0501080_0096741_972_1952 263
1254 3300049743 Ga0501081_0001767 Ga0501081_0001767_9030_9998 263
1255 3300049743 Ga0501081_0010888 Ga0501081_0010888_4607_5560 263
1256 3300049743 Ga0501081_0024939 Ga0501081_0024939_826_1809 263
1257 3300049743 Ga0501081_0054812 Ga0501081_0054812_395_1393 263
1258 3300049743 Ga0501081_0055859 Ga0501081_0055859_990_1952 263
1259 3300049744 Ga0501083_0029184 Ga0501083_0029184_395_1384 263
1260 3300049744 Ga0501083_0106169 Ga0501083_0106169_863_1831 263
1261 3300049744 Ga0501083_0141130 Ga0501083_0141130_543_1505 263
1262 3300049822 Ga0501035_0000127 Ga0501035_0000127_55642_56622 263
1263 3300049823 Ga0501044_0008177 Ga0501044_0008177_6582_7571 263
1264 3300049823 Ga0501044_0023098 Ga0501044_0023098_2394_3374 263
1265 3300049823 Ga0501044_0088157 Ga0501044_0088157_1307_2296 263
1266 3300049824 Ga0501045_0018155 Ga0501045_0018155_2042_3010 263
1267 3300049824 Ga0501045_0057834 Ga0501045_0057834_1826_2812 263
1268 3300049824 Ga0501045_0133245 Ga0501045_0133245_28_981 263
1269 3300049824 Ga0501045_0162931 Ga0501045_0162931_26_976 263
1270 3300049824 Ga0501045_0173509 Ga0501045_0173509_191_1144 263
1271 3300050489 nmdc:mga03683_56333_c1 nmdc:mga03683_56333_c1_650_1633 263
1272 3300050491 nmdc:mga00v17_126627_c1 nmdc:mga00v17_126627_c1_101_1084 263
1273 3300050492 nmdc:mga0yw44_65200_c1 nmdc:mga0yw44_65200_c1_634_1617 263
1274 3300050494 nmdc:mga06z11_200577_c1 nmdc:mga06z11_200577_c1_261_1118 263
1275 3300050496 nmdc:mga07m45_84329_c2 nmdc:mga07m45_84329_c2_363_1352 263
1276 3300050507 nmdc:mga05p37_114724_c1 nmdc:mga05p37_114724_c1_143_1132 263
1277 3300050507 nmdc:mga05p37_1808_c2 nmdc:mga05p37_1808_c2_7541_8548 263
1278 3300050507 nmdc:mga05p37_227255_c1 nmdc:mga05p37_227255_c1_44_1018 263
1279 3300050507 nmdc:mga05p37_295597_c1 nmdc:mga05p37_295597_c1_723_1709 263
1280 3300050507 nmdc:mga05p37_356208_c1 nmdc:mga05p37_356208_c1_326_1315 263
1281 3300050507 nmdc:mga05p37_45950_c1 nmdc:mga05p37_45950_c1_3711_4706 263
1282 3300050507 nmdc:mga05p37_508_c2 nmdc:mga05p37_508_c2_3613_4608 263
1283 3300050507 nmdc:mga05p37_711641_c1 nmdc:mga05p37_711641_c1_51_1049 263
1284 3300050507 nmdc:mga05p37_75031_c1 nmdc:mga05p37_75031_c1_1725_2714 263
1285 3300050507 nmdc:mga05p37_888971_c1 nmdc:mga05p37_888971_c1_72_920 263
1286 3300050508 nmdc:mga09592_152046_c1 nmdc:mga09592_152046_c1_85_1074 263
1287 3300050508 nmdc:mga09592_239014_c1 nmdc:mga09592_239014_c1_326_1324 263
1288 3300050508 nmdc:mga09592_30039_c1 nmdc:mga09592_30039_c1_925_1920 263
1289 3300050508 nmdc:mga09592_5057_c1 nmdc:mga09592_5057_c1_8220_9227 263
1290 3300050509 nmdc:mga0qj67_15510_c1 nmdc:mga0qj67_15510_c1_3439_4434 263
1291 3300050509 nmdc:mga0qj67_5333_c1 nmdc:mga0qj67_5333_c1_8220_9227 263
1292 3300050510 nmdc:mga06r32_124972_c1 nmdc:mga06r32_124972_c1_264_1253 263
1293 3300050510 nmdc:mga06r32_146979_c1 nmdc:mga06r32_146979_c1_363_1358 263
1294 3300050510 nmdc:mga06r32_1960_c1 nmdc:mga06r32_1960_c1_5179_6174 263
1295 3300050510 nmdc:mga06r32_236663_c1 nmdc:mga06r32_236663_c1_414_1409 263
1296 3300050510 nmdc:mga06r32_33897_c1 nmdc:mga06r32_33897_c1_1168_2166 263
1297 3300050510 nmdc:mga06r32_3441_c1 nmdc:mga06r32_3441_c1_7231_8238 263
1298 3300050510 nmdc:mga06r32_4445_c1 nmdc:mga06r32_4445_c1_88_1086 263
1299 3300050510 nmdc:mga06r32_53801_c1 nmdc:mga06r32_53801_c1_1864_2847 263
1300 3300050511 nmdc:mga08y16_14675_c1 nmdc:mga08y16_14675_c1_6783_7763 263
1301 3300050511 nmdc:mga08y16_2332_c1 nmdc:mga08y16_2332_c1_5178_6173 263
1302 3300050511 nmdc:mga08y16_3146_c1 nmdc:mga08y16_3146_c1_2777_3784 263
1303 3300050511 nmdc:mga08y16_378174_c1 nmdc:mga08y16_378174_c1_94_1083 263
1304 3300050511 nmdc:mga08y16_3939_c1 nmdc:mga08y16_3939_c1_8680_9669 263
1305 3300050511 nmdc:mga08y16_566179_c1 nmdc:mga08y16_566179_c1_128_1117 263
1306 3300050511 nmdc:mga08y16_63381_c1 nmdc:mga08y16_63381_c1_1119_2111 263
1307 3300050511 nmdc:mga08y16_640818_c1 nmdc:mga08y16_640818_c1_60_1043 263
1308 3300050511 nmdc:mga08y16_75718_c1 nmdc:mga08y16_75718_c1_1789_2742 263
1309 3300050512 nmdc:mga0n895_142493_c1 nmdc:mga0n895_142493_c1_705_1553 263
1310 3300050512 nmdc:mga0n895_145_c1 nmdc:mga0n895_145_c1_12771_13718 263
1311 3300050512 nmdc:mga0n895_149686_c1 nmdc:mga0n895_149686_c1_798_1790 263
1312 3300050512 nmdc:mga0n895_159698_c1 nmdc:mga0n895_159698_c1_868_1857 263
1313 3300050512 nmdc:mga0n895_204112_c1 nmdc:mga0n895_204112_c1_271_1254 263
1314 3300050512 nmdc:mga0n895_37534_c1 nmdc:mga0n895_37534_c1_3542_4531 263
1315 3300050512 nmdc:mga0n895_429381_c1 nmdc:mga0n895_429381_c1_185_1165 263
1316 3300050512 nmdc:mga0n895_450487_c1 nmdc:mga0n895_450487_c1_282_1289 263
1317 3300050512 nmdc:mga0n895_494323_c1 nmdc:mga0n895_494323_c1_52_909 263
1318 3300050512 nmdc:mga0n895_4964_c1 nmdc:mga0n895_4964_c1_4357_5346 263
1319 3300050512 nmdc:mga0n895_545530_c1 nmdc:mga0n895_545530_c1_79_1071 263
1320 3300050512 nmdc:mga0n895_662439_c1 nmdc:mga0n895_662439_c1_15_974 263
1321 3300050512 nmdc:mga0n895_697_c1 nmdc:mga0n895_697_c1_21870_22823 263
1322 3300050513 nmdc:mga0rr50_2684_c1 nmdc:mga0rr50_2684_c1_7437_8384 263
1323 3300050513 nmdc:mga0rr50_26927_c1 nmdc:mga0rr50_26927_c1_1464_2450 263
1324 3300050513 nmdc:mga0rr50_354727_c1 nmdc:mga0rr50_354727_c1_17_865 263
1325 3300050513 nmdc:mga0rr50_42859_c1 nmdc:mga0rr50_42859_c1_667_1656 263
1326 3300050513 nmdc:mga0rr50_48815_c1 nmdc:mga0rr50_48815_c1_24_1031 263
1327 3300050513 nmdc:mga0rr50_59705_c1 nmdc:mga0rr50_59705_c1_517_1509 263
1328 3300050514 nmdc:mga08x19_113019_c1 nmdc:mga08x19_113019_c1_669_1616 263
1329 3300050514 nmdc:mga08x19_33203_c1 nmdc:mga08x19_33203_c1_114_1100 263
1330 3300050514 nmdc:mga08x19_73938_c1 nmdc:mga08x19_73938_c1_212_1237 263
1331 3300050515 nmdc:mga0a205_17058_c2 nmdc:mga0a205_17058_c2_2189_3178 263
1332 3300050515 nmdc:mga0a205_17080_c2 nmdc:mga0a205_17080_c2_1407_2399 263
1333 3300050515 nmdc:mga0a205_18201_c1 nmdc:mga0a205_18201_c1_56_1042 263
1334 3300050515 nmdc:mga0a205_19981_c1 nmdc:mga0a205_19981_c1_3808_4797 263
1335 3300050515 nmdc:mga0a205_2724_c1 nmdc:mga0a205_2724_c1_6685_7692 263
1336 3300050515 nmdc:mga0a205_44400_c1 nmdc:mga0a205_44400_c1_332_1321 263
1337 3300053077 Ga0495601_0000008 Ga0495601_0000008_285286_286257 263
1338 3300053077 Ga0495601_0001042 Ga0495601_0001042_13234_14223 263
1339 3300053077 Ga0495601_0001925 Ga0495601_0001925_8632_9618 263
1340 3300053077 Ga0495601_0044685 Ga0495601_0044685_1279_2268 263
1341 3300053077 Ga0495601_0153402 Ga0495601_0153402_409_1398 263
1342 3300053077 Ga0495601_0224351 Ga0495601_0224351_201_1193 263
1343 3300053077 Ga0495601_0230234 Ga0495601_0230234_65_1042 263
1344 3300053078 Ga0495612_0000026 Ga0495612_0000026_59702_60673 263
1345 3300053078 Ga0495612_0000858 Ga0495612_0000858_5465_6451 263
1346 3300053078 Ga0495612_0012643 Ga0495612_0012643_1047_2036 263
1347 3300053078 Ga0495612_0021006 Ga0495612_0021006_1463_2452 263
1348 3300053084 Ga0495595_0000024 Ga0495595_0000024_17745_18716 263
1349 3300053084 Ga0495595_0000879 Ga0495595_0000879_2311_3279 263
1350 3300053084 Ga0495595_0006336 Ga0495595_0006336_2658_3647 263
1351 3300053084 Ga0495595_0010002 Ga0495595_0010002_2258_3250 263
1352 3300053084 Ga0495595_0026796 Ga0495595_0026796_828_1826 263
1353 3300053085 Ga0495619_0000002 Ga0495619_0000002_36488_37459 263
1354 3300053085 Ga0495619_0000229 Ga0495619_0000229_15587_16573 263
1355 3300053085 Ga0495619_0002881 Ga0495619_0002881_9230_10216 263
1356 3300053085 Ga0495619_0005795 Ga0495619_0005795_1404_2390 263
1357 3300053085 Ga0495619_0013992 Ga0495619_0013992_1822_2811 263
1358 3300053085 Ga0495619_0018217 Ga0495619_0018217_3153_4121 263
1359 3300053085 Ga0495619_0022907 Ga0495619_0022907_203_1192 263
1360 3300053085 Ga0495619_0177839 Ga0495619_0177839_147_1145 263
1361 3300053087 Ga0500643_009516 Ga0500643_009516_1661_2653 263
1362 3300053117 Ga0500593_023541 Ga0500593_023541_478_1470 263
1363 3300053118 Ga0500594_0047434 Ga0500594_0047434_78_1085 263
1364 3300053119 Ga0500595_000010 Ga0500595_000010_62148_63140 263
1365 3300053151 Ga0500604_0069737 Ga0500604_0069737_255_1103 263
1366 3300053153 Ga0500616_0000001 Ga0500616_0000001_757425_758432 263
1367 3300053153 Ga0500616_0042710 Ga0500616_0042710_242_1228 263
1368 3300053730 Ga0500645_000015 Ga0500645_000015_113111_114130 263
1369 3300054114 Ga0501084_0046785 Ga0501084_0046785_201_1184 263
1370 3300054114 Ga0501084_0068704 Ga0501084_0068704_1022_1984 263
1371 3300054114 Ga0501084_0077346 Ga0501084_0077346_944_1942 263
1372 3300054114 Ga0501084_0170353 Ga0501084_0170353_64_1059 263
1373 3300059426 Ga0590077_005770 Ga0590077_005770_1409_2374 263
1374 3300060353 Ga0501082_0013431 Ga0501082_0013431_2708_3697 263
1375 3300060353 Ga0501082_0015413 Ga0501082_0015413_1480_2475 263
1376 3300060353 Ga0501082_0152268 Ga0501082_0152268_614_1612 263
1377 3300060353 Ga0501082_0271122 Ga0501082_0271122_104_1093 263
1378 3300061734 Ga0530510_0000596 Ga0530510_0000596_9952_10920 263
1379 3300061734 Ga0530510_0030147 Ga0530510_0030147_2533_3486 263
1380 3300061734 Ga0530510_0224288 Ga0530510_0224288_241_1236 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

54

278

0.85

PF09084

NMT1

NMT1/THI5 like

67

274

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7837 1 254
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7599 2 252
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7581 1 254
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7454 2 254
4h6d-assembly2.cif.gz_H crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae 0.736 2 257
ID Description Score Start End Superfamily
4h6dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7915 2 257 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7567 70 144 3.40.190.10
4h65B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7507 2 257 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7437 69 142 3.40.190.10
3e4rA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7334 2 254 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6A7LX51-F1-model_v4 PhnD/SsuA/transferrin family substrate-binding protein 0.9199 2 262
AF-A0A6A7LX51-F1-model_v4 PhnD/SsuA/transferrin family substrate-binding protein 0.91 2 262
AF-A0A522QMN1-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9011 2 262
AF-A0A537RUM9-F1-model_v4 ABC transporter substrate-binding protein 0.9003 2 263
AF-A0A1F4DDW2-F1-model_v4 SsuA/THI5-like domain-containing protein 0.8972 6 262

Feature Viewer

pLDDT pTM Quality
89.12 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map